1OYJA

Crystal structure solution of rice gst1 (osgstu1) in complex with glutathione.
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
229
structure length
228
Chain Sequence
AEEKELVLLDFWVSPFGQRCRIAMAEKGLEFEYREEDLGNKSDLLLRSNPVHRKIPVLLHAGRPVSESLVILQYLDDAFPGTPHLLPPANSGADAAYARATARFWADYVDRKLYDCGSRLWRLKGEPQAAAGREMAEILRTLEAELGDREFFGGGGGGRLGFVDVALVPFTAWFYSYERCGGFSVEEVAPRLAAWARRCGRIDSVVKHLPSPEKVYDFVGVLKKKYGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutathione s-transferase
publication title Forced evolution of a herbicide detoxifying glutathione transferase.
pubmed doi rcsb
source organism Oryza sativa
molecule tags Transferase
total genus 80
structure length 228
sequence length 229
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2003-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1oyjA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1oyjA01
2YWIA 4DSSA 3I6AA 4FIWA 3LXTA 4K9ZA 3TKPA 3ZVJD 16GSA 1FOVA 1VF4A 2V1MA 2YPMA 4O32A 1JFUA 3MSZA 2GQLA 3DGQA 2GDRA 2H19A 5IMDA 1M2AA 4H86A 5IQYA 4KDXA 2VL9A 5B8AA 3G7JA 5CRHA 3R2QA 3ERFA 3LXZA 4PQ1A 4NAXA 4IP1A 2ON7A 4IQ1A 2X8HA 4KAEA 1DE2A 4ECBA 2TRCP 3TKSC 3F9UA 3IAM2 4FYBA 2DIYA 5JWOB 5LD0A 3FYGA 1JZWA 4ULXA 3HJPA 3F4TA 4JU5A 2B1KA 4V2MA 3TRPA 1PX7A 3TGZA 1M99A 4RQXA 1AQWA 1NW2A 2B6MA 4L5OA 2XPEA 5CRGA 3PH9A 5HR0A 4ZL7A 2IL3A 2GQMA 3A5WA 6GSSA 5KN2A 3ZYWA 1AAZA 3FRCA 2YZHA 3D22A 1T00A 3H1NA 1GSQA 3ED3A 4DVCA 1NM3A 4BPYA 1TK5B 1VGLA 2XBQA 3MDKA 1T7PB 3UAPA 4K6XA 2ALBA 5AGYA 2LJRA 1SJ6A 1PGTA 3KH7A 1GTBA 1H4OA 5EL8A 1PQNA 1Y6EA 2N5FA 5GSTA 1Q98A 3RHBA 4DSSB 2PERA 3KTLA 1SJZA 4MZCA 3EVIA 2LV3A 2LJAA 1R26A 2ES7A 2JU5A 2E2MA 8GSSA 4KA0A 1WE0A 1S3DA 2CX4A 2HNLA 2YOIA 2H73A 2LUSA 3FHKA 3QDNA 1S3CA 2BJXA 2YZUA 1HYUA 1MDJA 3HVVA 2CX3A 2OA7A 4JR4A 2JZTA 1OC3A 3BJ5A 1A0FA 2F8AA 1V40A 6GSWA 3GMFA 2LRCA 3CTGA 1RQMA 3FR6A 1TRVA 2F51A 2CQ9A 1XPVA 3Q19A 4IVFA 4V2LA 1WPIA 13GSA 3WGXA 4BA7A 1USBA 2OBIA 5ECSA 5HR1A 4TR1A 1MD4A 4EF0A 2JSZA 2MBTA 4EKZA 2IMEA 4YQMA 5CAXA 3KH9A 3EINA 4ILFA 1ERUA 2QKEA 4YAVA 4WF4A 5J5NA 2IMFA 3R3EA 3C73A 4MZBA 4QL7A 3CRUA 4BVYA 5DBQA 2WJUA 3UMAA 4ZB6A 1GTUA 1XWBA 5CRDA 3VURA 1X5EA 1PA3A 3A2WA 3TB2A 3KD0A 4ZL9A 4HJMA 2H6ZA 1ZZYA 3IRAA 1M9AA 2VCZA 3ERWA 3GHAA 2ZNMA 2LNSA 2G2QA 2GZZA 1JLVA 2PPTA 4IN0A 6GSVA 2NPBA 2VM2A 4N30A 5CO3A 2OKAA 3KJYA 1CQHA 2FA4A 1R5PA 1HNAA 2OE3A 3IE3A 5IMFA 4POMA 3L9SA 2I81A 4WBJA 1GL8A 2YWOA 2ZCTA 5J3RA 3TJKA 1NHYA 2JZSA 3HD5A 2GTUA 2OADA 3SBCA 4G19A 4PURA 2C3QA 2OE1A 4BWSA 3M1GA 5DVBA 5C00A 1A8YA 1FB0A 1EEMA 3KEBA 4ZB9A 4KSMA 1GSUA 1U3AA 3UBLA 4X43A 1ABAA 1Q4JA 3AY8A 6GSUA 3GKXA 2CVBA 4MF7A 2NBSA 2VD0A 3NIVA 5J41A 3TKRA 2I1UA 4HUAA 4NWYA 1JZDA 2PN8A 1OKTA 2A4VA 4PXOA 3GYKA 4K8MA 5AIXA 4OWYA 3QCPA 4F0BA 4MJAA 4MCUA 2O89A 3KMOA 3IOSA 1F2EA 2E2GA 4AJ6A 2QSIA 3BCKA 2HYXA 3WGDA 1CQGA 4TR4A 1GH2A 1QXHA 3CXGA 1EGRA 1YEPA 3KM6A 2GSTA 5IPHA 4Q5FA 1EZKA 3K8NA 4KF9A 1GSFA 3GNJA 4PNFA 4E8HA 1XZOA 3F63A 2DJ2A 1UA5A 1SKRB 4OFNA 2HZFA 3VWUA 4TRXA 3J7Yb 3P2AA 1ZYEA 4AF2A 2V2GA 1TP9A 3F4RA 1GUKA 1YKAA 2K8VA 3GX0A 2NVLA 5A5KA 4K7OA 1K3LA 4I6XA 1XVQA 18GSA 2LKUA 4Z7XA 1VF2A 5D9VA 2H74A 1OE7A 2BMXA 3IV4A 1URMA 2DMMA 3VK9A 4TR3A 3UEMA 4EVMA 1KEBA 4P3YB 1FAAA 1GLQA 1V9WA 2MMAA 3IC8A 1K0NA 3QFBC 5CP1A 1WOUA 2E0QA 3ZFLA 3WD6A 2X8GA 4L5LA 1W4VA 4GQCA 3U6VA 1IYIA 2DJKA 4GQFA 1H75A 2FHEA 1MTCA 3LSZA 3UARA 4HQSA 1B9XC 1U88A 2PMTA 3M3MA 5DDLA 1PL1A 4HU9A 1HNCA 5IMVA 5D8IA 4V2NA 4N0ZA 1AW9A 3VPQA 2B5EA 2Z9SA 2VCVA 3F4SA 1K0CA 1O8XA 3PGTA 4ZB8A 5HR2A 1TOFA 1X9MB 1X5CA 5GAND 1XWAA 3IHQA 4L0WA 3GH6A 1NHOA 1PL2A 3RPPA 3APQA 4L8EA 3LORA 4ZXGA 5AISA 5ECRB 5ID2A 3DWVA 1WIKA 3GKKA 4ZBBA 3TRQA 1XXUA 5GSSA 2OJLA 2DJJA 4GF0A 4PTSA 3IK9A 1ZYQB 6GSYA 1J0FA 2JL4A 3DD3A 5JCGA 4TKYA 5D9WA 1U3IA 3VI5A 3GV1A 3HHVA 2VOCA 3F6FA 3M9KA 2PGTA 4HQZA 2PUKC 5ECMB 1YZXA 2FWGA 3DMLA 3TJFA 1YQ1A 11GSA 3C1RA 5ENUA 2D2ZA 5G2ZA 3IK7A 4TXOA 4RI7A 1HQOA 4MLYA 4EDZA 3UL3A 4KGIA 3LJRA 3EYTA 3WYWA 1YY7A 2JACA 1EV4A 1ZOFA 1SD9A 3E9JB 1XWKA 3Q6OA 3FR9A 4GSTA 2CZ3A 1F3AA 3FKFA 4F2IA 4V1Ag 1HNBA 2C8UA 1JLWA 3G7YA 3IC4A 3F6DA 1QK8A 4HZ4A 4K0GA 2GT6A 1TU8A 3DEXA 5ABRA 3TKQA 3VPTA 2RM6A 4CHSA 1ST9A 2VCTA 5KN0A 3EURA 1YDKA 2V32A 4WEYA 1SD8A 3O3TA 1AQVA 4KX4A 3KZQA 3ZTLA 2VCWA 3VLNA 4EC0A 3RAZA 2WB9A 5DJMA 3F8UA 4LLRA 5EVOA 5EY6A 3CSHA 3L9VA 1I5GA 1PSQA 1W89A 3ZRDA 4XRDA 4HZ2A 4L0UA 2WZ9A 1TK0B 2FA8A 5ID2B 1M2BA 2R37A 4QL9A 5A4WA 1BAYA 3IA1A 5DCHA 4G2EA 5J9CA 5JWQB 2GZPA 4MF6A 3KXOA 1ZL9A 1TJDA 2CVKA 3UVHA 3W6GA 5INYA 3M9JA 3GSTA 2L4QA 2YJ7A 3ISOA 3GKMA 3E0UA 1K0BA 1GP1A 1B48A 1FB6A 3M8NA 2WS2A 4ACSA 4F0CA 5ECKB 3V1WA 2I9HA 1Z3EA 2L5OA 1UN2A 1TI1A 4TXOB 4IHUA 1X5DA 2FGXA 2JZRA 3ME8A 2HRAA 1KNGA 4GSNA 3M0FA 4TR0A 1KBNA 1A2LA 1GUHA 2HRFA 1M7TA 1WWJA 2EC4A 3GL5A 4MJBA 5KEJA 3HVXA 2TIRA 4ECIA 1U6TA 2UZ8A 2AB6A 1YF0A 4I2TA 4POKA 3RBTA 2HQTA 12GSA 1ERTA 2CV4A 2GS3A 3LG6A 1X9WB 2L6DA 1EOHA 4KDYA 1AIUA 5E59A 5ECLB 4ZILA 3HZ8A 2XC2A 7GSSA 2C0GA 1QMVA 4HEA2 5CYYA 5FHIA 2BTOT 3EU4A 5F05A 2H6XA 2AAWA 2VL3A 5JWRB 2C3NA 1T8EB 2RIIA 5EPFA 1JHBA 2OBKA 2H76A 4RI6A 2PBJA 5B8BA 4WF5A 1ZMAA 20GSA 2VUPA 4I2UA 3KTBA 1QFNA 4OMVA 1SKWB 4IJIA 3L0HA 2JADA 1EV9A 1G7OA 1DSBA 1GULA 1J08A 1ERWA 3EE2A 2PVOC 3O76A 1LJRA 1JZRA 1G6YA 1XVWA 4GRFA 1O8WA 2FCHA 1G0TA 2CAIA 3QR6A 4PX1A 4ZIJA 3WGEA 2KHPA 2FY6A 4EUYA 1TK8B 4AGSA 3G7IA 3VWWA 3IXRA 4QQ7A 2ON5A 2K9FA 3N9JA 4KE3A 1MDIA 3FK8A 2KLXA 2M46A 2FD3A 4I8BA 2F8FA 4N11A 1VF1A 1TRWA 1TW9A 4RQRA 1B4PA 3H93A 5A4VA 2R5GA 2X8CA 4HS1A 5DQSA 3Q18A 3F3QA 3C71A 1G6WA 2HE3A 3IDVA 1PD21 4NHZA 2VCQA 4GWRA 1XOAA 1OC9A 14GSA 1FVKA 2JSYA 2OE0A 4IS0A 2B7JA 4Q5RA 4GSSA 4MPFA 19GSA 1QQ2A 2LEGA 2K6VA 1TTZA 1O7UA 4K7NA 1SJIA 3L78A 1K3OA 2K18A 2VL2C 1DE1A 4FYCA 3FEUA 1TU7A 1Z6MA 4NV5A 3DKSA 1BQ7A 5ECHB 5IIZA 3CBUA 2VM1A 3WT1A 4TR1B 2H8LA 2YWMA 4ZL8A 4JBBA 1YKCA 1MD3A 3QAGA 4O5RA 1PMTA 1N8JA 4PUAA 4G0IA 5ECNB 4XS4A 5FT3A 4BVYB 2YP6A 2IN3A 2PU9C 2LQQA 3ZMLA 4HI7A 1VRSD 2LNTA 4N0VA 3TJJA 2M72A 1LU4A 4ID0A 2AV4A 1SL2B 1BX9A 3D4TA 4XCSA 1Z7PA 2DJ3A 3EMXA 5G5EA 4NMUA 1WJKA 4JRRA 3FZ9A 5D96A 1FW1A 2H01A 3GTUA 3TKSA 5A4UA 2G0FA 2KP2A 1A8LA 5B7CA 4DSRA 1TRUA 3NZNA 2H1DA 2MMOA 2B5YA 2HT9A 4JEDA 9GSSA 1TI3A 4KCEA 2O85A 2GZYA 3BBYA 1LBKA 3LGCA 2REMA 2V6OA 1YJ6A 2H1AA 4WKWA 2HXKA 3UIWA 5DCGA 2EIQA 2C4JA 1FO5A 1OC9B 5D9TA 1V98A 1WP0A 4CW9A 2KOKA 2XHFA 4KNDA 3GUSA 5L71A 3BOAA 4KDUA 2M80A 3TJBA 3GSSA 1RK4A 2FWEA 2GT5A 3HYPA 2MMZA 4E8EA 2QC7A 3KP8A 1F37A 4FYUA 2EIOA 2H72A 5HFIA 5GAPD 3HDCA 4DEJA 5HFGA 1YEXA 2MBSA 2FUG2 4PGTA 3HVSA 1Z9HA 3LYKA 4XRAA 4NPBA 5D93A 3QPMA 1TXXA 1MDKA 2HSMA 6GSTA 2H70A 5DALA 3DRNA 3IBHA 5FWGA 2PVQA 2P5QA 4NV2A 1OC8A 5F06A 4WETA 4XTSA 1S3AA 2ZUPA 1EOGA 3HJOA 3GFKA 4ISDA 3DIEA 2KUCA 4CDOA 1F3BA 3CRTA 1ERVA 4XS4B 4LMVA 2J23A 5G31A 3CSIA 22GSA 2L6CA 3APOA 4OFTA 3H8QA 4AJ8A 2H6YA 4HJ2A 1X0RA 5IMCA 1AQXA 1R5AA 2YV9A 3VI7A 3KCMA 2VLVA 1Y25A 2O87A 3RDWA 2VO4A 4F03A 4WR4A 4KB3A 2YNXA 2MYGA 2N5AA 5COHA 4WBRD 3MAKA 3A2VA 4FH8A 1BEDA 4TVEA 2C0FA 3APSA 5C04A 2XPDA 2C80A 4K1FA 2IIYA 4MK3A 2RUEA 2C0EA 2R2JA 2L57A 2P0GA 4V1Ap 4BL7A 3CSJA 4YH2A 3KGKA 2LTKA 4NXIA 1XWGA 1AUCA 5J4UA 3JCML 2HFDA 1GSYA 1GSDA 4TOPA 1GWCA 2DSAA 3VWVA 5GZZB 1K0DA 5BMUA 5LCZA 4YAPA 2FLSA 4PQHA 2P31A 1O81A 2LRTA 1TDIA 1QUWA 4DSQA 3RHCA 4OFMA 3D0ZA 2H1GA 1PN9A 1FG4A 4BWQA 3GRXA 6GSXA 4YQVA 5IO2A 4ECJA 5H5RA 3LFLA 1OE8A 2EIRA 5J9BA 3QAVA 1T3BA 3GA4A 3U5RE 1EWXA 4MA9A 4XHMA 2IMKA 3MWHA 1G7EA 4MABA 4K7IA 3F0IA 3FZAA 3W8SA 2V41A 1GTAA 1M2DA 3LYPA 4FO5A 2MZCA 1SL0B 1GSEA 4G0KA 2GSQA 3HXSA 3H79A 4JE1A 1XCCA 2H75A 2VIMA 2C3TA 4MH2A 4LL1B 2VCXA 2O8VB 5ECOB 4TXVA 1MEKA 4HU7A 2RM5A 5E4WA 2VL2A 1N2AA 2LS5A 1SYXA 2DC5A 3QD9A 2HSHA 4IKHA 3EU3A 2GSSA 4BL7B 4K2DA 4I5QA 3C7MA 4YQUA 3LWAA 1XW5A 3US3A 1XIYA 2H0IA 2E7PA 3C1SA 5KN3A 4G0LA 3ZFBA 3O6TA 3GL3A 3NOFA 1M0UA 2CZ2A 2L5LA 3FZ5A 2AJQB 2GVPA 3PR8A 1GTIA 3S9FA 2R6KA 1K0OA 3SWLA 3IR4A 2AYTA 5G1LA 4HDEA 3CTFA 3ZREA 3TCOA 3FW2A 4F9ZA 5IO0A 4WXTA 2K8SA 4J2FA 2CAQA 4MP4A 4K0NA 1I9DA 1SK2A 4MMMA 1ZCPA 2IPAA 1Z7RA 2L59A 2IMDA 2FWFA 2B3SA 2LRNA 3TOUA 2A2SA 3ZLPA 2HRKA 5AN1A 3VWXA 1O6JA 5B6NA 5JCWA 3HZ4A 1ZGNA 5ELAA 1A24A 2B1LA 1K3YA 1UVZA 5IM9A 1KTEA 4X0XA 4IBPA 3ZITA 1THXA 1M9BA 3I9V2 1TKDB 4ECCA 5LNKe 3CMIA 4IELA 1GLPA 2DBCA 2H0GA 3D4MA 3DYRA 1WRYA 1O85A 4AJ7A 4X1UA 4PQIA 1T1VA 2GGTA 1ILOA 3A3TA 2NTOA 4MPGA 5F8BA 3GIXA 1A23A 1SK0A 1SU9A 3L4NA 3QFAC 1R4WA 2H1BA 1RW1A 2YANA 1SKSB 4MH3A 1ON4A 1V2AA 2WDUA 2HZEA 1DUGA 3FY7A 1IYHA 1T4ZA 3ZZXA 2AHEA 4MJCA 3KP9A 3KIJA 4BVXA 3DVXA 4MJEA 1OVNA 2HLSA 4OO4A 2YN1A 3P8WA 5ELGA 1F6MC 5CRWA 1THOA 3TJGA 4IJ3A 3ERGA 3CYNA 3IPZA 3ME7A 1GRXA 4KSOA 5HR3A 5IOXA 3HA9A 4LA1A 2H66A 3VFIA 2YCDA 3A2XA 2F3MA 1GNWA 1BG5A 4GLTA 2RLIA 3TDGA 1ML6A 1Z6NA 2N5BA 5F0GA 4GXZA 3L9UA 2PWJA 3UBKA 2QGVA 4TW5A 5ECIB 2IFQA 3G9BA 5ECPB 5F07A 4KH7A 4EE0A 2HRKB 1X9SB 5D73A 2H0HA 3LQ7A 2AUVA 2GSRA 3UVTA 2X99A 4MZWA 2LQOA 1BJXA 4I97A 1NSWA 3E3EA 4JZQA 1B9YC 2YJHA 4O7HA 1XBSA 2IJYA 2LJKA 3IAS2 1B8XA 2CT6A 3QOUA 3J7Yk 3ZVJA 3I43A 4EL1A 1XOBA 2IMIA 2DLXA 4N10A 4GTUA 1VF3A 5JCUA 1K0AA 1GSSA 3RPNA 2L4CA 3TKSE 2B5XA 4IW9A 3C8EA 2V6KA 2I4AA 3P7XA 2WFCA 2WGRA 4NHWA 2DIZA 4Q5QA 5CNWA 2MMNA 4TN8A 3HCZA 4POLA 2VLUA 4KW6A 3OR5A 5IMZA 2HZEB 3KMNA 2NDOA 1EGOA 4MF5A 2YV7A 4BVXB 4USSA 4OD7A 1SK1A 4J56E 2VLTA 1WMJA 2OACA 1A2MA 3ZIJA 3PPUA 3BD2A 5G5FA 1EP7A 3QAWA 5ECQB 5IMAA 3UOMA 3LEFA 3ZIVA 1ACVA 5KN1A 4Q5NA 3MNGA 3GN3A 4EXJA 4XS6A 2XBIA 5G1KA 2IFQB 4J57E 2GLRA 1SYRA 2J9HA 4KCAA 4LMWA 1V57A 3UJ1A 4D73A 3N5OA 4IGJA 5IOWA 3TOTA 4RUVA 4IQAA 1FVJA 2RUFA 1OKDA 3D6IA 2H71A 4WR5A 3W8JA 4MDCA 2HI7A 1XW9A 4POBA 1UC7A 1C72A 2HSNB 1OYJA 1EEJA 1GUMA 1PRXA 1QGVA 1J9BA 2DJ0A 4LL4B 3HKRA 1A0RP 1DBYA 1XWCA 5H5QA 1SENA 4XS1A 4OCEA 5H5SA 1B4QA 2I3YA 2DMLA 2VD1A 5HQPA 5AIVA 2H30A 1V58A 2B7KA 1GNEA 3P90A 5DJLA 1XW6A 3PINA 5DAKA 4JR6A 4ZBDA 2IWTA 2WCIA 1FHEA 2HRNA 1E2YA 3H4KA 4PNGA 2HSYA 1T4YA 3FZ4A 1R7HA 2YWNA 3GX8A 2KP1A 5IPGA 2R3XA 5B6MA 2FNOA 3D21A 4IP6A 2A2RA 2C1YA 3EWLA 3EMPA 3FR3A 2WULA 17GSA 3GTUB 5HFKA 1HD2A 1K0MA 3HJMA 1O73A 3Q74A 2X64A 3WT2A 3GKNA 2P5RA 4D73B 1OAZA 1AXDA 5DQYA 3F3RA 4ML1A 1U87A 4G9HA 4EO3A 3ZMKA 4KUNA 2CA8A 3DXBA 3GURA 2O7KA 3DVWA 4XIHA 1E6BA 2R4VA 1JZOA 3BCIA 2WRTA 1YF1A 1AC1A 1BYEA 1PKZA 3HY2A 1Z5YE 4HOJA 3D5JA 3EC3A 3GH9A 4ZBAA 2GQKA 3TRXA 2DJ1A 4OO5A 3QMXA 4O92A 2CVDA 4G10A 1TRSA 2VAFA 5G30A 1A2JA 4OCFA 2F9SA 5D9XA 1SL1B 4GCIA 4PUFC 2HSMB 1PX6A 2TRXA 5DALB 2FWHA 2C0DA 10GSA 4F82A 4ML6A 1EP8A 3TUEA 2LSTA 1F9MA 4EDYA 5DAKB 5CREA 3I69A 1PKWA 1XFLA 4FQUA 3ZL5A
chains in the Genus database with same CATH superfamily
2YWIA 4DSSA 3I6AA 4FIWA 3LXTA 4K9ZA 1SVMA 3TKPA 3ZVJD 16GSA 1FOVA 1VF4A 2V1MA 2YPMA 4O32A 1JFUA 3MSZA 2GQLA 3DGQA 2GDRA 2H19A 5IMDA 1M2AA 4H86A 2R0CA 5IQYA 4KDXA 2VL9A 5B8AA 2WW0A 3G7JA 5CRHA 3R2QA 3ERFA 1ZYNA 3LXZA 4PQ1A 4NAXA 4IP1A 2ON7A 4IQ1A 2X8HA 4KAEA 1DE2A 4ECBA 2TRCP 3TKSC 3F9UA 2X4AA 3IAM2 4FYBA 4CY8A 2DIYA 5JWOB 5LD0A 3FYGA 1JZWA 4ULXA 3HJPA 3F4TA 4JU5A 2B1KA 4V2MA 3TRPA 1PX7A 3TGZA 1M99A 4RQXA 1AQWA 1NW2A 2B6MA 4L5OA 2XPEA 5CRGA 3PH9A 5HR0A 4ZL7A 1YVLA 2IL3A 2GQMA 3A5WA 6GSSA 5KN2A 1PFOA 3ZYWA 1AAZA 3FRCA 2YZHA 3D22A 1T00A 3H1NA 3TU3B 1GSQA 3ED3A 4DVCA 1NM3A 4BPYA 1TK5B 1VGLA 2XBQA 3MDKA 1T7PB 3UAPA 4K6XA 2ALBA 5AGYA 2LJRA 1SJ6A 1PGTA 3KH7A 1GTBA 1H4OA 5EL8A 1PQNA 1Y6EA 2N5FA 5GSTA 1Q98A 4K5RA 3RHBA 4DSSB 2PERA 3KTLA 1SJZA 4MZCA 3EVIA 2LV3A 2LJAA 1R26A 2ES7A 2JU5A 2E2MA 8GSSA 4KA0A 1WE0A 1S3DA 2CX4A 2HNLA 2YOIA 2H73A 2LUSA 3FHKA 3QDNA 1S3CA 2BJXA 2YZUA 1HYUA 1MDJA 3HVVA 2CX3A 2OA7A 5J40A 4JR4A 2JZTA 1OC3A 3BJ5A 1A0FA 2F8AA 1V40A 6GSWA 3GMFA 2LRCA 3CTGA 1RQMA 3FR6A 1TRVA 2F51A 2CQ9A 1XPVA 3Q19A 4IVFA 3A5IA 4V2LA 1WPIA 13GSA 3WGXA 4BA7A 1USBA 2OBIA 5ECSA 5HR1A 5A5HA 4TR1A 1MD4A 4EF0A 2JSZA 2MBTA 2QA2A 4EKZA 2IMEA 4YQMA 5CAXA 3KH9A 3EINA 4ILFA 1ERUA 2QKEA 4YAVA 4WF4A 5J5NA 2IMFA 3R3EA 3C73A 4MZBA 1TXUA 4QL7A 3CRUA 4BVYA 5DBQA 2WJUA 3UMAA 4ZB6A 1GTUA 1XWBA 5CRDA 3VURA 1X5EA 1PA3A 3A2WA 3TB2A 3KD0A 4Z2UA 4ZL9A 4HJMA 2H6ZA 1ZZYA 3IRAA 1M9AA 2VCZA 2WZSA 3ERWA 3GHAA 2ZNMA 2LNSA 2G2QA 2GZZA 1JLVA 2PPTA 4IN0A 6GSVA 2NPBA 2VM2A 4N30A 4AKGA 5CO3A 2WVXA 2OKAA 3KJYA 1CQHA 2FA4A 1R5PA 1HNAA 2OE3A 3IE3A 5IMFA 4POMA 3L9SA 2I81A 4WBJA 1GL8A 2YWOA 2ZCTA 5J3RA 3TJKA 1NHYA 2JZSA 3HD5A 2GTUA 2OADA 3SBCA 4G19A 4PURA 2C3QA 2OE1A 4BWSA 3M1GA 5DVBA 5C00A 1A8YA 1FB0A 1EEMA 3KEBA 4ZB9A 3MYDA 4KSMA 1GSUA 1U3AA 3UBLA 4X43A 1ABAA 4Z2TA 1Q4JA 3AY8A 6GSUA 3GKXA 2CVBA 4MF7A 2NBSA 2VD0A 3NIVA 5J41A 3TKRA 2I1UA 4HUAA 4NWYA 1JZDA 2PN8A 1OKTA 2A4VA 4PXOA 3GYKA 4K8MA 5AIXA 4OWYA 3QCPA 4F0BA 4MJAA 4MCUA 2O89A 3KMOA 3IOSA 1F2EA 2E2GA 4AJ6A 2QSIA 3BCKA 2HYXA 3WGDA 1CQGA 4TR4A 1GH2A 1QXHA 3CXGA 1EGRA 1YEPA 3KM6A 2GSTA 5IPHA 4Q5FA 1EZKA 3K8NA 4KF9A 4N3ZA 1GSFA 3GNJA 4PNFA 4E8HA 1XZOA 3F63A 2DJ2A 1UA5A 1SKRB 4OFNA 2HZFA 3VWUA 4TRXA 3J7Yb 3P2AA 1ZYEA 4AF2A 2V2GA 1TP9A 3F4RA 4FXYP 1GUKA 1YKAA 2K8VA 2WVXB 3GX0A 2NVLA 5A5KA 4K7OA 1K3LA 4I6XA 1XVQA 18GSA 2LKUA 4Z7XA 1VF2A 5D9VA 2H74A 1OE7A 2BMXA 3IV4A 1URMA 2DMMA 3VK9A 4TR3A 3UEMA 4EVMA 1KEBA 4P3YB 1FAAA 1GLQA 1V9WA 2MMAA 3IC8A 1K0NA 3QFBC 5CP1A 1WOUA 2E0QA 3ZFLA 3WD6A 2X8GA 4L5LA 1W4VA 4GQCA 3U6VA 1IYIA 2DJKA 4GQFA 1H75A 2FHEA 1MTCA 3LSZA 3UARA 4HQSA 1B9XC 1U88A 2PMTA 3M3MA 5DDLA 1PL1A 4HU9A 1HNCA 5IMVA 5D8IA 4V2NA 4N0ZA 1AW9A 2H1LA 3VPQA 2B5EA 4X4JA 2Z9SA 2VCVA 4GDFA 3F4SA 1K0CA 1O8XA 3PGTA 4ZB8A 5HR2A 1TOFA 2VKZG 1X9MB 1X5CA 5GAND 1XWAA 3IHQA 4L0WA 3GH6A 1NHOA 1PL2A 3RPPA 3APQA 4L8EA 3LORA 4ZXGA 5AISA 3CHXC 5ECRB 5ID2A 3DWVA 1WIKA 3GKKA 4ZBBA 3TRQA 1XXUA 5GSSA 2OJLA 2DJJA 4GF0A 4PTSA 3IK9A 1ZYQB 6GSYA 1J0FA 2JL4A 3DD3A 5JCGA 4TKYA 5D9WA 1U3IA 3CQFA 3VI5A 3GV1A 3HHVA 2VOCA 3F6FA 3M9KA 2PGTA 4HQZA 2PUKC 5ECMB 1YZXA 2FWGA 3DMLA 3HVNA 3TJFA 1YQ1A 11GSA 3C1RA 5ENUA 2D2ZA 5G2ZA 3IK7A 4TXOA 4RI7A 2R0GA 1HQOA 4MLYA 4EDZA 3UL3A 4KGIA 3LJRA 3EYTA 3WYWA 1YY7A 2JACA 1EV4A 1ZOFA 1SD9A 3E9JB 1XWKA 3Q6OA 3FR9A 4GSTA 2CZ3A 1F3AA 4HSCX 3FKFA 4F2IA 4V1Ag 5A34A 1HNBA 2C8UA 1JLWA 3G7YA 3IC4A 3F6DA 1QK8A 1SVOA 4HZ4A 4K0GA 2GT6A 1TU8A 3DEXA 5ABRA 3TKQA 3VPTA 2RM6A 4CHSA 1ST9A 2VCTA 5KN0A 3EURA 1YDKA 2V32A 4WEYA 1SD8A 3O3TA 1AQVA 4KX4A 3KZQA 3ZTLA 4YKGA 2VCWA 3VLNA 4EC0A 3RAZA 2WB9A 5DJMA 3F8UA 4LLRA 5EVOA 5EY6A 3CSHA 3L9VA 1N25A 1I5GA 1PSQA 1M3IA 1W89A 3ZRDA 4XRDA 4HZ2A 4L0UA 2WZ9A 4E68A 1TK0B 2EFCA 2FA8A 5ID2B 1M2BA 2A2PA 2R37A 4QL9A 5A4WA 4AKHA 2R0PA 1BAYA 3IA1A 5DCHA 4G2EA 5J9CA 5JWQB 2GZPA 4MF6A 3KXOA 1ZL9A 1TJDA 1XG8A 2CVKA 3UVHA 3W6GA 5INYA 3M9JA 3GSTA 2L4QA 2YJ7A 3ISOA 3GKMA 3E0UA 1K0BA 1GP1A 1B48A 1FB6A 3M8NA 2WS2A 4ACSA 4F0CA 5ECKB 3V1WA 2UV8G 2I9HA 1Z3EA 2L5OA 1UN2A 1TI1A 4TXOB 4IHUA 1X5DA 2FGXA 5BRTA 2JZRA 3ME8A 4YKFA 2HRAA 1KNGA 4GSNA 3M0FA 4TR0A 1KBNA 1A2LA 1GUHA 2HRFA 1M7TA 1WWJA 2EC4A 3GL5A 4MJBA 5KEJA 3HVXA 2TIRA 4PHZC 4ECIA 1U6TA 2UZ8A 2AB6A 1YF0A 4I2TA 4POKA 3RBTA 2HQTA 12GSA 1ERTA 2CV4A 2GS3A 3LG6A 1X9WB 2L6DA 1EOHA 5J4VA 4KDYA 1AIUA 5E59A 5ECLB 4ZILA 3HZ8A 2XC2A 7GSSA 2C0GA 1QMVA 4HEA2 5CYYA 5FHIA 2BTOT 3EU4A 5F05A 2H6XA 2AAWA 2VL3A 5JWRB 2C3NA 1T8EB 2RIIA 5EPFA 1JHBA 2OBKA 2H76A 4RI6A 2PBJA 5B8BA 4EIQA 4WF5A 1ZMAA 20GSA 2VUPA 4I2UA 3KTBA 1QFNA 4OMVA 1SKWB 2WVYA 4IJIA 3L0HA 3RGBC 2JADA 1EV9A 1G7OA 1DSBA 1GULA 1J08A 1ERWA 3EE2A 2PVOC 3O76A 1LJRA 1JZRA 1G6YA 1XVWA 4GRFA 1O8WA 2FCHA 1G0TA 2CAIA 2EFHA 3EPTA 3QR6A 4PX1A 4ZIJA 3WGEA 2KHPA 2FY6A 4EUYA 1TK8B 4AGSA 3G7IA 2EFEA 3VWWA 3RFRC 4QQ7A 3IXRA 2ON5A 2K9FA 2DKIA 3N9JA 4KE3A 1MDIA 3FK8A 2KLXA 2M46A 2FD3A 4I8BA 2F8FA 4N11A 1VF1A 1TRWA 1TW9A 4RQRA 1B4PA 3H93A 5A4VA 2R5GA 2X8CA 4HS1A 5DQSA 5KOWA 3Q18A 3F3QA 3C71A 1G6WA 2HE3A 3IDVA 1PD21 4NHZA 2VCQA 4GWRA 1XOAA 1OC9A 14GSA 1FVKA 2JSYA 2OE0A 4IS0A 2B7JA 4Q5RA 4GSSA 4MPFA 19GSA 1QQ2A 2LEGA 4AKIA 2K6VA 1TTZA 1O7UA 4K7NA 1SJIA 3L78A 1K3OA 2K18A 2VL2C 1DE1A 4FYCA 3FEUA 1TU7A 1Z6MA 4NV5A 3DKSA 1BQ7A 5ECHB 4K2XA 5IIZA 3CBUA 2VM1A 3WT1A 5A5HB 4TR1B 2H8LA 2YWMA 4ZL8A 4JBBA 1YKCA 1MD3A 3QAGA 4O5RA 1PMTA 1N8JA 4PUAA 4G0IA 5ECNB 4XS4A 5FT3A 4BVYB 2YP6A 2IN3A 2PU9C 2QA1A 2DKHA 2LQQA 3ZMLA 4HI7A 1VRSD 2LNTA 4N0VA 3TJJA 2M72A 1LU4A 4ID0A 2AV4A 1SL2B 1BX9A 3D4TA 4XCSA 1Z7PA 2DJ3A 3EMXA 5G5EA 4NMUA 1WJKA 4JRRA 3FZ9A 5D96A 1FW1A 2H01A 3GTUA 3TKSA 5A4UA 2G0FA 2KP2A 1A8LA 5B7CA 4DSRA 1TRUA 3NZNA 2H1DA 2MMOA 2B5YA 2HT9A 4JEDA 9GSSA 1TI3A 4KCEA 2O85A 2GZYA 3BBYA 1LBKA 3LGCA 2REMA 2V6OA 1YJ6A 2H1AA 4WKWA 2HXKA 3UIWA 5DCGA 2EIQA 2C4JA 1PN0A 1ZYPA 1FO5A 1OC9B 5D9TA 1V98A 1WP0A 4CW9A 2KOKA 2XHFA 4KNDA 3GUSA 5L71A 3BOAA 4KDUA 2M80A 3TJBA 3GSSA 1RK4A 2FWEA 2GT5A 3HYPA 2MMZA 4E8EA 2QC7A 3KP8A 1F37A 4FYUA 2EIOA 3MIXA 2H72A 5HFIA 5GAPD 3HDCA 4DEJA 4Z2RA 5HFGA 1YEXA 2MBSA 2FUG2 4PGTA 3HVSA 1Z9HA 3LYKA 4XRAA 4NPBA 5D93A 2O5VA 1TXXA 3QPMA 1MDKA 2HSMA 6GSTA 2H70A 5DALA 3DRNA 3IBHA 5FWGA 2PVQA 2P5QA 4NV2A 1OC8A 5F06A 4WETA 4XTSA 1S3AA 2ZUPA 1EOGA 3HJOA 3GFKA 1M3JA 4ISDA 3DIEA 2KUCA 4CDOA 3LW9A 1F3BA 3CRTA 1ERVA 4XS4B 1FOHA 4LMVA 2J23A 4PI2C 5G31A 3CSIA 22GSA 2L6CA 3APOA 4OFTA 3H8QA 4AJ8A 2H6YA 4HJ2A 1X0RA 5IMCA 1AQXA 1R5AA 2YV9A 3VI7A 3KCMA 4ZB7A 2VLVA 1Y25A 2O87A 3RDWA 2VO4A 4F03A 4O5UA 4WR4A 4KB3A 2YNXA 2MYGA 2N5AA 5COHA 4WBRD 3MAKA 3A2VA 4FH8A 1BEDA 4TVEA 2C0FA 3APSA 5C04A 2XPDA 2C80A 4K1FA 2IIYA 4MK3A 4W66A 2RUEA 2C0EA 2R2JA 2L57A 2P0GA 4V1Ap 4BL7A 3CSJA 4YH2A 3KGKA 2LTKA 4NXIA 1XWGA 1AUCA 5J4UA 3FMWA 3JCML 2HFDA 1GSYA 3HMJG 1GSDA 4TOPA 1GWCA 2DSAA 3VWVA 5GZZB 1K0DA 5BMUA 5LCZA 4YAPA 2FLSA 4PQHA 2P31A 1O81A 2LRTA 1TDIA 1QUWA 4DSQA 3RHCA 4OFMA 3D0ZA 2H1GA 1PN9A 1FG4A 4BWQA 3GRXA 6GSXA 4YQVA 5IO2A 1BG1A 4ECJA 5H5RA 3LFLA 1OE8A 2EIRA 5J9BA 3QAVA 1T3BA 3GA4A 3U5RE 1EWXA 4MA9A 4XHMA 2WW2A 2IMKA 3MWHA 1G7EA 2OT3A 4MABA 4K7IA 5A1NA 3F0IA 3FZAA 3W8SA 2V41A 1GTAA 1M2DA 3LYPA 4FO5A 2MZCA 1SL0B 1GSEA 4G0KA 2GSQA 3HXSA 3H79A 4JE1A 1XCCA 2H75A 3CWGA 2VIMA 2C3TA 4MH2A 4LL1B 2VCXA 2O8VB 5ECOB 4TXVA 1MEKA 4HU7A 2RM5A 2EFDA 5E4WA 2VL2A 1N2AA 2LS5A 1SYXA 2DC5A 3QD9A 2HSHA 4IKHA 3EU3A 2GSSA 4BL7B 4K2DA 4I5QA 3C7MA 4YQUA 3LWAA 4BIKA 1XW5A 3US3A 1XIYA 2H0IA 2E7PA 3C1SA 5KN3A 4G0LA 3ZFBA 3O6TA 3GL3A 3NOFA 1M0UA 2CZ2A 2L5LA 3FZ5A 2AJQB 2GVPA 2WVZA 3PR8A 1GTIA 3S9FA 5BMUB 2R6KA 1K0OA 4PI0C 3SWLA 3IR4A 4G01A 2AYTA 5G1LA 4HDEA 3CTFA 3ZREA 3TCOA 3FW2A 4F9ZA 5IO0A 4WXTA 2K8SA 4J2FA 2CAQA 4MP4A 4K0NA 1I9DA 1SK2A 4MMMA 1ZCPA 2IPAA 1Z7RA 2L59A 2IMDA 2FWFA 2B3SA 1S4BP 4AKXB 5A34B 2LRNA 3TOUA 2A2SA 3ZLPA 2HRKA 5AN1A 5A1NB 3VWXA 1O6JA 5B6NA 5JCWA 3HZ4A 1ZGNA 5ELAA 1A24A 2B1LA 1K3YA 1UVZA 5IM9A 4MNNA 1S3RA 1KTEA 4X0XA 4IBPA 1BF5A 1THXA 3ZITA 1M9BA 3I9V2 1TKDB 4ECCA 5LNKe 3CMIA 4IELA 1GLPA 2DBCA 2H0GA 3D4MA 3DYRA 1WRYA 1O85A 4AJ7A 4X1UA 4PQIA 1T1VA 2GGTA 1ILOA 3A3TA 2NTOA 5J4YA 4MPGA 5F8BA 3GIXA 1A23A 1SK0A 1SU9A 3L4NA 3QFAC 1R4WA 2H1BA 1RW1A 2YANA 1SKSB 4MH3A 1ON4A 1V2AA 2WDUA 2HZEA 1DUGA 3FY7A 1IYHA 1T4ZA 3ZZXA 2AHEA 4MJCA 3KP9A 3KIJA 4BVXA 3DVXA 4MJEA 1OVNA 2HLSA 4OO4A 2YN1A 3P8WA 5ELGA 1F6MC 5CRWA 1THOA 3TJGA 4IJ3A 3ERGA 3CYNA 3IPZA 3ME7A 1GRXA 4KSOA 5HR3A 5IOXA 3HA9A 4LA1A 2H66A 3VFIA 2YCDA 3A2XA 2F3MA 1GNWA 1BG5A 4GLTA 2RLIA 3TDGA 1ML6A 1Z6NA 2N5BA 5F0GA 4GXZA 3L9UA 2PWJA 4O5QA 3UBKA 2QGVA 3IHGA 4TW5A 5ECIB 2IFQA 3G9BA 5ECPB 5F07A 4KH7A 4EE0A 4EIPA 2HRKB 1X9SB 5D73A 2H0HA 2WW1A 3LQ7A 2AUVA 2GSRA 3UVTA 2X99A 4MZWA 2LQOA 1BJXA 4I97A 1NSWA 3E3EA 4JZQA 1B9YC 2YJHA 4O7HA 1XBSA 2WW3A 2IJYA 2LJKA 3IAS2 2HSNA 1B8XA 2CT6A 3QOUA 3J7Yk 5J47A 3ZVJA 3I43A 1SVLA 4EL1A 1XOBA 2IMIA 2DLXA 4N10A 4GTUA 1VF3A 5JCUA 1K0AA 1GSSA 3RPNA 2L4CA 3TKSE 2B5XA 4IW9A 3C8EA 2V6KA 2I4AA 3P7XA 2WFCA 2WGRA 4NHWA 2DIZA 4Q5QA 5CNWA 2MMNA 4TN8A 3HCZA 4POLA 2VLUA 4KW6A 3OR5A 5IMZA 2HZEB 3KMNA 2NDOA 1EGOA 2O3EA 4MF5A 2YV7A 4ICYA 4BVXB 4USSA 4OD7A 1SK1A 4J56E 2VLTA 1WMJA 2OACA 1A2MA 3ZIJA 3PPUA 3BD2A 5G5FA 1EP7A 3QAWA 5ECQB 5IMAA 4QMKA 3UOMA 3LEFA 3ZIVA 1ACVA 5KN1A 4Q5NA 1I1IP 3MNGA 3GN3A 4EXJA 4XS6A 2XBIA 5G1KA 2IFQB 4J57E 2GLRA 1SYRA 2J9HA 4KCAA 4LMWA 1V57A 3UJ1A 4D73A 3N5OA 4IGJA 5IOWA 3TOTA 4RUVA 4IQAA 1FVJA 2RUFA 1OKDA 3D6IA 2H71A 4WR5A 4AI6A 1YEWC 3W8JA 4MDCA 2HI7A 4K5SA 1XW9A 4POBA 1UC7A 1C72A 2HSNB 1OYJA 1EEJA 1GUMA 1PRXA 2X49A 1QGVA 1J9BA 2DJ0A 4LL4B 3HKRA 1A0RP 1DBYA 4CY6A 1XWCA 5H5QA 1SENA 4XS1A 4OCEA 2A4HA 5H5SA 1B4QA 2I3YA 2DMLA 2VD1A 5HQPA 5AIVA 2H30A 1V58A 2B7KA 1GNEA 3P90A 5DJLA 1XW6A 3PINA 5DAKA 4JR6A 4ZBDA 2IWTA 2WCIA 1FHEA 2HRNA 1E2YA 3H4KA 4PNGA 2HSYA 1T4YA 3FZ4A 1R7HA 2YWNA 3GX8A 2KP1A 5IPGA 2R3XA 5B6MA 2FNOA 3D21A 4IP6A 2A2RA 2C1YA 3EWLA 3EMPA 3FR3A 2WULA 17GSA 3GTUB 5HFKA 1HD2A 1K0MA 3HJMA 1O73A 3Q74A 2X64A 3WT2A 4A5PA 3GKNA 2P5RA 4D73B 1OAZA 1AXDA 5DQYA 3F3RA 4ML1A 1U87A 4G9HA 4EO3A 3ZMKA 4KUNA 2CA8A 3DXBA 3GURA 2O7KA 3DVWA 4XIHA 1Y1UA 1E6BA 2R4VA 1JZOA 3BCIA 2WRTA 1YF1A 1AC1A 1BYEA 1PKZA 2O36A 3HY2A 1Z5YE 4HOJA 3D5JA 3EC3A 3GH9A 4ZBAA 2GQKA 3TRXA 2DJ1A 4OO5A 3QMXA 4O92A 2CVDA 5KOXA 4G10A 1TRSA 2VAFA 5G30A 1A2JA 4OCFA 2F9SA 5D9XA 1SL1B 4GCIA 4PUFC 2HSMB 1PX6A 2TRXA 5DALB 2FWHA 2C0DA 10GSA 4F82A 4ML6A 1EP8A 3TUEA 2LSTA 1F9MA 4EDYA 5DAKB 5CREA 3I69A 1PKWA 1XFLA 4FQUA 3ZL5A
chains in the Genus database with same CATH topology
2YWIA 4DSSA 3I6AA 4FIWA 3LXTA 4K9ZA 1SVMA 3TKPA 3ZVJD 16GSA 1FOVA 1VF4A 2V1MA 2YPMA 4O32A 1JFUA 3MSZA 2GQLA 3DGQA 2GDRA 2H19A 5IMDA 1M2AA 4H86A 2R0CA 5IQYA 4KDXA 2VL9A 5B8AA 3G7JA 5CRHA 3R2QA 3ERFA 1ZYNA 3LXZA 4PQ1A 4NAXA 4IP1A 2ON7A 4IQ1A 2X8HA 4KAEA 1DE2A 4ECBA 2TRCP 3TKSC 3F9UA 2X4AA 3IAM2 4FYBA 4CY8A 2DIYA 5JWOB 5LD0A 3FYGA 1JZWA 4ULXA 3HJPA 3F4TA 4JU5A 2B1KA 4V2MA 3TRPA 1PX7A 3TGZA 1M99A 4RQXA 1AQWA 1NW2A 2B6MA 4L5OA 2XPEA 5CRGA 3PH9A 5HR0A 4ZL7A 1YVLA 2IL3A 2GQMA 3A5WA 6GSSA 5KN2A 3ZYWA 1AAZA 3FRCA 2YZHA 3D22A 1T00A 3H1NA 3TU3B 1GSQA 3ED3A 4DVCA 1NM3A 4BPYA 1TK5B 1VGLA 2XBQA 3MDKA 1T7PB 3UAPA 4K6XA 2ALBA 5AGYA 2LJRA 1SJ6A 1PGTA 3KH7A 1GTBA 1H4OA 5EL8A 1PQNA 1Y6EA 2N5FA 5GSTA 1Q98A 4K5RA 3RHBA 4DSSB 2PERA 3KTLA 1SJZA 4MZCA 3EVIA 2LV3A 2LJAA 1R26A 2ES7A 2JU5A 2E2MA 8GSSA 4KA0A 1WE0A 1S3DA 2CX4A 2HNLA 2YOIA 2H73A 2LUSA 3FHKA 3QDNA 1S3CA 2BJXA 2YZUA 1HYUA 1MDJA 3HVVA 2CX3A 2OA7A 5J40A 4JR4A 2JZTA 1OC3A 3BJ5A 1A0FA 2F8AA 1V40A 6GSWA 3GMFA 2LRCA 3CTGA 1RQMA 3FR6A 1TRVA 2F51A 2CQ9A 1XPVA 3Q19A 4IVFA 3A5IA 4V2LA 1WPIA 13GSA 3WGXA 4BA7A 1USBA 2OBIA 5ECSA 5HR1A 5A5HA 4TR1A 1MD4A 4EF0A 2JSZA 2MBTA 2QA2A 4EKZA 2IMEA 4YQMA 5CAXA 3KH9A 3EINA 4ILFA 1ERUA 2QKEA 4YAVA 4WF4A 5J5NA 2IMFA 3R3EA 3C73A 4MZBA 1TXUA 4QL7A 3CRUA 4BVYA 5DBQA 2WJUA 3UMAA 4ZB6A 1GTUA 1XWBA 5CRDA 3VURA 1X5EA 1PA3A 3A2WA 3TB2A 3KD0A 4Z2UA 4ZL9A 4HJMA 2H6ZA 1ZZYA 3IRAA 1M9AA 2VCZA 3ERWA 3GHAA 2ZNMA 2LNSA 2G2QA 2GZZA 1JLVA 2PPTA 4IN0A 6GSVA 2NPBA 2VM2A 4N30A 4AKGA 5CO3A 2OKAA 3KJYA 1CQHA 2FA4A 1R5PA 1HNAA 2OE3A 3IE3A 5IMFA 4POMA 3L9SA 2I81A 4WBJA 1GL8A 2YWOA 2ZCTA 5J3RA 3TJKA 1NHYA 2JZSA 3HD5A 2GTUA 2OADA 3SBCA 4G19A 4PURA 2C3QA 2OE1A 4BWSA 3M1GA 5DVBA 5C00A 1A8YA 1FB0A 1EEMA 3KEBA 4ZB9A 3MYDA 4KSMA 1GSUA 1U3AA 3UBLA 4X43A 1ABAA 4Z2TA 1Q4JA 3AY8A 6GSUA 3GKXA 2CVBA 4MF7A 2NBSA 2VD0A 3NIVA 5J41A 3TKRA 2I1UA 4HUAA 4NWYA 1JZDA 2PN8A 1OKTA 2A4VA 4PXOA 3GYKA 4K8MA 5AIXA 4OWYA 3QCPA 4F0BA 4MJAA 4MCUA 2O89A 3KMOA 3IOSA 1F2EA 2E2GA 4AJ6A 2QSIA 3BCKA 2HYXA 3WGDA 1CQGA 4TR4A 1GH2A 1QXHA 3CXGA 1EGRA 1YEPA 3KM6A 2GSTA 5IPHA 4Q5FA 1EZKA 3K8NA 4KF9A 4N3ZA 1GSFA 3GNJA 4PNFA 4E8HA 1XZOA 3F63A 2DJ2A 1UA5A 1SKRB 4OFNA 2HZFA 3VWUA 4TRXA 3J7Yb 3P2AA 1ZYEA 4AF2A 2V2GA 1TP9A 3F4RA 1GUKA 1YKAA 2K8VA 3GX0A 2NVLA 5A5KA 4K7OA 1K3LA 4I6XA 1XVQA 18GSA 2LKUA 4Z7XA 1VF2A 5D9VA 2H74A 1OE7A 2BMXA 3IV4A 1URMA 2DMMA 3VK9A 4TR3A 3UEMA 4EVMA 1KEBA 4P3YB 1FAAA 1GLQA 1V9WA 2MMAA 3IC8A 1K0NA 3QFBC 5CP1A 1WOUA 2E0QA 3ZFLA 3WD6A 2X8GA 4L5LA 1W4VA 4GQCA 3U6VA 1IYIA 2DJKA 4GQFA 1H75A 2FHEA 1MTCA 3LSZA 3UARA 4HQSA 1B9XC 1U88A 2PMTA 3M3MA 5DDLA 1PL1A 4HU9A 1HNCA 5IMVA 5D8IA 4V2NA 4N0ZA 1AW9A 2H1LA 3VPQA 2B5EA 4X4JA 2Z9SA 2VCVA 4GDFA 3F4SA 1K0CA 1O8XA 3PGTA 4ZB8A 5HR2A 1TOFA 2VKZG 1X9MB 1X5CA 5GAND 1XWAA 3IHQA 4L0WA 3GH6A 1NHOA 1PL2A 3RPPA 3APQA 4L8EA 3LORA 4ZXGA 5AISA 5ECRB 5ID2A 3DWVA 1WIKA 3GKKA 4ZBBA 3TRQA 1XXUA 5GSSA 2OJLA 2DJJA 4GF0A 4PTSA 3IK9A 1ZYQB 6GSYA 1J0FA 2JL4A 3DD3A 5JCGA 4TKYA 5D9WA 1U3IA 3VI5A 3GV1A 3HHVA 2VOCA 3F6FA 3M9KA 2PGTA 4HQZA 2PUKC 5ECMB 1YZXA 2FWGA 3DMLA 3TJFA 1YQ1A 11GSA 3C1RA 5ENUA 2D2ZA 5G2ZA 3IK7A 4TXOA 4RI7A 2R0GA 1HQOA 4MLYA 4EDZA 3UL3A 4KGIA 3LJRA 3EYTA 3WYWA 1YY7A 2JACA 1EV4A 1ZOFA 1SD9A 3E9JB 1XWKA 3Q6OA 3FR9A 4GSTA 2CZ3A 1F3AA 3FKFA 4F2IA 4V1Ag 5A34A 1HNBA 2C8UA 1JLWA 3G7YA 3IC4A 3F6DA 1QK8A 1SVOA 4HZ4A 4K0GA 2GT6A 1TU8A 3DEXA 5ABRA 3TKQA 3VPTA 2RM6A 4CHSA 1ST9A 2VCTA 5KN0A 3EURA 1YDKA 2V32A 4WEYA 1SD8A 3O3TA 1AQVA 4KX4A 3KZQA 3ZTLA 4YKGA 2VCWA 3VLNA 4EC0A 3RAZA 2WB9A 5DJMA 3F8UA 4LLRA 5EVOA 5EY6A 3CSHA 3L9VA 1N25A 1I5GA 1PSQA 1W89A 3ZRDA 4XRDA 4HZ2A 4L0UA 2WZ9A 4E68A 1TK0B 2EFCA 2FA8A 5ID2B 1M2BA 2A2PA 2R37A 4QL9A 5A4WA 4AKHA 2R0PA 1BAYA 3IA1A 5DCHA 4G2EA 5J9CA 5JWQB 2GZPA 4MF6A 3KXOA 1ZL9A 1TJDA 2CVKA 3UVHA 3W6GA 5INYA 3M9JA 3GSTA 2L4QA 2YJ7A 3ISOA 3GKMA 3E0UA 1K0BA 1GP1A 1B48A 1FB6A 3M8NA 2WS2A 4ACSA 4F0CA 5ECKB 3V1WA 2UV8G 2I9HA 1Z3EA 2L5OA 1UN2A 1TI1A 4TXOB 4IHUA 1X5DA 2FGXA 5BRTA 2JZRA 3ME8A 4YKFA 2HRAA 1KNGA 4GSNA 3M0FA 4TR0A 1KBNA 1A2LA 1GUHA 2HRFA 1M7TA 1WWJA 2EC4A 3GL5A 4MJBA 5KEJA 3HVXA 2TIRA 4ECIA 1U6TA 2UZ8A 2AB6A 1YF0A 4I2TA 4POKA 3RBTA 2HQTA 12GSA 1ERTA 2CV4A 2GS3A 3LG6A 1X9WB 2L6DA 1EOHA 5J4VA 4KDYA 1AIUA 5E59A 5ECLB 4ZILA 3HZ8A 2XC2A 7GSSA 2C0GA 1QMVA 4HEA2 5CYYA 5FHIA 2BTOT 3EU4A 5F05A 2H6XA 2AAWA 2VL3A 5JWRB 2C3NA 1T8EB 2RIIA 5EPFA 1JHBA 2OBKA 2H76A 4RI6A 2PBJA 5B8BA 4EIQA 4WF5A 1ZMAA 20GSA 2VUPA 4I2UA 3KTBA 1QFNA 4OMVA 1SKWB 4IJIA 3L0HA 2JADA 1EV9A 1G7OA 1DSBA 1GULA 1J08A 1ERWA 3EE2A 2PVOC 3O76A 1LJRA 1JZRA 1G6YA 1XVWA 4GRFA 1O8WA 2FCHA 1G0TA 2CAIA 2EFHA 3EPTA 3QR6A 4PX1A 4ZIJA 3WGEA 2KHPA 2FY6A 4EUYA 1TK8B 4AGSA 3G7IA 2EFEA 3VWWA 3IXRA 4QQ7A 2ON5A 2K9FA 2DKIA 3N9JA 4KE3A 1MDIA 3FK8A 2KLXA 2M46A 2FD3A 4I8BA 2F8FA 4N11A 1VF1A 1TRWA 1TW9A 4RQRA 1B4PA 3H93A 5A4VA 2R5GA 2X8CA 4HS1A 5DQSA 5KOWA 3Q18A 3F3QA 3C71A 1G6WA 2HE3A 3IDVA 1PD21 4NHZA 2VCQA 4GWRA 1XOAA 1OC9A 14GSA 1FVKA 2JSYA 2OE0A 4IS0A 2B7JA 4Q5RA 4GSSA 4MPFA 19GSA 1QQ2A 2LEGA 4AKIA 2K6VA 1TTZA 1O7UA 4K7NA 1SJIA 3L78A 1K3OA 2K18A 2VL2C 1DE1A 4FYCA 3FEUA 1TU7A 1Z6MA 4NV5A 3DKSA 1BQ7A 5ECHB 4K2XA 5IIZA 3CBUA 2VM1A 3WT1A 5A5HB 4TR1B 2H8LA 2YWMA 4ZL8A 4JBBA 1YKCA 1MD3A 3QAGA 4O5RA 1PMTA 1N8JA 4PUAA 4G0IA 5ECNB 4XS4A 5FT3A 4BVYB 2YP6A 2IN3A 2PU9C 2QA1A 2DKHA 2LQQA 3ZMLA 4HI7A 1VRSD 2LNTA 4N0VA 3TJJA 2M72A 1LU4A 4ID0A 2AV4A 1SL2B 1BX9A 3D4TA 4XCSA 1Z7PA 2DJ3A 3EMXA 5G5EA 4NMUA 1WJKA 4JRRA 3FZ9A 5D96A 1FW1A 2H01A 3GTUA 3TKSA 5A4UA 2G0FA 2KP2A 1A8LA 5B7CA 4DSRA 1TRUA 3NZNA 2H1DA 2MMOA 2B5YA 2HT9A 4JEDA 9GSSA 1TI3A 4KCEA 2O85A 2GZYA 3BBYA 1LBKA 3LGCA 2REMA 2V6OA 1YJ6A 2H1AA 4WKWA 2HXKA 3UIWA 5DCGA 2EIQA 2C4JA 1PN0A 1ZYPA 1FO5A 1OC9B 5D9TA 1V98A 1WP0A 4CW9A 2KOKA 2XHFA 4KNDA 3GUSA 5L71A 3BOAA 4KDUA 2M80A 3TJBA 3GSSA 1RK4A 2FWEA 2GT5A 3HYPA 2MMZA 4E8EA 2QC7A 3KP8A 1F37A 4FYUA 2EIOA 3MIXA 2H72A 5HFIA 5GAPD 3HDCA 4DEJA 4Z2RA 5HFGA 1YEXA 2MBSA 2FUG2 4PGTA 3HVSA 1Z9HA 3LYKA 4XRAA 4NPBA 5D93A 2O5VA 1TXXA 3QPMA 1MDKA 2HSMA 6GSTA 2H70A 5DALA 3DRNA 3IBHA 5FWGA 2PVQA 2P5QA 4NV2A 1OC8A 5F06A 4WETA 4XTSA 1S3AA 2ZUPA 1EOGA 3HJOA 3GFKA 4ISDA 3DIEA 2KUCA 4CDOA 3LW9A 1F3BA 3CRTA 1ERVA 4XS4B 1FOHA 4LMVA 2J23A 5G31A 3CSIA 22GSA 2L6CA 3APOA 4OFTA 3H8QA 4AJ8A 2H6YA 4HJ2A 1X0RA 5IMCA 1AQXA 1R5AA 2YV9A 3VI7A 3KCMA 4ZB7A 2VLVA 1Y25A 2O87A 3RDWA 2VO4A 4F03A 4O5UA 4WR4A 4KB3A 2YNXA 2MYGA 2N5AA 5COHA 4WBRD 3MAKA 3A2VA 4FH8A 1BEDA 4TVEA 2C0FA 3APSA 5C04A 2XPDA 2C80A 4K1FA 2IIYA 4MK3A 4W66A 2RUEA 2C0EA 2R2JA 2L57A 2P0GA 4V1Ap 4BL7A 3CSJA 4YH2A 3KGKA 2LTKA 4NXIA 1XWGA 1AUCA 5J4UA 3FMWA 3JCML 2HFDA 1GSYA 3HMJG 1GSDA 4TOPA 1GWCA 2DSAA 3VWVA 5GZZB 1K0DA 5BMUA 5LCZA 4YAPA 2FLSA 4PQHA 2P31A 1O81A 2LRTA 1TDIA 1QUWA 4DSQA 3RHCA 4OFMA 3D0ZA 2H1GA 1PN9A 1FG4A 4BWQA 3GRXA 6GSXA 4YQVA 5IO2A 1BG1A 4ECJA 5H5RA 3LFLA 1OE8A 2EIRA 5J9BA 3QAVA 1T3BA 3GA4A 3U5RE 1EWXA 4MA9A 4XHMA 2IMKA 3MWHA 1G7EA 2OT3A 4MABA 4K7IA 5A1NA 3F0IA 3FZAA 3W8SA 2V41A 1GTAA 1M2DA 3LYPA 4FO5A 2MZCA 1SL0B 1GSEA 4G0KA 2GSQA 3HXSA 3H79A 4JE1A 1XCCA 2H75A 3CWGA 2VIMA 2C3TA 4MH2A 4LL1B 2VCXA 2O8VB 5ECOB 4TXVA 1MEKA 4HU7A 2RM5A 2EFDA 5E4WA 2VL2A 1N2AA 2LS5A 1SYXA 2DC5A 3QD9A 2HSHA 4IKHA 3EU3A 2GSSA 4BL7B 4K2DA 4I5QA 3C7MA 4YQUA 3LWAA 1XW5A 3US3A 1XIYA 2H0IA 2E7PA 3C1SA 5KN3A 4G0LA 3ZFBA 3O6TA 3GL3A 3NOFA 1M0UA 2CZ2A 2L5LA 3FZ5A 2AJQB 2GVPA 3PR8A 1GTIA 3S9FA 5BMUB 2R6KA 1K0OA 3SWLA 3IR4A 4G01A 2AYTA 5G1LA 4HDEA 3CTFA 3ZREA 3TCOA 3FW2A 4F9ZA 5IO0A 4WXTA 2K8SA 4J2FA 2CAQA 4MP4A 4K0NA 1I9DA 1SK2A 4MMMA 1ZCPA 2IPAA 1Z7RA 2L59A 2IMDA 2FWFA 2B3SA 4AKXB 5A34B 2LRNA 3TOUA 2A2SA 3ZLPA 2HRKA 5AN1A 5A1NB 3VWXA 1O6JA 5B6NA 5JCWA 3HZ4A 1ZGNA 5ELAA 1A24A 2B1LA 1K3YA 1UVZA 5IM9A 4MNNA 1KTEA 4X0XA 4IBPA 1BF5A 1THXA 3ZITA 1M9BA 3I9V2 1TKDB 4ECCA 5LNKe 3CMIA 4IELA 1GLPA 2DBCA 2H0GA 3D4MA 3DYRA 1WRYA 1O85A 4AJ7A 4X1UA 4PQIA 1T1VA 2GGTA 1ILOA 3A3TA 2NTOA 5J4YA 4MPGA 5F8BA 3GIXA 1A23A 1SK0A 1SU9A 3L4NA 3QFAC 1R4WA 2H1BA 1RW1A 2YANA 1SKSB 4MH3A 1ON4A 1V2AA 2WDUA 2HZEA 1DUGA 3FY7A 1IYHA 1T4ZA 3ZZXA 2AHEA 4MJCA 3KP9A 3KIJA 4BVXA 3DVXA 4MJEA 1OVNA 2HLSA 4OO4A 2YN1A 3P8WA 5ELGA 1F6MC 5CRWA 1THOA 3TJGA 4IJ3A 3ERGA 3CYNA 3IPZA 3ME7A 1GRXA 4KSOA 5HR3A 5IOXA 3HA9A 4LA1A 2H66A 3VFIA 2YCDA 3A2XA 2F3MA 1GNWA 1BG5A 4GLTA 2RLIA 3TDGA 1ML6A 1Z6NA 2N5BA 5F0GA 4GXZA 3L9UA 2PWJA 4O5QA 3UBKA 2QGVA 3IHGA 4TW5A 5ECIB 2IFQA 3G9BA 5ECPB 5F07A 4KH7A 4EE0A 4EIPA 2HRKB 1X9SB 5D73A 2H0HA 3LQ7A 2AUVA 2GSRA 3UVTA 2X99A 4MZWA 2LQOA 1BJXA 4I97A 1NSWA 3E3EA 4JZQA 1B9YC 2YJHA 4O7HA 1XBSA 2IJYA 2LJKA 3IAS2 2HSNA 1B8XA 2CT6A 3QOUA 3J7Yk 5J47A 3ZVJA 3I43A 1SVLA 4EL1A 1XOBA 2IMIA 2DLXA 4N10A 4GTUA 1VF3A 5JCUA 1K0AA 1GSSA 3RPNA 2L4CA 3TKSE 2B5XA 4IW9A 3C8EA 2V6KA 2I4AA 3P7XA 2WFCA 2WGRA 4NHWA 2DIZA 4Q5QA 5CNWA 2MMNA 4TN8A 3HCZA 4POLA 2VLUA 4KW6A 3OR5A 5IMZA 2HZEB 3KMNA 2NDOA 1EGOA 4MF5A 2YV7A 4ICYA 4BVXB 4USSA 4OD7A 1SK1A 4J56E 2VLTA 1WMJA 2OACA 1A2MA 3ZIJA 3PPUA 3BD2A 5G5FA 1EP7A 3QAWA 5ECQB 5IMAA 4QMKA 3UOMA 3LEFA 3ZIVA 1ACVA 5KN1A 4Q5NA 3MNGA 3GN3A 4EXJA 4XS6A 2XBIA 5G1KA 2IFQB 4J57E 2GLRA 1SYRA 2J9HA 4KCAA 4LMWA 1V57A 3UJ1A 4D73A 3N5OA 4IGJA 5IOWA 3TOTA 4RUVA 4IQAA 1FVJA 2RUFA 1OKDA 3D6IA 2H71A 4WR5A 4AI6A 3W8JA 4MDCA 2HI7A 4K5SA 1XW9A 4POBA 1UC7A 1C72A 2HSNB 1OYJA 1EEJA 1GUMA 1PRXA 2X49A 1QGVA 1J9BA 2DJ0A 4LL4B 3HKRA 1A0RP 1DBYA 4CY6A 1XWCA 5H5QA 1SENA 4XS1A 4OCEA 2A4HA 5H5SA 1B4QA 2I3YA 2DMLA 2VD1A 5HQPA 5AIVA 2H30A 1V58A 2B7KA 1GNEA 3P90A 5DJLA 1XW6A 3PINA 5DAKA 4JR6A 4ZBDA 2IWTA 2WCIA 1FHEA 2HRNA 1E2YA 3H4KA 4PNGA 2HSYA 1T4YA 3FZ4A 1R7HA 2YWNA 3GX8A 2KP1A 5IPGA 2R3XA 5B6MA 2FNOA 3D21A 4IP6A 2A2RA 2C1YA 3EWLA 3EMPA 3FR3A 2WULA 17GSA 3GTUB 5HFKA 1HD2A 1K0MA 3HJMA 1O73A 3Q74A 2X64A 3WT2A 4A5PA 3GKNA 2P5RA 4D73B 1OAZA 1AXDA 5DQYA 3F3RA 4ML1A 1U87A 4G9HA 4EO3A 3ZMKA 4KUNA 2CA8A 3DXBA 3GURA 2O7KA 3DVWA 4XIHA 1Y1UA 1E6BA 2R4VA 1JZOA 3BCIA 2WRTA 1YF1A 1AC1A 1BYEA 1PKZA 3HY2A 1Z5YE 4HOJA 3D5JA 3EC3A 3GH9A 4ZBAA 2GQKA 3TRXA 2DJ1A 4OO5A 3QMXA 4O92A 2CVDA 5KOXA 4G10A 1TRSA 2VAFA 5G30A 1A2JA 4OCFA 2F9SA 5D9XA 1SL1B 4GCIA 4PUFC 2HSMB 1PX6A 2TRXA 5DALB 2FWHA 2C0DA 10GSA 4F82A 4ML6A 1EP8A 3TUEA 2LSTA 1F9MA 4EDYA 5DAKB 5CREA 3I69A 1PKWA 1XFLA 4FQUA 3ZL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YWI A;  4DSS A;  3I6A A;  4FIW A;  3LXT A;  4K9Z A;  3TKP A;  3ZVJ D;  16GS A;  1FOV A;  1VF4 A;  2V1M A;  2YPM A;  4O32 A;  1JFU A;  3MSZ A;  2GQL A;  3DGQ A;  2GDR A;  2H19 A;  5IMD A;  1M2A A;  4H86 A;  5IQY A;  4KDX A;  2VL9 A;  5B8A A;  3G7J A;  5CRH A;  3R2Q A;  3ERF A;  3LXZ A;  4PQ1 A;  4NAX A;  4IP1 A;  2ON7 A;  4IQ1 A;  2X8H A;  4KAE A;  1DE2 A;  4ECB A;  2TRC P;  3TKS C;  3F9U A;  3IAM 2;  4FYB A;  2DIY A;  5JWO B;  5LD0 A;  3FYG A;  1JZW A;  4ULX A;  3HJP A;  3F4T A;  4JU5 A;  2B1K A;  4V2M A;  3TRP A;  1PX7 A;  3TGZ A;  1M99 A;  4RQX A;  1AQW A;  1NW2 A;  2B6M A;  4L5O A;  2XPE A;  5CRG A;  3PH9 A;  5HR0 A;  4ZL7 A;  2IL3 A;  2GQM A;  3A5W A;  6GSS A;  5KN2 A;  3ZYW A;  1AAZ A;  3FRC A;  2YZH A;  3D22 A;  1T00 A;  3H1N A;  1GSQ A;  3ED3 A;  4DVC A;  1NM3 A;  4BPY A;  1TK5 B;  1VGL A;  2XBQ A;  3MDK A;  1T7P B;  3UAP A;  4K6X A;  2ALB A;  5AGY A;  2LJR A;  1SJ6 A;  1PGT A;  3KH7 A;  1GTB A;  1H4O A;  5EL8 A;  1PQN A;  1Y6E A;  2N5F A;  5GST A;  1Q98 A;  3RHB A;  4DSS B;  2PER A;  3KTL A;  1SJZ A;  4MZC A;  3EVI A;  2LV3 A;  2LJA A;  1R26 A;  2ES7 A;  2JU5 A;  2E2M A;  8GSS A;  4KA0 A;  1WE0 A;  1S3D A;  2CX4 A;  2HNL A;  2YOI A;  2H73 A;  2LUS A;  3FHK A;  3QDN A;  1S3C A;  2BJX A;  2YZU A;  1HYU A;  1MDJ A;  3HVV A;  2CX3 A;  2OA7 A;  4JR4 A;  2JZT A;  1OC3 A;  3BJ5 A;  1A0F A;  2F8A A;  1V40 A;  6GSW A;  3GMF A;  2LRC A;  3CTG A;  1RQM A;  3FR6 A;  1TRV A;  2F51 A;  2CQ9 A;  1XPV A;  3Q19 A;  4IVF A;  4V2L A;  1WPI A;  13GS A;  3WGX A;  4BA7 A;  1USB A;  2OBI A;  5ECS A;  5HR1 A;  4TR1 A;  1MD4 A;  4EF0 A;  2JSZ A;  2MBT A;  4EKZ A;  2IME A;  4YQM A;  5CAX A;  3KH9 A;  3EIN A;  4ILF A;  1ERU A;  2QKE A;  4YAV A;  4WF4 A;  5J5N A;  2IMF A;  3R3E A;  3C73 A;  4MZB A;  4QL7 A;  3CRU A;  4BVY A;  5DBQ A;  2WJU A;  3UMA A;  4ZB6 A;  1GTU A;  1XWB A;  5CRD A;  3VUR A;  1X5E A;  1PA3 A;  3A2W A;  3TB2 A;  3KD0 A;  4ZL9 A;  4HJM A;  2H6Z A;  1ZZY A;  3IRA A;  1M9A A;  2VCZ A;  3ERW A;  3GHA A;  2ZNM A;  2LNS A;  2G2Q A;  2GZZ A;  1JLV A;  2PPT A;  4IN0 A;  6GSV A;  2NPB A;  2VM2 A;  4N30 A;  5CO3 A;  2OKA A;  3KJY A;  1CQH A;  2FA4 A;  1R5P A;  1HNA A;  2OE3 A;  3IE3 A;  5IMF A;  4POM A;  3L9S A;  2I81 A;  4WBJ A;  1GL8 A;  2YWO A;  2ZCT A;  5J3R A;  3TJK A;  1NHY A;  2JZS A;  3HD5 A;  2GTU A;  2OAD A;  3SBC A;  4G19 A;  4PUR A;  2C3Q A;  2OE1 A;  4BWS A;  3M1G A;  5DVB A;  5C00 A;  1A8Y A;  1FB0 A;  1EEM A;  3KEB A;  4ZB9 A;  4KSM A;  1GSU A;  1U3A A;  3UBL A;  4X43 A;  1ABA A;  1Q4J A;  3AY8 A;  6GSU A;  3GKX A;  2CVB A;  4MF7 A;  2NBS A;  2VD0 A;  3NIV A;  5J41 A;  3TKR A;  2I1U A;  4HUA A;  4NWY A;  1JZD A;  2PN8 A;  1OKT A;  2A4V A;  4PXO A;  3GYK A;  4K8M A;  5AIX A;  4OWY A;  3QCP A;  4F0B A;  4MJA A;  4MCU A;  2O89 A;  3KMO A;  3IOS A;  1F2E A;  2E2G A;  4AJ6 A;  2QSI A;  3BCK A;  2HYX A;  3WGD A;  1CQG A;  4TR4 A;  1GH2 A;  1QXH A;  3CXG A;  1EGR A;  1YEP A;  3KM6 A;  2GST A;  5IPH A;  4Q5F A;  1EZK A;  3K8N A;  4KF9 A;  1GSF A;  3GNJ A;  4PNF A;  4E8H A;  1XZO A;  3F63 A;  2DJ2 A;  1UA5 A;  1SKR B;  4OFN A;  2HZF A;  3VWU A;  4TRX A;  3J7Y b;  3P2A A;  1ZYE A;  4AF2 A;  2V2G A;  1TP9 A;  3F4R A;  1GUK A;  1YKA A;  2K8V A;  3GX0 A;  2NVL A;  5A5K A;  4K7O A;  1K3L A;  4I6X A;  1XVQ A;  18GS A;  2LKU A;  4Z7X A;  1VF2 A;  5D9V A;  2H74 A;  1OE7 A;  2BMX A;  3IV4 A;  1URM A;  2DMM A;  3VK9 A;  4TR3 A;  3UEM A;  4EVM A;  1KEB A;  4P3Y B;  1FAA A;  1GLQ A;  1V9W A;  2MMA A;  3IC8 A;  1K0N A;  3QFB C;  5CP1 A;  1WOU A;  2E0Q A;  3ZFL A;  3WD6 A;  2X8G A;  4L5L A;  1W4V A;  4GQC A;  3U6V A;  1IYI A;  2DJK A;  4GQF A;  1H75 A;  2FHE A;  1MTC A;  3LSZ A;  3UAR A;  4HQS A;  1B9X C;  1U88 A;  2PMT A;  3M3M A;  5DDL A;  1PL1 A;  4HU9 A;  1HNC A;  5IMV A;  5D8I A;  4V2N A;  4N0Z A;  1AW9 A;  3VPQ A;  2B5E A;  2Z9S A;  2VCV A;  3F4S A;  1K0C A;  1O8X A;  3PGT A;  4ZB8 A;  5HR2 A;  1TOF A;  1X9M B;  1X5C A;  5GAN D;  1XWA A;  3IHQ A;  4L0W A;  3GH6 A;  1NHO A;  1PL2 A;  3RPP A;  3APQ A;  4L8E A;  3LOR A;  4ZXG A;  5AIS A;  5ECR B;  5ID2 A;  3DWV A;  1WIK A;  3GKK A;  4ZBB A;  3TRQ A;  1XXU A;  5GSS A;  2OJL A;  2DJJ A;  4GF0 A;  4PTS A;  3IK9 A;  1ZYQ B;  6GSY A;  1J0F A;  2JL4 A;  3DD3 A;  5JCG A;  4TKY A;  5D9W A;  1U3I A;  3VI5 A;  3GV1 A;  3HHV A;  2VOC A;  3F6F A;  3M9K A;  2PGT A;  4HQZ A;  2PUK C;  5ECM B;  1YZX A;  2FWG A;  3DML A;  3TJF A;  1YQ1 A;  11GS A;  3C1R A;  5ENU A;  2D2Z A;  5G2Z A;  3IK7 A;  4TXO A;  4RI7 A;  1HQO A;  4MLY A;  4EDZ A;  3UL3 A;  4KGI A;  3LJR A;  3EYT A;  3WYW A;  1YY7 A;  2JAC A;  1EV4 A;  1ZOF A;  1SD9 A;  3E9J B;  1XWK A;  3Q6O A;  3FR9 A;  4GST A;  2CZ3 A;  1F3A A;  3FKF A;  4F2I A;  4V1A g;  1HNB A;  2C8U A;  1JLW A;  3G7Y A;  3IC4 A;  3F6D A;  1QK8 A;  4HZ4 A;  4K0G A;  2GT6 A;  1TU8 A;  3DEX A;  5ABR A;  3TKQ A;  3VPT A;  2RM6 A;  4CHS A;  1ST9 A;  2VCT A;  5KN0 A;  3EUR A;  1YDK A;  2V32 A;  4WEY A;  1SD8 A;  3O3T A;  1AQV A;  4KX4 A;  3KZQ A;  3ZTL A;  2VCW A;  3VLN A;  4EC0 A;  3RAZ A;  2WB9 A;  5DJM A;  3F8U A;  4LLR A;  5EVO A;  5EY6 A;  3CSH A;  3L9V A;  1I5G A;  1PSQ A;  1W89 A;  3ZRD A;  4XRD A;  4HZ2 A;  4L0U A;  2WZ9 A;  1TK0 B;  2FA8 A;  5ID2 B;  1M2B A;  2R37 A;  4QL9 A;  5A4W A;  1BAY A;  3IA1 A;  5DCH A;  4G2E A;  5J9C A;  5JWQ B;  2GZP A;  4MF6 A;  3KXO A;  1ZL9 A;  1TJD A;  2CVK A;  3UVH A;  3W6G A;  5INY A;  3M9J A;  3GST A;  2L4Q A;  2YJ7 A;  3ISO A;  3GKM A;  3E0U A;  1K0B A;  1GP1 A;  1B48 A;  1FB6 A;  3M8N A;  2WS2 A;  4ACS A;  4F0C A;  5ECK B;  3V1W A;  2I9H A;  1Z3E A;  2L5O A;  1UN2 A;  1TI1 A;  4TXO B;  4IHU A;  1X5D A;  2FGX A;  2JZR A;  3ME8 A;  2HRA A;  1KNG A;  4GSN A;  3M0F A;  4TR0 A;  1KBN A;  1A2L A;  1GUH A;  2HRF A;  1M7T A;  1WWJ A;  2EC4 A;  3GL5 A;  4MJB A;  5KEJ A;  3HVX A;  2TIR A;  4ECI A;  1U6T A;  2UZ8 A;  2AB6 A;  1YF0 A;  4I2T A;  4POK A;  3RBT A;  2HQT A;  12GS A;  1ERT A;  2CV4 A;  2GS3 A;  3LG6 A;  1X9W B;  2L6D A;  1EOH A;  4KDY A;  1AIU A;  5E59 A;  5ECL B;  4ZIL A;  3HZ8 A;  2XC2 A;  7GSS A;  2C0G A;  1QMV A;  4HEA 2;  5CYY A;  5FHI A;  2BTO T;  3EU4 A;  5F05 A;  2H6X A;  2AAW A;  2VL3 A;  5JWR B;  2C3N A;  1T8E B;  2RII A;  5EPF A;  1JHB A;  2OBK A;  2H76 A;  4RI6 A;  2PBJ A;  5B8B A;  4WF5 A;  1ZMA A;  20GS A;  2VUP A;  4I2U A;  3KTB A;  1QFN A;  4OMV A;  1SKW B;  4IJI A;  3L0H A;  2JAD A;  1EV9 A;  1G7O A;  1DSB A;  1GUL A;  1J08 A;  1ERW A;  3EE2 A;  2PVO C;  3O76 A;  1LJR A;  1JZR A;  1G6Y A;  1XVW A;  4GRF A;  1O8W A;  2FCH A;  1G0T A;  2CAI A;  3QR6 A;  4PX1 A;  4ZIJ A;  3WGE A;  2KHP A;  2FY6 A;  4EUY A;  1TK8 B;  4AGS A;  3G7I A;  3VWW A;  3IXR A;  4QQ7 A;  2ON5 A;  2K9F A;  3N9J A;  4KE3 A;  1MDI A;  3FK8 A;  2KLX A;  2M46 A;  2FD3 A;  4I8B A;  2F8F A;  4N11 A;  1VF1 A;  1TRW A;  1TW9 A;  4RQR A;  1B4P A;  3H93 A;  5A4V A;  2R5G A;  2X8C A;  4HS1 A;  5DQS A;  3Q18 A;  3F3Q A;  3C71 A;  1G6W A;  2HE3 A;  3IDV A;  1PD2 1;  4NHZ A;  2VCQ A;  4GWR A;  1XOA A;  1OC9 A;  14GS A;  1FVK A;  2JSY A;  2OE0 A;  4IS0 A;  2B7J A;  4Q5R A;  4GSS A;  4MPF A;  19GS A;  1QQ2 A;  2LEG A;  2K6V A;  1TTZ A;  1O7U A;  4K7N A;  1SJI A;  3L78 A;  1K3O A;  2K18 A;  2VL2 C;  1DE1 A;  4FYC A;  3FEU A;  1TU7 A;  1Z6M A;  4NV5 A;  3DKS A;  1BQ7 A;  5ECH B;  5IIZ A;  3CBU A;  2VM1 A;  3WT1 A;  4TR1 B;  2H8L A;  2YWM A;  4ZL8 A;  4JBB A;  1YKC A;  1MD3 A;  3QAG A;  4O5R A;  1PMT A;  1N8J A;  4PUA A;  4G0I A;  5ECN B;  4XS4 A;  5FT3 A;  4BVY B;  2YP6 A;  2IN3 A;  2PU9 C;  2LQQ A;  3ZML A;  4HI7 A;  1VRS D;  2LNT A;  4N0V A;  3TJJ A;  2M72 A;  1LU4 A;  4ID0 A;  2AV4 A;  1SL2 B;  1BX9 A;  3D4T A;  4XCS A;  1Z7P A;  2DJ3 A;  3EMX A;  5G5E A;  4NMU A;  1WJK A;  4JRR A;  3FZ9 A;  5D96 A;  1FW1 A;  2H01 A;  3GTU A;  3TKS A;  5A4U A;  2G0F A;  2KP2 A;  1A8L A;  5B7C A;  4DSR A;  1TRU A;  3NZN A;  2H1D A;  2MMO A;  2B5Y A;  2HT9 A;  4JED A;  9GSS A;  1TI3 A;  4KCE A;  2O85 A;  2GZY A;  3BBY A;  1LBK A;  3LGC A;  2REM A;  2V6O A;  1YJ6 A;  2H1A A;  4WKW A;  2HXK A;  3UIW A;  5DCG A;  2EIQ A;  2C4J A;  1FO5 A;  1OC9 B;  5D9T A;  1V98 A;  1WP0 A;  4CW9 A;  2KOK A;  2XHF A;  4KND A;  3GUS A;  5L71 A;  3BOA A;  4KDU A;  2M80 A;  3TJB A;  3GSS A;  1RK4 A;  2FWE A;  2GT5 A;  3HYP A;  2MMZ A;  4E8E A;  2QC7 A;  3KP8 A;  1F37 A;  4FYU A;  2EIO A;  2H72 A;  5HFI A;  5GAP D;  3HDC A;  4DEJ A;  5HFG A;  1YEX A;  2MBS A;  2FUG 2;  4PGT A;  3HVS A;  1Z9H A;  3LYK A;  4XRA A;  4NPB A;  5D93 A;  3QPM A;  1TXX A;  1MDK A;  2HSM A;  6GST A;  2H70 A;  5DAL A;  3DRN A;  3IBH A;  5FWG A;  2PVQ A;  2P5Q A;  4NV2 A;  1OC8 A;  5F06 A;  4WET A;  4XTS A;  1S3A A;  2ZUP A;  1EOG A;  3HJO A;  3GFK A;  4ISD A;  3DIE A;  2KUC A;  4CDO A;  1F3B A;  3CRT A;  1ERV A;  4XS4 B;  4LMV A;  2J23 A;  5G31 A;  3CSI A;  22GS A;  2L6C A;  3APO A;  4OFT A;  3H8Q A;  4AJ8 A;  2H6Y A;  4HJ2 A;  1X0R A;  5IMC A;  1AQX A;  1R5A A;  2YV9 A;  3VI7 A;  3KCM A;  2VLV A;  1Y25 A;  2O87 A;  3RDW A;  2VO4 A;  4F03 A;  4WR4 A;  4KB3 A;  2YNX A;  2MYG A;  2N5A A;  5COH A;  4WBR D;  3MAK A;  3A2V A;  4FH8 A;  1BED A;  4TVE A;  2C0F A;  3APS A;  5C04 A;  2XPD A;  2C80 A;  4K1F A;  2IIY A;  4MK3 A;  2RUE A;  2C0E A;  2R2J A;  2L57 A;  2P0G A;  4V1A p;  4BL7 A;  3CSJ A;  4YH2 A;  3KGK A;  2LTK A;  4NXI A;  1XWG A;  1AUC A;  5J4U A;  3JCM L;  2HFD A;  1GSY A;  1GSD A;  4TOP A;  1GWC A;  2DSA A;  3VWV A;  5GZZ B;  1K0D A;  5BMU A;  5LCZ A;  4YAP A;  2FLS A;  4PQH A;  2P31 A;  1O81 A;  2LRT A;  1TDI A;  1QUW A;  4DSQ A;  3RHC A;  4OFM A;  3D0Z A;  2H1G A;  1PN9 A;  1FG4 A;  4BWQ A;  3GRX A;  6GSX A;  4YQV A;  5IO2 A;  4ECJ A;  5H5R A;  3LFL A;  1OE8 A;  2EIR A;  5J9B A;  3QAV A;  1T3B A;  3GA4 A;  3U5R E;  1EWX A;  4MA9 A;  4XHM A;  2IMK A;  3MWH A;  1G7E A;  4MAB A;  4K7I A;  3F0I A;  3FZA A;  3W8S A;  2V41 A;  1GTA A;  1M2D A;  3LYP A;  4FO5 A;  2MZC A;  1SL0 B;  1GSE A;  4G0K A;  2GSQ A;  3HXS A;  3H79 A;  4JE1 A;  1XCC A;  2H75 A;  2VIM A;  2C3T A;  4MH2 A;  4LL1 B;  2VCX A;  2O8V B;  5ECO B;  4TXV A;  1MEK A;  4HU7 A;  2RM5 A;  5E4W A;  2VL2 A;  1N2A A;  2LS5 A;  1SYX A;  2DC5 A;  3QD9 A;  2HSH A;  4IKH A;  3EU3 A;  2GSS A;  4BL7 B;  4K2D A;  4I5Q A;  3C7M A;  4YQU A;  3LWA A;  1XW5 A;  3US3 A;  1XIY A;  2H0I A;  2E7P A;  3C1S A;  5KN3 A;  4G0L A;  3ZFB A;  3O6T A;  3GL3 A;  3NOF A;  1M0U A;  2CZ2 A;  2L5L A;  3FZ5 A;  2AJQ B;  2GVP A;  3PR8 A;  1GTI A;  3S9F A;  2R6K A;  1K0O A;  3SWL A;  3IR4 A;  2AYT A;  5G1L A;  4HDE A;  3CTF A;  3ZRE A;  3TCO A;  3FW2 A;  4F9Z A;  5IO0 A;  4WXT A;  2K8S A;  4J2F A;  2CAQ A;  4MP4 A;  4K0N A;  1I9D A;  1SK2 A;  4MMM A;  1ZCP A;  2IPA A;  1Z7R A;  2L59 A;  2IMD A;  2FWF A;  2B3S A;  2LRN A;  3TOU A;  2A2S A;  3ZLP A;  2HRK A;  5AN1 A;  3VWX A;  1O6J A;  5B6N A;  5JCW A;  3HZ4 A;  1ZGN A;  5ELA A;  1A24 A;  2B1L A;  1K3Y A;  1UVZ A;  5IM9 A;  1KTE A;  4X0X A;  4IBP A;  3ZIT A;  1THX A;  1M9B A;  3I9V 2;  1TKD B;  4ECC A;  5LNK e;  3CMI A;  4IEL A;  1GLP A;  2DBC A;  2H0G A;  3D4M A;  3DYR A;  1WRY A;  1O85 A;  4AJ7 A;  4X1U A;  4PQI A;  1T1V A;  2GGT A;  1ILO A;  3A3T A;  2NTO A;  4MPG A;  5F8B A;  3GIX A;  1A23 A;  1SK0 A;  1SU9 A;  3L4N A;  3QFA C;  1R4W A;  2H1B A;  1RW1 A;  2YAN A;  1SKS B;  4MH3 A;  1ON4 A;  1V2A A;  2WDU A;  2HZE A;  1DUG A;  3FY7 A;  1IYH A;  1T4Z A;  3ZZX A;  2AHE A;  4MJC A;  3KP9 A;  3KIJ A;  4BVX A;  3DVX A;  4MJE A;  1OVN A;  2HLS A;  4OO4 A;  2YN1 A;  3P8W A;  5ELG A;  1F6M C;  5CRW A;  1THO A;  3TJG A;  4IJ3 A;  3ERG A;  3CYN A;  3IPZ A;  3ME7 A;  1GRX A;  4KSO A;  5HR3 A;  5IOX A;  3HA9 A;  4LA1 A;  2H66 A;  3VFI A;  2YCD A;  3A2X A;  2F3M A;  1GNW A;  1BG5 A;  4GLT A;  2RLI A;  3TDG A;  1ML6 A;  1Z6N A;  2N5B A;  5F0G A;  4GXZ A;  3L9U A;  2PWJ A;  3UBK A;  2QGV A;  4TW5 A;  5ECI B;  2IFQ A;  3G9B A;  5ECP B;  5F07 A;  4KH7 A;  4EE0 A;  2HRK B;  1X9S B;  5D73 A;  2H0H A;  3LQ7 A;  2AUV A;  2GSR A;  3UVT A;  2X99 A;  4MZW A;  2LQO A;  1BJX A;  4I97 A;  1NSW A;  3E3E A;  4JZQ A;  1B9Y C;  2YJH A;  4O7H A;  1XBS A;  2IJY A;  2LJK A;  3IAS 2;  1B8X A;  2CT6 A;  3QOU A;  3J7Y k;  3ZVJ A;  3I43 A;  4EL1 A;  1XOB A;  2IMI A;  2DLX A;  4N10 A;  4GTU A;  1VF3 A;  5JCU A;  1K0A A;  1GSS A;  3RPN A;  2L4C A;  3TKS E;  2B5X A;  4IW9 A;  3C8E A;  2V6K A;  2I4A A;  3P7X A;  2WFC A;  2WGR A;  4NHW A;  2DIZ A;  4Q5Q A;  5CNW A;  2MMN A;  4TN8 A;  3HCZ A;  4POL A;  2VLU A;  4KW6 A;  3OR5 A;  5IMZ A;  2HZE B;  3KMN A;  2NDO A;  1EGO A;  4MF5 A;  2YV7 A;  4BVX B;  4USS A;  4OD7 A;  1SK1 A;  4J56 E;  2VLT A;  1WMJ A;  2OAC A;  1A2M A;  3ZIJ A;  3PPU A;  3BD2 A;  5G5F A;  1EP7 A;  3QAW A;  5ECQ B;  5IMA A;  3UOM A;  3LEF A;  3ZIV A;  1ACV A;  5KN1 A;  4Q5N A;  3MNG A;  3GN3 A;  4EXJ A;  4XS6 A;  2XBI A;  5G1K A;  2IFQ B;  4J57 E;  2GLR A;  1SYR A;  2J9H A;  4KCA A;  4LMW A;  1V57 A;  3UJ1 A;  4D73 A;  3N5O A;  4IGJ A;  5IOW A;  3TOT A;  4RUV A;  4IQA A;  1FVJ A;  2RUF A;  1OKD A;  3D6I A;  2H71 A;  4WR5 A;  3W8J A;  4MDC A;  2HI7 A;  1XW9 A;  4POB A;  1UC7 A;  1C72 A;  2HSN B;  1OYJ A;  1EEJ A;  1GUM A;  1PRX A;  1QGV A;  1J9B A;  2DJ0 A;  4LL4 B;  3HKR A;  1A0R P;  1DBY A;  1XWC A;  5H5Q A;  1SEN A;  4XS1 A;  4OCE A;  5H5S A;  1B4Q A;  2I3Y A;  2DML A;  2VD1 A;  5HQP A;  5AIV A;  2H30 A;  1V58 A;  2B7K A;  1GNE A;  3P90 A;  5DJL A;  1XW6 A;  3PIN A;  5DAK A;  4JR6 A;  4ZBD A;  2IWT A;  2WCI A;  1FHE A;  2HRN A;  1E2Y A;  3H4K A;  4PNG A;  2HSY A;  1T4Y A;  3FZ4 A;  1R7H A;  2YWN A;  3GX8 A;  2KP1 A;  5IPG A;  2R3X A;  5B6M A;  2FNO A;  3D21 A;  4IP6 A;  2A2R A;  2C1Y A;  3EWL A;  3EMP A;  3FR3 A;  2WUL A;  17GS A;  3GTU B;  5HFK A;  1HD2 A;  1K0M A;  3HJM A;  1O73 A;  3Q74 A;  2X64 A;  3WT2 A;  3GKN A;  2P5R A;  4D73 B;  1OAZ A;  1AXD A;  5DQY A;  3F3R A;  4ML1 A;  1U87 A;  4G9H A;  4EO3 A;  3ZMK A;  4KUN A;  2CA8 A;  3DXB A;  3GUR A;  2O7K A;  3DVW A;  4XIH A;  1E6B A;  2R4V A;  1JZO A;  3BCI A;  2WRT A;  1YF1 A;  1AC1 A;  1BYE A;  1PKZ A;  3HY2 A;  1Z5Y E;  4HOJ A;  3D5J A;  3EC3 A;  3GH9 A;  4ZBA A;  2GQK A;  3TRX A;  2DJ1 A;  4OO5 A;  3QMX A;  4O92 A;  2CVD A;  4G10 A;  1TRS A;  2VAF A;  5G30 A;  1A2J A;  4OCF A;  2F9S A;  5D9X A;  1SL1 B;  4GCI A;  4PUF C;  2HSM B;  1PX6 A;  2TRX A;  5DAL B;  2FWH A;  2C0D A;  10GS A;  4F82 A;  4ML6 A;  1EP8 A;  3TUE A;  2LST A;  1F9M A;  4EDY A;  5DAK B;  5CRE A;  3I69 A;  1PKW A;  1XFL A;  4FQU A;  3ZL5 A; 
#chains in the Genus database with same CATH topology
 2YWI A;  4DSS A;  3I6A A;  4FIW A;  3LXT A;  4K9Z A;  1SVM A;  3TKP A;  3ZVJ D;  16GS A;  1FOV A;  1VF4 A;  2V1M A;  2YPM A;  4O32 A;  1JFU A;  3MSZ A;  2GQL A;  3DGQ A;  2GDR A;  2H19 A;  5IMD A;  1M2A A;  4H86 A;  2R0C A;  5IQY A;  4KDX A;  2VL9 A;  5B8A A;  2WW0 A;  3G7J A;  5CRH A;  3R2Q A;  3ERF A;  1ZYN A;  3LXZ A;  4PQ1 A;  4NAX A;  4IP1 A;  2ON7 A;  4IQ1 A;  2X8H A;  4KAE A;  1DE2 A;  4ECB A;  2TRC P;  3TKS C;  3F9U A;  2X4A A;  3IAM 2;  4FYB A;  4CY8 A;  2DIY A;  5JWO B;  5LD0 A;  3FYG A;  1JZW A;  4ULX A;  3HJP A;  3F4T A;  4JU5 A;  2B1K A;  4V2M A;  3TRP A;  1PX7 A;  3TGZ A;  1M99 A;  4RQX A;  1AQW A;  1NW2 A;  2B6M A;  4L5O A;  2XPE A;  5CRG A;  3PH9 A;  5HR0 A;  4ZL7 A;  1YVL A;  2IL3 A;  2GQM A;  3A5W A;  6GSS A;  5KN2 A;  1PFO A;  3ZYW A;  1AAZ A;  3FRC A;  2YZH A;  3D22 A;  1T00 A;  3H1N A;  3TU3 B;  1GSQ A;  3ED3 A;  4DVC A;  1NM3 A;  4BPY A;  1TK5 B;  1VGL A;  2XBQ A;  3MDK A;  1T7P B;  3UAP A;  4K6X A;  2ALB A;  5AGY A;  2LJR A;  1SJ6 A;  1PGT A;  3KH7 A;  1GTB A;  1H4O A;  5EL8 A;  1PQN A;  1Y6E A;  2N5F A;  5GST A;  1Q98 A;  4K5R A;  3RHB A;  4DSS B;  2PER A;  3KTL A;  1SJZ A;  4MZC A;  3EVI A;  2LV3 A;  2LJA A;  1R26 A;  2ES7 A;  2JU5 A;  2E2M A;  8GSS A;  4KA0 A;  1WE0 A;  1S3D A;  2CX4 A;  2HNL A;  2YOI A;  2H73 A;  2LUS A;  3FHK A;  3QDN A;  1S3C A;  2BJX A;  2YZU A;  1HYU A;  1MDJ A;  3HVV A;  2CX3 A;  2OA7 A;  5J40 A;  4JR4 A;  2JZT A;  1OC3 A;  3BJ5 A;  1A0F A;  2F8A A;  1V40 A;  6GSW A;  3GMF A;  2LRC A;  3CTG A;  1RQM A;  3FR6 A;  1TRV A;  2F51 A;  2CQ9 A;  1XPV A;  3Q19 A;  4IVF A;  3A5I A;  4V2L A;  1WPI A;  13GS A;  3WGX A;  4BA7 A;  1USB A;  2OBI A;  5ECS A;  5HR1 A;  5A5H A;  4TR1 A;  1MD4 A;  4EF0 A;  2JSZ A;  2MBT A;  2QA2 A;  4EKZ A;  2IME A;  4YQM A;  5CAX A;  3KH9 A;  3EIN A;  4ILF A;  1ERU A;  2QKE A;  4YAV A;  4WF4 A;  5J5N A;  2IMF A;  3R3E A;  3C73 A;  4MZB A;  1TXU A;  4QL7 A;  3CRU A;  4BVY A;  5DBQ A;  2WJU A;  3UMA A;  4ZB6 A;  1GTU A;  1XWB A;  5CRD A;  3VUR A;  1X5E A;  1PA3 A;  3A2W A;  3TB2 A;  3KD0 A;  4Z2U A;  4ZL9 A;  4HJM A;  2H6Z A;  1ZZY A;  3IRA A;  1M9A A;  2VCZ A;  2WZS A;  3ERW A;  3GHA A;  2ZNM A;  2LNS A;  2G2Q A;  2GZZ A;  1JLV A;  2PPT A;  4IN0 A;  6GSV A;  2NPB A;  2VM2 A;  4N30 A;  4AKG A;  5CO3 A;  2WVX A;  2OKA A;  3KJY A;  1CQH A;  2FA4 A;  1R5P A;  1HNA A;  2OE3 A;  3IE3 A;  5IMF A;  4POM A;  3L9S A;  2I81 A;  4WBJ A;  1GL8 A;  2YWO A;  2ZCT A;  5J3R A;  3TJK A;  1NHY A;  2JZS A;  3HD5 A;  2GTU A;  2OAD A;  3SBC A;  4G19 A;  4PUR A;  2C3Q A;  2OE1 A;  4BWS A;  3M1G A;  5DVB A;  5C00 A;  1A8Y A;  1FB0 A;  1EEM A;  3KEB A;  4ZB9 A;  3MYD A;  4KSM A;  1GSU A;  1U3A A;  3UBL A;  4X43 A;  1ABA A;  4Z2T A;  1Q4J A;  3AY8 A;  6GSU A;  3GKX A;  2CVB A;  4MF7 A;  2NBS A;  2VD0 A;  3NIV A;  5J41 A;  3TKR A;  2I1U A;  4HUA A;  4NWY A;  1JZD A;  2PN8 A;  1OKT A;  2A4V A;  4PXO A;  3GYK A;  4K8M A;  5AIX A;  4OWY A;  3QCP A;  4F0B A;  4MJA A;  4MCU A;  2O89 A;  3KMO A;  3IOS A;  1F2E A;  2E2G A;  4AJ6 A;  2QSI A;  3BCK A;  2HYX A;  3WGD A;  1CQG A;  4TR4 A;  1GH2 A;  1QXH A;  3CXG A;  1EGR A;  1YEP A;  3KM6 A;  2GST A;  5IPH A;  4Q5F A;  1EZK A;  3K8N A;  4KF9 A;  4N3Z A;  1GSF A;  3GNJ A;  4PNF A;  4E8H A;  1XZO A;  3F63 A;  2DJ2 A;  1UA5 A;  1SKR B;  4OFN A;  2HZF A;  3VWU A;  4TRX A;  3J7Y b;  3P2A A;  1ZYE A;  4AF2 A;  2V2G A;  1TP9 A;  3F4R A;  4FXY P;  1GUK A;  1YKA A;  2K8V A;  2WVX B;  3GX0 A;  2NVL A;  5A5K A;  4K7O A;  1K3L A;  4I6X A;  1XVQ A;  18GS A;  2LKU A;  4Z7X A;  1VF2 A;  5D9V A;  2H74 A;  1OE7 A;  2BMX A;  3IV4 A;  1URM A;  2DMM A;  3VK9 A;  4TR3 A;  3UEM A;  4EVM A;  1KEB A;  4P3Y B;  1FAA A;  1GLQ A;  1V9W A;  2MMA A;  3IC8 A;  1K0N A;  3QFB C;  5CP1 A;  1WOU A;  2E0Q A;  3ZFL A;  3WD6 A;  2X8G A;  4L5L A;  1W4V A;  4GQC A;  3U6V A;  1IYI A;  2DJK A;  4GQF A;  1H75 A;  2FHE A;  1MTC A;  3LSZ A;  3UAR A;  4HQS A;  1B9X C;  1U88 A;  2PMT A;  3M3M A;  5DDL A;  1PL1 A;  4HU9 A;  1HNC A;  5IMV A;  5D8I A;  4V2N A;  4N0Z A;  1AW9 A;  2H1L A;  3VPQ A;  2B5E A;  4X4J A;  2Z9S A;  2VCV A;  4GDF A;  3F4S A;  1K0C A;  1O8X A;  3PGT A;  4ZB8 A;  5HR2 A;  1TOF A;  2VKZ G;  1X9M B;  1X5C A;  5GAN D;  1XWA A;  3IHQ A;  4L0W A;  3GH6 A;  1NHO A;  1PL2 A;  3RPP A;  3APQ A;  4L8E A;  3LOR A;  4ZXG A;  5AIS A;  3CHX C;  5ECR B;  5ID2 A;  3DWV A;  1WIK A;  3GKK A;  4ZBB A;  3TRQ A;  1XXU A;  5GSS A;  2OJL A;  2DJJ A;  4GF0 A;  4PTS A;  3IK9 A;  1ZYQ B;  6GSY A;  1J0F A;  2JL4 A;  3DD3 A;  5JCG A;  4TKY A;  5D9W A;  1U3I A;  3CQF A;  3VI5 A;  3GV1 A;  3HHV A;  2VOC A;  3F6F A;  3M9K A;  2PGT A;  4HQZ A;  2PUK C;  5ECM B;  1YZX A;  2FWG A;  3DML A;  3HVN A;  3TJF A;  1YQ1 A;  11GS A;  3C1R A;  5ENU A;  2D2Z A;  5G2Z A;  3IK7 A;  4TXO A;  4RI7 A;  2R0G A;  1HQO A;  4MLY A;  4EDZ A;  3UL3 A;  4KGI A;  3LJR A;  3EYT A;  3WYW A;  1YY7 A;  2JAC A;  1EV4 A;  1ZOF A;  1SD9 A;  3E9J B;  1XWK A;  3Q6O A;  3FR9 A;  4GST A;  2CZ3 A;  1F3A A;  4HSC X;  3FKF A;  4F2I A;  4V1A g;  5A34 A;  1HNB A;  2C8U A;  1JLW A;  3G7Y A;  3IC4 A;  3F6D A;  1QK8 A;  1SVO A;  4HZ4 A;  4K0G A;  2GT6 A;  1TU8 A;  3DEX A;  5ABR A;  3TKQ A;  3VPT A;  2RM6 A;  4CHS A;  1ST9 A;  2VCT A;  5KN0 A;  3EUR A;  1YDK A;  2V32 A;  4WEY A;  1SD8 A;  3O3T A;  1AQV A;  4KX4 A;  3KZQ A;  3ZTL A;  4YKG A;  2VCW A;  3VLN A;  4EC0 A;  3RAZ A;  2WB9 A;  5DJM A;  3F8U A;  4LLR A;  5EVO A;  5EY6 A;  3CSH A;  3L9V A;  1N25 A;  1I5G A;  1PSQ A;  1M3I A;  1W89 A;  3ZRD A;  4XRD A;  4HZ2 A;  4L0U A;  2WZ9 A;  4E68 A;  1TK0 B;  2EFC A;  2FA8 A;  5ID2 B;  1M2B A;  2A2P A;  2R37 A;  4QL9 A;  5A4W A;  4AKH A;  2R0P A;  1BAY A;  3IA1 A;  5DCH A;  4G2E A;  5J9C A;  5JWQ B;  2GZP A;  4MF6 A;  3KXO A;  1ZL9 A;  1TJD A;  1XG8 A;  2CVK A;  3UVH A;  3W6G A;  5INY A;  3M9J A;  3GST A;  2L4Q A;  2YJ7 A;  3ISO A;  3GKM A;  3E0U A;  1K0B A;  1GP1 A;  1B48 A;  1FB6 A;  3M8N A;  2WS2 A;  4ACS A;  4F0C A;  5ECK B;  3V1W A;  2UV8 G;  2I9H A;  1Z3E A;  2L5O A;  1UN2 A;  1TI1 A;  4TXO B;  4IHU A;  1X5D A;  2FGX A;  5BRT A;  2JZR A;  3ME8 A;  4YKF A;  2HRA A;  1KNG A;  4GSN A;  3M0F A;  4TR0 A;  1KBN A;  1A2L A;  1GUH A;  2HRF A;  1M7T A;  1WWJ A;  2EC4 A;  3GL5 A;  4MJB A;  5KEJ A;  3HVX A;  2TIR A;  4PHZ C;  4ECI A;  1U6T A;  2UZ8 A;  2AB6 A;  1YF0 A;  4I2T A;  4POK A;  3RBT A;  2HQT A;  12GS A;  1ERT A;  2CV4 A;  2GS3 A;  3LG6 A;  1X9W B;  2L6D A;  1EOH A;  5J4V A;  4KDY A;  1AIU A;  5E59 A;  5ECL B;  4ZIL A;  3HZ8 A;  2XC2 A;  7GSS A;  2C0G A;  1QMV A;  4HEA 2;  5CYY A;  5FHI A;  2BTO T;  3EU4 A;  5F05 A;  2H6X A;  2AAW A;  2VL3 A;  5JWR B;  2C3N A;  1T8E B;  2RII A;  5EPF A;  1JHB A;  2OBK A;  2H76 A;  4RI6 A;  2PBJ A;  5B8B A;  4EIQ A;  4WF5 A;  1ZMA A;  20GS A;  2VUP A;  4I2U A;  3KTB A;  1QFN A;  4OMV A;  1SKW B;  2WVY A;  4IJI A;  3L0H A;  3RGB C;  2JAD A;  1EV9 A;  1G7O A;  1DSB A;  1GUL A;  1J08 A;  1ERW A;  3EE2 A;  2PVO C;  3O76 A;  1LJR A;  1JZR A;  1G6Y A;  1XVW A;  4GRF A;  1O8W A;  2FCH A;  1G0T A;  2CAI A;  2EFH A;  3EPT A;  3QR6 A;  4PX1 A;  4ZIJ A;  3WGE A;  2KHP A;  2FY6 A;  4EUY A;  1TK8 B;  4AGS A;  3G7I A;  2EFE A;  3VWW A;  3RFR C;  4QQ7 A;  3IXR A;  2ON5 A;  2K9F A;  2DKI A;  3N9J A;  4KE3 A;  1MDI A;  3FK8 A;  2KLX A;  2M46 A;  2FD3 A;  4I8B A;  2F8F A;  4N11 A;  1VF1 A;  1TRW A;  1TW9 A;  4RQR A;  1B4P A;  3H93 A;  5A4V A;  2R5G A;  2X8C A;  4HS1 A;  5DQS A;  5KOW A;  3Q18 A;  3F3Q A;  3C71 A;  1G6W A;  2HE3 A;  3IDV A;  1PD2 1;  4NHZ A;  2VCQ A;  4GWR A;  1XOA A;  1OC9 A;  14GS A;  1FVK A;  2JSY A;  2OE0 A;  4IS0 A;  2B7J A;  4Q5R A;  4GSS A;  4MPF A;  19GS A;  1QQ2 A;  2LEG A;  4AKI A;  2K6V A;  1TTZ A;  1O7U A;  4K7N A;  1SJI A;  3L78 A;  1K3O A;  2K18 A;  2VL2 C;  1DE1 A;  4FYC A;  3FEU A;  1TU7 A;  1Z6M A;  4NV5 A;  3DKS A;  1BQ7 A;  5ECH B;  4K2X A;  5IIZ A;  3CBU A;  2VM1 A;  3WT1 A;  5A5H B;  4TR1 B;  2H8L A;  2YWM A;  4ZL8 A;  4JBB A;  1YKC A;  1MD3 A;  3QAG A;  4O5R A;  1PMT A;  1N8J A;  4PUA A;  4G0I A;  5ECN B;  4XS4 A;  5FT3 A;  4BVY B;  2YP6 A;  2IN3 A;  2PU9 C;  2QA1 A;  2DKH A;  2LQQ A;  3ZML A;  4HI7 A;  1VRS D;  2LNT A;  4N0V A;  3TJJ A;  2M72 A;  1LU4 A;  4ID0 A;  2AV4 A;  1SL2 B;  1BX9 A;  3D4T A;  4XCS A;  1Z7P A;  2DJ3 A;  3EMX A;  5G5E A;  4NMU A;  1WJK A;  4JRR A;  3FZ9 A;  5D96 A;  1FW1 A;  2H01 A;  3GTU A;  3TKS A;  5A4U A;  2G0F A;  2KP2 A;  1A8L A;  5B7C A;  4DSR A;  1TRU A;  3NZN A;  2H1D A;  2MMO A;  2B5Y A;  2HT9 A;  4JED A;  9GSS A;  1TI3 A;  4KCE A;  2O85 A;  2GZY A;  3BBY A;  1LBK A;  3LGC A;  2REM A;  2V6O A;  1YJ6 A;  2H1A A;  4WKW A;  2HXK A;  3UIW A;  5DCG A;  2EIQ A;  2C4J A;  1PN0 A;  1ZYP A;  1FO5 A;  1OC9 B;  5D9T A;  1V98 A;  1WP0 A;  4CW9 A;  2KOK A;  2XHF A;  4KND A;  3GUS A;  5L71 A;  3BOA A;  4KDU A;  2M80 A;  3TJB A;  3GSS A;  1RK4 A;  2FWE A;  2GT5 A;  3HYP A;  2MMZ A;  4E8E A;  2QC7 A;  3KP8 A;  1F37 A;  4FYU A;  2EIO A;  3MIX A;  2H72 A;  5HFI A;  5GAP D;  3HDC A;  4DEJ A;  4Z2R A;  5HFG A;  1YEX A;  2MBS A;  2FUG 2;  4PGT A;  3HVS A;  1Z9H A;  3LYK A;  4XRA A;  4NPB A;  5D93 A;  2O5V A;  1TXX A;  3QPM A;  1MDK A;  2HSM A;  6GST A;  2H70 A;  5DAL A;  3DRN A;  3IBH A;  5FWG A;  2PVQ A;  2P5Q A;  4NV2 A;  1OC8 A;  5F06 A;  4WET A;  4XTS A;  1S3A A;  2ZUP A;  1EOG A;  3HJO A;  3GFK A;  1M3J A;  4ISD A;  3DIE A;  2KUC A;  4CDO A;  3LW9 A;  1F3B A;  3CRT A;  1ERV A;  4XS4 B;  1FOH A;  4LMV A;  2J23 A;  4PI2 C;  5G31 A;  3CSI A;  22GS A;  2L6C A;  3APO A;  4OFT A;  3H8Q A;  4AJ8 A;  2H6Y A;  4HJ2 A;  1X0R A;  5IMC A;  1AQX A;  1R5A A;  2YV9 A;  3VI7 A;  3KCM A;  4ZB7 A;  2VLV A;  1Y25 A;  2O87 A;  3RDW A;  2VO4 A;  4F03 A;  4O5U A;  4WR4 A;  4KB3 A;  2YNX A;  2MYG A;  2N5A A;  5COH A;  4WBR D;  3MAK A;  3A2V A;  4FH8 A;  1BED A;  4TVE A;  2C0F A;  3APS A;  5C04 A;  2XPD A;  2C80 A;  4K1F A;  2IIY A;  4MK3 A;  4W66 A;  2RUE A;  2C0E A;  2R2J A;  2L57 A;  2P0G A;  4V1A p;  4BL7 A;  3CSJ A;  4YH2 A;  3KGK A;  2LTK A;  4NXI A;  1XWG A;  1AUC A;  5J4U A;  3FMW A;  3JCM L;  2HFD A;  1GSY A;  3HMJ G;  1GSD A;  4TOP A;  1GWC A;  2DSA A;  3VWV A;  5GZZ B;  1K0D A;  5BMU A;  5LCZ A;  4YAP A;  2FLS A;  4PQH A;  2P31 A;  1O81 A;  2LRT A;  1TDI A;  1QUW A;  4DSQ A;  3RHC A;  4OFM A;  3D0Z A;  2H1G A;  1PN9 A;  1FG4 A;  4BWQ A;  3GRX A;  6GSX A;  4YQV A;  5IO2 A;  1BG1 A;  4ECJ A;  5H5R A;  3LFL A;  1OE8 A;  2EIR A;  5J9B A;  3QAV A;  1T3B A;  3GA4 A;  3U5R E;  1EWX A;  4MA9 A;  4XHM A;  2WW2 A;  2IMK A;  3MWH A;  1G7E A;  2OT3 A;  4MAB A;  4K7I A;  5A1N A;  3F0I A;  3FZA A;  3W8S A;  2V41 A;  1GTA A;  1M2D A;  3LYP A;  4FO5 A;  2MZC A;  1SL0 B;  1GSE A;  4G0K A;  2GSQ A;  3HXS A;  3H79 A;  4JE1 A;  1XCC A;  2H75 A;  3CWG A;  2VIM A;  2C3T A;  4MH2 A;  4LL1 B;  2VCX A;  2O8V B;  5ECO B;  4TXV A;  1MEK A;  4HU7 A;  2RM5 A;  2EFD A;  5E4W A;  2VL2 A;  1N2A A;  2LS5 A;  1SYX A;  2DC5 A;  3QD9 A;  2HSH A;  4IKH A;  3EU3 A;  2GSS A;  4BL7 B;  4K2D A;  4I5Q A;  3C7M A;  4YQU A;  3LWA A;  4BIK A;  1XW5 A;  3US3 A;  1XIY A;  2H0I A;  2E7P A;  3C1S A;  5KN3 A;  4G0L A;  3ZFB A;  3O6T A;  3GL3 A;  3NOF A;  1M0U A;  2CZ2 A;  2L5L A;  3FZ5 A;  2AJQ B;  2GVP A;  2WVZ A;  3PR8 A;  1GTI A;  3S9F A;  5BMU B;  2R6K A;  1K0O A;  4PI0 C;  3SWL A;  3IR4 A;  4G01 A;  2AYT A;  5G1L A;  4HDE A;  3CTF A;  3ZRE A;  3TCO A;  3FW2 A;  4F9Z A;  5IO0 A;  4WXT A;  2K8S A;  4J2F A;  2CAQ A;  4MP4 A;  4K0N A;  1I9D A;  1SK2 A;  4MMM A;  1ZCP A;  2IPA A;  1Z7R A;  2L59 A;  2IMD A;  2FWF A;  2B3S A;  1S4B P;  4AKX B;  5A34 B;  2LRN A;  3TOU A;  2A2S A;  3ZLP A;  2HRK A;  5AN1 A;  5A1N B;  3VWX A;  1O6J A;  5B6N A;  5JCW A;  3HZ4 A;  1ZGN A;  5ELA A;  1A24 A;  2B1L A;  1K3Y A;  1UVZ A;  5IM9 A;  4MNN A;  1S3R A;  1KTE A;  4X0X A;  4IBP A;  1BF5 A;  1THX A;  3ZIT A;  1M9B A;  3I9V 2;  1TKD B;  4ECC A;  5LNK e;  3CMI A;  4IEL A;  1GLP A;  2DBC A;  2H0G A;  3D4M A;  3DYR A;  1WRY A;  1O85 A;  4AJ7 A;  4X1U A;  4PQI A;  1T1V A;  2GGT A;  1ILO A;  3A3T A;  2NTO A;  5J4Y A;  4MPG A;  5F8B A;  3GIX A;  1A23 A;  1SK0 A;  1SU9 A;  3L4N A;  3QFA C;  1R4W A;  2H1B A;  1RW1 A;  2YAN A;  1SKS B;  4MH3 A;  1ON4 A;  1V2A A;  2WDU A;  2HZE A;  1DUG A;  3FY7 A;  1IYH A;  1T4Z A;  3ZZX A;  2AHE A;  4MJC A;  3KP9 A;  3KIJ A;  4BVX A;  3DVX A;  4MJE A;  1OVN A;  2HLS A;  4OO4 A;  2YN1 A;  3P8W A;  5ELG A;  1F6M C;  5CRW A;  1THO A;  3TJG A;  4IJ3 A;  3ERG A;  3CYN A;  3IPZ A;  3ME7 A;  1GRX A;  4KSO A;  5HR3 A;  5IOX A;  3HA9 A;  4LA1 A;  2H66 A;  3VFI A;  2YCD A;  3A2X A;  2F3M A;  1GNW A;  1BG5 A;  4GLT A;  2RLI A;  3TDG A;  1ML6 A;  1Z6N A;  2N5B A;  5F0G A;  4GXZ A;  3L9U A;  2PWJ A;  4O5Q A;  3UBK A;  2QGV A;  3IHG A;  4TW5 A;  5ECI B;  2IFQ A;  3G9B A;  5ECP B;  5F07 A;  4KH7 A;  4EE0 A;  4EIP A;  2HRK B;  1X9S B;  5D73 A;  2H0H A;  2WW1 A;  3LQ7 A;  2AUV A;  2GSR A;  3UVT A;  2X99 A;  4MZW A;  2LQO A;  1BJX A;  4I97 A;  1NSW A;  3E3E A;  4JZQ A;  1B9Y C;  2YJH A;  4O7H A;  1XBS A;  2WW3 A;  2IJY A;  2LJK A;  3IAS 2;  2HSN A;  1B8X A;  2CT6 A;  3QOU A;  3J7Y k;  5J47 A;  3ZVJ A;  3I43 A;  1SVL A;  4EL1 A;  1XOB A;  2IMI A;  2DLX A;  4N10 A;  4GTU A;  1VF3 A;  5JCU A;  1K0A A;  1GSS A;  3RPN A;  2L4C A;  3TKS E;  2B5X A;  4IW9 A;  3C8E A;  2V6K A;  2I4A A;  3P7X A;  2WFC A;  2WGR A;  4NHW A;  2DIZ A;  4Q5Q A;  5CNW A;  2MMN A;  4TN8 A;  3HCZ A;  4POL A;  2VLU A;  4KW6 A;  3OR5 A;  5IMZ A;  2HZE B;  3KMN A;  2NDO A;  1EGO A;  2O3E A;  4MF5 A;  2YV7 A;  4ICY A;  4BVX B;  4USS A;  4OD7 A;  1SK1 A;  4J56 E;  2VLT A;  1WMJ A;  2OAC A;  1A2M A;  3ZIJ A;  3PPU A;  3BD2 A;  5G5F A;  1EP7 A;  3QAW A;  5ECQ B;  5IMA A;  4QMK A;  3UOM A;  3LEF A;  3ZIV A;  1ACV A;  5KN1 A;  4Q5N A;  1I1I P;  3MNG A;  3GN3 A;  4EXJ A;  4XS6 A;  2XBI A;  5G1K A;  2IFQ B;  4J57 E;  2GLR A;  1SYR A;  2J9H A;  4KCA A;  4LMW A;  1V57 A;  3UJ1 A;  4D73 A;  3N5O A;  4IGJ A;  5IOW A;  3TOT A;  4RUV A;  4IQA A;  1FVJ A;  2RUF A;  1OKD A;  3D6I A;  2H71 A;  4WR5 A;  4AI6 A;  1YEW C;  3W8J A;  4MDC A;  2HI7 A;  4K5S A;  1XW9 A;  4POB A;  1UC7 A;  1C72 A;  2HSN B;  1OYJ A;  1EEJ A;  1GUM A;  1PRX A;  2X49 A;  1QGV A;  1J9B A;  2DJ0 A;  4LL4 B;  3HKR A;  1A0R P;  1DBY A;  4CY6 A;  1XWC A;  5H5Q A;  1SEN A;  4XS1 A;  4OCE A;  2A4H A;  5H5S A;  1B4Q A;  2I3Y A;  2DML A;  2VD1 A;  5HQP A;  5AIV A;  2H30 A;  1V58 A;  2B7K A;  1GNE A;  3P90 A;  5DJL A;  1XW6 A;  3PIN A;  5DAK A;  4JR6 A;  4ZBD A;  2IWT A;  2WCI A;  1FHE A;  2HRN A;  1E2Y A;  3H4K A;  4PNG A;  2HSY A;  1T4Y A;  3FZ4 A;  1R7H A;  2YWN A;  3GX8 A;  2KP1 A;  5IPG A;  2R3X A;  5B6M A;  2FNO A;  3D21 A;  4IP6 A;  2A2R A;  2C1Y A;  3EWL A;  3EMP A;  3FR3 A;  2WUL A;  17GS A;  3GTU B;  5HFK A;  1HD2 A;  1K0M A;  3HJM A;  1O73 A;  3Q74 A;  2X64 A;  3WT2 A;  4A5P A;  3GKN A;  2P5R A;  4D73 B;  1OAZ A;  1AXD A;  5DQY A;  3F3R A;  4ML1 A;  1U87 A;  4G9H A;  4EO3 A;  3ZMK A;  4KUN A;  2CA8 A;  3DXB A;  3GUR A;  2O7K A;  3DVW A;  4XIH A;  1Y1U A;  1E6B A;  2R4V A;  1JZO A;  3BCI A;  2WRT A;  1YF1 A;  1AC1 A;  1BYE A;  1PKZ A;  2O36 A;  3HY2 A;  1Z5Y E;  4HOJ A;  3D5J A;  3EC3 A;  3GH9 A;  4ZBA A;  2GQK A;  3TRX A;  2DJ1 A;  4OO5 A;  3QMX A;  4O92 A;  2CVD A;  5KOX A;  4G10 A;  1TRS A;  2VAF A;  5G30 A;  1A2J A;  4OCF A;  2F9S A;  5D9X A;  1SL1 B;  4GCI A;  4PUF C;  2HSM B;  1PX6 A;  2TRX A;  5DAL B;  2FWH A;  2C0D A;  10GS A;  4F82 A;  4ML6 A;  1EP8 A;  3TUE A;  2LST A;  1F9M A;  4EDY A;  5DAK B;  5CRE A;  3I69 A;  1PKW A;  1XFL A;  4FQU A;  3ZL5 A; 
#chains in the Genus database with same CATH homology
 2YWI A;  4DSS A;  3I6A A;  4FIW A;  3LXT A;  4K9Z A;  1SVM A;  3TKP A;  3ZVJ D;  16GS A;  1FOV A;  1VF4 A;  2V1M A;  2YPM A;  4O32 A;  1JFU A;  3MSZ A;  2GQL A;  3DGQ A;  2GDR A;  2H19 A;  5IMD A;  1M2A A;  4H86 A;  2R0C A;  5IQY A;  4KDX A;  2VL9 A;  5B8A A;  3G7J A;  5CRH A;  3R2Q A;  3ERF A;  1ZYN A;  3LXZ A;  4PQ1 A;  4NAX A;  4IP1 A;  2ON7 A;  4IQ1 A;  2X8H A;  4KAE A;  1DE2 A;  4ECB A;  2TRC P;  3TKS C;  3F9U A;  2X4A A;  3IAM 2;  4FYB A;  4CY8 A;  2DIY A;  5JWO B;  5LD0 A;  3FYG A;  1JZW A;  4ULX A;  3HJP A;  3F4T A;  4JU5 A;  2B1K A;  4V2M A;  3TRP A;  1PX7 A;  3TGZ A;  1M99 A;  4RQX A;  1AQW A;  1NW2 A;  2B6M A;  4L5O A;  2XPE A;  5CRG A;  3PH9 A;  5HR0 A;  4ZL7 A;  1YVL A;  2IL3 A;  2GQM A;  3A5W A;  6GSS A;  5KN2 A;  3ZYW A;  1AAZ A;  3FRC A;  2YZH A;  3D22 A;  1T00 A;  3H1N A;  3TU3 B;  1GSQ A;  3ED3 A;  4DVC A;  1NM3 A;  4BPY A;  1TK5 B;  1VGL A;  2XBQ A;  3MDK A;  1T7P B;  3UAP A;  4K6X A;  2ALB A;  5AGY A;  2LJR A;  1SJ6 A;  1PGT A;  3KH7 A;  1GTB A;  1H4O A;  5EL8 A;  1PQN A;  1Y6E A;  2N5F A;  5GST A;  1Q98 A;  4K5R A;  3RHB A;  4DSS B;  2PER A;  3KTL A;  1SJZ A;  4MZC A;  3EVI A;  2LV3 A;  2LJA A;  1R26 A;  2ES7 A;  2JU5 A;  2E2M A;  8GSS A;  4KA0 A;  1WE0 A;  1S3D A;  2CX4 A;  2HNL A;  2YOI A;  2H73 A;  2LUS A;  3FHK A;  3QDN A;  1S3C A;  2BJX A;  2YZU A;  1HYU A;  1MDJ A;  3HVV A;  2CX3 A;  2OA7 A;  5J40 A;  4JR4 A;  2JZT A;  1OC3 A;  3BJ5 A;  1A0F A;  2F8A A;  1V40 A;  6GSW A;  3GMF A;  2LRC A;  3CTG A;  1RQM A;  3FR6 A;  1TRV A;  2F51 A;  2CQ9 A;  1XPV A;  3Q19 A;  4IVF A;  3A5I A;  4V2L A;  1WPI A;  13GS A;  3WGX A;  4BA7 A;  1USB A;  2OBI A;  5ECS A;  5HR1 A;  5A5H A;  4TR1 A;  1MD4 A;  4EF0 A;  2JSZ A;  2MBT A;  2QA2 A;  4EKZ A;  2IME A;  4YQM A;  5CAX A;  3KH9 A;  3EIN A;  4ILF A;  1ERU A;  2QKE A;  4YAV A;  4WF4 A;  5J5N A;  2IMF A;  3R3E A;  3C73 A;  4MZB A;  1TXU A;  4QL7 A;  3CRU A;  4BVY A;  5DBQ A;  2WJU A;  3UMA A;  4ZB6 A;  1GTU A;  1XWB A;  5CRD A;  3VUR A;  1X5E A;  1PA3 A;  3A2W A;  3TB2 A;  3KD0 A;  4Z2U A;  4ZL9 A;  4HJM A;  2H6Z A;  1ZZY A;  3IRA A;  1M9A A;  2VCZ A;  3ERW A;  3GHA A;  2ZNM A;  2LNS A;  2G2Q A;  2GZZ A;  1JLV A;  2PPT A;  4IN0 A;  6GSV A;  2NPB A;  2VM2 A;  4N30 A;  4AKG A;  5CO3 A;  2OKA A;  3KJY A;  1CQH A;  2FA4 A;  1R5P A;  1HNA A;  2OE3 A;  3IE3 A;  5IMF A;  4POM A;  3L9S A;  2I81 A;  4WBJ A;  1GL8 A;  2YWO A;  2ZCT A;  5J3R A;  3TJK A;  1NHY A;  2JZS A;  3HD5 A;  2GTU A;  2OAD A;  3SBC A;  4G19 A;  4PUR A;  2C3Q A;  2OE1 A;  4BWS A;  3M1G A;  5DVB A;  5C00 A;  1A8Y A;  1FB0 A;  1EEM A;  3KEB A;  4ZB9 A;  3MYD A;  4KSM A;  1GSU A;  1U3A A;  3UBL A;  4X43 A;  1ABA A;  4Z2T A;  1Q4J A;  3AY8 A;  6GSU A;  3GKX A;  2CVB A;  4MF7 A;  2NBS A;  2VD0 A;  3NIV A;  5J41 A;  3TKR A;  2I1U A;  4HUA A;  4NWY A;  1JZD A;  2PN8 A;  1OKT A;  2A4V A;  4PXO A;  3GYK A;  4K8M A;  5AIX A;  4OWY A;  3QCP A;  4F0B A;  4MJA A;  4MCU A;  2O89 A;  3KMO A;  3IOS A;  1F2E A;  2E2G A;  4AJ6 A;  2QSI A;  3BCK A;  2HYX A;  3WGD A;  1CQG A;  4TR4 A;  1GH2 A;  1QXH A;  3CXG A;  1EGR A;  1YEP A;  3KM6 A;  2GST A;  5IPH A;  4Q5F A;  1EZK A;  3K8N A;  4KF9 A;  4N3Z A;  1GSF A;  3GNJ A;  4PNF A;  4E8H A;  1XZO A;  3F63 A;  2DJ2 A;  1UA5 A;  1SKR B;  4OFN A;  2HZF A;  3VWU A;  4TRX A;  3J7Y b;  3P2A A;  1ZYE A;  4AF2 A;  2V2G A;  1TP9 A;  3F4R A;  1GUK A;  1YKA A;  2K8V A;  3GX0 A;  2NVL A;  5A5K A;  4K7O A;  1K3L A;  4I6X A;  1XVQ A;  18GS A;  2LKU A;  4Z7X A;  1VF2 A;  5D9V A;  2H74 A;  1OE7 A;  2BMX A;  3IV4 A;  1URM A;  2DMM A;  3VK9 A;  4TR3 A;  3UEM A;  4EVM A;  1KEB A;  4P3Y B;  1FAA A;  1GLQ A;  1V9W A;  2MMA A;  3IC8 A;  1K0N A;  3QFB C;  5CP1 A;  1WOU A;  2E0Q A;  3ZFL A;  3WD6 A;  2X8G A;  4L5L A;  1W4V A;  4GQC A;  3U6V A;  1IYI A;  2DJK A;  4GQF A;  1H75 A;  2FHE A;  1MTC A;  3LSZ A;  3UAR A;  4HQS A;  1B9X C;  1U88 A;  2PMT A;  3M3M A;  5DDL A;  1PL1 A;  4HU9 A;  1HNC A;  5IMV A;  5D8I A;  4V2N A;  4N0Z A;  1AW9 A;  2H1L A;  3VPQ A;  2B5E A;  4X4J A;  2Z9S A;  2VCV A;  4GDF A;  3F4S A;  1K0C A;  1O8X A;  3PGT A;  4ZB8 A;  5HR2 A;  1TOF A;  2VKZ G;  1X9M B;  1X5C A;  5GAN D;  1XWA A;  3IHQ A;  4L0W A;  3GH6 A;  1NHO A;  1PL2 A;  3RPP A;  3APQ A;  4L8E A;  3LOR A;  4ZXG A;  5AIS A;  5ECR B;  5ID2 A;  3DWV A;  1WIK A;  3GKK A;  4ZBB A;  3TRQ A;  1XXU A;  5GSS A;  2OJL A;  2DJJ A;  4GF0 A;  4PTS A;  3IK9 A;  1ZYQ B;  6GSY A;  1J0F A;  2JL4 A;  3DD3 A;  5JCG A;  4TKY A;  5D9W A;  1U3I A;  3VI5 A;  3GV1 A;  3HHV A;  2VOC A;  3F6F A;  3M9K A;  2PGT A;  4HQZ A;  2PUK C;  5ECM B;  1YZX A;  2FWG A;  3DML A;  3TJF A;  1YQ1 A;  11GS A;  3C1R A;  5ENU A;  2D2Z A;  5G2Z A;  3IK7 A;  4TXO A;  4RI7 A;  2R0G A;  1HQO A;  4MLY A;  4EDZ A;  3UL3 A;  4KGI A;  3LJR A;  3EYT A;  3WYW A;  1YY7 A;  2JAC A;  1EV4 A;  1ZOF A;  1SD9 A;  3E9J B;  1XWK A;  3Q6O A;  3FR9 A;  4GST A;  2CZ3 A;  1F3A A;  3FKF A;  4F2I A;  4V1A g;  5A34 A;  1HNB A;  2C8U A;  1JLW A;  3G7Y A;  3IC4 A;  3F6D A;  1QK8 A;  1SVO A;  4HZ4 A;  4K0G A;  2GT6 A;  1TU8 A;  3DEX A;  5ABR A;  3TKQ A;  3VPT A;  2RM6 A;  4CHS A;  1ST9 A;  2VCT A;  5KN0 A;  3EUR A;  1YDK A;  2V32 A;  4WEY A;  1SD8 A;  3O3T A;  1AQV A;  4KX4 A;  3KZQ A;  3ZTL A;  4YKG A;  2VCW A;  3VLN A;  4EC0 A;  3RAZ A;  2WB9 A;  5DJM A;  3F8U A;  4LLR A;  5EVO A;  5EY6 A;  3CSH A;  3L9V A;  1N25 A;  1I5G A;  1PSQ A;  1W89 A;  3ZRD A;  4XRD A;  4HZ2 A;  4L0U A;  2WZ9 A;  4E68 A;  1TK0 B;  2EFC A;  2FA8 A;  5ID2 B;  1M2B A;  2A2P A;  2R37 A;  4QL9 A;  5A4W A;  4AKH A;  2R0P A;  1BAY A;  3IA1 A;  5DCH A;  4G2E A;  5J9C A;  5JWQ B;  2GZP A;  4MF6 A;  3KXO A;  1ZL9 A;  1TJD A;  2CVK A;  3UVH A;  3W6G A;  5INY A;  3M9J A;  3GST A;  2L4Q A;  2YJ7 A;  3ISO A;  3GKM A;  3E0U A;  1K0B A;  1GP1 A;  1B48 A;  1FB6 A;  3M8N A;  2WS2 A;  4ACS A;  4F0C A;  5ECK B;  3V1W A;  2UV8 G;  2I9H A;  1Z3E A;  2L5O A;  1UN2 A;  1TI1 A;  4TXO B;  4IHU A;  1X5D A;  2FGX A;  5BRT A;  2JZR A;  3ME8 A;  4YKF A;  2HRA A;  1KNG A;  4GSN A;  3M0F A;  4TR0 A;  1KBN A;  1A2L A;  1GUH A;  2HRF A;  1M7T A;  1WWJ A;  2EC4 A;  3GL5 A;  4MJB A;  5KEJ A;  3HVX A;  2TIR A;  4ECI A;  1U6T A;  2UZ8 A;  2AB6 A;  1YF0 A;  4I2T A;  4POK A;  3RBT A;  2HQT A;  12GS A;  1ERT A;  2CV4 A;  2GS3 A;  3LG6 A;  1X9W B;  2L6D A;  1EOH A;  5J4V A;  4KDY A;  1AIU A;  5E59 A;  5ECL B;  4ZIL A;  3HZ8 A;  2XC2 A;  7GSS A;  2C0G A;  1QMV A;  4HEA 2;  5CYY A;  5FHI A;  2BTO T;  3EU4 A;  5F05 A;  2H6X A;  2AAW A;  2VL3 A;  5JWR B;  2C3N A;  1T8E B;  2RII A;  5EPF A;  1JHB A;  2OBK A;  2H76 A;  4RI6 A;  2PBJ A;  5B8B A;  4EIQ A;  4WF5 A;  1ZMA A;  20GS A;  2VUP A;  4I2U A;  3KTB A;  1QFN A;  4OMV A;  1SKW B;  4IJI A;  3L0H A;  2JAD A;  1EV9 A;  1G7O A;  1DSB A;  1GUL A;  1J08 A;  1ERW A;  3EE2 A;  2PVO C;  3O76 A;  1LJR A;  1JZR A;  1G6Y A;  1XVW A;  4GRF A;  1O8W A;  2FCH A;  1G0T A;  2CAI A;  2EFH A;  3EPT A;  3QR6 A;  4PX1 A;  4ZIJ A;  3WGE A;  2KHP A;  2FY6 A;  4EUY A;  1TK8 B;  4AGS A;  3G7I A;  2EFE A;  3VWW A;  3IXR A;  4QQ7 A;  2ON5 A;  2K9F A;  2DKI A;  3N9J A;  4KE3 A;  1MDI A;  3FK8 A;  2KLX A;  2M46 A;  2FD3 A;  4I8B A;  2F8F A;  4N11 A;  1VF1 A;  1TRW A;  1TW9 A;  4RQR A;  1B4P A;  3H93 A;  5A4V A;  2R5G A;  2X8C A;  4HS1 A;  5DQS A;  5KOW A;  3Q18 A;  3F3Q A;  3C71 A;  1G6W A;  2HE3 A;  3IDV A;  1PD2 1;  4NHZ A;  2VCQ A;  4GWR A;  1XOA A;  1OC9 A;  14GS A;  1FVK A;  2JSY A;  2OE0 A;  4IS0 A;  2B7J A;  4Q5R A;  4GSS A;  4MPF A;  19GS A;  1QQ2 A;  2LEG A;  4AKI A;  2K6V A;  1TTZ A;  1O7U A;  4K7N A;  1SJI A;  3L78 A;  1K3O A;  2K18 A;  2VL2 C;  1DE1 A;  4FYC A;  3FEU A;  1TU7 A;  1Z6M A;  4NV5 A;  3DKS A;  1BQ7 A;  5ECH B;  4K2X A;  5IIZ A;  3CBU A;  2VM1 A;  3WT1 A;  5A5H B;  4TR1 B;  2H8L A;  2YWM A;  4ZL8 A;  4JBB A;  1YKC A;  1MD3 A;  3QAG A;  4O5R A;  1PMT A;  1N8J A;  4PUA A;  4G0I A;  5ECN B;  4XS4 A;  5FT3 A;  4BVY B;  2YP6 A;  2IN3 A;  2PU9 C;  2QA1 A;  2DKH A;  2LQQ A;  3ZML A;  4HI7 A;  1VRS D;  2LNT A;  4N0V A;  3TJJ A;  2M72 A;  1LU4 A;  4ID0 A;  2AV4 A;  1SL2 B;  1BX9 A;  3D4T A;  4XCS A;  1Z7P A;  2DJ3 A;  3EMX A;  5G5E A;  4NMU A;  1WJK A;  4JRR A;  3FZ9 A;  5D96 A;  1FW1 A;  2H01 A;  3GTU A;  3TKS A;  5A4U A;  2G0F A;  2KP2 A;  1A8L A;  5B7C A;  4DSR A;  1TRU A;  3NZN A;  2H1D A;  2MMO A;  2B5Y A;  2HT9 A;  4JED A;  9GSS A;  1TI3 A;  4KCE A;  2O85 A;  2GZY A;  3BBY A;  1LBK A;  3LGC A;  2REM A;  2V6O A;  1YJ6 A;  2H1A A;  4WKW A;  2HXK A;  3UIW A;  5DCG A;  2EIQ A;  2C4J A;  1PN0 A;  1ZYP A;  1FO5 A;  1OC9 B;  5D9T A;  1V98 A;  1WP0 A;  4CW9 A;  2KOK A;  2XHF A;  4KND A;  3GUS A;  5L71 A;  3BOA A;  4KDU A;  2M80 A;  3TJB A;  3GSS A;  1RK4 A;  2FWE A;  2GT5 A;  3HYP A;  2MMZ A;  4E8E A;  2QC7 A;  3KP8 A;  1F37 A;  4FYU A;  2EIO A;  3MIX A;  2H72 A;  5HFI A;  5GAP D;  3HDC A;  4DEJ A;  4Z2R A;  5HFG A;  1YEX A;  2MBS A;  2FUG 2;  4PGT A;  3HVS A;  1Z9H A;  3LYK A;  4XRA A;  4NPB A;  5D93 A;  2O5V A;  1TXX A;  3QPM A;  1MDK A;  2HSM A;  6GST A;  2H70 A;  5DAL A;  3DRN A;  3IBH A;  5FWG A;  2PVQ A;  2P5Q A;  4NV2 A;  1OC8 A;  5F06 A;  4WET A;  4XTS A;  1S3A A;  2ZUP A;  1EOG A;  3HJO A;  3GFK A;  4ISD A;  3DIE A;  2KUC A;  4CDO A;  3LW9 A;  1F3B A;  3CRT A;  1ERV A;  4XS4 B;  1FOH A;  4LMV A;  2J23 A;  5G31 A;  3CSI A;  22GS A;  2L6C A;  3APO A;  4OFT A;  3H8Q A;  4AJ8 A;  2H6Y A;  4HJ2 A;  1X0R A;  5IMC A;  1AQX A;  1R5A A;  2YV9 A;  3VI7 A;  3KCM A;  4ZB7 A;  2VLV A;  1Y25 A;  2O87 A;  3RDW A;  2VO4 A;  4F03 A;  4O5U A;  4WR4 A;  4KB3 A;  2YNX A;  2MYG A;  2N5A A;  5COH A;  4WBR D;  3MAK A;  3A2V A;  4FH8 A;  1BED A;  4TVE A;  2C0F A;  3APS A;  5C04 A;  2XPD A;  2C80 A;  4K1F A;  2IIY A;  4MK3 A;  4W66 A;  2RUE A;  2C0E A;  2R2J A;  2L57 A;  2P0G A;  4V1A p;  4BL7 A;  3CSJ A;  4YH2 A;  3KGK A;  2LTK A;  4NXI A;  1XWG A;  1AUC A;  5J4U A;  3FMW A;  3JCM L;  2HFD A;  1GSY A;  3HMJ G;  1GSD A;  4TOP A;  1GWC A;  2DSA A;  3VWV A;  5GZZ B;  1K0D A;  5BMU A;  5LCZ A;  4YAP A;  2FLS A;  4PQH A;  2P31 A;  1O81 A;  2LRT A;  1TDI A;  1QUW A;  4DSQ A;  3RHC A;  4OFM A;  3D0Z A;  2H1G A;  1PN9 A;  1FG4 A;  4BWQ A;  3GRX A;  6GSX A;  4YQV A;  5IO2 A;  1BG1 A;  4ECJ A;  5H5R A;  3LFL A;  1OE8 A;  2EIR A;  5J9B A;  3QAV A;  1T3B A;  3GA4 A;  3U5R E;  1EWX A;  4MA9 A;  4XHM A;  2IMK A;  3MWH A;  1G7E A;  2OT3 A;  4MAB A;  4K7I A;  5A1N A;  3F0I A;  3FZA A;  3W8S A;  2V41 A;  1GTA A;  1M2D A;  3LYP A;  4FO5 A;  2MZC A;  1SL0 B;  1GSE A;  4G0K A;  2GSQ A;  3HXS A;  3H79 A;  4JE1 A;  1XCC A;  2H75 A;  3CWG A;  2VIM A;  2C3T A;  4MH2 A;  4LL1 B;  2VCX A;  2O8V B;  5ECO B;  4TXV A;  1MEK A;  4HU7 A;  2RM5 A;  2EFD A;  5E4W A;  2VL2 A;  1N2A A;  2LS5 A;  1SYX A;  2DC5 A;  3QD9 A;  2HSH A;  4IKH A;  3EU3 A;  2GSS A;  4BL7 B;  4K2D A;  4I5Q A;  3C7M A;  4YQU A;  3LWA A;  1XW5 A;  3US3 A;  1XIY A;  2H0I A;  2E7P A;  3C1S A;  5KN3 A;  4G0L A;  3ZFB A;  3O6T A;  3GL3 A;  3NOF A;  1M0U A;  2CZ2 A;  2L5L A;  3FZ5 A;  2AJQ B;  2GVP A;  3PR8 A;  1GTI A;  3S9F A;  5BMU B;  2R6K A;  1K0O A;  3SWL A;  3IR4 A;  4G01 A;  2AYT A;  5G1L A;  4HDE A;  3CTF A;  3ZRE A;  3TCO A;  3FW2 A;  4F9Z A;  5IO0 A;  4WXT A;  2K8S A;  4J2F A;  2CAQ A;  4MP4 A;  4K0N A;  1I9D A;  1SK2 A;  4MMM A;  1ZCP A;  2IPA A;  1Z7R A;  2L59 A;  2IMD A;  2FWF A;  2B3S A;  4AKX B;  5A34 B;  2LRN A;  3TOU A;  2A2S A;  3ZLP A;  2HRK A;  5AN1 A;  5A1N B;  3VWX A;  1O6J A;  5B6N A;  5JCW A;  3HZ4 A;  1ZGN A;  5ELA A;  1A24 A;  2B1L A;  1K3Y A;  1UVZ A;  5IM9 A;  4MNN A;  1KTE A;  4X0X A;  4IBP A;  1BF5 A;  1THX A;  3ZIT A;  1M9B A;  3I9V 2;  1TKD B;  4ECC A;  5LNK e;  3CMI A;  4IEL A;  1GLP A;  2DBC A;  2H0G A;  3D4M A;  3DYR A;  1WRY A;  1O85 A;  4AJ7 A;  4X1U A;  4PQI A;  1T1V A;  2GGT A;  1ILO A;  3A3T A;  2NTO A;  5J4Y A;  4MPG A;  5F8B A;  3GIX A;  1A23 A;  1SK0 A;  1SU9 A;  3L4N A;  3QFA C;  1R4W A;  2H1B A;  1RW1 A;  2YAN A;  1SKS B;  4MH3 A;  1ON4 A;  1V2A A;  2WDU A;  2HZE A;  1DUG A;  3FY7 A;  1IYH A;  1T4Z A;  3ZZX A;  2AHE A;  4MJC A;  3KP9 A;  3KIJ A;  4BVX A;  3DVX A;  4MJE A;  1OVN A;  2HLS A;  4OO4 A;  2YN1 A;  3P8W A;  5ELG A;  1F6M C;  5CRW A;  1THO A;  3TJG A;  4IJ3 A;  3ERG A;  3CYN A;  3IPZ A;  3ME7 A;  1GRX A;  4KSO A;  5HR3 A;  5IOX A;  3HA9 A;  4LA1 A;  2H66 A;  3VFI A;  2YCD A;  3A2X A;  2F3M A;  1GNW A;  1BG5 A;  4GLT A;  2RLI A;  3TDG A;  1ML6 A;  1Z6N A;  2N5B A;  5F0G A;  4GXZ A;  3L9U A;  2PWJ A;  4O5Q A;  3UBK A;  2QGV A;  3IHG A;  4TW5 A;  5ECI B;  2IFQ A;  3G9B A;  5ECP B;  5F07 A;  4KH7 A;  4EE0 A;  4EIP A;  2HRK B;  1X9S B;  5D73 A;  2H0H A;  3LQ7 A;  2AUV A;  2GSR A;  3UVT A;  2X99 A;  4MZW A;  2LQO A;  1BJX A;  4I97 A;  1NSW A;  3E3E A;  4JZQ A;  1B9Y C;  2YJH A;  4O7H A;  1XBS A;  2IJY A;  2LJK A;  3IAS 2;  2HSN A;  1B8X A;  2CT6 A;  3QOU A;  3J7Y k;  5J47 A;  3ZVJ A;  3I43 A;  1SVL A;  4EL1 A;  1XOB A;  2IMI A;  2DLX A;  4N10 A;  4GTU A;  1VF3 A;  5JCU A;  1K0A A;  1GSS A;  3RPN A;  2L4C A;  3TKS E;  2B5X A;  4IW9 A;  3C8E A;  2V6K A;  2I4A A;  3P7X A;  2WFC A;  2WGR A;  4NHW A;  2DIZ A;  4Q5Q A;  5CNW A;  2MMN A;  4TN8 A;  3HCZ A;  4POL A;  2VLU A;  4KW6 A;  3OR5 A;  5IMZ A;  2HZE B;  3KMN A;  2NDO A;  1EGO A;  4MF5 A;  2YV7 A;  4ICY A;  4BVX B;  4USS A;  4OD7 A;  1SK1 A;  4J56 E;  2VLT A;  1WMJ A;  2OAC A;  1A2M A;  3ZIJ A;  3PPU A;  3BD2 A;  5G5F A;  1EP7 A;  3QAW A;  5ECQ B;  5IMA A;  4QMK A;  3UOM A;  3LEF A;  3ZIV A;  1ACV A;  5KN1 A;  4Q5N A;  3MNG A;  3GN3 A;  4EXJ A;  4XS6 A;  2XBI A;  5G1K A;  2IFQ B;  4J57 E;  2GLR A;  1SYR A;  2J9H A;  4KCA A;  4LMW A;  1V57 A;  3UJ1 A;  4D73 A;  3N5O A;  4IGJ A;  5IOW A;  3TOT A;  4RUV A;  4IQA A;  1FVJ A;  2RUF A;  1OKD A;  3D6I A;  2H71 A;  4WR5 A;  4AI6 A;  3W8J A;  4MDC A;  2HI7 A;  4K5S A;  1XW9 A;  4POB A;  1UC7 A;  1C72 A;  2HSN B;  1OYJ A;  1EEJ A;  1GUM A;  1PRX A;  2X49 A;  1QGV A;  1J9B A;  2DJ0 A;  4LL4 B;  3HKR A;  1A0R P;  1DBY A;  4CY6 A;  1XWC A;  5H5Q A;  1SEN A;  4XS1 A;  4OCE A;  2A4H A;  5H5S A;  1B4Q A;  2I3Y A;  2DML A;  2VD1 A;  5HQP A;  5AIV A;  2H30 A;  1V58 A;  2B7K A;  1GNE A;  3P90 A;  5DJL A;  1XW6 A;  3PIN A;  5DAK A;  4JR6 A;  4ZBD A;  2IWT A;  2WCI A;  1FHE A;  2HRN A;  1E2Y A;  3H4K A;  4PNG A;  2HSY A;  1T4Y A;  3FZ4 A;  1R7H A;  2YWN A;  3GX8 A;  2KP1 A;  5IPG A;  2R3X A;  5B6M A;  2FNO A;  3D21 A;  4IP6 A;  2A2R A;  2C1Y A;  3EWL A;  3EMP A;  3FR3 A;  2WUL A;  17GS A;  3GTU B;  5HFK A;  1HD2 A;  1K0M A;  3HJM A;  1O73 A;  3Q74 A;  2X64 A;  3WT2 A;  4A5P A;  3GKN A;  2P5R A;  4D73 B;  1OAZ A;  1AXD A;  5DQY A;  3F3R A;  4ML1 A;  1U87 A;  4G9H A;  4EO3 A;  3ZMK A;  4KUN A;  2CA8 A;  3DXB A;  3GUR A;  2O7K A;  3DVW A;  4XIH A;  1Y1U A;  1E6B A;  2R4V A;  1JZO A;  3BCI A;  2WRT A;  1YF1 A;  1AC1 A;  1BYE A;  1PKZ A;  3HY2 A;  1Z5Y E;  4HOJ A;  3D5J A;  3EC3 A;  3GH9 A;  4ZBA A;  2GQK A;  3TRX A;  2DJ1 A;  4OO5 A;  3QMX A;  4O92 A;  2CVD A;  5KOX A;  4G10 A;  1TRS A;  2VAF A;  5G30 A;  1A2J A;  4OCF A;  2F9S A;  5D9X A;  1SL1 B;  4GCI A;  4PUF C;  2HSM B;  1PX6 A;  2TRX A;  5DAL B;  2FWH A;  2C0D A;  10GS A;  4F82 A;  4ML6 A;  1EP8 A;  3TUE A;  2LST A;  1F9M A;  4EDY A;  5DAK B;  5CRE A;  3I69 A;  1PKW A;  1XFL A;  4FQU A;  3ZL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...