1OYQA

Trypsin inhibitor complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin, cationic
publication title Structural Basis for Inhibition Promiscuity of Dual Specific Thrombin and Factor Xa Blood Coagulation Inhibitors
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1oyqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1oyqA02
3RLWH 2F3CE 2WV5A 2ZP0H 3PWBA 5JDUB 3A7WA 3A89A 1NN6A 1MQ6A 2J92A 3V13A 2BY7X 6CHAB 2PSYA 3MFJA 3E91A 4B76A 1UHBA 2Z3CA 3EGKH 1O5BB 1P3CA 3DUXH 2GGVB 3A87A 1EXFA 5CHAC 3GCNA 4Y8YA 4NG9H 1P10A 3FAOA 2ZFTA 3MYWA 4KTCA 1Q31A 1HCGA 1ZTLA 2V0BA 1GMCF 4FVDA 1YBWA 2PV9B 4JYUH 3EA9A 2A7JA 1IQLA 2GKVE 2ZFPH 1EZXC 2HOBA 7LPRA 5HXFA 2FEQH 3GY5A 3SNCA 3SGAE 1P2QA 1YPMH 1OP8A 4IMQA 3RXEA 1XMNB 1GJBB 1NROH 3SUDA 3LGWA 3R3GB 4INLA 1INCA 3I78A 2OP9A 3L33A 5C1UA 2QXJA 1GBJA 3BTTE 3RC5A 1BRCE 1ANBA 1EP5A 3QZRA 3TPIZ 1JRTA 4RN6A 2XYAA 2OC7A 1O3LA 1ZHRA 1DSTA 3UREA 1TIOA 1Y8TA 3SV6A 3ATIA 1AFQB 4D76A 4ZHAA 4Y76A 8KME2 1OSSA 5DJ7A 1AO5A 3DHKH 1WOFA 2TBSA 3MH5A 4B2BA 2H5DA 1QB1A 1PFXC 1HYLA 2Y80A 1L1JA 1PPEE 3RU4T 5LH8A 5HM2A 1ELTA 1ESAA 1BBRE 1MTNB 2PGQB 2A7CA 3VB7A 1C1WH 2WUCA 3SUGA 2ZCKP 1C5WB 4YLQH 3KNXA 5DP8A 1ZJDA 2PLXA 2Z3DA 3LGYA 5C20A 1IQKA 3RC6A 2Z9KA 2XRCA 2QXGA 2GZ8A 2JKHA 3EA7A 3ENSB 3TNTA 1V2JT 3Q3KA 1O2UA 4A1XA 1TMBH 3SNDA 1HLTH 2P3UB 1AB9B 1BJVA 4NA7A 2FS8A 1YKTA 1GBTA 1GI1A 4CH8B 2Q6FA 1T8NA 3NUMA 1ANCA 1ZMJA 3MTYA 1L4DA 1LTOA 2ZTZA 3RXPA 1G32B 1LKBA 1C5UA 1PPBH 4MQAA 3RXUA 2BQ7B 2H2ZA 4RKJB 3VXEH 1KLJH 1NRNH 2VU8E 3TU7H 4A1TA 2BX4A 1Z71A 2A4GA 4KTSA 1ETRH 1D9IA 1DUEA 3VGCB 1W0YH 1K1MA 1CA8B 1L0ZA 3SU3A 1LQDB 1O2XA 1EAXA 1C4U2 2ZZUH 4DVAU 3UFAA 4FUHA 5E8EH 2J38A 2ZDAH 1SGCA 3GCTF 3T27A 1K1NA 4BAQB 3FP8E 1QBNA 2BVRH 1EZUC 3IG6B 1SGEE 1UVUH 2AGIX 1GBKA 3O8RA 4Y8ZA 3RMMH 2ZGXH 1ZMLA 3PV4A 2J34A 1CHOF 1J14A 2NU0E 1GHBF 1ZHMA 3MMGA 1JRSA 1T31A 3TK6A 3ESTA 3CS7A 3F9FA 2ZI2H 1O36A 1Y3VA 3LIWA 1WBGB 1YPGH 4NA9H 1GBLA 1SSXA 3SJOA 3GYMA 4TY7A 1QL8A 1UTNA 4OS6A 3OY5U 2ZF0H 1A4WH 1O5CB 4FXGH 1VJAU 2BQ6B 1GJ4H 1C5NH 1O2NA 2VH6A 1Z8IB 5G4BA 1W8BH 1Y59T 2O8TA 5GXPA 3TGKE 1B7XB 1C5ZB 1BTXA 1C5YB 1GBBA 1WSSH 2PFEA 2ZKSA 1DPOA 5EQSA 1DOJA 3A8CA 5F03A 4JZFH 3V0XA 4TWYA 1GHZA 4H6TA 3RMLH 4ABBA 4NSVA 2IPHA 1DX5M 3MNCA 2BLWA 3UNSA 4U01A 5LGOA 3C1KA 2H6MA 3AW0A 1ZTKA 1BDAA 2UWPA 4FUCA 1H8IH 1O32A 1ABIH 1Z8GA 1FAKH 3A8BA 2FOEA 1K28D 2JETC 1HAGE 1MMJN 4K1EA 3RU4E 3RC4A 1JMOH 3ATLA 2AIQA 3SHCH 2RG3A 8ESTE 4DT7B 2G8TA 2XCFA 2AIPA 5FX5A 1VITH 3PMBB 1SGRE 1GMDG 2PKSB 1LVYA 4MPUA 4Y0ZE 3UNRA 1VCPA 3PYHA 3RMOH 2SNVA 3RXBA 1XUFA 4BXWA 4BXSA 3AVZA 3QDZB 4OS4A 3LJJA 2FLRH 3F1SB 2FDAA 3RXVA 3A86A 1GHAF 2V3OH 4FU9A 4WWYA 3SJ8A 3LH1A 1TPSA 1O5GH 1C1TA 2DE9A 1IQEA 2NU4E 2ZTYA 2UWOA 4NIVA 3SV8A 3EYDA 2GD4B 1THSH 5C2ZA 2F9OA 1AZ8A 1ELFA 1O2VA 2ZFQH 2D2DA 5F8XA 1O5DH 1DWBH 1ZOMA 1J17T 2G55A 4NWKA 1KXFA 2A4OA 1DWEH 2FTMA 4X0WU 5A8ZA 1BTPA 1XUGA 1C5TA 1NPMA 5GJ4B 2IN2A 1TYNA 1QJ7B 3SBKA 4X2YA 4UFFH 1O2SA 2ANYA 1FDPA 4DOQA 5K0HA 1HNEE 1O3AA 3BTEE 2ZNKH 3M7QA 1TNLA 2WPHS 5B6OA 5FPTA 1DITH 2XBWA 3ZZ7A 1L4ZA 1HB0B 3GCOA 2VJ1A 1FONA 7GCHG 6GCHF 2BLVA 3KL6A 3BEUA 1Z8JB 3NPSA 2ZDVH 2O8LA 5EXMA 4MPWA 1RTFB 1B0FA 4ZXXH 5EXNA 2VIQA 1N6YA 4O9VA 1AUJA 2SGEE 1F5LA 2KAIA 1G30B 2BOHB 1SBWA 1C5QA 2QXHA 5JBAS 1Z1IA 1HAVB 1J15A 4FUIA 2ODYB 4K2YA 4NIXA 3EQ0H 3BN9A 1LQEA 5FBEA 5TCCA 1ZGIA 4Q2KA 5JBBS 4D7FA 2G00A 2BD7A 1GI9B 4XBBA 1AUTC 4X8TH 5L30H 1O38A 1ANEA 4BOHA 1XX9A 1PPFE 1WCZA 1V2KT 1FUJA 4VGCB 1QY6A 4R0IA 6CHAC 2B8OH 3P92A 4TYDA 2FYRA 3K6YA 2RDLA 5DP3A 3RUOA 3L6PA 3TITA 5IDKA 1AGJA 2NU1E 2ZQ2A 1TRNA 2ZO3H 4MDSA 2OUAA 1O2MA 1V2LT 4YZUA 1ETSH 2BLQA 1S5SA 2ZU2A 3QN7A 4IC6A 2K1QA 3TH2H 5FXLA 2OQ5A 2PUXB 1SHHB 4ZKNU 1EAIA 4WMDA 1PYTD 1GMHF 1W10U 1BITA 1RGQA 2B5TB 3ZZBA 3SNBA 2GDEH 3S9BA 3SNEA 4XBDA 1FAXA 4UE7H 1P2MA 4ABEA 1GMCG 1TBRH 3GY6A 1HPGA 1NRQH 2ALVA 4O3UA 4XDEA 1ZMNA 5DP4A 1CBWB 3MO9A 4FU8A 2ZPQA 3LH3A 2R2MB 3SV2H 4B1TA 1O2PA 5C3NA 4SGAE 1NFYA 1UVPA 2F9NA 1V2OT 4UFGH 3ZYEA 4OS5A 1S6FA 2OD3B 1PPGE 4UFDH 2H5CA 4Q7XA 4BTTB 4E7RG 4E7NA 3RU4D 2W26A 5FCKA 2FS9A 1UCYE 1IQNA 2PWXA 2YNBA 1HAXB 2EC9H 2ZCHP 3WY8A 3SGBE 3BTWE 1QQ4A 2A5AA 1AE8H 3IITA 1UK2A 2VB0A 3OX7U 1V2RT 4MG3A 3HKIB 3ZVCA 4WMEA 2SGFE 3ZZ4A 1IQIA 3W95A 3GISB 4ZHMU 1MTNC 4TPIZ 3V12A 3ODDA 3OY6U 1LCYA 1OX1A 3NWUA 4ABJA 3SORA 3TVJB 3TNSA 1HAOH 1P12E 1TOCB 3HK6B 2UUYA 4XE4A 1NFWA 1SGPE 2NU2E 4H6SB 1G2MA 4AFQA 4LOYH 4XOJA 1GBAA 1BTYA 2OTVA 3IWMA 2ULLA 2LNCA 1UVOA 2O8UA 1FPHH 1XVMA 1HIAB 3UY9A 7ESTE 1W7GH 3HATH 4OGYA 2FOMB 4ZKOU 5JB9S 2IJOB 3RLYH 2ODQA 1Z6EA 4UD9H 2O8WA 1OKXA 4ABGA 1KDQB 4X6PA 1BMMH 1O2GH 2F9UA 3BSQA 1D3TB 1GJ7B 1SGFG 3KEEA 1T7CA 1GJ6A 2QIQA 3PLKA 5EXLA 3ZZ3A 3SV9A 4KELA 3C27B 4JZ1A 1TGCA 1ZHPA 3ZZCA 2WPMS 2AMQA 1W2KH 9ESTA 3S7KB 1F0SA 3LC3A 1CHGA 5ABWA 1XKAC 5DG6A 1EP6A 1EQ9A 1ZPCA 1QB9A 2WINI 1HV7A 4Q7ZA 2OBQA 3RXHA 2ZDNA 4FUBA 2Z9JA 3FANA 3GCTG 2HGTH 1ANDA 1XUJA 5EPYA 3VEQB 3A8DA 1GI4A 3GY8A 1UK3A 4I8KA 1GJ9B 1C2JA 3E0NB 3RP2A 2H9TH 4CHAC 2FOHA 4I8HA 4X1RU 1A2CH 1CHOG 4JZDH 3PTBA 1GHBG 2A32A 1JBUH 2FOCA 2QC2A 2ZU4A 1DFPA 1QJ6B 1Y5AT 5FPSA 4H4FA 1QBVH 3UNQA 4CH2B 5CE1A 2W3IA 5FBIA 2BB4A 1O3HA 3BTFE 4D9RA 4Y0YE 4BAMB 1A7SA 5EU8A 4CRBA 1O0DH 1GWAA 1S84A 2CN0H 1FPCH 2TGPZ 1BTUA 2ZU5A 1SFQB 3RXLA 1GGDC 3ZVBA 1NS3A 1O2YA 2ZA5A 1C2DA 1XXDA 3P17H 2HLCA 1FQ3A 1LHCH 1QGFA 3FZDA 2HRVA 3P8NA 1YM0A 4ZKRU 1K1OA 2FOGA 2STAE 4AYYB 2A45B 2CMYA 2R3YA 1C2FA 1QRWA 4DW2U 2ZFSA 2TPIZ 2V35A 3UIRA 1DVAH 3TH4H 1XUKA 1LHEH 2ZC9H 1GCTB 3PM3A 5C67A 2PKSC 1TMUH 3LJOA 1C2EA 1C5SA 1W13U 4B73A 4DIIH 1TNIA 3PWCA 2ZHQH 1OXGA 4WXVA 1TQ0B 5E2PA 3AAUA 1UTPA 4IW4E 1ABJH 1MH0A 1O2LA 5C5NA 3MH7A 3M5OA 1OWKA 3M3VA 4U30A 2NWNA 4UDWH 1G37A 4B2AA 1GJDB 3SU5A 1YGCH 4E06H 3OTJE 5E0GA 1BIOA 4NIWA 4WF8A 1MBQA 4FUDA 4ZUHA 1FY4A 4BTUB 1RIWC 2BY8X 1CSOE 5E0HA 1HXFH 3BIVH 4IC5A 4MPVA 2O8MA 2O9QA 1UTOA 2OCVB 4K5ZA 1OWIA 2NU3E 1HAHH 3KCGH 3F9EA 2ZGCA 2VIOA 3RXSA 4SGBE 2ZQ1A 3T62A 4TPYA 5DKMA 1EJMA 4JK6A 3SUFA 5AFYH 1H9IE 3D65E 1AWHB 4KTUA 1GI0A 1KXBA 1YPLH 4GHTA 3RM2H 1EAWA 3MH4A 1QA0A 2QF3A 1AU8A 3QK1A 1YPEH 1P01A 1HAYB 4NZLA 1L1NA 1TFXA 3ZVGA 3M5LA 1QA7A 4NCYA 2OQUA 1HJAB 2ANKH 6GCHG 4Y79A 2BHGA 2VVUA 1BMLA 1ELDE 1HAVA 1ELVA 2HWLB 2F83A 3T2NA 2JH5D 1G36A 3SO3A 1SGDE 1O30A 3GDUA 2F9BH 2GCTB 1P2OA 1AHTH 4A92A 1TNJA 1YPKH 1BRAA 3NK8A 1EJNA 4CRFA 3RXCA 3LGIA 4UONA 3Q77A 1YC0A 2AS9A 1FIWA 1G3EA 3MU1A 1C5OH 2Z6BD 1TRMA 1ZRBA 3SU1A 1TOMH 3SUEA 3B8JA 3ZYDA 5A0CA 2RCEA 3HGPA 1XVOA 2AYWA 1HXEH 2WYGA 4X6OA 2SGDE 2ZU1A 4VGCC 4CBNA 1GBFA 2A1DB 4Y71A 3R0FA 1G3BA 2FWWA 4ZKSU 3TJUA 4H42U 2XWBI 1FIZA 1P9SA 1ZPZA 5EODA 1K21H 1OYQA 2PUQH 1UTKA 1MTWA 3A7VA 1VGCB 1C4V2 1BCUH 1UK4A 3E3TA 3U8TH 1S83A 1VCWA 3MU5A 2FYQA 2XCNA 1BOQA 3ZZ6A 4X6MA 1JWTA 3ATKA 3Q3YA 1GBCA 1OP0A 2FTLE 1HAZB 1YP9A 2FI5E 2ZTXA 3GY2A 4UEHH 4WJG2 1SGYE 3KHVA 1SL3A 3PMHB 4YT6H 2XTTB 1GMHG 1AD8H 4JZEH 1EB2A 3PMAB 2I6SA 1MAXA 1W7XH 4B71A 1DM4B 1P02A 3ZZAA 7KMEH 2EEKA 1CBWC 3HK3B 3BV9B 2ZDLA 4AZ2B 1FY1A 4KKDA 4DJZB 1LMWB 1NTPA 1EX3A 1YCPM 1AY6H 4R8TB 3BTME 2FOBA 2GV6A 3STIA 1DT2A 1GVLA 2BDAA 2WPLS 4CHAB 4CR9A 5JBCS 2C90B 4K60A 1FLEE 1C9TA 1QFKH 1HRTH 1SVPA 3RXKA 4I8GA 5GPIB 1GI2A 4XFQA 2FP7B 5E2OA 1ORFA 2XWAA 1P06A 1GDUA 1AFEH 5HYOA 2VWLA 1QJ1B 3VPKA 1DXPA 1THPB 1C1VH 1YYY1 3BTGE 3H7TA 4I31A 5FX6A 2XBXA 1FZZA 2CGAA 4WH6A 5DK1A 1GGDB 3O8DA 3GY3A 1TLDA 1W3CA 1QL9A 1CU1A 1D6WA 2J95A 3GCHB 2VIDA 1EZSC 1P2KA 4I7YH 2H9EH 1MAYA 1J8AA 2AERH 3MOCA 3LONA 4K69A 1XUHA 4THNH 1IQGA 2FMJA 3K65B 1GI8B 1D3PB 1WV7H 2VWOA 1IQMA 1G2LA 1HIAA 3TJNA 1N8OC 1BTWA 1P2JA 3SU6A 3AW1A 2BM2A 2CXVA 3ELAH 1C1QA 1VR1H 1C1OA 2QY0B 2Z9GA 1SQAA 1AI8H 3BEFB 4HTCH 4ISIH 3CP7A 4IMZA 3U69H 1PQ7A 1QNJA 1TBZH 1KDQA 1K1LA 4FUGA 4X2WA 4XBCA 3NCLA 4MNVA 1CA0C 1O3JA 2STBE 1H1BA 1GBEA 1L1GA 5TCAA 1LPKB 1ZPBA 2ZHEH 3PLBA 1P2IA 3U1IB 3QGJA 2C4FH 3PLPA 2W7UA 5K7RA 1KYNA 2A4RA 1C1RA 4LZ1H 5C1XA 3A7YA 1EASA 1AVWA 3TIUA 1ZZZA 1RIWB 1YF4A 4BAKB 1A0HB 2F9PA 1BJUA 2P16A 1UHBB 2A31A 2A5KA 1GJ5H 3DFJA 2D8WA 3P6ZB 2PTNA 1RRKA 1F0UA 2FM2A 3DA9B 4Y8XA 4PROA 1GBIA 1Y3XA 3FZZA 2HPQH 5I25A 2XC0A 1AWFH 1O3OA 4J2YB 3UUZA 3ZV8A 2YOLA 3KIDU 2HNTC 2A5IA 3ZVAA 4Y10E 1SHYA 1GHWH 2BTCE 3E0PB 2Y5FA 4D7GA 4X8SH 5J4QA 3EE0B 1GBHA 2ZDKA 3LKWA 4ESTE 1B0EA 2ZIQH 1G3CA 2TGTA 2Q6GA 3P8OA 1CQQA 3B9FH 4JCNA 1OPHB 1DLEA 1WUNH 3V3MA 1B5GH 1BZXE 3BG4B 4GUXA 2C8ZB 3KQDA 2C8YB 2HVXA 3QTOH 4GAWA 2J9NA 1NRRH 1O3DA 2B0FA 3HPTB 5DP5A 2FODA 1C1PA 3TK5A 5GWZA 5SGAE 1Y3UA 2OC0A 4AG2A 1W12U 2A0QB 3A7ZA 5FHTA 3A81A 1BHXF 4AFUA 3JZ2B 1V2QT 1T4VH 1FN6A 1E36B 4KP0A 1YCPK 2AEIH 3D23A 1LVMA 1SB1H 2A2XH 3MO3A 2QN5T 2Y7XA 3U98H 1EOJA 2GT7A 3U1JB 1DY8A 1MCVA 1O5AB 2VGCB 3UPEA 4ISNA 2WPIS 1PQ8A 2V3HH 4NSYA 2BD8A 4Q7YA 5EGMA 4FU7A 3SJKA 2ZEBA 6ESTA 2CJIA 1GCTC 4X1SU 3CS0A 3T25A 4LXBH 4YLUA 2W3KA 4D8NA 2SGQE 1A46H 1ZJKA 1V2UT 4ISHH 1P9UA 3TGIE 1ESTA 1LHFH 2XC5A 2BLOA 5LPRA 4TWWA 1A5HA 1S81A 3I29A 3UR9A 2SNWA 3ZZ9A 4LK4A 1G9IE 1C4Y2 3SU4A 1TALA 2BXTH 1IQJA 3UOUA 3LDXH 6LPRA 4HFPB 1GHXH 1ELCA 4AFSA 3LGUA 3M36A 1AKSB 1OWEA 1S6HA 4INHA 1Z8RA 1Q3XA 3Q3XA 2RA3A 5PTPA 3LGTA 2A4QA 3FP7E 4IGDA 2P95A 2UUFB 1DY9A 1WTGH 1MU8B 4MLFB 2VH0A 1EPTC 1BUIA 3T28A 1DWDH 3LPRA 4Y6DA 1V2ST 1FJSA 1K1JA 1ZR0A 3U8OH 1RFNA 2W7SA 1GBMA 1K2I1 3RXQA 3P95A 5C5OA 1QBOA 4J1YA 4Z6AH 2HALA 1MCTA 4I33A 1W11U 1KTSB 3CENA 3MU0A 3UWJH 1C5RA 1T8OA 2AMPA 5E0JA 2SGPE 1AVGH 1CT2E 2ZFFH 4DG4A 3MI4A 1S85A 3MWIU 4MNWA 3E90B 4U32A 4GHQA 1QCPA 1BTZA 1HJAC 2BDCA 1THRH 2XXLA 2G4UA 8GCHF 3F68H 1KXCA 1CGIE 1O2RA 4INKA 3ATWA 1ID5H 4HZHA 1HDTH 3LOXA 3H5CB 1O39A 2GCTC 3M3TA 2BD4A 1LVBA 1A61H 1OWJA 2FZZA 1C1MA 3SU2A 3MH6A 3PTNA 1N8OB 2GZ9A 2GDDA 1TPAE 4HGCA 1IQFA 2FPZA 2PKAB 1W14U 2R0LA 4YM9A 1V2NT 3VB4A 1TBQH 1P2NA 2GX4A 4GCHF 2EA3A 1GJAB 5F8ZA 3SU0A 3BTDE 1FXYA 2ZFRH 2D26C 3D62A 1K1IA 1F0TA 1FI8A 3KF2A 1TGBA 1TONA 1GDNA 4X8VH 1CA0B 2WPKS 2ZHFH 4A5TS 1O5FH 1QRZA 1EJAA 3UQOA 5HM9A 4F4OC 2BZ6H 1CO7E 4ISLA 1XM1A 1VGCC 5T6GA 4A7IB 1N1LA 4DIHH 3SOSA 3DD2H 4WVPE 2ASUB 1OWDA 1MU6B 3LC5A 1LHGH 1TNKA 3OU0A 1TPOA 1C5PA 1V2PT 1TA6A 4AX9H 4WMFA 1O3MA 5AFZH 3OSYA 3T5FH 4CREA 1K1PA 2Y5HA 3AAVA 5CMXH 3SHAH 1AE5A 4NZQA 5EG4A 4JMYA 1PQ5A 3QO6A 3TJOA 1T32A 1TGSZ 1DICA 1NRPH 1SGIB 1E37B 1BA8B 2ZPRA 1DLKB 5L6NH 1SOTA 2BXUH 1BQYA 2B7DH 5A0BA 1PPCE 3M35A 2GV7A 4HI3A 1WYKA 1GL0E 3K9XB 1ELBA 1MTSA 1TWXB 4ZAEA 1O2QA 2Y82A 1C1UH 1VITF 5GCHF 1V2VT 4AOQA 4NA8A 4GPGA 2BDYA 5JB8S 1P04A 2BVXH 1A0JA 1DXWA 1C1SA 2G51A 2AGGX 1IQHA 5JYIA 2FX4A 2ZGBH 1C2IA 3KN2A 4BTIB 1F2SE 1PJPA 3RXRA 1EOLA 5FCRA 3M61U 2VWNA 1AN1E 2F91A 3NKKA 1H4WA 2ZECA 1SGFA 3HGNA 3RMNH 1CGHA 2HPPH 3SZNA 1AMHA 8LPRA 4OS7A 1UTMA 3GCHC 2Y81A 2R9PA 3TK9A 5J4SA 1NU7B 2V6NA 4A6LA 3I77A 5EQQA 3GDVA 1A3EH 1C1NA 1F7ZA 1LDTT 1LPZB 2G52A 4CRDA 1Q2WA 1SFIA 3P8FA 1JIMA 3SQEE 1G3DA 1VZQH 4IN2A 1KXEA 2OLGA 2KAIB 3GYLB 4AG1A 1A0LA 2PSXA 1ESBA 3M7TA 1MZAA 3QGNB 1F0RA 4ZROA 3RXGA 1LKAA 2WV4A 1UTQA 3EAJA 2Z9IA 2G5VA 5GDSH 1TPPA 1A5GH 3ZZ8A 1CVWH 2UUJB 5ESBA 4CBOA 3QZQA 4MPXA 1O2ZA 3S9AA 1HFDA 3RXIA 1TE0A 4AB8A 4AFZA 1GJCB 1OS8A 2H9HA 4I32A 5A2MH 1PPHE 2PR3A 3RXTA 2G81E 1SLUB 1SC8U 1F5KU 1EB1H 1GI7B 1O31A 1BBRK 1GHAG 3V7TA 1SR5C 4F49A 1IOEA 5HGGA 2ANMH 2RA0A 3A7XA 4CRCA 2BDGA 3BEIB 3F9GA 2Y7ZA 1BRBE 2ZHWH 3URCA 1BMNH 1C2GA 1EKBB 5EPNA 2AH4X 1CT4E 1SLXB 1V2MT 2TGAA 5IYTA 1KLIH 2FI4E 2ZHDA 1EPTB 1JOUB 2PHBA 3EDXB 3SW2B 4ABDA 4JYVH 5EW1H 1VJ9U 2AGEX 3UR6A 3SN8A 1GVKB 3MNSA 1SGNE 1EATA 2FOFA 2HNTE 1QL7A 4CRGA 1SOZA 1Y5BT 4RSPA 3KQBA 4YESB 3UWIA 1KLTA 4K1SA 3BG4C 3N7OA 1EUFA 1VCQA 3KGPA 3M3SA 5BPEA 1K22H 1O3KA 4TY6A 1MTVA 3ZVEA 2P3FH 3SI3H 1OWHA 1MBMA 1O35A 4CR5A 4NFFA 4BANB 1D4PB 1ZGVA 3SQHE 2WYJA 4FUEA 1KSNA 1QHRB 5F8TA 4E05H 1C2MA 1GI3A 4YOJA 1OYTH 3PO1C 3BTKE 2FOAA 2J4IA 1QURH 2GP9B 2QYIA 2G5NA 5AHGH 4YT7H 2GMTC 1KIGH 1YPHC 1UTLM 1NRSH 2VGCC 2BD3A 4GVUA 1O2KA 2Y6TA 2QAAA 4FUFA 3A88A 3MNBA 3T29A 5DO4H 4I8JA 3VB6A 2J2UA 2Z94A 3Q76A 1MUEB 3RDZA 2P3TB 1TX6A 2C8WB 2OC8A 2VVVA 1C2LA 3ZVFA 2Q6DA 4AN7A 1C5VA 1NY22 5DP6A 2GCHF 4GSOA 1DUAA 1O2TA 1O37A 1AKSA 1F5RA 4U2WA 4X2XA 4AORA 1SPJA 4AGKA 2BOKA 4JYTA 3K2UA 1RXPA 1O2JA 2P59A 1WQSA 2ESTE 1MD8A 1ARBA 1PQAA 3F9HA 2R2WU 3ZZDA 5A8XA 4ABIA 3SJIA 1NFUA 3QX5H 3ITIA 3S0NA 1FN8A 4B75A 3S7HB 1MQ5A 1O2WA 5AVDA 1TGNA 2BYAX 3GICB 1TX7A 1SI5H 2P93A 1H8DH 4YO9A 1SQOA 2SGAA 2VWMA 4ABHA 1MKWK 1BB0B 1FY5A 1TB6H 1P03A 1RTKA 2BY9X 4B2CA 1SLWB 2XW9A 2CHAC 2D1JA 1TQ7B 5AF9H 5F6MA 1BBRH 1C9PA 1AVXA 1H9HE 1X7AC 4WY3A 3HKJB 2OINA 4K8YA 3MU8A 2W5EA 5JPMH 3MO6A 1J16A 1YLDA 3E1XB 1O2OA 2GTBA 2PTCE 2GZ7A 2P8OB 9LPRA 2TGDA 1UO6A 4X1QU 1N6XA 2JH0D 2ZG0H 1EAUA 4IN1A 4BNRA 1P0SH 1S82A 5ETXA 1ETTH 5HMAA 1FY3A 2WPJS 2Z7FE 2PKAA 1GBDA 2I6QA 1AQ7A 3ZZ5A 1HAIH 8GCHG 1GHVH 1P3EA 1M9UA 2BY6X 1DDJA 2FLBH 5T6FA 1IAUA 1MKXK 1J9CH 3UTUH 1A3BH 1RS0A 2LPRA 4ZXYH 4MVNA 1ZYOA 2VNTA 1K9OE 3M5MA 1P09A 3BF6H 2QGRA 4IBLH 1ZRKA 4GCHG 2CF9H 3QUMP 3SNAA 3PROA 4Q80A 1SGQE 3STJA 3BIUH 1UMAH 1KXAA 1UVSH 1O3BA 1FY8E 4FVBA 4NIYA 4YTAA 1NT1A 1NFXA 1XKBC 1D6RA 1Z1JA 2CV3A 1GDQA 3BG8A 5CHAB 5T3HA 5T6DA 4KGAA 5GIBA 5I46H 5JBTA 1WU1A 1P11E 3DT0H 1TMTH 1BT7A 2GT8A 1GPZA 3U9AH 3MNXA 5L2YH 1E34B 3URDA 2FIRH 1RJXB 3S69A 2AMDA 1T8LA 1D3DB 1A1RA 1LHDH 5BRRE 1C5MD 2P94A 1ELGA 4CRAA 1ELAA 1CGJE 1TABE 3PB1E 3D49H 1O5EH 1LPGB 5DGJA 1DS2E 1C5XB 4RKOB 1Y3WA 3T26A 4O3TA 4AB9A 2ZWLH 4I8LA 5A09A 1HAPH 1V6DA 2OC1A 2VIVA 3A7TA 3A84A 1NC6A 2A7HA 3GY7A 1O3EA 3VB3A 1VITG 5GCHG 4GLYA 3VFEA 4BAHB 1WAYB 3M7UA 4ZMAH 2BDIA 5LPEA 1A5IA 4OGXA 4ASHA 3A82A 1MKWH 2THFB 3ATMA 1GG6C 2TRMA 1O2HA 4X2VA 2R0KA 2WUBA 3PO1B 1NZQH 3LU9B 1HUTH 1T4UH 3FVFB 3VXFH 2GMTB 2H1UA 5FAHA 1TX8A 1YLCA 4WH8A 1PPZA 3SGQE 5LPFA 1DSUA 1YPJH 3QTVH 4DY7B 2BQWB 1KXDA 4NGAH 2UUKB 4ZH8A 3SV7A 4ISOA 4Y7AA 1RTLA 1O3PB 4K8BA 2ODPA 2BVSH 2XNIA 1CE5A 1U6QA 1O33A 4D9QA 4XSKU 2FXRA 2ANWA 4MNXA 4MTBA 2F9VA 1O3CA 1UCYK 1O34A 1QTFA 3GDSA 3E8LA 2VIWA 1UJ1A 2BMGB 1HBTH 4X8UH 1E35B 1DWCH 1BMAA 1E0FD 2XC4A 1D3QB 1TRYA 1MKXH 3A85A 1FMGA 1UTJA 4YOIA 2M5TA 4UFEH 4NWLA 3LGVA 2FO9A 2GVFA 3TH3H 4X1PU 3W94A 2PW8H 1CT0E 1DE7H 4BAOB 4AYVB 1EPTA 1GI5A 4DCDA 3NZIA 5A0AE 1C5LH 2FX6A 4X1NU 1Z6JH 2C3SA 1JXPA 5A8YA 1WTHD 2Q1JA 3L3TA 5ESTE 3TLOA 1BRUP 1XUIA 2BDBA 2ZU3A 3BTHE 3NXPA 2Y5GA 3ODFA 1EZQA 3RXMA 1TAWA 1HJ9A 2CHAB 2BY5X 1DANH 1LO6A 1XXFA 5C1YA 2IOTA 4Z0KA 1ZTJA 1O3IA 1QIXB 2QCYA 1GCDA 2FI3E 1BHXB 3DFLA 1W0ZU 1V2WT 5TJXA 4AGJA 1PYTC 1TNHA 4ABFA 5EW2H 1LVOA 1Z7KA 1KY9A 1ZSJA 1HGTH 1UVTH 2TIOA 2BDHA 1AFQC 1MZDA 1JIRA 1ZSLA 2HNTF 3RXFA 2ZDMA 1BTHH 2ZGHA 3P70B 3GOVB 4Y11E 5L2ZH 4NFEA 1AZZA 2Z9LA 2ZPSA 3Q00A 1KTTB 3S9CA 3MU4A 2Z3EA 2OBOA 3UQVA 3PMJA 1E38B 3ZV9A 2B9LA 3M5NA 2BD5A 1YPHE 3F6UH 3KQCA 2ZCLP 1P57B 4DURA 2EI6A 4JK5A 2JETB 4K1TA 2DE8A 1GMDF 3B23B 2YNAA 4JZIA 1SQTA 2BD2A 4LZ4B 2VIPA 3EA8A 1Y5UT 1QB6A 1YCPH 1NU9A 2QV1A 1O3FA 2UWLA 5EQRA 3TJVA 1AB9C 3FP6E 2JH6D 3G01A 4O97A 2DUCA 3LT3A 1IHTH 1SLVB 1NESE 2GCHG 3QWCH 3AASA 3KQEA 4QT8C 1MTUA 3RXDA 1ZSKA 2AFQB 3JZ1B 4OS2A 3VGCC 1H9LB 4K3JA 1UCYH 1TNGA 2VINA 3QLPH 1OP2A 1V3XA 3FFGA 4B74A 1QR3E 3BTQE 1RD3B 2C93B 1WQVH 1NM6A 2QA9E 3U8RH 5DPAA 5DP7A 4ABAA 1HJ8A 4YOGA 2ZGJA 3RXAA 1ELEE 1C2HA 1GHYH 2R3UA 1FNIA 2PGBB 2SFAA 4FUJA 1QQUA 3E6PH 3RXJA 1ACBE 1O3GA 1GL1A 1FV9A 1GVZA 1S0QA 4IS5A 2ILNA 3O8CA 2G4TA 3O8BA 5FPYA 1P05A 2FESH 4WXIA 7GCHF 2C8XB 4M7GA 2BD9A 1IHSH 2EI7A 1C2KA 2BX3A 3A8AA 3MHWU 2OXSA 1V2TT 2P8OC 3OYPA 4MNYA 2EI8A 4OS1A 1SGTA 3H7OA 4DGJA 3TGJE 1GI6A 1GG6B 1P8VC 2ALPA 2J94A 3GY4A 5EOKA 4ZHLU 2QF0A 3M37A 5DP9A 3A83A 1AIXH 1TGTA 1ZLRA 3SJ9A 2A2QH 3RM0H 2QXIA 3K6ZA 1ARCA 1S0RA 1OOKB 1T8MA 3SI4H 2XBYA 1QRXA 2CF8H 5H4IB 2VVCA 1SG8B 2XBVA 1L2EA 3VB5A 4A1VA 3E16B 3P8GA 3A80A 1TA2A 4O03A 1O3NA 2BZAA 1F92A 1Y3YA 3RXOA 1NO9H 1MD7A 4Y7BA 1GJ8B 1SMFE 1O2IA 4X6NA 3ZVDA 3UOPA
chains in the Genus database with same CATH superfamily
3RLWH 2F3CE 2WV5A 2ZP0H 3PWBA 5JDUB 3A7WA 3A89A 1NN6A 1MQ6A 2J92A 3V13A 2BY7X 6CHAB 2PSYA 3MFJA 3E91A 4B76A 1UHBA 2Z3CA 3EGKH 1O5BB 1P3CA 3DUXH 2GGVB 3A87A 5DSFA 1EXFA 5CHAC 3GCNA 4Y8YA 4NG9H 1P10A 3FAOA 2ZFTA 3MYWA 4KTCA 1Q31A 1HCGA 1ZTLA 2V0BA 4ACBA 1GMCF 4FVDA 1YBWA 2PV9B 4JYUH 3EA9A 2A7JA 1IQLA 2GKVE 2ZFPH 1EZXC 2HOBA 7LPRA 5HXFA 2FEQH 3GY5A 3SNCA 3SGAE 1P2QA 1YPMH 1OP8A 4IMQA 3RXEA 1XMNB 1GJBB 1NROH 3SUDA 3LGWA 3R3GB 4AC9A 4INLA 1INCA 3I78A 2OP9A 3L33A 5C1UA 1FX0B 2QXJA 1GBJA 3BTTE 3RC5A 1BRCE 1ANBA 1EP5A 3QZRA 3TPIZ 1JRTA 4RN6A 2XYAA 4P00A 2K0QA 2OC7A 1O3LA 1ZHRA 1DSTA 3UREA 1TIOA 1Y8TA 3SV6A 3ATIA 2YMSD 1AFQB 4D76A 4ZHAA 4Y76A 8KME2 1OSSA 5DJ7A 1AO5A 3DHKH 1WOFA 3FKSD 2TBSA 3MH5A 4B2BA 2H5DA 1QB1A 1PFXC 1HYLA 2Y80A 1L1JA 1PPEE 3RU4T 5LH8A 5HM2A 1ELTA 1ESAA 1BBRE 1MTNB 2PGQB 2A7CA 3VB7A 1C1WH 2WUCA 3SUGA 2ZCKP 1C5WB 4YLQH 3KNXA 5DP8A 1ZJDA 2PLXA 2Z3DA 3LGYA 5C20A 1IQKA 3RC6A 2Z9KA 2XRCA 2QXGA 2GZ8A 2JKHA 3EA7A 3KYGA 3ENSB 3TNTA 1V2JT 3Q3KA 1O2UA 4A1XA 1TMBH 3SNDA 1HLTH 2P3UB 1AB9B 1BJVA 1EFRD 4NA7A 2FS8A 1YKTA 1GBTA 1GI1A 4CH8B 2Q6FA 1T8NA 3NUMA 1ANCA 1ZMJA 3MTYA 1L4DA 1LTOA 2ZTZA 3RXPA 1G32B 1LKBA 1C5UA 1PPBH 4MQAA 3RXUA 2BQ7B 2H2ZA 4RKJB 3VXEH 1KLJH 1NRNH 2VU8E 3TU7H 4A1TA 2BX4A 1Z71A 2A4GA 4KTSA 1ETRH 2J98A 1D9IA 1DUEA 3VGCB 1W0YH 1K1MA 1CA8B 1L0ZA 3SU3A 1LQDB 1O2XA 1EAXA 1C4U2 2ZZUH 4DVAU 3UFAA 4FUHA 5E8EH 2J38A 2ZDAH 1SGCA 3GCTF 3T27A 1K1NA 4BAQB 3FP8E 1QBNA 2BVRH 1EZUC 3IG6B 1SGEE 1UVUH 3VG8A 2AGIX 1GBKA 3FOAA 3O8RA 4Y8ZA 3RMMH 2ZGXH 1ZMLA 3PV4A 2J34A 3PRBA 1CHOF 1J14A 2NU0E 1GHBF 1ZHMA 3MMGA 1JRSA 1T31A 3TK6A 3ESTA 3CS7A 3F9FA 2ZI2H 1O36A 1Y3VA 3LIWA 1WBGB 1YPGH 4NA9H 1GBLA 1SSXA 3SJOA 3GYMA 4TY7A 1QL8A 1UTNA 4OS6A 3OY5U 2ZF0H 1A4WH 1O5CB 4FXGH 1VJAU 2BQ6B 1GJ4H 1C5NH 1O2NA 2VH6A 1Z8IB 5G4BA 1W8BH 1Y59T 2O8TA 5GXPA 3TGKE 1B7XB 1C5ZB 1BTXA 1C5YB 1GBBA 1WSSH 2PFEA 2ZKSA 1DPOA 5EQSA 1DOJA 3A8CA 5F03A 4JZFH 3V0XA 4TWYA 1GHZA 4H6TA 3RMLH 4ABBA 4NSVA 2IPHA 1DX5M 3MNCA 2BLWA 3UNSA 4U01A 5LGOA 3C1KA 2H6MA 3AW0A 1ZTKA 1BDAA 2UWPA 2WHXA 4FUCA 1H8IH 1O32A 1ABIH 1Z8GA 1FAKH 3A8BA 4YXWD 2FOEA 1K28D 2JETC 1HAGE 1MMJN 4K1EA 3RU4E 3RC4A 1JMOH 3ATLA 2AIQA 3SHCH 2RG3A 8ESTE 4DT7B 2G8TA 2XCFA 2AIPA 5FX5A 1VITH 3PMBB 1SGRE 1GMDG 2PKSB 1OHHD 1LVYA 4MPUA 4Y0ZE 3UNRA 1VCPA 3PYHA 3RMOH 2SNVA 3RXBA 5C0TA 2JJ2D 3WW7A 4F48B 1XUFA 3WWFA 4BXWA 4BXSA 3AVZA 3QDZB 4OS4A 3LJJA 2FLRH 3F1SB 2FDAA 3RXVA 3A86A 1GHAF 2V3OH 4FU9A 4WWYA 3SJ8A 3LH1A 1TPSA 1O5GH 1C1TA 2DE9A 1IQEA 2NU4E 2ZTYA 2UWOA 4NIVA 3SV8A 3EYDA 2GD4B 1THSH 5C2ZA 2F9OA 1AZ8A 1ELFA 1O2VA 2ZFQH 4Q4LA 5CHBA 2D2DA 5F8XA 1O5DH 1DWBH 1ZOMA 1J17T 2G55A 4NWKA 1KXFA 2A4OA 1DWEH 2FTMA 4X0WU 5A8ZA 1BTPA 1XUGA 1C5TA 5KECA 1NPMA 5GJ4B 2IN2A 1TYNA 1QJ7B 3SBKA 4X2YA 4UFFH 1O2SA 3H09A 2ANYA 1FDPA 4DOQA 5K0HA 1HNEE 3OEED 1O3AA 3BTEE 2ZNKH 3M7QA 1TNLA 2WPHS 5B6OA 5FPTA 1DITH 2XBWA 3ZZ7A 1L4ZA 1HB0B 3GCOA 2VJ1A 1FONA 7GCHG 6GCHF 2BLVA 3KL6A 3BEUA 1Z8JB 3NPSA 2ZDVH 2O8LA 5EXMA 4MPWA 1RTFB 1B0FA 4ZXXH 5EXNA 2VIQA 1N6YA 4O9VA 1AUJA 2SGEE 1F5LA 2KAIA 1G30B 2BOHB 1E79D 1SBWA 1KMHB 1C5QA 2QXHA 5JBAS 1Z1IA 1HAVB 1J15A 4FUIA 2ODYB 4K2YA 4NIXA 3EQ0H 3BN9A 1LQEA 5FBEA 5TCCA 1ZGIA 4Q2KA 5JBBS 4D7FA 2G00A 2BD7A 1GI9B 4XBBA 1AUTC 4X8TH 5L30H 1O38A 4I86A 3ZIAD 1ANEA 4BOHA 1XX9A 1PPFE 1WCZA 1V2KT 1FUJA 4VGCB 1QY6A 4R0IA 2W6JD 2B8OH 3P92A 4TYDA 2FYRA 6CHAC 3K6YA 2RDLA 5DP3A 3RUOA 3L6PA 3TITA 5IDKA 1AGJA 2NU1E 2ZQ2A 3PV2A 1TRNA 2ZO3H 4MDSA 2OUAA 1O2MA 1V2LT 4YZUA 1ETSH 2BLQA 1S5SA 2ZU2A 3QN7A 4IC6A 2K1QA 3TH2H 5FXLA 2OQ5A 2PUXB 1SHHB 4ZKNU 1EAIA 4WMDA 1PYTD 1GMHF 1W10U 1BITA 1RGQA 2B5TB 3ZZBA 3SNBA 2GDEH 3S9BA 3SNEA 4XBDA 1FAXA 4UE7H 1P2MA 4ABEA 1GMCG 1TBRH 3GY6A 1HPGA 1NRQH 2ALVA 4O3UA 4XDEA 1ZMNA 5DP4A 1CBWB 3MO9A 4FU8A 2ZPQA 3LH3A 2R2MB 3SV2H 4B1TA 1O2PA 5C3NA 4SGAE 1NFYA 1UVPA 2F9NA 1V2OT 4UFGH 3ZYEA 4OS5A 1S6FA 2OD3B 1PPGE 4UFDH 2H5CA 4Q7XA 4BTTB 4E7RG 4E7NA 3RU4D 2W26A 5FCKA 2FS9A 1UCYE 1IQNA 2PWXA 2YNBA 1HAXB 2EC9H 2ZCHP 3OEHD 3WY8A 3SGBE 3BTWE 1QQ4A 2A5AA 1AE8H 3IITA 1UK2A 2VB0A 3OX7U 1V2RT 4MG3A 2KX4A 3HKIB 3ZVCA 4WMEA 2SGFE 3ZZ4A 1IQIA 3W95A 3GISB 4ZHMU 1MTNC 4TPIZ 3V12A 1WXRA 3ODDA 3OY6U 1LCYA 1OX1A 3NWUA 4ABJA 3SORA 3TVJB 3TNSA 1HAOH 1P12E 1TOCB 3HK6B 2UUYA 4XE4A 1NFWA 1SGPE 2NU2E 4H6SB 1G2MA 4AFQA 3EE7A 4LOYH 4XOJA 1GBAA 1BTYA 2OTVA 3IWMA 2ULLA 2LNCA 3F2GA 1UVOA 2O8UA 1FPHH 1XVMA 1HIAB 3UY9A 7ESTE 1W7GH 3HATH 4OGYA 2FOMB 4ZKOU 3KYFA 5JB9S 2IJOB 3RLYH 2ODQA 1Z6EA 4ZCNA 4UD9H 2O8WA 1OKXA 4ABGA 1KDQB 4X6PA 1BMMH 1O2GH 2F9UA 3BSQA 1D3TB 1GJ7B 1SGFG 3KEEA 1T7CA 1GJ6A 2QIQA 3PLKA 5EXLA 3ZZ3A 3SV9A 4KELA 3C27B 4JZ1A 1TGCA 1ZHPA 3ZZCA 2WPMS 2AMQA 1W2KH 9ESTA 3S7KB 1F0SA 3LC3A 1CHGA 5ABWA 1XKAC 5DG6A 1EP6A 1EQ9A 1ZPCA 1QB9A 2WINI 1HV7A 4Q7ZA 2OBQA 4XRNA 3RXHA 2ZDNA 4FUBA 2Z9JA 3FANA 3GCTG 2HGTH 1ANDA 1XUJA 5EPYA 3VEQB 3A8DA 1GI4A 3GY8A 1UK3A 1W0JD 4I8KA 1GJ9B 2L6OA 2QE7D 2L74A 1C2JA 3E0NB 3RP2A 2H9TH 4CHAC 2FOHA 4I8HA 4X1RU 1A2CH 1CHOG 4JZDH 3PTBA 1GHBG 2A32A 1JBUH 2FOCA 2QC2A 2QF4A 2ZU4A 1DFPA 1QJ6B 1Y5AT 5FPSA 4H4FA 1QBVH 3UNQA 4CH2B 5CE1A 2W3IA 5FBIA 2BB4A 1O3HA 1SQRA 3BTFE 4D9RA 4Y0YE 4BAMB 1A7SA 5EU8A 4CRBA 1O0DH 1GWAA 1S84A 2CN0H 1FPCH 4FOUC 2TGPZ 1BTUA 2ZU5A 1SFQB 3RXLA 1GGDC 3ZVBA 1NS3A 1O2YA 2ZA5A 1C2DA 1XXDA 3P17H 2HLCA 5DN6D 1FQ3A 1LHCH 1QGFA 3FZDA 2HRVA 3P8NA 1YM0A 4ZKRU 1K1OA 2FOGA 2STAE 4AYYB 2A45B 2CMYA 2R3YA 1C2FA 1QRWA 5FL7D 4DW2U 2ZFSA 2TPIZ 3DSGA 2V35A 3UIRA 1DVAH 3TH4H 1XUKA 1LHEH 2ZC9H 5C94A 1GCTB 2JDID 3PM3A 5C67A 2PKSC 4OM9A 1TMUH 3LJOA 1C2EA 1C5SA 1W13U 4B73A 4DIIH 1TNIA 3PWCA 2ZHQH 1OXGA 4WXVA 1TQ0B 5E2PA 3AAUA 1UTPA 4IW4E 1ABJH 1MH0A 1O2LA 5C5NA 3MH7A 3M5OA 1OWKA 2KCYA 3M3VA 4U30A 2NWNA 4UDWH 5EJ1A 1G37A 4B2AA 1WDIA 1GJDB 3SU5A 1YGCH 4E06H 3OTJE 5E0GA 1BIOA 4NIWA 4WF8A 1MBQA 4FUDA 4ZUHA 1FY4A 4BTUB 1RIWC 2BY8X 1CSOE 5E0HA 1HXFH 3BIVH 4IC5A 4MPVA 2O8MA 2O9QA 1UTOA 2OCVB 4K5ZA 1OWIA 2NU3E 1HAHH 3KCGH 3F9EA 2ZGCA 2VIOA 3DSPA 3RXSA 4SGBE 2ZQ1A 3T62A 4TPYA 1W0KD 5DKMA 1EJMA 4JK6A 2QF5A 3SUFA 5AFYH 1H9IE 1NBME 2HLDD 3D65E 1AWHB 4KTUA 1GI0A 1KXBA 1YPLH 4GHTA 3RM2H 1EAWA 3MH4A 1QA0A 2QF3A 1AU8A 1QZ8A 3QK1A 2WV9A 1YPEH 1P01A 1HAYB 4NZLA 1L1NA 1TFXA 3ZVGA 2K8IA 3M5LA 1QA7A 1YY3A 4NCYA 2OQUA 1HJAB 2ANKH 3F0PA 4Y79A 2BHGA 6GCHG 2VVUA 1BMLA 1ELDE 1HAVA 1ELVA 2HWLB 2F83A 3T2NA 2JH5D 1G36A 3SO3A 1SGDE 5C17A 1O30A 3GDUA 2F9BH 2GCTB 1P2OA 1AHTH 4A92A 1TNJA 1YPKH 1BRAA 3NK8A 1EJNA 5EJLA 4CRFA 4XD7D 3LGIA 3RXCA 4UONA 2KCPA 3Q77A 1YC0A 3UB0A 2AS9A 1FIWA 1G3EA 3SYJA 3UAIC 3MU1A 1C5OH 2Z6BD 1TRMA 1ZRBA 3SU1A 1TOMH 3SUEA 3B8JA 3ZYDA 5A0CA 2RCEA 3HGPA 1XVOA 2AYWA 1HXEH 2WYGA 4X6OA 2SGDE 2ZU1A 4VGCC 4CBNA 1GBFA 2A1DB 4Y71A 3R0FA 1G3BA 2FWWA 4ZKSU 3TJUA 4H42U 4F55A 2XWBI 4RT0A 2GJGA 1FIZA 1P9SA 1ZPZA 3PV5A 5EODA 1K21H 1OYQA 2PUQH 1UTKA 1MTWA 3A7VA 1VGCB 5HIZA 1C4V2 1BCUH 1UK4A 3E3TA 3U8TH 1S83A 1VCWA 3MU5A 2FYQA 2XCNA 1BOQA 3ZZ6A 4X6MA 1JWTA 3ATKA 3Q3YA 1GBCA 1OP0A 2FTLE 1HAZB 1YP9A 2FI5E 2ZTXA 3GY2A 4UEHH 4WJG2 1S6LA 1SGYE 3KHVA 1SL3A 3PMHB 4YT6H 2XTTB 1GMHG 1AD8H 2VBCA 2XOKD 4JZEH 1EB2A 3PMAB 2I6SA 1MAXA 1W7XH 4B71A 1DM4B 1P02A 3ZZAA 7KMEH 2EEKA 1CBWC 3HK3B 3BV9B 2ZDLA 4AZ2B 1FY1A 4KKDA 4DJZB 1LMWB 1NTPA 1EX3A 2KZ4A 1YCPM 1AY6H 4R8TB 3BTME 2FOBA 2GV6A 3STIA 1DT2A 1GVLA 2BDAA 2WPLS 4CHAB 4CR9A 5JBCS 2C90B 4K60A 1FLEE 1C9TA 1QFKH 1HRTH 1SVPA 3RXKA 4I8GA 5GPIB 1GI2A 4XFQA 2FP7B 5E2OA 1ORFA 2XWAA 1P06A 1GDUA 1AFEH 5HYOA 2VWLA 1QJ1B 3VPKA 1DXPA 1THPB 1C1VH 1YYY1 3BTGE 3H7TA 4I31A 5FX6A 2XBXA 1FZZA 2CGAA 4WH6A 5DK1A 1GGDB 3O8DA 3GY3A 1TLDA 1W3CA 1QL9A 1CU1A 1D6WA 2J95A 3GCHB 2VIDA 1EZSC 1P2KA 4I7YH 2H9EH 1MAYA 1J8AA 1E1RD 2AERH 3MOCA 3LONA 4K69A 1XUHA 4THNH 2FMJA 1IQGA 3K65B 1GI8B 1D3PB 1WV7H 2VWOA 1IQMA 1G2LA 1HIAA 3TJNA 1N8OC 1BTWA 1P2JA 3SU6A 3AW1A 2BM2A 2CXVA 3ELAH 1C1QA 1VR1H 1C1OA 2QY0B 2Z9GA 1SQAA 1AI8H 3BEFB 4HTCH 4ISIH 3CP7A 4IMZA 3U69H 1PQ7A 1QNJA 1TBZH 1KDQA 1K1LA 4FUGA 4X2WA 4XBCA 3NCLA 4MNVA 1CA0C 1O3JA 2STBE 1H1BA 1GBEA 1L1GA 5TCAA 1LPKB 1ZPBA 2ZHEH 3N7DA 3PLBA 1P2IA 3U1IB 3QGJA 2C4FH 3PLPA 2W7UA 5K7RA 1KYNA 2A4RA 1C1RA 4LZ1H 5C1XA 3A7YA 1EASA 1AVWA 3TIUA 1ZZZA 1RIWB 1YF4A 4BAKB 1A0HB 2F9PA 1BJUA 2P16A 1UHBB 2A31A 5CDFE 2A5KA 1GJ5H 3DFJA 2D8WA 3P6ZB 2PTNA 1RRKA 1F0UA 2FM2A 3DA9B 4Y8XA 2LP6A 4PROA 1GBIA 1Y3XA 3FZZA 2HPQH 5I25A 2XC0A 1AWFH 1O3OA 4J2YB 3UUZA 3ZV8A 2YOLA 3KIDU 2HNTC 2A5IA 3ZVAA 4Y10E 1SHYA 4ASUD 1GHWH 2BTCE 3E0PB 2Y5FA 4D7GA 4X8SH 5J4QA 2XNDD 1GBHA 2ZDKA 3EE0B 3LKWA 4ESTE 1B0EA 2ZIQH 1G3CA 2TGTA 2Q6GA 3P8OA 1CQQA 2EQNA 3B9FH 4JCNA 1OPHB 2KM0A 1DLEA 1WUNH 3V3MA 1B5GH 1BZXE 3BG4B 2JJ1D 3OTPA 4GUXA 2C8ZB 3KQDA 2C8YB 2HVXA 3QTOH 4GAWA 2J9NA 1NRRH 1O3DA 2B0FA 2KCOA 3HPTB 5DP5A 2FODA 1C1PA 3TK5A 5GWZA 5SGAE 1Y3UA 2OC0A 4AG2A 4P02A 1W12U 2A0QB 3A7ZA 5FHTA 3A81A 1BHXF 3W1EA 4AFUA 3JZ2B 1V2QT 1T4VH 1FN6A 1E36B 4KP0A 1YCPK 2AEIH 3D23A 1LVMA 1SB1H 2A2XH 3MO3A 2QN5T 2Y7XA 3U98H 1EOJA 2GT7A 3U1JB 1DY8A 2V7QD 1MCVA 1O5AB 2VGCB 3UPEA 4ISNA 2WPIS 1PQ8A 2V3HH 4NSYA 2BD8A 4Q7YA 5EGMA 4FU7A 3SJKA 2ZEBA 6ESTA 2CJIA 4B6EA 2YMSB 1GCTC 4X1SU 3CS0A 3T25A 4LXBH 4YLUA 2W3KA 4D8NA 2SGQE 1A46H 1ZJKA 1V2UT 4ISHH 1P9UA 3TGIE 1ESTA 1LHFH 2XC5A 2BLOA 5LPRA 4TWWA 1A5HA 1S81A 3I29A 3UR9A 2SNWA 3ZZ9A 4LK4A 1G9IE 3OAAD 1C4Y2 3SU4A 1TALA 2BXTH 2KCAA 1IQJA 3UOUA 5HKKD 3LDXH 6LPRA 4HFPB 1GHXH 1ELCA 4AFSA 3LGUA 3M36A 1AKSB 1OWEA 1S6HA 4INHA 1Z8RA 1Q3XA 3Q3XA 2RA3A 5PTPA 3LGTA 2A4QA 3FP7E 4IGDA 2P95A 2UUFB 4TT3D 1DY9A 1WTGH 1MU8B 4MLFB 2J98B 2VH0A 1EPTC 1BUIA 3T28A 1DWDH 2AHME 3LPRA 4Y6DA 1V2ST 1FJSA 1K1JA 1ZR0A 3U8OH 1RFNA 2CK3D 2W7SA 1GBMA 1K2I1 3RXQA 4RT1A 2HVYB 3P95A 5C5OA 1QBOA 4J1YA 4Z6AH 2HALA 1MCTA 4I33A 1W11U 1KTSB 3CENA 3MU0A 3UWJH 1C5RA 1T8OA 2AMPA 5E0JA 2SGPE 1AVGH 1CT2E 2ZFFH 4DG4A 3MI4A 1S85A 3MWIU 4MNWA 4B6FA 3E90B 4U32A 4GHQA 1QCPA 1BTZA 1HJAC 2BDCA 1THRH 5KGOA 2XXLA 2G4UA 8GCHF 3F68H 1KXCA 1CGIE 1O2RA 4INKA 3ATWA 1ID5H 4HZHA 1HDTH 3LOXA 3H5CB 1O39A 2GCTC 4ACAA 2KFWA 3M3TA 1MABB 2BD4A 1LVBA 1A61H 1OWJA 2FZZA 1C1MA 3SU2A 3MH6A 3PTNA 1N8OB 2GZ9A 2GDDA 1TPAE 4HGCA 1IQFA 2FPZA 2PKAB 1W14U 2R0LA 4YM9A 1V2NT 3VB4A 1TBQH 2PP6A 1P2NA 2GX4A 4GCHF 2EY4C 2EA3A 1GJAB 5F8ZA 3SU0A 3BTDE 1FXYA 2ZFRH 2D26C 3D62A 1K1IA 1F0TA 1FI8A 3KF2A 1TGBA 1TONA 1GDNA 4X8VH 1CA0B 2WPKS 2ZHFH 4A5TS 1O5FH 1QRZA 1EJAA 3UQOA 5HM9A 4F4OC 2BZ6H 1CO7E 4ISLA 1XM1A 1VGCC 5T6GA 4A7IB 1N1LA 4DIHH 3SOSA 3DD2H 1H8ED 4WVPE 2ASUB 1OWDA 1MU6B 3LC5A 1LHGH 1TNKA 3OU0A 1TPOA 1C5PA 1V2PT 1TA6A 4AX9H 4WMFA 1O3MA 5AFZH 3OSYA 3T5FH 4CREA 1K1PA 2Y5HA 3AAVA 5CMXH 3SHAH 1AE5A 4NZQA 5EG4A 4JMYA 1PQ5A 3QO6A 3TJOA 5EJZA 1T32A 1TGSZ 1DICA 1NRPH 1SGIB 4FETA 1E37B 1BA8B 2ZPRA 1DLKB 5L6NH 1SOTA 3NRLA 3N7EA 3U28C 2BXUH 1BQYA 2B7DH 5A0BA 1PPCE 3M35A 2GV7A 4HI3A 1WYKA 1GL0E 3K9XB 1ELBA 1MTSA 1TWXB 4ZAEA 1O2QA 2Y82A 1C1UH 1VITF 5GCHF 1V2VT 4AOQA 4NA8A 4GPGA 2BDYA 5JB8S 1P04A 2BVXH 1A0JA 1DXWA 1C1SA 1H8HD 2G51A 2AGGX 1IQHA 5JYIA 2FX4A 2ZGBH 1C2IA 3KN2A 4BTIB 1F2SE 1PJPA 3RXRA 1EOLA 5FCRA 3DCLA 3M61U 2VWNA 1AN1E 2F91A 3NKKA 1H4WA 2ZECA 1SGFA 3HGNA 3RMNH 1CGHA 2HPPH 3SZNA 1AMHA 2IJD1 8LPRA 4OS7A 1UTMA 3GCHC 2Y81A 2R9PA 3TK9A 5J4SA 1NU7B 2V6NA 4A6LA 3I77A 5EQQA 2LELA 3GDVA 1A3EH 1C1NA 1F7ZA 1LDTT 1LPZB 2G52A 2KR7A 4CRDA 1Q2WA 1SFIA 3P8FA 1JIMA 3SQEE 1G3DA 1VZQH 4IN2A 1KXEA 2OLGA 2F43B 2KAIB 3GYLB 4AG1A 1A0LA 2PSXA 1ESBA 3M7TA 1MZAA 3QGNB 1F0RA 4ZROA 3RXGA 1LKAA 2WV4A 1UTQA 3EAJA 2Z9IA 2G5VA 1YWUA 5GDSH 1TPPA 1A5GH 3ZZ8A 1CVWH 2UUJB 5ESBA 4CBOA 3QZQA 4MPXA 1O2ZA 3S9AA 1HFDA 3RXIA 1TE0A 4AB8A 4AFZA 1GJCB 1OS8A 2H9HA 4I32A 5A2MH 1PPHE 2PR3A 3RXTA 2G81E 1SLUB 1SC8U 3WWBA 1F5KU 1EB1H 1GI7B 1O31A 5B6LA 1BBRK 1GHAG 3V7TA 1SR5C 4F49A 1IOEA 5HGGA 2ANMH 2RA0A 3A7XA 4CRCA 2BDGA 3BEIB 3F9GA 2Y7ZA 1BRBE 2ZHWH 3URCA 1BMNH 3MQKC 1C2GA 1EKBB 5EPNA 2AH4X 1CT4E 1SLXB 1V2MT 2TGAA 5IYTA 2J5UA 1KLIH 2FI4E 2ZHDA 1EPTB 1JOUB 2PHBA 3EDXB 3SW2B 4ABDA 4JYVH 5EW1H 1VJ9U 2AGEX 3UR6A 3SN8A 1GVKB 3MNSA 1SGNE 2WZQA 1EATA 2FOFA 2HNTE 1QL7A 4CRGA 1SOZA 1Y5BT 4RSPA 3KQBA 4YESB 3UWIA 1KLTA 4K1SA 3BG4C 3N7OA 1EUFA 1VCQA 3KGPA 3M3SA 5BPEA 1K22H 1O3KA 4TY6A 1MTVA 3F2FA 3ZVEA 2P3FH 3SI3H 1OWHA 5F53A 1MBMA 1O35A 4CR5A 4NFFA 4BANB 1D4PB 1ZGVA 3SQHE 2WYJA 4FUEA 1KSNA 1QHRB 5F8TA 4E05H 1C2MA 1GI3A 4YOJA 1OYTH 3FO8D 3PO1C 3BTKE 2J97A 2FOAA 2J4IA 1QURH 2GP9B 2QYIA 2G5NA 5AHGH 4YT7H 2GMTC 1KIGH 1YPHC 1UTLM 1NRSH 2VGCC 2BD3A 4GVUA 1O2KA 2Y6TA 2QAAA 4FUFA 3A88A 3MNBA 3T29A 5DO4H 4I8JA 3VB6A 2YMSC 2J2UA 2Z94A 3Q76A 1MUEB 3RDZA 2M2AA 2P3TB 1TX6A 2C8WB 2OC8A 2VVVA 1C2LA 3ZVFA 2Q6DA 4AN7A 1C5VA 1NY22 5DP6A 2GCHF 4GSOA 1DUAA 1O2TA 1O37A 1AKSA 1F5RA 4U2WA 4X2XA 5C0UA 4AORA 1SPJA 4AGKA 3F2HA 2BOKA 4JYTA 3K2UA 1RXPA 1O2JA 1E1QD 1WQSA 2ESTE 1MD8A 2P59A 1ARBA 1PQAA 3F9HA 2R2WU 3ZZDA 5A8XA 4ABIA 3SJIA 1NFUA 3QX5H 3ITIA 3S0NA 1FN8A 4B75A 3S7HB 1MQ5A 1O2WA 5AVDA 1TGNA 2BYAX 3GICB 1TX7A 1SI5H 2P93A 1H8DH 4YO9A 1SQOA 3DSOA 2SGAA 2VWMA 4ABHA 1MKWK 1BB0B 1FY5A 1TB6H 1P03A 1RTKA 2BY9X 4B2CA 1SLWB 2XW9A 2CHAC 2D1JA 1TQ7B 5AF9H 5F6MA 1BBRH 1C9PA 1AVXA 1H9HE 1X7AC 4WY3A 3HKJB 2OINA 4K8YA 3MU8A 2W5EA 5JPMH 3MO6A 1J16A 1SKYE 1YLDA 3E1XB 1O2OA 2GTBA 2PTCE 2GZ7A 2P8OB 9LPRA 2TGDA 1UO6A 4X1QU 1N6XA 2JH0D 2ZG0H 1EAUA 4IN1A 2WSSD 4BNRA 1P0SH 4DT4A 1S82A 5ETXA 1ETTH 5HMAA 1FY3A 2WPJS 2Z7FE 2PKAA 1GBDA 2I6QA 1AQ7A 3ZZ5A 1HAIH 8GCHG 1GHVH 1P3EA 1M9UA 2BY6X 1DDJA 2FLBH 5T6FA 1IAUA 1MKXK 1J9CH 3UTUH 1A3BH 1RS0A 2LPRA 4ZXYH 4MVNA 1ZYOA 2VNTA 1K9OE 3M5MA 1P09A 3BF6H 2QGRA 4IBLH 1K0HA 1ZRKA 4GCHG 2CF9H 1NBMD 3QUMP 3SNAA 3PROA 4Q80A 1SGQE 3STJA 3BIUH 1UMAH 1KXAA 1UVSH 1O3BA 1FY8E 4FVBA 4NIYA 4YTAA 1NT1A 1NFXA 1XKBC 1D6RA 1Z1JA 2CV3A 1GDQA 3BG8A 5CHAB 5T3HA 5T6DA 4KGAA 5GIBA 5I46H 5JBTA 1WU1A 1P11E 3DT0H 1TMTH 4M9FA 1BT7A 3FN8A 2GT8A 1GPZA 3SZEA 3U9AH 3MNXA 5L2YH 1E34B 3URDA 2FIRH 1RJXB 3S69A 2AMDA 1T8LA 1D3DB 1A1RA 1LHDH 5BRRE 3N99A 1C5MD 2P94A 1ELGA 4CRAA 1ELAA 1CGJE 3OFND 5GNDA 2JIZD 1TABE 3PB1E 3D49H 4HG6A 1O5EH 1LPGB 2W6ID 5DGJA 1DS2E 1C5XB 4RKOB 1Y3WA 3T26A 4O3TA 4AB9A 2ZWLH 4I8LA 5A09A 1HAPH 1V6DA 2OC1A 2VIVA 3A7TA 3A84A 1NC6A 2A7HA 3GY7A 1O3EA 3VB3A 1VITG 5GCHG 4GLYA 3VFEA 4BAHB 1WAYB 2V3MA 3M7UA 4ZMAH 2BDIA 5LPEA 1A5IA 4OGXA 4ASHA 3A82A 1MKWH 2THFB 3ATMA 1GG6C 2TRMA 1O2HA 4X2VA 2R0KA 2WUBA 3PO1B 1COWD 1NZQH 3LU9B 1HUTH 1T4UH 3FVFB 3VXFH 2GMTB 2H1UA 5FAHA 1TX8A 1YLCA 4WH8A 5IK2D 1PPZA 3SGQE 5EIYA 5LPFA 1DSUA 1YPJH 3QTVH 4DY7B 2BQWB 1KXDA 4NGAH 2UUKB 1UW7A 4ZH8A 3SV7A 4ISOA 4Y7AA 1RTLA 1O3PB 1YLNA 2ODPA 2BVSH 4K8BA 2XNIA 2OK5A 1CE5A 1U6QA 1O33A 4D9QA 4XSKU 2FXRA 2ANWA 4MNXA 4TSFD 4MTBA 2F9VA 1O3CA 1UCYK 1O34A 1QTFA 3GDSA 3E8LA 2VIWA 1UJ1A 2BMGB 1HBTH 4X8UH 1E35B 2WPDD 1DWCH 1BMAA 1E0FD 2XC4A 1D3QB 5KEDA 1TRYA 3OE7D 2IPQX 1MKXH 3A85A 1FMGA 1UTJA 4YOIA 2M5TA 4UFEH 4NWLA 3LGVA 2FO9A 2GVFA 3TH3H 4X1PU 3W94A 2PW8H 1CT0E 1DE7H 4BAOB 4AYVB 1EPTA 1GI5A 4DCDA 3NZIA 5A0AE 1C5LH 2FX6A 4X1NU 1Z6JH 2C3SA 1JXPA 5A8YA 1WTHD 2Q1JA 3L3TA 5ESTE 3TLOA 1BRUP 1XUIA 2BDBA 2ZU3A 3BTHE 3NXPA 2Y5GA 3ODFA 1EZQA 3RXMA 1TAWA 1HJ9A 2CHAB 2BY5X 1DANH 1LO6A 1XXFA 5C1YA 2IOTA 4Z0KA 1ZTJA 1O3IA 1QIXB 2QCYA 1GCDA 2FI3E 1BHXB 3DFLA 1W0ZU 1V2WT 5TJXA 4AGJA 1PYTC 1TNHA 4ABFA 5EW2H 1LVOA 1Z7KA 1KY9A 3F3BA 1ZSJA 1HGTH 1UVTH 2TIOA 2BDHA 1AFQC 1MZDA 1JIRA 1ZSLA 2HNTF 3RXFA 2ZDMA 1BTHH 2ZGHA 3P70B 3GOVB 2F4LA 4Y11E 5L2ZH 4NFEA 1AZZA 2Z9LA 2ZPSA 3Q00A 1KTTB 5HIYA 3S9CA 3MU4A 2Z3EA 2OBOA 5T1VA 3AK5A 3PMJA 3UQVA 1E38B 3ZV9A 2B9LA 2RDEA 3M5NA 2BD5A 1YPHE 3F6UH 3KQCA 2ZCLP 1P57B 4DURA 2EI6A 4JK5A 1VKYA 2JETB 4K1TA 2DE8A 1GMDF 3B23B 3F0OA 2YNAA 4JZIA 1SQTA 2BD2A 4LZ4B 2VIPA 3EA8A 1Y5UT 1QB6A 1YCPH 1NU9A 2QV1A 1O3FA 2UWLA 5EQRA 3TJVA 1AB9C 3FP6E 2JH6D 3G01A 4O97A 2DUCA 3LT3A 1IHTH 1SLVB 1NESE 2GCHG 3QWCH 3AASA 3KQEA 4QT8C 1MTUA 3RXDA 1ZSKA 2AFQB 3JZ1B 4OS2A 3VGCC 1H9LB 4K3JA 1UCYH 1TNGA 2VINA 3QLPH 1OP2A 1V3XA 3FFGA 4B74A 1QR3E 3BTQE 1RD3B 2C93B 1WQVH 1BMFD 1NM6A 2QA9E 3U8RH 5DPAA 5DP7A 4ABAA 1HJ8A 4YOGA 2ZGJA 4RI0A 3RXAA 1ELEE 1C2HA 1GHYH 2R3UA 1FNIA 2PGBB 2SFAA 3CNRA 1QQUA 4FUJA 3E6PH 3RXJA 4Q63A 1ACBE 1O3GA 1GL1A 1FV9A 1GVZA 1S0QA 4IS5A 2ILNA 3O8CA 2G4TA 3O8BA 5FPYA 1P05A 2FESH 4WXIA 7GCHF 2C8XB 4M7GA 2BD9A 1IHSH 2EI7A 1C2KA 2BX3A 3A8AA 3MHWU 2OXSA 1V2TT 2P8OC 3OYPA 4MNYA 2EI8A 4OS1A 1SGTA 3H7OA 4DGJA 3TGJE 1GI6A 1GG6B 1P8VC 2ALPA 2J94A 3GY4A 5EOKA 4ZHLU 2QF0A 3M37A 5DP9A 4Z1MD 3A83A 1AIXH 1TGTA 1ZLRA 3SJ9A 2A2QH 3RM0H 2QXIA 3K6ZA 2RFKC 1ARCA 1S0RA 1OOKB 1T8MA 3SI4H 2XBYA 3KQ5A 1QRXA 2CF8H 5H4IB 2VVCA 1SG8B 2XBVA 1L2EA 3VB5A 4A1VA 3E16B 3P8GA 3A80A 1TA2A 3GS9A 4O03A 1O3NA 2BZAA 1F92A 1Y3YA 3RXOA 3PRDA 1NO9H 1MD7A 4Y7BA 1GJ8B 1SMFE 1O2IA 4X6NA 3ZVDA 3UOPA
chains in the Genus database with same CATH topology
3RLWH 2F3CE 2WV5A 2ZP0H 3PWBA 5JDUB 3A7WA 3A89A 1NN6A 1MQ6A 2J92A 3V13A 2BY7X 6CHAB 2PSYA 3MFJA 3E91A 4B76A 1UHBA 2Z3CA 3EGKH 1O5BB 1P3CA 3DUXH 2GGVB 3A87A 1EXFA 5CHAC 3GCNA 4Y8YA 4NG9H 1P10A 3FAOA 2ZFTA 3MYWA 4KTCA 1Q31A 1HCGA 1ZTLA 2V0BA 1GMCF 4FVDA 1YBWA 2PV9B 4JYUH 3EA9A 2A7JA 1IQLA 2GKVE 2ZFPH 1EZXC 2HOBA 7LPRA 5HXFA 2FEQH 3GY5A 3SNCA 3SGAE 1P2QA 1YPMH 1OP8A 4IMQA 3RXEA 1XMNB 1GJBB 1NROH 3SUDA 3LGWA 3R3GB 4INLA 1INCA 3I78A 2OP9A 3L33A 5C1UA 2QXJA 1GBJA 3BTTE 3RC5A 1BRCE 1ANBA 1EP5A 3QZRA 3TPIZ 1JRTA 4RN6A 2XYAA 2OC7A 1O3LA 1ZHRA 1DSTA 3UREA 1TIOA 1Y8TA 3SV6A 3ATIA 1AFQB 4D76A 4ZHAA 4Y76A 8KME2 1OSSA 5DJ7A 1AO5A 3DHKH 1WOFA 2TBSA 3MH5A 4B2BA 2H5DA 1QB1A 1PFXC 1HYLA 2Y80A 1L1JA 1PPEE 3RU4T 5LH8A 5HM2A 1ELTA 1ESAA 1BBRE 1MTNB 2PGQB 2A7CA 3VB7A 1C1WH 2WUCA 3SUGA 2ZCKP 1C5WB 4YLQH 3KNXA 5DP8A 1ZJDA 2PLXA 2Z3DA 3LGYA 5C20A 1IQKA 3RC6A 2Z9KA 2XRCA 2QXGA 2GZ8A 2JKHA 3EA7A 3ENSB 3TNTA 1V2JT 3Q3KA 1O2UA 4A1XA 1TMBH 3SNDA 1HLTH 2P3UB 1AB9B 1BJVA 4NA7A 2FS8A 1YKTA 1GBTA 1GI1A 4CH8B 2Q6FA 1T8NA 3NUMA 1ANCA 1ZMJA 3MTYA 1L4DA 1LTOA 2ZTZA 3RXPA 1G32B 1LKBA 1C5UA 1PPBH 4MQAA 3RXUA 2BQ7B 2H2ZA 4RKJB 3VXEH 1KLJH 1NRNH 2VU8E 3TU7H 4A1TA 2BX4A 1Z71A 2A4GA 4KTSA 1ETRH 1D9IA 1DUEA 3VGCB 1W0YH 1K1MA 1CA8B 1L0ZA 3SU3A 1LQDB 1O2XA 1EAXA 1C4U2 2ZZUH 4DVAU 3UFAA 4FUHA 5E8EH 2J38A 2ZDAH 1SGCA 3GCTF 3T27A 1K1NA 4BAQB 3FP8E 1QBNA 2BVRH 1EZUC 3IG6B 1SGEE 1UVUH 2AGIX 1GBKA 3O8RA 4Y8ZA 3RMMH 2ZGXH 1ZMLA 3PV4A 2J34A 1CHOF 1J14A 2NU0E 1GHBF 1ZHMA 3MMGA 1JRSA 1T31A 3TK6A 3ESTA 3CS7A 3F9FA 2ZI2H 1O36A 1Y3VA 3LIWA 1WBGB 1YPGH 4NA9H 1GBLA 1SSXA 3SJOA 3GYMA 4TY7A 1QL8A 1UTNA 4OS6A 3OY5U 2ZF0H 1A4WH 1O5CB 4FXGH 1VJAU 2BQ6B 1GJ4H 1C5NH 1O2NA 2VH6A 1Z8IB 5G4BA 1W8BH 1Y59T 2O8TA 5GXPA 3TGKE 1B7XB 1C5ZB 1BTXA 1C5YB 1GBBA 1WSSH 2PFEA 2ZKSA 1DPOA 5EQSA 1DOJA 3A8CA 5F03A 4JZFH 3V0XA 4TWYA 1GHZA 4H6TA 3RMLH 4ABBA 4NSVA 2IPHA 1DX5M 3MNCA 2BLWA 3UNSA 4U01A 5LGOA 3C1KA 2H6MA 3AW0A 1ZTKA 1BDAA 2UWPA 4FUCA 1H8IH 1O32A 1ABIH 1Z8GA 1FAKH 3A8BA 2FOEA 1K28D 2JETC 1HAGE 1MMJN 4K1EA 3RU4E 3RC4A 1JMOH 3ATLA 2AIQA 3SHCH 2RG3A 8ESTE 4DT7B 2G8TA 2XCFA 2AIPA 5FX5A 1VITH 3PMBB 1SGRE 1GMDG 2PKSB 1LVYA 4MPUA 4Y0ZE 3UNRA 1VCPA 3PYHA 3RMOH 2SNVA 3RXBA 1XUFA 4BXWA 4BXSA 3AVZA 3QDZB 4OS4A 3LJJA 2FLRH 3F1SB 2FDAA 3RXVA 3A86A 1GHAF 2V3OH 4FU9A 4WWYA 3SJ8A 3LH1A 1TPSA 1O5GH 1C1TA 2DE9A 1IQEA 2NU4E 2ZTYA 2UWOA 4NIVA 3SV8A 3EYDA 2GD4B 1THSH 5C2ZA 2F9OA 1AZ8A 1ELFA 1O2VA 2ZFQH 2D2DA 5F8XA 1O5DH 1DWBH 1ZOMA 1J17T 2G55A 4NWKA 1KXFA 2A4OA 1DWEH 2FTMA 4X0WU 5A8ZA 1BTPA 1XUGA 1C5TA 1NPMA 5GJ4B 2IN2A 1TYNA 1QJ7B 3SBKA 4X2YA 4UFFH 1O2SA 2ANYA 1FDPA 4DOQA 5K0HA 1HNEE 1O3AA 3BTEE 2ZNKH 3M7QA 1TNLA 2WPHS 5B6OA 5FPTA 1DITH 2XBWA 3ZZ7A 1L4ZA 1HB0B 3GCOA 2VJ1A 1FONA 7GCHG 6GCHF 2BLVA 3KL6A 3BEUA 1Z8JB 3NPSA 2ZDVH 2O8LA 5EXMA 4MPWA 1RTFB 1B0FA 4ZXXH 5EXNA 2VIQA 1N6YA 4O9VA 1AUJA 2SGEE 1F5LA 2KAIA 1G30B 2BOHB 1SBWA 1C5QA 2QXHA 5JBAS 1Z1IA 1HAVB 1J15A 4FUIA 2ODYB 4K2YA 4NIXA 3EQ0H 3BN9A 1LQEA 5FBEA 5TCCA 1ZGIA 4Q2KA 5JBBS 4D7FA 2G00A 2BD7A 1GI9B 4XBBA 1AUTC 4X8TH 5L30H 1O38A 1ANEA 4BOHA 1XX9A 1PPFE 1WCZA 1V2KT 1FUJA 4VGCB 1QY6A 4R0IA 6CHAC 2B8OH 3P92A 4TYDA 2FYRA 3K6YA 2RDLA 5DP3A 3RUOA 3L6PA 3TITA 5IDKA 1AGJA 2NU1E 2ZQ2A 1TRNA 2ZO3H 4MDSA 2OUAA 1O2MA 1V2LT 4YZUA 1ETSH 2BLQA 1S5SA 2ZU2A 3QN7A 4IC6A 2K1QA 3TH2H 5FXLA 2OQ5A 2PUXB 1SHHB 4ZKNU 1EAIA 4WMDA 1PYTD 1GMHF 1W10U 1BITA 1RGQA 2B5TB 3ZZBA 3SNBA 2GDEH 3S9BA 3SNEA 4XBDA 1FAXA 4UE7H 1P2MA 4ABEA 1GMCG 1TBRH 3GY6A 1HPGA 1NRQH 2ALVA 4O3UA 4XDEA 1ZMNA 5DP4A 1CBWB 3MO9A 4FU8A 2ZPQA 3LH3A 2R2MB 3SV2H 4B1TA 1O2PA 5C3NA 4SGAE 1NFYA 1UVPA 2F9NA 1V2OT 4UFGH 3ZYEA 4OS5A 1S6FA 2OD3B 1PPGE 4UFDH 2H5CA 4Q7XA 4BTTB 4E7RG 4E7NA 3RU4D 2W26A 5FCKA 2FS9A 1UCYE 1IQNA 2PWXA 2YNBA 1HAXB 2EC9H 2ZCHP 3WY8A 3SGBE 3BTWE 1QQ4A 2A5AA 1AE8H 3IITA 1UK2A 2VB0A 3OX7U 1V2RT 4MG3A 3HKIB 3ZVCA 4WMEA 2SGFE 3ZZ4A 1IQIA 3W95A 3GISB 4ZHMU 1MTNC 4TPIZ 3V12A 3ODDA 3OY6U 1LCYA 1OX1A 3NWUA 4ABJA 3SORA 3TVJB 3TNSA 1HAOH 1P12E 1TOCB 3HK6B 2UUYA 4XE4A 1NFWA 1SGPE 2NU2E 4H6SB 1G2MA 4AFQA 4LOYH 4XOJA 1GBAA 1BTYA 2OTVA 3IWMA 2ULLA 2LNCA 1UVOA 2O8UA 1FPHH 1XVMA 1HIAB 3UY9A 7ESTE 1W7GH 3HATH 4OGYA 2FOMB 4ZKOU 5JB9S 2IJOB 3RLYH 2ODQA 1Z6EA 4UD9H 2O8WA 1OKXA 4ABGA 1KDQB 4X6PA 1BMMH 1O2GH 2F9UA 3BSQA 1D3TB 1GJ7B 1SGFG 3KEEA 1T7CA 1GJ6A 2QIQA 3PLKA 5EXLA 3ZZ3A 3SV9A 4KELA 3C27B 4JZ1A 1TGCA 1ZHPA 3ZZCA 2WPMS 2AMQA 1W2KH 9ESTA 3S7KB 1F0SA 3LC3A 1CHGA 5ABWA 1XKAC 5DG6A 1EP6A 1EQ9A 1ZPCA 1QB9A 2WINI 1HV7A 4Q7ZA 2OBQA 3RXHA 2ZDNA 4FUBA 2Z9JA 3FANA 3GCTG 2HGTH 1ANDA 1XUJA 5EPYA 3VEQB 3A8DA 1GI4A 3GY8A 1UK3A 4I8KA 1GJ9B 1C2JA 3E0NB 3RP2A 2H9TH 4CHAC 2FOHA 4I8HA 4X1RU 1A2CH 1CHOG 4JZDH 3PTBA 1GHBG 2A32A 1JBUH 2FOCA 2QC2A 2ZU4A 1DFPA 1QJ6B 1Y5AT 5FPSA 4H4FA 1QBVH 3UNQA 4CH2B 5CE1A 2W3IA 5FBIA 2BB4A 1O3HA 3BTFE 4D9RA 4Y0YE 4BAMB 1A7SA 5EU8A 4CRBA 1O0DH 1GWAA 1S84A 2CN0H 1FPCH 2TGPZ 1BTUA 2ZU5A 1SFQB 3RXLA 1GGDC 3ZVBA 1NS3A 1O2YA 2ZA5A 1C2DA 1XXDA 3P17H 2HLCA 1FQ3A 1LHCH 1QGFA 3FZDA 2HRVA 3P8NA 1YM0A 4ZKRU 1K1OA 2FOGA 2STAE 4AYYB 2A45B 2CMYA 2R3YA 1C2FA 1QRWA 4DW2U 2ZFSA 2TPIZ 2V35A 3UIRA 1DVAH 3TH4H 1XUKA 1LHEH 2ZC9H 1GCTB 3PM3A 5C67A 2PKSC 1TMUH 3LJOA 1C2EA 1C5SA 1W13U 4B73A 4DIIH 1TNIA 3PWCA 2ZHQH 1OXGA 4WXVA 1TQ0B 5E2PA 3AAUA 1UTPA 4IW4E 1ABJH 1MH0A 1O2LA 5C5NA 3MH7A 3M5OA 1OWKA 3M3VA 4U30A 2NWNA 4UDWH 1G37A 4B2AA 1GJDB 3SU5A 1YGCH 4E06H 3OTJE 5E0GA 1BIOA 4NIWA 4WF8A 1MBQA 4FUDA 4ZUHA 1FY4A 4BTUB 1RIWC 2BY8X 1CSOE 5E0HA 1HXFH 3BIVH 4IC5A 4MPVA 2O8MA 2O9QA 1UTOA 2OCVB 4K5ZA 1OWIA 2NU3E 1HAHH 3KCGH 3F9EA 2ZGCA 2VIOA 3RXSA 4SGBE 2ZQ1A 3T62A 4TPYA 5DKMA 1EJMA 4JK6A 3SUFA 5AFYH 1H9IE 3D65E 1AWHB 4KTUA 1GI0A 1KXBA 1YPLH 4GHTA 3RM2H 1EAWA 3MH4A 1QA0A 2QF3A 1AU8A 3QK1A 1YPEH 1P01A 1HAYB 4NZLA 1L1NA 1TFXA 3ZVGA 3M5LA 1QA7A 4NCYA 2OQUA 1HJAB 2ANKH 6GCHG 4Y79A 2BHGA 2VVUA 1BMLA 1ELDE 1HAVA 1ELVA 2HWLB 2F83A 3T2NA 2JH5D 1G36A 3SO3A 1SGDE 1O30A 3GDUA 2F9BH 2GCTB 1P2OA 1AHTH 4A92A 1TNJA 1YPKH 1BRAA 3NK8A 1EJNA 4CRFA 3RXCA 3LGIA 4UONA 3Q77A 1YC0A 2AS9A 1FIWA 1G3EA 3MU1A 1C5OH 2Z6BD 1TRMA 1ZRBA 3SU1A 1TOMH 3SUEA 3B8JA 3ZYDA 5A0CA 2RCEA 3HGPA 1XVOA 2AYWA 1HXEH 2WYGA 4X6OA 2SGDE 2ZU1A 4VGCC 4CBNA 1GBFA 2A1DB 4Y71A 3R0FA 1G3BA 2FWWA 4ZKSU 3TJUA 4H42U 2XWBI 1FIZA 1P9SA 1ZPZA 5EODA 1K21H 1OYQA 2PUQH 1UTKA 1MTWA 3A7VA 1VGCB 1C4V2 1BCUH 1UK4A 3E3TA 3U8TH 1S83A 1VCWA 3MU5A 2FYQA 2XCNA 1BOQA 3ZZ6A 4X6MA 1JWTA 3ATKA 3Q3YA 1GBCA 1OP0A 2FTLE 1HAZB 1YP9A 2FI5E 2ZTXA 3GY2A 4UEHH 4WJG2 1SGYE 3KHVA 1SL3A 3PMHB 4YT6H 2XTTB 1GMHG 1AD8H 4JZEH 1EB2A 3PMAB 2I6SA 1MAXA 1W7XH 4B71A 1DM4B 1P02A 3ZZAA 7KMEH 2EEKA 1CBWC 3HK3B 3BV9B 2ZDLA 4AZ2B 1FY1A 4KKDA 4DJZB 1LMWB 1NTPA 1EX3A 1YCPM 1AY6H 4R8TB 3BTME 2FOBA 2GV6A 3STIA 1DT2A 1GVLA 2BDAA 2WPLS 4CHAB 4CR9A 5JBCS 2C90B 4K60A 1FLEE 1C9TA 1QFKH 1HRTH 1SVPA 3RXKA 4I8GA 5GPIB 1GI2A 4XFQA 2FP7B 5E2OA 1ORFA 2XWAA 1P06A 1GDUA 1AFEH 5HYOA 2VWLA 1QJ1B 3VPKA 1DXPA 1THPB 1C1VH 1YYY1 3BTGE 3H7TA 4I31A 5FX6A 2XBXA 1FZZA 2CGAA 4WH6A 5DK1A 1GGDB 3O8DA 3GY3A 1TLDA 1W3CA 1QL9A 1CU1A 1D6WA 2J95A 3GCHB 2VIDA 1EZSC 1P2KA 4I7YH 2H9EH 1MAYA 1J8AA 2AERH 3MOCA 3LONA 4K69A 1XUHA 4THNH 1IQGA 2FMJA 3K65B 1GI8B 1D3PB 1WV7H 2VWOA 1IQMA 1G2LA 1HIAA 3TJNA 1N8OC 1BTWA 1P2JA 3SU6A 3AW1A 2BM2A 2CXVA 3ELAH 1C1QA 1VR1H 1C1OA 2QY0B 2Z9GA 1SQAA 1AI8H 3BEFB 4HTCH 4ISIH 3CP7A 4IMZA 3U69H 1PQ7A 1QNJA 1TBZH 1KDQA 1K1LA 4FUGA 4X2WA 4XBCA 3NCLA 4MNVA 1CA0C 1O3JA 2STBE 1H1BA 1GBEA 1L1GA 5TCAA 1LPKB 1ZPBA 2ZHEH 3PLBA 1P2IA 3U1IB 3QGJA 2C4FH 3PLPA 2W7UA 5K7RA 1KYNA 2A4RA 1C1RA 4LZ1H 5C1XA 3A7YA 1EASA 1AVWA 3TIUA 1ZZZA 1RIWB 1YF4A 4BAKB 1A0HB 2F9PA 1BJUA 2P16A 1UHBB 2A31A 2A5KA 1GJ5H 3DFJA 2D8WA 3P6ZB 2PTNA 1RRKA 1F0UA 2FM2A 3DA9B 4Y8XA 4PROA 1GBIA 1Y3XA 3FZZA 2HPQH 5I25A 2XC0A 1AWFH 1O3OA 4J2YB 3UUZA 3ZV8A 2YOLA 3KIDU 2HNTC 2A5IA 3ZVAA 4Y10E 1SHYA 1GHWH 2BTCE 3E0PB 2Y5FA 4D7GA 4X8SH 5J4QA 3EE0B 1GBHA