1OYXA

Crystal structure of 3-mbt repeats of lethal (3) malignant brain tumor (seleno-met) at 1.85 angstrom
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
313
structure length
313
Chain Sequence
b'WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title Malignant brain tumor repeats: a three-leaved propeller architecture with ligand/peptide binding pockets.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 70
structure length 313
sequence length 313
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oyxA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oyxA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oyxA03
2BUDA 3MEAA 3OYKA 4IUPA 3MP1A 2JZ2A 3DB4A 3LGFA 4X34A 5D6WA 2X4WA 1OI1A 2MWOA 2RHXA 1RI0A 2RHZA 4E7KA 3MP8A 3PMIA 2R5MA 5IN1A 4BACA 2RHUA 2LTOA 4E7HA 3META 2LRQA 4BE2A 4QQGA 2RJDA 3M9QA 2X4YA 3OYGA 4PLLA 5FRNA 3FC3A 4B9WA 2EFIA 3DLMA 3P8HA 3NTIA 4N4GA 4A4FA 2XDPA 4PLIA 5J39A 2R57A 2RHYA 2EQMA 3L2RA 3OYCA 2FHDA 1MHNA 4C5HA 5KE3A 5D6YA 3ZEHA 3GOXA 2RI3A 3P8DA 3MEUA 1WGSA 3OB9A 2R58A 5IAYA 4BDYA 2E6NA 2GFAA 2EKOA 2PQWA 3E9GA 3MO8A 2F5KA 4HCZA 2YRVA 3L42A 2DAQA 1G5VA 2HQEA 1WJSA 1WJRA 5J26A 2HQXA 2QQRA 2BKDN 3FDRA 4Z02A 2LCCA 3OYNA 3S3OA 5FRMA 2JTFA 3S3MA 1H3ZA 3PFSA 3FEOA 2EQKA 3OMGA 3OYJA 4IKFA 4C5IA 2XK0A 2RHIA 3QIIA 3NTHA 3OYAA 5KE2A 3FLGA 4C5EA 4E7JA 3LX7A 2EQJA 4BE0A 3E9FA 3OYHA 4IUQA 3MEWA 5KCHA 1SSFA 2EQUA 2P0KA 2RJEA 2BIVA 1N27A 2RI2A 3OA6A 3PMTA 4B9XA 3S3NA 4UC4A 4L59A 3LGLA 4ZTJA 3EAEA 4GY5A 3L2WA 3Q1JA 1OZ3A 3UWNA 2L8DA 4QQ6A 3L2VA 2DIQA 4A4HA 2RJFA 3UT1A 3O8VA 2GF7A 3ASKA 2MWPA 2NLUA 2R5AA 3DB3A 2X35A 3OS0A 3OYIA 2LDMA 3MEVA 5C6SA 4II1A 3OYDA 2WACA 4FU6A 4LD6A 2RO0A 4BD3A 3OS1A 4FL6A 1OYXA 1WJQA 3CEYA 5M9OA 5KCOA 3L2UA 3OQ5A 3LLRA 5CIUA 3S6WA 2X4XA 5FROA 3OYLA 4A4EA 4IUVA 5C0MA 4IUTA 4QW2A 2M1HA 4RG2A 1KHCA 4QVZA 3OS2A 3QBYA 4C5GA 2CKKA 3NTKA 3OYEA 1XNIA 3H6ZA 3LYIA 4EDUA 2M0OA 2IG0A 3F70A 3QKJA 1OZ2A 4OVAA 4QQDA 3OYMA 4E7IA 3OYBA 4N4HA 3H8ZA 2DIGA 2K3YA 2D9TA 3C4SA 5D6XA 4IURA 5KH6A 2K3XA 3BDLA 3QJ6A 4BE1A 4E7LA 3LH0A 2E5QA 3PNWC 2L89A 2RJCA 4PL6A 3OY9A 2G3RA 4BDZA 4ZTFA 2M16A 3MP6A 4NS5A 2QQSA 2GFUA 3L2QA 4CRIA 4IUUA 3KUFA 2RI5A 3ME9A 2LVMA 3OYFA 2L3RA 2O4XA 4N4IA 2O4XB 4Q5WA 3SD4A 2B8AA 2VYTA 3OMCA 4A4GA
chains in the Genus database with same CATH superfamily
3QWYA 2DXCA 2JZ2A 2MAMA 5GAMh 3CCJT 2XD0A 3J80E 4A63B 2EAYA 3QDRB 4Y28E 4XTXA 4KT0E 1D1AA 3P8HA 3JCMg 2EGCA 4M7AE 1HJDA 4PJOD 2CUDA 1AWOA 2K5FA 1LOJA 2VC8A 5D6YA 1HK9A 1QP3A 5CQYA 5LJ3g 1NJIU 3JB9D 3L42A 2DAQA 1YITT 1AWWA 2QQRA 3QG1A 2BZ8A 4Z02A 1YWPA 1YNZA 3RBBB 2DE0X 2PUKB 3MPUB 4E7JA 2YSQA 5GAN5 2RD1A 2D8JA 4BE0A 1IHVA 2DTHA 4IUQA 1N8RC 1M90U 4UC4A 2CP0A 1T3SA 1OZ3A 4TVRA 4GLMA 1YCYA 1D09B 4OB3B 5C6SA 2X4JA 3EGDA 4KH0B 2XICA 1I5LA 3CD6T 4Z89A 4M78C 1WJQA 2ZGWA 2GNCA 2EJGA 5FROA 2V8KA 3M53A 4BI3A 2DL8A 1SRLA 1OULA 2F2VA 3LYIA 2BTTA 2XG8D 2E65A 2LQWA 4M7DE 5GAMf 2BE7D 3JB9J 4CC2A 3BY7A 2CT4A 3M0SA 4M77E 4IUUA 4M75A 3ME9A 3SWNB 2YT6A 3OYFA 1SEMA 2DJQA 1WHGA 1YJ9A 1K73U 3THKA 2CS7A 4M7DD 2LT4A 3SWNC 1Q86U 5GANe 4XK8E 3PMIA 1Y57A 3CCUQ 2JN0A 3A8GB 4NL2A 2P4TA 2IVWA 4M77D 1BBZA 4M7AA 5CAIA 1GL5A 3DLMA 1PM3A 2SEMA 4DOWA 1ZX6A 2EGAA 4ZGJB 1MHNA 1I4K1 1M27C 1K9AA 3I56T 2WSEE 1WHHA 5J26A 9ATCB 4CC7A 2G6FX 1UDLA 3PFSA 1PG5B 3PGGA 3RUXA 2KNBB 1ZSZA 3QIIA 2KE9A 2KRSA 3M0TA 2VKNA 3E9FA 2P0KA 1K76A 4J9BA 3ULRB 2A28A 5KYUB 2VASA 4J7IA 2RJFA 2C0OA 1WQWA 4AT1B 4PJLA 3ASKA 3SHWA 1V1CA 1N8RU 2RQUA 3MEVA 2WACA 2OAUA 8AT1B 4AMCA 1UGPB 3TQ7P 2QA4T 5KYWB 3VKIA 5FU7B 3S6WA 4E2FB 2QQBA 3A1PA 1K1ZA 3OS2A 1KD1R 2HMAA 2KGTA 1LCKA 5FLXE 5KYUA 2CREA 3IQLA 4CC4B 2E6ZA 3VUBA 1UEBA 2D1XA 5L23A 5KH6A 2EVRA 5HK0A 2RB6A 2P84A 4BDZA 1HYOA 2PVGB 5IH2A 2CGHA 3QXEB 5FU6B 3EHRA 4M75G 2AK5A 4VUBA 1ZUUA 4PJOG 1SF9A 2VYTA 4LN2A 3MEAA 3INZA 3JB9G 1IB8A 1UGQB 2RHXA 1OU8A 2QYZA 3EGXB 1VQKT 4ATOA 3QO3A 4M7AG 1X43A 4C0ZA 1X01A 4BY6B 1T0HA 3WVDB 4C0FA 1CKAA 2HZYA 1AEYA 2QEXT 1IREB 2FHDA 4EMHA 1UGVA 4GBQA 2LQNA 4EMKC 2RQRA 2CZ7B 1M2OA 2LJ0A 1WJSA 2VXEA 4LDWA 3G4SA 2OI3A 8ATCB 1M30A 3EGXA 3NPFA 3REAB 1IHWA 2X3WD 3M58A 3EFOB 1I1JA 3GPLA 2C0TA 4D6WA 3S3NA 1BYMA 3EG3A 2HNIA 1QMCA 3H41A 3G6EA 3HSBA 4WF2A 4XU2A 2HCKA 3KFVA 2C0IA 1K0SA 1VQOA 4J6YA 3TSZA 3OS0A 1O9SA 2NUTB 2HL5C 3I5RA 1VQ7T 3EFOA 3CC2A 2YUNA 1BK2A 4QVZA 2MMPA 5GMKl 3PE0A 3G4SQ 4M7DG 2CP7A 1WXBA 3BW1A 1TUCA 1LNXA 2K3XA 1N5ZA 3LH0A 3CCLT 4M77G 1MNDA 4D8KA 1Y7XA 3M56A 2A0FB 2GFUA 4A53A 2E12A 4XTVA 2JNGA 2DVEA 2YRCA 3SD4A 1VQOQ 1K4US 4Z8AA 3OYKA 1OEBA 2CP3A 3MP1A 1EFNA 2RHZA 2O9SA 4JDSA 3CC2Q 4C92C 3HL8A 1TUGB 1KJWA 1D3BB 4KH1B 3REBB 4PLIA 3HPWA 4M4ZA 2AKLA 3L2RA 5KE3A 3X24B 1RUWA 1RL2A 1U06A 2VGMA 1TU0B 2ROLA 2D0NA 3P8DA 3CCRT 2EYXA 3TSWA 3CXCS 2CZ1B 1SSHA 3PVQA 3J7AF 5GAN4 3JCMb 2LMJA 2BZXA 3OBWA 3OW2S 1H3ZA 1M3AA 1AWXA 2EQKA 3HRSA 5GAOp 2Z0WA 1QP2A 3FLGA 5LJ5h 3LX7A 4CI0C 3EFSA 2O2OA 1N27A 4BB7A 1RAGB 1KD1C 1YJWA 1VQ8A 3L2VA 1GCQC 1S72T 2GF7A 2NLUA 2X35A 1K9MR 1OPLA 4II1A 3KBGA 4FU6A 3JCMX 3DLLA 5J3BA 4RCBA 4FT2A 1QVFA 2M51A 4KULA 2M1HA 1E6HA 3NTKA 3CCQA 2EYZA 2ZCFB 1WHLA 5GAN6 3URGA 2A36A 3CCVA 5LJ3h 4RTVA 2L5QA 3PIOA 1GBRA 2OAWA 2D6FA 2COYA 4AG1C 1TH7A 2QGFB 5GANg 6AT1B 4RCCA 3HRTA 1YJWQ 1VQ8Q 1RI9A 4L5GA 3JCMP 4J6WA 1RLPC 2OTJT 1M5Q1 3DB4A 3D7SB 1NG2A 4FM4B 4O6JA 2NYSA 2VXFA 2XDBA 1G8XA 2MPXC 2R5MA 2GQVA 2LCSA 2LTOA 3META 1UJ0A 5FRNA 4PFOA 2DBMA 4Y91A 1VQMQ 4XU1A 3CCQQ 3RIRA 5GJVB 1ZA2B 1VQ5T 1ABQA 4RTTA 3CCVQ 1VIEA 2CP2A 5LJ5f 5CK9A 5A2QE 3OB9A 2P4RA 5IAYA 1Y96A 3ZBDA 2GGRA 4YTLA 2LCCA 2DLPA 2YRDA 1VQPT 4IKFA 2RHIA 2KY9A 2EQUA 1X6OA 1GFDA 3WXMB 1KQ2A 1EX4A 5I2SA 1B07A 2RMOA 2DIQA 3JCMf 1RLQC 3CCEA 2CP5A 3VRYA 2E70A 2QG9B 3VJPA 4PNOA 1KD1U 2FPFA 3UATA 2O01E 5LJ3f 3QZ5B 4KGXB 2CSIA 3LLRA 2HBPA 2F69A 2ESWA 1PNJA 3VS3A 4IUTA 1BI1A 3L2ZA 4OGEA 2DNUA 2LC4A 4B6MA 3A8OB 1SRMA 2EYQA 5DM7R 3X20B 3A8MB 2L3SA 5A0LA 2YXYA 5EG2A 1VQ4A 2J06A 4DQ2A 1YP5A 4FYYB 3CMAT 2KROA 2RJCA 3EH2A 1RAIB 3MP6A 1MMNA 4NS5A 1FMKA 1QQJA 1D0XA 3CCEQ 7AT1B 2HDAA 4C8QE 2RQWA 1PCXA 4N0AA 2M9UA 2B86A 1X6GA 2E1HA 1BKBA 3MKDA 1D0ZA 1KQSP 1FYNA 2DYBA 2LRQA 1JU5C 4N4GA 2HSPA 5IHKA 2ED0A 1WHMA 3QYGB 1UG1A 2HQHA 3P8BB 1QCFA 1FX7A 3G71T 2JMAA 4BDYA 1JJ2A 2EGEA 2PUOB 2PQWA 2EKOA 3EGUA 1KQSA 1VQ4Q 4M78E 2BKDN 1QCOA 2XKOC 1MV3A 1NLPC 3S3OA 3CCJQ 1K9MC 2IPOB 4LDXA 1RADB 3GNFB 3CC7A 5AT1B 3U23A 2LJ1A 2DL7A 2Y90A 5GJWB 2RNAA 2XIDA 5GAMj 4J9GA 3GF5A 3H0HA 2C06A 3M4GA 4M78D 4ZGDB 2JS2A 4J8OA 3VYGA 3VRZA 5GMKm 1YITQ 1WXTA 3JCMW 3M5AA 3MHXA 3X26B 3EGDB 1H641 1SPKA 2RQTA 1W4SA 2COZA 2E5KA 1KHCA 4F14A 1JRIA 1XNIA 4X9DA 1J3TA 2CDTA 3QKJA 1ACMB 1VQ9T 3CC7Q 2MF2A 5KYYA 4F17A 1WHJA 1BI3A 2E5QA 3PNWC 5CR2A 4M75F 2M16A 4PJOF 3G7ZA 4RTUA 3CD6Q 2BE9B 3N5BB 5IHIA 3M0QA 4M75B 2RH2A 4C8QA 1AT1B 4PJOB 2YUQA 3CCUA 1RAFB 3OMCA 4DBFA 3H9NA 1VQ6T 1TTHB 3JB9F 5HK3A 4RMOA 2KAFA 4M75C 2CH4A 2JM8A 5GMKi 2EJ9A 2FZKB 1G3YA 1U3OA 4M7AF 1BI2A 1VYTA 4M7AB 4RTXA 5I22A 4E47A 4A4FA 1X6BA 3T9NA 2VV5A 2ZPBB 4PJOA 2KRMA 3VS1A 2RI3A 4M7AC 2ABLA 1Z9QA 1SG5A 4DBHA 3JCMV 1G2BA 2YRVA 1AHJB 1JO8A 4PJMA 4Z88A 1N9SA 5HCKA 4IIOA 2DL5A 3I5SA 1ZSZB 1WFWA 1B7TA 4JS5A 3HP9A 1KC8R 5D7UA 2K5LA 2DMOA 1K9MU 1ZSZC 3WVEB 2VVKA 2LQKA 2QQAA 2FG0A 3UT1A 3I56Q 3LH5A 3AT1B 4ZNXA 1WPYA 2OJ2A 3C95A 3L2UA 3OQ5A 2HBWA 2DETA 2X4XA 3NMZC 4RKUE 1WLPB 2ZAEA 3HFOA 3SFMA 5DY9A 1W70A 4QW2A 4BUGA 1NYGA 5GAMd 3H6ZA 2Y4YA 4E6RA 2KEAA 4M7DF 3QPHA 2V8IA 2EWNA 4QQDA 4M7DB 1G3TA 2QQ9A 3RKYA 4M77F 1YJ9T 1NPRA 4MZMA 2L89A 1WI7A 4M77B 3UDCA 3ZFJA 3V8JA 2XHCA 2QASA 4C8QG 2QA4Q 1WQ7A 1E6GA 2L3RA 4HVUA 4QKUA 1FWZA 3CMET 1JXMA 4JRKA 1VQKA 3CCST 3CBMA 1PWTA 5FU7C 1BI0A 2MWOA 1CSKA 4M7DA 2DD4A 1I81A 2YWWA 3ER0A 5A0GA 1W1FA 4JRQA 3CQTA 1QVGA 4LE9A 5CKEA 4M77A 1GBQA 1JQQA 3JAME 3I9QA 2DPPB 3CC4A 1YIJA 2RM4A 2DXTA 5HKCA 1W2BS 2M0YA 1WGSA 4M78G 2F5KA 5FU6C 2A3LA 1SHGA 1WJRA 4DBQA 2KK4A 1IZ6A 5IXBA 4X9CA 3CCMA 4PKCC 3FEOA 3NFCA 4C0DB 3OYJA 1D1BA 2XK0A 1DJ7B 3NTHA 1VQKQ 4LUEA 1OPKA 2RQVA 2RJEA 2BIVA 3OA6A 2QEXQ 2FYKA 4C0DC 5GANh 2CH4W 1V29B 2F2WA 4RG8A 2MK5A 2ZPIB 4BY6C 4E7ZA 2E3IA 1BCOA 1RABB 4FT4A 2JVVA 3HHTB 4XTZA 3CC4Q 1YIJQ 3SB2A 2FZCB 2YDLA 5KCOA 3QDFA 1KK7A 1Y07A 5GAN2 3C94A 1PD1A 4JJBA 4C92E 1VOMA 3CCLA 3CCMQ 2DO3A 3F70A 1OZ2A 4PFZA 2O9VA 2DBKA 2EYWA 4XTUA 2K3YA 3CPWP 1YCSB 3C12A 4LNPA 1G3SA 2MIOA 4DOVA 4HT8A 2L3PA 1UHCA 4OGCA 4F7UE 2J7IA 1VQ7Q 3L1AA 3KUFA 4C92D 1FXXA 3EG1A 1JB0E 3OSVA 1M2VA 2QK0A 4IUPA 1WDXA 2AZSA 5D6WA 2X4WA 3JCMe 3CPWA 3PT9A 1GXIE 1UHFA 4QQGA 3OYGA 4JJDA 4B9WA 3X25B 2EFIA 1OX8A 2DEQA 3CCLQ 1VQNT 1KC8C 4AFZC 4ELZC 2RHYA 1OOTA 2EBPA 3UPUA 2D8HA 1I07A 4OMQA 2COWA 2PNIA 3R6NA 3MEUA 2XU8A 2R58A 2FRYA 1C1AA 4XQ3A 4A4KA 1YJNA 5GANf 1M90R 2HL3A 3TEEA 1PD0A 2V8JA 4HCKA 3G6ET 4FYVB 3E2UA 1F1BB 2K2MA 1YHQT 4P5NA 1LPLA 2FVUA 4PJJA 3VS6A 2FB7A 2OTLT 5IT9E 3EAEA 3Q1JA 1M9SA 3CCRQ 3C0CA 1MGQA 2PZ1A 1FMVA 2LDMA 3OYDA 2ZPEB 2YLBA 3I55T 1OYXA 2ECZA 1VQLT 1YJNQ 2VWFA 2DM1A 1QWEA 1Y0MA 3UA7A 2CKKA 1QVPA 1WZOA 3OYEA 4HT9A 1QVFP 4J9IA 4HA8A 2M0OA 2IG0A 2E41A 3KXTA 2FPDA 5LJ5j 4QT7A 1ARKA 2XI9A 1K73R 1S72Q 2DIGA 1Z9ZA 2D9TA 3JV3A 1KFZA 1VYUA 3SEMA 2F2XA 3TCJA 2DL3A 2J05A 4F7UA 2A7YA 4R56A 2LJ3A 3L2QA 4AFSC 1TSFA 5DLOA 4OP0A 3TU4K 2O31A 2K5IA 1VQMA 1YFNA 3LGFA 4O5VA 1RI0A 1YBYA 1VQ5A 3GIBA 5IN1A 1QW1A 4DEYA 4BACA 3RMQA 2ROTA 2X4YA 4JJNK 2DZCA 3FJPA 3VS7A 1LVKA 5GMKj 2MOXA 2JS0A 3SDZA 1TXQA 5FWCA 3JRZA 3OYCA 2DK3A 1X2QA 2KT8A 5LJ3j 1Y96B 2E6NA 3MJXA 4EIKA 5GAOn 1G5VA 1X2KA 2HSEB 4XTWA 1KC8U 1NYFA 2JM9A 1MMGA 2NUPA 1M1GA 3QYHB 1NZ9A 1NEGA 2EQJA 3OYHA 1N8RR 3HFNA 1WYXA 1VQ5Q 2KRNA 1I8FA 2CSQA 3BFMA 2BZYA 4A4HA 1H92A 1UTIA 1V76A 2HEQA 1M3CA 1WHKA 1PRLC 4KGVB 1KSWA 2LX7A 1ZBXA 5GAMe 2RK1A 1VQPQ 2EW3A 2FL7A 3TVTA 3VS0A 1Q95G 4C92G 4ESRA 1RAAB 3CMAA 2X51A 1C0MA 4JRPA 4OVAA 3H8ZA 2KVQG 3C4SA 4D8DA 2QTXA 3BDLA 2KQWA 2JT4A 3EH1A 4F7UG 1YI2T 4FYXB 1Q7YR 4FSXA 2DEUA 3V8KA 2DTOA 2JJ9A 1M8VA 3M0UA 1JBMA 2J6OA 1SKUB 3HKSA 5A0DA 1M90C 4J9EA 1G3WA 2DRKA 4HCBA 2AZVA 4E7HA 2RJDA 3V7RA 4N0AC 4PLLA 3G71A 3ZL7C 2KMTA 3FIFA 3NTIA 3CMAQ 1B34A 2KT1A 4ZGEB 3UF4A 2R57A 4XU3A 3CCJA 1AZEA 1WIEA 2DF6A 1FMWA 2QDYB 5FW9A 4EPCA 4DEXA 2EYYA 2D0QB 4C0GA 1JJ2P 1U8RA 2DFUA 1RACB 1O75A 3H0FA 1WXUA 3CBPA 1WA7A 4LDYA 1ZQ1A 4C5IA 3G1JA 4DBRA 3QSUA 5KE2A 2H3JA 1R0BG 3X28B 3JCMd 3CCET 4MDXA 4FCYA 1YITA 1GRIA 4RTYA 2ZPGB 1HXDA 4HCCA 1PRMC 2ENMA 3LGLA 2RK2A 1AOJA 2E64A 2SRCA 4GY5A 4OMFB 1PC0A 5LJ3d 3G71Q 3A8HB 3OYYA 2JW4A 1AWJA 4JRIA 2PTKA 1N9RA 2KXCA 3DB3A 2E4HA 5GAOr 1GCPA 4KUIA 2RO0A 2YHTA 4AFUC 1WNLA 3CEYA 2GQIA 1NPPA 1VQ9A 2GBQA 2DXUA 2H3EB 4MMKA 2Y4XA 3GP8A 3JB9H 2VUBA 3CD6A 4ELYC 2MI6A 1TOVA 5KYYB 2XMFA 3H0IA 4IURA 1VA7A 1VQ6A 2QDLA 4PL6A 5CVIA 4M75D 4C8QF 4CRIA 2L3QA 3M0PA 3LWHA 4C8QB 4N4IA 2O4XA 4FW2A 1UJYA 1XQHA 2A08A 2BUDA 2CUBA 4OMPA 3V7CA 5CCAA 3QUIA 4X34A 4C8QC 1ZUKA 2KBTA 2QI2A 4WCIA 1VQ9Q 4XTYA 4M7AD 2LCLA 2AKKA 2E10A 3M9QA 1M1FA 1QCNA 2QTVA 1D1CA 5J39A 1X75C 2F5TX 1IGQA 3V8LA 1R0CB 1Q82R 3CPFA 2IIMA 1HSQA 3GOXA 4M78F 3TREA 1QVFS 1P92A 3CC7T 2YLCA 2K79A 3MO8A 4M78B 1VQ6Q 2XDDA 2HQEA 3VU3C 4PJOC 2LZ6B 3FDRA 1PSEA 5FRMA 1HD3A 4PK4A 1VUBA 1VYVA 1K8AR 1N6AA 4ANJA 3I56A 4LDVA 2HAXA 1A0NB 4V2SA 1SSFA 2QAZA 1IO6A 3EG9B 2GTJA 3VS5A 4B9XA 4ZTJA 5GAOq 4FYWB 3L2WA 2DZ9A 2DA9A 3UWNA 3PIPA 4M78A 3EG0A 3CXCP 1D0YA 1K0XA 3QWXX 3E19A 4JZ3A 3BE3A 2ZPHB 3OW2P 3UA6A 1Q7YC 4A4EA 3EG9A 4LUDA 3RERA 3CXCA 2K4YA 2CZ6B 2JXBA 4Y92A 5CKFA 4JLIA 2L2PA 2QGGA 2QA4A 4LD9K 3OW2A 3CCUT 1ZA1B 2FZGB 4NOYA 4N4HA 3VUZA 3CMEA 2KR3A 1AD5A 3CCSA 1KHIA 4RTZA 4ZTFA 3OY9A 2VGNA 2HKNA 3VS2A 2DVJA 2RI5A 3SWNA 1IXDA 2H8HA 4OB0B 4Q5WA 3OBYA 4R0KA 3M0RA 1M4ZA 4OMLA 1NEBA 1I0CA 3M54A 3MP8A 1YN8A 2NWMA 2X9HA 2FPEA 2JMCA 3FB9A 4WTOB 3J81E 2EPDA 4QVDA 5I11A 3FC3A 1YJ9Q 1MV0B 3OS5A 4M7DC 2CZ0B 1QVGP 3R6OA 1OX9A 3QJYA 3JCMc 3RKXA 3VYHB 3CMEQ 4M77C 2GFAA 5IXFA 3CCSQ 2EIFA 2EJFA 5CKHA 2P0PA 2QEXA 1PHTA 4ZN3A 1UGSB 3QZ9B 2JTFA 2ZPFB 2PU9B 2QXFA 2OX7A 3BDUA 5GAN3 3QHSA 1RAEB 1H8KA 3A8LB 3O5ZA 1U5SA 4ZN1A 2KYBA 2RI2A 2GTOA 4OB2B 5GAMg 4L59A 2AHJB 3PTAA 4IIMA 4MZPA 2L8DA 4QQ6A 5GAN8 1ZUYA 2PVOB 4JUVA 1M3BA 5GAOl 2PVDB 2R5AA 3JB9I 2AT1B 5AYFA 4J7FA 3M59A 4JZ4A 2I2LA 4LD6A 5GAN7 2LNVA 4QVCA 4FIBA 2NUZA 5KYWA 1ABOA 3VS4A 4JPBW 3OYLA 1Q81R 1TG0A 4RG2A 1IRXA 4J5YA 1I5OB 1VQ7A 1BU1A 1Q7YU 4PJNA 1JJ2S 4XU0A 1KQSS 2WSCE 2W0ZA 5CKDA 2GCXA 5D6XA 2RF0A 1QKXA 4E7LA 5GANj 4EMKB 3I35A 2DILA 1XOVA 3A5ZB 1Q82C 2K7AA 1M1KR 4HXJA 2B8AA 5FWBA 1S1NA 4J9FA 2AIRB 5LJ5e 1M2VB 3CBOA 1VQNA 3CC4T 3GBQA 1YIJT 3NHNA 3M57A 4E7KA 2CYZB 3EG2A 2RHUA 1AZGB 4BE2A 3DKMA 5I21A 4EMKA 1K8AC 3HTRA 2XDPA 1NBEB 3M55A 2DL4A 5EC7A 3AHUA 3CCMT 1JXOA 1T3LA 1QWFA 1MMAA 1BCMA 1B3QA 1H3HA 4HCZA 2O88A 3RNJA 1ZLMA 1YHQA 1TUDA 2RA2A 4HVWA 2FRWA 4OF1A 2K57A 2EKHA 3S3MA 2OTLA 5GMKe 2M02A 4F16A 1NJIR 3CCRA 2MYSA 1NLOC 4PFPA 5CO7A 5LJ3e 1VQNQ 4EMGA 2JTMA 3PMTA 3G4ST 4RTWA 4AFQC 3I55A 1XTDA 3LWIA 4GLKA 1VQLA 1BB9A 1JEGA 3FRNA 1CKBA 4J9HA 1ZSGA 3MCAB 2NUTA 3RMSA 3OS1A 3G6EQ 2K2VA 2YUOA 5CIUA 4C92F 1YHQQ 1S72A 1VQOT 1UECA 2DTIA 2HD0A 1TS9A 4LXCA 4C92B 4NL3A 3EFRA 2OTLQ 1KG1A 1ZHIA 3CC2T 4E7IA 4F7UF 4OMNA 4A54A 1C6VX 2JOYA 1U1TA 2KSSA 4F7UB 2QQSA 4FSSA 2KYMA 2L0AA 3I55Q 2KXDA 2KDSA 4HKEA 5CQXA 1VQLQ 4C92A 4J6XA 1AVZC 1ZBJA 4A4GA 4AG2C 5LL6S 4OMOA 1Q82U 2DYIA 1LJOA 1D3BA 1Y71A 2ED1A 1YJNT 1Q86R 2OTJA 2LNHB 2P0QA 5GANd 1PSFA 2HKQB 5DLQE 4C5HA 1SHFA 1T0JA 3ZEHA 4JJCA 4KRTA 1OV3A 4OB1B 5KYXB 3E9GA 5HY6A 1K8AU 2LP5A 1UE9A 2DD5A 4KGZB 3OYNA 1VIFA 2NUPB 3V7SA 1WX6A 1X27A 1R8OB 1UUEA 2F1LA 3OYAA 2E3HA 1GCQA 5KCHA 3MEWA 1U1SA 3JCMh 1Q81C 5IHNA 2MCNA 4DA4A 2DX1A 2LQ8A 4XAXB 5GMKh 1VQPA 5KYXA 3JSCA 2LX9A 2OTJQ 2EQIA 3OYIA 2DERA 3LW5E 4JS4A 1YJWT 2J6FA 2VB6A 1VQ8T 2A37A 4FL6A 4BI8B 3OSSC 1QVGS 1MMDA 3RESA 1YWOA 5L8RE 1UB4A 4IUVA 1M1KC 3RKWA 3JCMJ 4C5GA 1R77A 3RR6A 2JUFA 1YI2A 1OU9A 5CKBA 5ECAA 4BI4A 3M4YA 2K9GA 2J6KA 4KBMB 1PKTA 4MDWA 4J9CA 3QJ6A 1OQKA 1TWBA 1VQMT 1X69A 3CCQT 2G3RA 4KUDK 2V1RA 1W6XA 1NE8A 3CCVT 4OMMA 2RPNA 1M8MA 2DJZA 4J83A 4X1VA 4E7SA 2V1QA 4CC3A 1OI1A 2DRMA 3HRUA 1G83A 1MUZA 1NJIC 2WSFE 5I2MA 1YI2Q 3PVLA 1B34B 2V26A 5KYNA 1QKWA 3EHQA 2X3XD 2CP6A 4ORZA 1QLYA 1BIBA 2EQMA 3GLXA 4R55A 1NM7A 4MMLA 1RAHB 3FJ5A 1EIFA 1PKSA 2FO0A 2I0NA 3A98A 4RUGA 2HQXA 1EZZB 3JCMQ 1XJWB 2ZZDA 5LJ5d 3OMGA 1BIAA 3VV0A 4C5EA 5GAOm 2LT1A 4MZTA 1W2BP 1GFCA 2RN8A 2ATCB 1MNEA 1E7OA 3O8VA 2DKGA 2MWPA 3GNGA 2JTEA 3RDVA 3CPWS 1Q81U 2YUPA 4FW1A 4BD3A 1KIKA 5M9OA 1W2BA 4J9DA 2W10A 5C0MA 4K11A 1IGUA 3QBYA 2DXBA 2K3BA 4EDUA 1KQ1A 1UGRB 4LDUA 3OYMA 3OYBA 2FEIA 5LJ5g 1M1KU 1K73C 2KI7A 4BE1A 4HVVA 2K6DA 1UFFA 1Q86C 4C8QD 2CT3A 4L6V5 4F04B 3NGPA 4JLGA 2LVMA 4ME7A 3E1SA 2O4XB 4M75E 4PJOE 1VQ4T
chains in the Genus database with same CATH topology
3OSVA 3M54A 4IUPA 1M5Q1 2DXCA 2OTJT 2JZ2A 2MAMA 3DB4A 5D6WA 5GAMh 2X4WA 3JCMe 3CPWA 3CCJT 4FM4B 2XDBA 4O6JA 2VXFA 2XD0A 3J80E 3MP8A 2EAYA 2R5MA 2GQVA 3PT9A 2LTOA 1GXIE 3META 3FB9A 3QDRB 4QQGA 4Y28E 3J81E 4XTXA 5FRNA 3OYGA 4QVDA 4KT0E 3FC3A 4B9WA 3X25B 2EFIA 3P8HA 3JCMg 4Y91A 3OS5A 2DEQA 4XU1A 1VQNT 1KC8C 4M7AE 3RIRA 4M7DC 4PJOD 4ELZC 2RHYA 1VQ5T 2CZ0B 2K5FA 3UPUA 1LOJA 2VC8A 5D6YA 1VIEA 3R6OA 3QJYA 5LJ5f 3JCMc 5CK9A 3RKXA 3VYHB 3MEUA 1HK9A 5A2QE 2XU8A 3OB9A 2R58A 1QP3A 1Y96A 4M77C 5CQYA 4XQ3A 2GFAA 3ZBDA 4A4KA 5LJ3g 1NJIU 3JB9D 3L42A 2DAQA 1YJNA 4YTLA 2EIFA 5GANf 1YITT 2EJFA 5CKHA 2QQRA 3QG1A 2P0PA 2QEXA 4Z02A 2LCCA 4ZN3A 1UGSB 3QZ9B 3TEEA 2JTFA 2V8JA 2ZPFB 2PU9B 1VQPT 3G6ET 2QXFA 4IKFA 2PUKB 2RHIA 3BDUA 2KY9A 4E7JA 5GAN3 1YHQT 3QHSA 4P5NA 5GAN5 2FVUA 2RD1A 4BE0A 3A8LB 2DTHA 4IUQA 2EQUA 4ZN1A 1X6OA 1N8RC 1M90U 2RI2A 2FB7A 4OB2B 5GAMg 4UC4A 3WXMB 4L59A 2OTLT 1KQ2A 5IT9E 3EAEA 5I2SA 2AHJB 3PTAA 3Q1JA 1OZ3A 4MZPA 1M9SA 2L8DA 4QQ6A 4TVRA 5GAN8 2DIQA 1MGQA 1YCYA 3JCMf 3CCEA 2PVOB 4JUVA 5GAOl 2PVDB 2R5AA 4OB3B 3JB9I 2E70A 3VJPA 2LDMA 4J7FA 5AYFA 3M59A 4PNOA 5C6SA 2I2LA 3OYDA 2X4JA 2ZPEB 4LD6A 2XICA 1KD1U 5GAN7 1I5LA 2LNVA 2YLBA 3CD6T 4M78C 2O01E 5LJ3f 3I55T 3QZ5B 1OYXA 1WJQA 4FIBA 4QVCA 2ZGWA 3LLRA 2HBPA 2EJGA 5FROA 2F69A 3OYLA 1VQLT 2V8KA 3M53A 4IUTA 4BI3A 1BI1A 3L2ZA 4OGEA 4RG2A 2LC4A 2CKKA 4J5YA 1QVPA 3A8OB 3OYEA 3LYIA 4HT9A 4HA8A 2M0OA 2IG0A 1VQ7A 2E41A 3KXTA 1Q7YU 1JJ2S 4XU0A 2EYQA 2XG8D 3X20B 5LJ5j 3A8MB 5DM7R 1KQSS 2XI9A 2E65A 2WSCE 5CKDA 2DIGA 2GCXA 2D9TA 5A0LA 5D6XA 4M7DE 5EG2A 5GAMf 1VQ4A 4E7LA 4DQ2A 5GANj 3TCJA 4EMKB 3CMAT 3JB9J 2RJCA 4F7UA 2A7YA 3MP6A 4R56A 4NS5A 3BY7A 3L2QA 4M77E 4IUUA 4M75A 1XOVA 3A5ZB 1Q82C 3ME9A 3SWNB 5DLOA 3OYFA 2B8AA 4C8QE 4OP0A 3TU4K 1YJ9A 1K73U 5LJ5e 2K5IA 1VQMA 4N0AA 2CS7A 2M9UA 3LGFA 3CBOA 1VQNA 4M7DD 4O5VA 2LT4A 3SWNC 1RI0A 1YBYA 2E1HA 1Q86U 1BKBA 3CC4T 5GANe 1YIJT 1VQ5A 3M57A 4XK8E 4E7KA 3GIBA 2CYZB 3PMIA 5IN1A 1QW1A 4BACA 2RHUA 2LRQA 2JN0A 3A8GB 3RMQA 4BE2A 3DKMA 2X4YA 4NL2A 2P4TA 2IVWA 4M77D 5I21A 4JJNK 4EMKA 1K8AC 5CAIA 2DZCA 3DLMA 3FJPA 4N4GA 4M7AA 2XDPA 4DOWA 5GMKj 3M55A 3SDZA 3QYGB 3JRZA 4ZGJB 3OYCA 1MHNA 2DK3A 3AHUA 3CCMT 3P8BB 1I4K1 5LJ3j 1FX7A 3G71T 4BDYA 1JJ2A 2PUOB 1Y96B 2E6NA 2PQWA 2EKOA 4HCZA 3I56T 1KQSA 1YHQA 2WSEE 5GAOn 1G5VA 2RA2A 5J26A 4XTWA 4OF1A 4M78E 1KC8U 2K57A 2BKDN 2XKOC 3S3OA 1K9MC 3S3MA 2OTLA 5GMKe 3PFSA 3PGGA 4LDXA 1M1GA 3RUXA 3CCRA 3GNFB 3QYHB 1NZ9A 3QIIA 3CC7A 2EQJA 2Y90A 5CO7A 5LJ3e 3E9FA 3OYHA 2XIDA 3HFNA 5GAMj 4EMGA 2P0KA 2JTMA 3PMTA 3G4ST 3GF5A 2C06A 1I8FA 3M4GA 4M78D 4ZGDB 3BFMA 3I55A 4J8OA 1XTDA 3LWIA 4A4HA 4J7IA 2RJFA 4GLKA 1WQWA 3VYGA 1VQLA 3ASKA 5GMKm 3FRNA 3JCMW 1N8RU 3MEVA 3M5AA 3MCAB 2WACA 3MHXA 3X26B 1H641 1ZBXA 2OAUA 5GAMe 2RK1A 1UGPB 3RMSA 3OS1A 2QA4T 1W4SA 2FL7A 2K2VA 3VKIA 5CIUA 4C92F 5FU7B 3S6WA 2QQBA 1S72A 1VQOT 4C92G 2DTIA 1KHCA 2HD0A 4C92B 3OS2A 2OTJA 1JRIA 3CMAA 1XNIA 3EFRA 4NL3A 5FLXE 4X9DA 1KG1A 4JRPA 1ZHIA 3QKJA 4OVAA 1VQ9T 2E6ZA 2MF2A 3CC2T 3VUBA 4E7IA 1UEBA 3H8ZA 5KH6A 2KVQG 3C4SA 1BI3A 4F7UF 2QTXA 5HK0A 2RB6A 3BDLA 4A54A 2KQWA 4F7UG 2E5QA 3PNWC 1YI2T 2JOYA 4BDZA 1U1TA 2KSSA 4F7UB 2PVGB 2M16A 4M75F 5CR2A 4PJOF 2QQSA 2CGHA 3G7ZA 3QXEB 3N5BB 5FU6B 4FSXA 4M75G 4VUBA 3V8KA 4PJOG 2KDSA 4M75B 4HKEA 2RH2A 4C8QA 4PJOB 3CCUA 5CQXA 2DTOA 2VYTA 3OMCA 4C92A 4J6XA 1M8VA 4A4GA 1VQ6T 3JB9F 3MEAA 1JBMA 5LL6S 5HK3A 4RMOA 3INZA 2KAFA 3HKSA 3JB9G 4M75C 5A0DA 1UGQB 2RHXA 5GMKi 1M90C 2EJ9A 1G3WA 1G3YA 1Q82U 4HCBA 4M7AF 1BI2A 4E7HA 2RJDA 1VQKT 3V7RA 3QO3A 1LJOA 4N0AC 1D3BA 1Y71A 4PLLA 3G71A 4ATOA 4M7AG 4M7AB 4C0ZA 2KMTA 3FIFA 3NTIA 1X01A 4A4FA 4BY6B 4E47A 1B34A 1YJNT 2P0QA 3WVDB 4C0FA 5GANd 1PSFA 3T9NA 4ZGEB 2QEXT 2VV5A 5DLQE 2R57A 1IREB 2ZPBB 4XU3A 3CCJA 2FHDA 4C5HA 4PJOA 4EMHA 3ZEHA 3CC4A 2RI3A 4EMKC 4M7AC 1YIJA 2CZ7B 4OB1B 3JCMV 2QDYB 3E9GA 5HY6A 1K8AU 2YRVA 1AHJB 4EPCA 1WJSA 2VXEA 2D0QB 4C0GA 2DD5A 3OYNA 1U8RA 4LDWA 3G4SA 1N9SA 1VIFA 3V7SA 1O75A 3CBPA 1R8OB 4LDYA 1ZQ1A 4C5IA 3M58A 3OYAA 5KE2A 3QSUA 2H3JA 3X28B 3JCMd 3HP9A 4JS5A 3CCET 4MDXA 3GPLA 2K5LA 5KCHA 3MEWA 1U1SA 1YITA 3JCMh 4D6WA 2ZPGB 1HXDA 1Q81C 4DA4A 3S3NA 4HCCA 2LQ8A 3LGLA 2RK2A 4XAXB 1K9MU 1BYMA 2HNIA 2E64A 4OMFB 4GY5A 5GMKh 1VQPA 3WVEB 3G6EA 5LJ3d 3HSBA 2LQKA 2QQAA 3A8HB 3JSCA 3OYYA 4WF2A 4XU2A 2LX9A 3UT1A 4JRIA 1N9RA 1VQOA 4J6YA 3DB3A 3OYIA 3OS0A 5GAOr 3LW5E 4JS4A 1O9SA 4KUIA 1WPYA 2RO0A 2YHTA 1YJWT 1VQ8T 1VQ7T 1WNLA 3C95A 4FL6A 4BI8B 3CEYA 3OSSC 1NPPA 3L2UA 3OQ5A 3RESA 1QVGS 1VQ9A 3CC2A 5L8RE 1UB4A 2X4XA 2DXUA 4RKUE 4IUVA 3HFOA 3SFMA 1M1KC 5DY9A 4QW2A 3RKWA 4BUGA 4MMKA 4QVZA 5GAMd 2MMPA 4C5GA 5GMKl 3JCMJ 1YI2A 2JUFA 2Y4XA 2Y4YA 3H6ZA 3GP8A 3JB9H 2VUBA 3CD6A 4M7DF 5CKBA 4ELYC 2MI6A 3QPHA 2V8IA 4M7DG 2EWNA 4QQDA 3M4YA 4BI4A 3BW1A 4M7DB 1G3TA 4KBMB 4MDWA 2QQ9A 1LNXA 3RKYA 4IURA 4M77F 2K3XA 1YJ9T 1NPRA 3QJ6A 3LH0A 4MZMA 1VQMT 1VQ6A 3CCLT 2L89A 4M77G 3CCQT 4PL6A 1Y7XA 2G3RA 3M56A 4M77B 4KUDK 5CVIA 4M75D 3UDCA 3V8JA 2GFUA 3ZFJA 2E12A 4A53A 1NE8A 4C8QF 2XHCA 4CRIA 3LWHA 4C8QG 3CCVT 4XTVA 1WQ7A 2JNGA 4C8QB 2L3RA 2DVEA 2O4XA 2DJZA 4J83A 1FWZA 4N4IA 3CMET 3SD4A 1XQHA 4JRKA 1VQKA 3CCST 2BUDA 3CBMA 3V7CA 5CCAA 3OYKA 3MP1A 3QUIA 4X34A 1OI1A 5FU7C 1BI0A 2MWOA 4C8QC 2RHZA 3HRUA 2QI2A 4JDSA 4M7DA 4C92C 2DD4A 1I81A 4XTYA 3HL8A 4M7AD 2LCLA 2E10A 3M9QA 3ER0A 5A0GA 1M1FA 4JRQA 1QVGA 1NJIC 1D3BB 2WSFE 5CKEA 4M77A 5I2MA 4PLIA 1B34B 5J39A 3HPWA 3JAME 1X75C 2F5TX 3V8LA 2DPPB 1BIBA 2EQMA 3GLXA 3CPFA 4R55A 2RM4A 5KE3A 2DXTA 3X24B 5HKCA 3L2RA 1RL2A 4MMLA 3GOXA 1W2BS 2VGMA 4M78F 3P8DA 3TREA 3CCRT 1QVFS 1P92A 1WGSA 3CC7T 1EIFA 2YLCA 4M78G 3MO8A 2F5KA 4M78B 2A3LA 5FU6C 3CXCS 2XDDA 2HQEA 1WJRA 2CZ1B 2HQXA 3VU3C 3JCMQ 3J7AF 4PJOC 5GAN4 3FDRA 2KK4A 3JCMb 3OBWA 1PSEA 2ZZDA 1IZ6A 5FRMA 3OW2S 1VUBA 4X9CA 3CCMA 4PKCC 1H3ZA 3FEOA 3NFCA 5LJ5d 4C0DB 2EQKA 3OMGA 1BIAA 3OYJA 3HRSA 2XK0A 1DJ7B 5GAOp 3NTHA 1N6AA 1QP2A 3FLGA 3VV0A 4C5EA 5LJ5h 3LX7A 4CI0C 4LDVA 5GAOm 3EFSA 3I56A 2HAXA 4V2SA 1SSFA 2RJEA 2BIVA 1N27A 2LT1A 3OA6A 2FYKA 4B9XA 4BB7A 4MZTA 4C0DC 5GANh 4ZTJA 1V29B 5GAOq 1KD1C 4RG8A 3L2WA 1YJWA 2DZ9A 1VQ8A 2ZPIB 3UWNA 4BY6C 3PIPA 3L2VA 4M78A 4FT4A 1S72T 3O8VA 2GF7A 2JVVA 3E19A 2DKGA 3HHTB 2MWPA 3GNGA 2NLUA 4XTZA 2ZPHB 2X35A 3CPWS 1Q81U 4II1A 3SB2A 3KBGA 4FU6A 3JCMX 4BD3A 5M9OA 3DLLA 1Q7YC 5J3BA 5KCOA 4RCBA 1W2BA 4FT2A 1Y07A 4A4EA 5GAN2 1QVFA 4KULA 3C94A 5C0MA 2M1HA 3QBYA 3RERA 2DXBA 3CXCA 2K4YA 2CZ6B 3NTKA 4C92E 3CCLA 3CCQA 2ZCFB 5CKFA 4EDUA 1KQ1A 2DO3A 1UGRB 5GAN6 4JLIA 3F70A 2QA4A 4LD9K 4LDUA 3URGA 1OZ2A 3OW2A 3CCVA 3OYMA 3CCUT 5LJ3h 4NOYA 3OYBA 4XTUA 4N4HA 3VUZA 2K3YA 2L5QA 5LJ5g 3CMEA 1M1KU 1K73C 3PIOA 3C12A 4BE1A 3CCSA 1G3SA 2D6FA 1KHIA 4ZTFA 4DOVA 3OY9A 4HT8A 1TH7A 2VGNA 5IAYA 5GANg 1Q86C 4OGCA 3HRTA 4RCCA 4C8QD 4F7UE 3L1AA 4L6V5 3KUFA 2RI5A 3SWNA 4JLGA 4C92D 2LVMA 4ME7A 1FXXA 4L5GA 3E1SA 2O4XB 4OB0B 4M75E 4Q5WA 3JCMP 3OBYA 4PJOE 1JB0E 1VQ4T 4J6WA 1M4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BUD A;  3MEA A;  3OYK A;  4IUP A;  3MP1 A;  2JZ2 A;  3DB4 A;  3LGF A;  4X34 A;  5D6W A;  2X4W A;  1OI1 A;  2MWO A;  2RHX A;  1RI0 A;  2RHZ A;  4E7K A;  3MP8 A;  3PMI A;  2R5M A;  5IN1 A;  4BAC A;  2RHU A;  2LTO A;  4E7H A;  3MET A;  2LRQ A;  4BE2 A;  4QQG A;  2RJD A;  3M9Q A;  2X4Y A;  3OYG A;  4PLL A;  5FRN A;  3FC3 A;  4B9W A;  2EFI A;  3DLM A;  3P8H A;  3NTI A;  4N4G A;  4A4F A;  2XDP A;  4PLI A;  5J39 A;  2R57 A;  2RHY A;  2EQM A;  3L2R A;  3OYC A;  2FHD A;  1MHN A;  4C5H A;  5KE3 A;  5D6Y A;  3ZEH A;  3GOX A;  2RI3 A;  3P8D A;  3MEU A;  1WGS A;  3OB9 A;  2R58 A;  5IAY A;  4BDY A;  2E6N A;  2GFA A;  2EKO A;  2PQW A;  3E9G A;  3MO8 A;  2F5K A;  4HCZ A;  2YRV A;  3L42 A;  2DAQ A;  1G5V A;  2HQE A;  1WJS A;  1WJR A;  5J26 A;  2HQX A;  2QQR A;  2BKD N;  3FDR A;  4Z02 A;  2LCC A;  3OYN A;  3S3O A;  5FRM A;  2JTF A;  3S3M A;  1H3Z A;  3PFS A;  3FEO A;  2EQK A;  3OMG A;  3OYJ A;  4IKF A;  4C5I A;  2XK0 A;  2RHI A;  3QII A;  3NTH A;  3OYA A;  5KE2 A;  3FLG A;  4C5E A;  4E7J A;  3LX7 A;  2EQJ A;  4BE0 A;  3E9F A;  3OYH A;  4IUQ A;  3MEW A;  5KCH A;  1SSF A;  2EQU A;  2P0K A;  2RJE A;  2BIV A;  1N27 A;  2RI2 A;  3OA6 A;  3PMT A;  4B9X A;  3S3N A;  4UC4 A;  4L59 A;  3LGL A;  4ZTJ A;  3EAE A;  4GY5 A;  3L2W A;  3Q1J A;  1OZ3 A;  3UWN A;  2L8D A;  4QQ6 A;  3L2V A;  2DIQ A;  4A4H A;  2RJF A;  3UT1 A;  3O8V A;  2GF7 A;  3ASK A;  2MWP A;  2NLU A;  2R5A A;  3DB3 A;  2X35 A;  3OS0 A;  3OYI A;  2LDM A;  3MEV A;  5C6S A;  4II1 A;  3OYD A;  2WAC A;  4FU6 A;  4LD6 A;  2RO0 A;  4BD3 A;  3OS1 A;  4FL6 A;  1OYX A;  1WJQ A;  3CEY A;  5M9O A;  5KCO A;  3L2U A;  3OQ5 A;  3LLR A;  5CIU A;  3S6W A;  2X4X A;  5FRO A;  3OYL A;  4A4E A;  4IUV A;  5C0M A;  4IUT A;  4QW2 A;  2M1H A;  4RG2 A;  1KHC A;  4QVZ A;  3OS2 A;  3QBY A;  4C5G A;  2CKK A;  3NTK A;  3OYE A;  1XNI A;  3H6Z A;  3LYI A;  4EDU A;  2M0O A;  2IG0 A;  3F70 A;  3QKJ A;  1OZ2 A;  4OVA A;  4QQD A;  3OYM A;  4E7I A;  3OYB A;  4N4H A;  3H8Z A;  2DIG A;  2K3Y A;  2D9T A;  3C4S A;  5D6X A;  4IUR A;  5KH6 A;  2K3X A;  3BDL A;  3QJ6 A;  4BE1 A;  4E7L A;  3LH0 A;  2E5Q A;  3PNW C;  2L89 A;  2RJC A;  4PL6 A;  3OY9 A;  2G3R A;  4BDZ A;  4ZTF A;  2M16 A;  3MP6 A;  4NS5 A;  2QQS A;  2GFU A;  3L2Q A;  4CRI A;  4IUU A;  3KUF A;  2RI5 A;  3ME9 A;  2LVM A;  3OYF A;  2L3R A;  2O4X A;  4N4I A;  2O4X B;  4Q5W A;  3SD4 A;  2B8A A;  2VYT A;  3OMC A;  4A4G A; 
#chains in the Genus database with same CATH topology
 3QWY A;  2DXC A;  2JZ2 A;  2MAM A;  5GAM h;  3CCJ T;  2XD0 A;  3J80 E;  4A63 B;  2EAY A;  3QDR B;  4Y28 E;  4XTX A;  4KT0 E;  1D1A A;  3P8H A;  3JCM g;  2EGC A;  4M7A E;  1HJD A;  4PJO D;  2CUD A;  1AWO A;  2K5F A;  1LOJ A;  2VC8 A;  5D6Y A;  1HK9 A;  1QP3 A;  5CQY A;  5LJ3 g;  1NJI U;  3JB9 D;  3L42 A;  2DAQ A;  1YIT T;  1AWW A;  2QQR A;  3QG1 A;  2BZ8 A;  4Z02 A;  1YWP A;  1YNZ A;  3RBB B;  2DE0 X;  2PUK B;  3MPU B;  4E7J A;  2YSQ A;  5GAN 5;  2RD1 A;  2D8J A;  4BE0 A;  1IHV A;  2DTH A;  4IUQ A;  1N8R C;  1M90 U;  4UC4 A;  2CP0 A;  1T3S A;  1OZ3 A;  4TVR A;  4GLM A;  1YCY A;  1D09 B;  4OB3 B;  5C6S A;  2X4J A;  3EGD A;  4KH0 B;  2XIC A;  1I5L A;  3CD6 T;  4Z89 A;  4M78 C;  1WJQ A;  2ZGW A;  2GNC A;  2EJG A;  5FRO A;  2V8K A;  3M53 A;  4BI3 A;  2DL8 A;  1SRL A;  1OUL A;  2F2V A;  3LYI A;  2BTT A;  2XG8 D;  2E65 A;  2LQW A;  4M7D E;  5GAM f;  2BE7 D;  3JB9 J;  4CC2 A;  3BY7 A;  2CT4 A;  3M0S A;  4M77 E;  4IUU A;  4M75 A;  3ME9 A;  3SWN B;  2YT6 A;  3OYF A;  1SEM A;  2DJQ A;  1WHG A;  1YJ9 A;  1K73 U;  3THK A;  2CS7 A;  4M7D D;  2LT4 A;  3SWN C;  1Q86 U;  5GAN e;  4XK8 E;  3PMI A;  1Y57 A;  3CCU Q;  2JN0 A;  3A8G B;  4NL2 A;  2P4T A;  2IVW A;  4M77 D;  1BBZ A;  4M7A A;  5CAI A;  1GL5 A;  3DLM A;  1PM3 A;  2SEM A;  4DOW A;  1ZX6 A;  2EGA A;  4ZGJ B;  1MHN A;  1I4K 1;  1M27 C;  1K9A A;  3I56 T;  2WSE E;  1WHH A;  5J26 A;  9ATC B;  4CC7 A;  2G6F X;  1UDL A;  3PFS A;  1PG5 B;  3PGG A;  3RUX A;  2KNB B;  1ZSZ A;  3QII A;  2KE9 A;  2KRS A;  3M0T A;  2VKN A;  3E9F A;  2P0K A;  1K76 A;  4J9B A;  3ULR B;  2A28 A;  5KYU B;  2VAS A;  4J7I A;  2RJF A;  2C0O A;  1WQW A;  4AT1 B;  4PJL A;  3ASK A;  3SHW A;  1V1C A;  1N8R U;  2RQU A;  3MEV A;  2WAC A;  2OAU A;  8AT1 B;  4AMC A;  1UGP B;  3TQ7 P;  2QA4 T;  5KYW B;  3VKI A;  5FU7 B;  3S6W A;  4E2F B;  2QQB A;  3A1P A;  1K1Z A;  3OS2 A;  1KD1 R;  2HMA A;  2KGT A;  1LCK A;  5FLX E;  5KYU A;  2CRE A;  3IQL A;  4CC4 B;  2E6Z A;  3VUB A;  1UEB A;  2D1X A;  5L23 A;  5KH6 A;  2EVR A;  5HK0 A;  2RB6 A;  2P84 A;  4BDZ A;  1HYO A;  2PVG B;  5IH2 A;  2CGH A;  3QXE B;  5FU6 B;  3EHR A;  4M75 G;  2AK5 A;  4VUB A;  1ZUU A;  4PJO G;  1SF9 A;  2VYT A;  4LN2 A;  3MEA A;  3INZ A;  3JB9 G;  1IB8 A;  1UGQ B;  2RHX A;  1OU8 A;  2QYZ A;  3EGX B;  1VQK T;  4ATO A;  3QO3 A;  4M7A G;  1X43 A;  4C0Z A;  1X01 A;  4BY6 B;  1T0H A;  3WVD B;  4C0F A;  1CKA A;  2HZY A;  1AEY A;  2QEX T;  1IRE B;  2FHD A;  4EMH A;  1UGV A;  4GBQ A;  2LQN A;  4EMK C;  2RQR A;  2CZ7 B;  1M2O A;  2LJ0 A;  1WJS A;  2VXE A;  4LDW A;  3G4S A;  2OI3 A;  8ATC B;  1M30 A;  3EGX A;  3NPF A;  3REA B;  1IHW A;  2X3W D;  3M58 A;  3EFO B;  1I1J A;  3GPL A;  2C0T A;  4D6W A;  3S3N A;  1BYM A;  3EG3 A;  2HNI A;  1QMC A;  3H41 A;  3G6E A;  3HSB A;  4WF2 A;  4XU2 A;  2HCK A;  3KFV A;  2C0I A;  1K0S A;  1VQO A;  4J6Y A;  3TSZ A;  3OS0 A;  1O9S A;  2NUT B;  2HL5 C;  3I5R A;  1VQ7 T;  3EFO A;  3CC2 A;  2YUN A;  1BK2 A;  4QVZ A;  2MMP A;  5GMK l;  3PE0 A;  3G4S Q;  4M7D G;  2CP7 A;  1WXB A;  3BW1 A;  1TUC A;  1LNX A;  2K3X A;  1N5Z A;  3LH0 A;  3CCL T;  4M77 G;  1MND A;  4D8K A;  1Y7X A;  3M56 A;  2A0F B;  2GFU A;  4A53 A;  2E12 A;  4XTV A;  2JNG A;  2DVE A;  2YRC A;  3SD4 A;  1VQO Q;  1K4U S;  4Z8A A;  3OYK A;  1OEB A;  2CP3 A;  3MP1 A;  1EFN A;  2RHZ A;  2O9S A;  4JDS A;  3CC2 Q;  4C92 C;  3HL8 A;  1TUG B;  1KJW A;  1D3B B;  4KH1 B;  3REB B;  4PLI A;  3HPW A;  4M4Z A;  2AKL A;  3L2R A;  5KE3 A;  3X24 B;  1RUW A;  1RL2 A;  1U06 A;  2VGM A;  1TU0 B;  2ROL A;  2D0N A;  3P8D A;  3CCR T;  2EYX A;  3TSW A;  3CXC S;  2CZ1 B;  1SSH A;  3PVQ A;  3J7A F;  5GAN 4;  3JCM b;  2LMJ A;  2BZX A;  3OBW A;  3OW2 S;  1H3Z A;  1M3A A;  1AWX A;  2EQK A;  3HRS A;  5GAO p;  2Z0W A;  1QP2 A;  3FLG A;  5LJ5 h;  3LX7 A;  4CI0 C;  3EFS A;  2O2O A;  1N27 A;  4BB7 A;  1RAG B;  1KD1 C;  1YJW A;  1VQ8 A;  3L2V A;  1GCQ C;  1S72 T;  2GF7 A;  2NLU A;  2X35 A;  1K9M R;  1OPL A;  4II1 A;  3KBG A;  4FU6 A;  3JCM X;  3DLL A;  5J3B A;  4RCB A;  4FT2 A;  1QVF A;  2M51 A;  4KUL A;  2M1H A;  1E6H A;  3NTK A;  3CCQ A;  2EYZ A;  2ZCF B;  1WHL A;  5GAN 6;  3URG A;  2A36 A;  3CCV A;  5LJ3 h;  4RTV A;  2L5Q A;  3PIO A;  1GBR A;  2OAW A;  2D6F A;  2COY A;  4AG1 C;  1TH7 A;  2QGF B;  5GAN g;  6AT1 B;  4RCC A;  3HRT A;  1YJW Q;  1VQ8 Q;  1RI9 A;  4L5G A;  3JCM P;  4J6W A;  1RLP C;  2OTJ T;  1M5Q 1;  3DB4 A;  3D7S B;  1NG2 A;  4FM4 B;  4O6J A;  2NYS A;  2VXF A;  2XDB A;  1G8X A;  2MPX C;  2R5M A;  2GQV A;  2LCS A;  2LTO A;  3MET A;  1UJ0 A;  5FRN A;  4PFO A;  2DBM A;  4Y91 A;  1VQM Q;  4XU1 A;  3CCQ Q;  3RIR A;  5GJV B;  1ZA2 B;  1VQ5 T;  1ABQ A;  4RTT A;  3CCV Q;  1VIE A;  2CP2 A;  5LJ5 f;  5CK9 A;  5A2Q E;  3OB9 A;  2P4R A;  5IAY A;  1Y96 A;  3ZBD A;  2GGR A;  4YTL A;  2LCC A;  2DLP A;  2YRD A;  1VQP T;  4IKF A;  2RHI A;  2KY9 A;  2EQU A;  1X6O A;  1GFD A;  3WXM B;  1KQ2 A;  1EX4 A;  5I2S A;  1B07 A;  2RMO A;  2DIQ A;  3JCM f;  1RLQ C;  3CCE A;  2CP5 A;  3VRY A;  2E70 A;  2QG9 B;  3VJP A;  4PNO A;  1KD1 U;  2FPF A;  3UAT A;  2O01 E;  5LJ3 f;  3QZ5 B;  4KGX B;  2CSI A;  3LLR A;  2HBP A;  2F69 A;  2ESW A;  1PNJ A;  3VS3 A;  4IUT A;  1BI1 A;  3L2Z A;  4OGE A;  2DNU A;  2LC4 A;  4B6M A;  3A8O B;  1SRM A;  2EYQ A;  5DM7 R;  3X20 B;  3A8M B;  2L3S A;  5A0L A;  2YXY A;  5EG2 A;  1VQ4 A;  2J06 A;  4DQ2 A;  1YP5 A;  4FYY B;  3CMA T;  2KRO A;  2RJC A;  3EH2 A;  1RAI B;  3MP6 A;  1MMN A;  4NS5 A;  1FMK A;  1QQJ A;  1D0X A;  3CCE Q;  7AT1 B;  2HDA A;  4C8Q E;  2RQW A;  1PCX A;  4N0A A;  2M9U A;  2B86 A;  1X6G A;  2E1H A;  1BKB A;  3MKD A;  1D0Z A;  1KQS P;  1FYN A;  2DYB A;  2LRQ A;  1JU5 C;  4N4G A;  2HSP A;  5IHK A;  2ED0 A;  1WHM A;  3QYG B;  1UG1 A;  2HQH A;  3P8B B;  1QCF A;  1FX7 A;  3G71 T;  2JMA A;  4BDY A;  1JJ2 A;  2EGE A;  2PUO B;  2PQW A;  2EKO A;  3EGU A;  1KQS A;  1VQ4 Q;  4M78 E;  2BKD N;  1QCO A;  2XKO C;  1MV3 A;  1NLP C;  3S3O A;  3CCJ Q;  1K9M C;  2IPO B;  4LDX A;  1RAD B;  3GNF B;  3CC7 A;  5AT1 B;  3U23 A;  2LJ1 A;  2DL7 A;  2Y90 A;  5GJW B;  2RNA A;  2XID A;  5GAM j;  4J9G A;  3GF5 A;  3H0H A;  2C06 A;  3M4G A;  4M78 D;  4ZGD B;  2JS2 A;  4J8O A;  3VYG A;  3VRZ A;  5GMK m;  1YIT Q;  1WXT A;  3JCM W;  3M5A A;  3MHX A;  3X26 B;  3EGD B;  1H64 1;  1SPK A;  2RQT A;  1W4S A;  2COZ A;  2E5K A;  1KHC A;  4F14 A;  1JRI A;  1XNI A;  4X9D A;  1J3T A;  2CDT A;  3QKJ A;  1ACM B;  1VQ9 T;  3CC7 Q;  2MF2 A;  5KYY A;  4F17 A;  1WHJ A;  1BI3 A;  2E5Q A;  3PNW C;  5CR2 A;  4M75 F;  2M16 A;  4PJO F;  3G7Z A;  4RTU A;  3CD6 Q;  2BE9 B;  3N5B B;  5IHI A;  3M0Q A;  4M75 B;  2RH2 A;  4C8Q A;  1AT1 B;  4PJO B;  2YUQ A;  3CCU A;  1RAF B;  3OMC A;  4DBF A;  3H9N A;  1VQ6 T;  1TTH B;  3JB9 F;  5HK3 A;  4RMO A;  2KAF A;  4M75 C;  2CH4 A;  2JM8 A;  5GMK i;  2EJ9 A;  2FZK B;  1G3Y A;  1U3O A;  4M7A F;  1BI2 A;  1VYT A;  4M7A B;  4RTX A;  5I22 A;  4E47 A;  4A4F A;  1X6B A;  3T9N A;  2VV5 A;  2ZPB B;  4PJO A;  2KRM A;  3VS1 A;  2RI3 A;  4M7A C;  2ABL A;  1Z9Q A;  1SG5 A;  4DBH A;  3JCM V;  1G2B A;  2YRV A;  1AHJ B;  1JO8 A;  4PJM A;  4Z88 A;  1N9S A;  5HCK A;  4IIO A;  2DL5 A;  3I5S A;  1ZSZ B;  1WFW A;  1B7T A;  4JS5 A;  3HP9 A;  1KC8 R;  5D7U A;  2K5L A;  2DMO A;  1K9M U;  1ZSZ C;  3WVE B;  2VVK A;  2LQK A;  2QQA A;  2FG0 A;  3UT1 A;  3I56 Q;  3LH5 A;  3AT1 B;  4ZNX A;  1WPY A;  2OJ2 A;  3C95 A;  3L2U A;  3OQ5 A;  2HBW A;  2DET A;  2X4X A;  3NMZ C;  4RKU E;  1WLP B;  2ZAE A;  3HFO A;  3SFM A;  5DY9 A;  1W70 A;  4QW2 A;  4BUG A;  1NYG A;  5GAM d;  3H6Z A;  2Y4Y A;  4E6R A;  2KEA A;  4M7D F;  3QPH A;  2V8I A;  2EWN A;  4QQD A;  4M7D B;  1G3T A;  2QQ9 A;  3RKY A;  4M77 F;  1YJ9 T;  1NPR A;  4MZM A;  2L89 A;  1WI7 A;  4M77 B;  3UDC A;  3ZFJ A;  3V8J A;  2XHC A;  2QAS A;  4C8Q G;  2QA4 Q;  1WQ7 A;  1E6G A;  2L3R A;  4HVU A;  4QKU A;  1FWZ A;  3CME T;  1JXM A;  4JRK A;  1VQK A;  3CCS T;  3CBM A;  1PWT A;  5FU7 C;  1BI0 A;  2MWO A;  1CSK A;  4M7D A;  2DD4 A;  1I81 A;  2YWW A;  3ER0 A;  5A0G A;  1W1F A;  4JRQ A;  3CQT A;  1QVG A;  4LE9 A;  5CKE A;  4M77 A;  1GBQ A;  1JQQ A;  3JAM E;  3I9Q A;  2DPP B;  3CC4 A;  1YIJ A;  2RM4 A;  2DXT A;  5HKC A;  1W2B S;  2M0Y A;  1WGS A;  4M78 G;  2F5K A;  5FU6 C;  2A3L A;  1SHG A;  1WJR A;  4DBQ A;  2KK4 A;  1IZ6 A;  5IXB A;  4X9C A;  3CCM A;  4PKC C;  3FEO A;  3NFC A;  4C0D B;  3OYJ A;  1D1B A;  2XK0 A;  1DJ7 B;  3NTH A;  1VQK Q;  4LUE A;  1OPK A;  2RQV A;  2RJE A;  2BIV A;  3OA6 A;  2QEX Q;  2FYK A;  4C0D C;  5GAN h;  2CH4 W;  1V29 B;  2F2W A;  4RG8 A;  2MK5 A;  2ZPI B;  4BY6 C;  4E7Z A;  2E3I A;  1BCO A;  1RAB B;  4FT4 A;  2JVV A;  3HHT B;  4XTZ A;  3CC4 Q;  1YIJ Q;  3SB2 A;  2FZC B;  2YDL A;  5KCO A;  3QDF A;  1KK7 A;  1Y07 A;  5GAN 2;  3C94 A;  1PD1 A;  4JJB A;  4C92 E;  1VOM A;  3CCL A;  3CCM Q;  2DO3 A;  3F70 A;  1OZ2 A;  4PFZ A;  2O9V A;  2DBK A;  2EYW A;  4XTU A;  2K3Y A;  3CPW P;  1YCS B;  3C12 A;  4LNP A;  1G3S A;  2MIO A;  4DOV A;  4HT8 A;  2L3P A;  1UHC A;  4OGC A;  4F7U E;  2J7I A;  1VQ7 Q;  3L1A A;  3KUF A;  4C92 D;  1FXX A;  3EG1 A;  1JB0 E;  3OSV A;  1M2V A;  2QK0 A;  4IUP A;  1WDX A;  2AZS A;  5D6W A;  2X4W A;  3JCM e;  3CPW A;  3PT9 A;  1GXI E;  1UHF A;  4QQG A;  3OYG A;  4JJD A;  4B9W A;  3X25 B;  2EFI A;  1OX8 A;  2DEQ A;  3CCL Q;  1VQN T;  1KC8 C;  4AFZ C;  4ELZ C;  2RHY A;  1OOT A;  2EBP A;  3UPU A;  2D8H A;  1I07 A;  4OMQ A;  2COW A;  2PNI A;  3R6N A;  3MEU A;  2XU8 A;  2R58 A;  2FRY A;  1C1A A;  4XQ3 A;  4A4K A;  1YJN A;  5GAN f;  1M90 R;  2HL3 A;  3TEE A;  1PD0 A;  2V8J A;  4HCK A;  3G6E T;  4FYV B;  3E2U A;  1F1B B;  2K2M A;  1YHQ T;  4P5N A;  1LPL A;  2FVU A;  4PJJ A;  3VS6 A;  2FB7 A;  2OTL T;  5IT9 E;  3EAE A;  3Q1J A;  1M9S A;  3CCR Q;  3C0C A;  1MGQ A;  2PZ1 A;  1FMV A;  2LDM A;  3OYD A;  2ZPE B;  2YLB A;  3I55 T;  1OYX A;  2ECZ A;  1VQL T;  1YJN Q;  2VWF A;  2DM1 A;  1QWE A;  1Y0M A;  3UA7 A;  2CKK A;  1QVP A;  1WZO A;  3OYE A;  4HT9 A;  1QVF P;  4J9I A;  4HA8 A;  2M0O A;  2IG0 A;  2E41 A;  3KXT A;  2FPD A;  5LJ5 j;  4QT7 A;  1ARK A;  2XI9 A;  1K73 R;  1S72 Q;  2DIG A;  1Z9Z A;  2D9T A;  3JV3 A;  1KFZ A;  1VYU A;  3SEM A;  2F2X A;  3TCJ A;  2DL3 A;  2J05 A;  4F7U A;  2A7Y A;  4R56 A;  2LJ3 A;  3L2Q A;  4AFS C;  1TSF A;  5DLO A;  4OP0 A;  3TU4 K;  2O31 A;  2K5I A;  1VQM A;  1YFN A;  3LGF A;  4O5V A;  1RI0 A;  1YBY A;  1VQ5 A;  3GIB A;  5IN1 A;  1QW1 A;  4DEY A;  4BAC A;  3RMQ A;  2ROT A;  2X4Y A;  4JJN K;  2DZC A;  3FJP A;  3VS7 A;  1LVK A;  5GMK j;  2MOX A;  2JS0 A;  3SDZ A;  1TXQ A;  5FWC A;  3JRZ A;  3OYC A;  2DK3 A;  1X2Q A;  2KT8 A;  5LJ3 j;  1Y96 B;  2E6N A;  3MJX A;  4EIK A;  5GAO n;  1G5V A;  1X2K A;  2HSE B;  4XTW A;  1KC8 U;  1NYF A;  2JM9 A;  1MMG A;  2NUP A;  1M1G A;  3QYH B;  1NZ9 A;  1NEG A;  2EQJ A;  3OYH A;  1N8R R;  3HFN A;  1WYX A;  1VQ5 Q;  2KRN A;  1I8F A;  2CSQ A;  3BFM A;  2BZY A;  4A4H A;  1H92 A;  1UTI A;  1V76 A;  2HEQ A;  1M3C A;  1WHK A;  1PRL C;  4KGV B;  1KSW A;  2LX7 A;  1ZBX A;  5GAM e;  2RK1 A;  1VQP Q;  2EW3 A;  2FL7 A;  3TVT A;  3VS0 A;  1Q95 G;  4C92 G;  4ESR A;  1RAA B;  3CMA A;  2X51 A;  1C0M A;  4JRP A;  4OVA A;  3H8Z A;  2KVQ G;  3C4S A;  4D8D A;  2QTX A;  3BDL A;  2KQW A;  2JT4 A;  3EH1 A;  4F7U G;  1YI2 T;  4FYX B;  1Q7Y R;  4FSX A;  2DEU A;  3V8K A;  2DTO A;  2JJ9 A;  1M8V A;  3M0U A;  1JBM A;  2J6O A;  1SKU B;  3HKS A;  5A0D A;  1M90 C;  4J9E A;  1G3W A;  2DRK A;  4HCB A;  2AZV A;  4E7H A;  2RJD A;  3V7R A;  4N0A C;  4PLL A;  3G71 A;  3ZL7 C;  2KMT A;  3FIF A;  3NTI A;  3CMA Q;  1B34 A;  2KT1 A;  4ZGE B;  3UF4 A;  2R57 A;  4XU3 A;  3CCJ A;  1AZE A;  1WIE A;  2DF6 A;  1FMW A;  2QDY B;  5FW9 A;  4EPC A;  4DEX A;  2EYY A;  2D0Q B;  4C0G A;  1JJ2 P;  1U8R A;  2DFU A;  1RAC B;  1O75 A;  3H0F A;  1WXU A;  3CBP A;  1WA7 A;  4LDY A;  1ZQ1 A;  4C5I A;  3G1J A;  4DBR A;  3QSU A;  5KE2 A;  2H3J A;  1R0B G;  3X28 B;  3JCM d;  3CCE T;  4MDX A;  4FCY A;  1YIT A;  1GRI A;  4RTY A;  2ZPG B;  1HXD A;  4HCC A;  1PRM C;  2ENM A;  3LGL A;  2RK2 A;  1AOJ A;  2E64 A;  2SRC A;  4GY5 A;  4OMF B;  1PC0 A;  5LJ3 d;  3G71 Q;  3A8H B;  3OYY A;  2JW4 A;  1AWJ A;  4JRI A;  2PTK A;  1N9R A;  2KXC A;  3DB3 A;  2E4H A;  5GAO r;  1GCP A;  4KUI A;  2RO0 A;  2YHT A;  4AFU C;  1WNL A;  3CEY A;  2GQI A;  1NPP A;  1VQ9 A;  2GBQ A;  2DXU A;  2H3E B;  4MMK A;  2Y4X A;  3GP8 A;  3JB9 H;  2VUB A;  3CD6 A;  4ELY C;  2MI6 A;  1TOV A;  5KYY B;  2XMF A;  3H0I A;  4IUR A;  1VA7 A;  1VQ6 A;  2QDL A;  4PL6 A;  5CVI A;  4M75 D;  4C8Q F;  4CRI A;  2L3Q A;  3M0P A;  3LWH A;  4C8Q B;  4N4I A;  2O4X A;  4FW2 A;  1UJY A;  1XQH A;  2A08 A;  2BUD A;  2CUB A;  4OMP A;  3V7C A;  5CCA A;  3QUI A;  4X34 A;  4C8Q C;  1ZUK A;  2KBT A;  2QI2 A;  4WCI A;  1VQ9 Q;  4XTY A;  4M7A D;  2LCL A;  2AKK A;  2E10 A;  3M9Q A;  1M1F A;  1QCN A;  2QTV A;  1D1C A;  5J39 A;  1X75 C;  2F5T X;  1IGQ A;  3V8L A;  1R0C B;  1Q82 R;  3CPF A;  2IIM A;  1HSQ A;  3GOX A;  4M78 F;  3TRE A;  1QVF S;  1P92 A;  3CC7 T;  2YLC A;  2K79 A;  3MO8 A;  4M78 B;  1VQ6 Q;  2XDD A;  2HQE A;  3VU3 C;  4PJO C;  2LZ6 B;  3FDR A;  1PSE A;  5FRM A;  1HD3 A;  4PK4 A;  1VUB A;  1VYV A;  1K8A R;  1N6A A;  4ANJ A;  3I56 A;  4LDV A;  2HAX A;  1A0N B;  4V2S A;  1SSF A;  2QAZ A;  1IO6 A;  3EG9 B;  2GTJ A;  3VS5 A;  4B9X A;  4ZTJ A;  5GAO q;  4FYW B;  3L2W A;  2DZ9 A;  2DA9 A;  3UWN A;  3PIP A;  4M78 A;  3EG0 A;  3CXC P;  1D0Y A;  1K0X A;  3QWX X;  3E19 A;  4JZ3 A;  3BE3 A;  2ZPH B;  3OW2 P;  3UA6 A;  1Q7Y C;  4A4E A;  3EG9 A;  4LUD A;  3RER A;  3CXC A;  2K4Y A;  2CZ6 B;  2JXB A;  4Y92 A;  5CKF A;  4JLI A;  2L2P A;  2QGG A;  2QA4 A;  4LD9 K;  3OW2 A;  3CCU T;  1ZA1 B;  2FZG B;  4NOY A;  4N4H A;  3VUZ A;  3CME A;  2KR3 A;  1AD5 A;  3CCS A;  1KHI A;  4RTZ A;  4ZTF A;  3OY9 A;  2VGN A;  2HKN A;  3VS2 A;  2DVJ A;  2RI5 A;  3SWN A;  1IXD A;  2H8H A;  4OB0 B;  4Q5W A;  3OBY A;  4R0K A;  3M0R A;  1M4Z A;  4OML A;  1NEB A;  1I0C A;  3M54 A;  3MP8 A;  1YN8 A;  2NWM A;  2X9H A;  2FPE A;  2JMC A;  3FB9 A;  4WTO B;  3J81 E;  2EPD A;  4QVD A;  5I11 A;  3FC3 A;  1YJ9 Q;  1MV0 B;  3OS5 A;  4M7D C;  2CZ0 B;  1QVG P;  3R6O A;  1OX9 A;  3QJY A;  3JCM c;  3RKX A;  3VYH B;  3CME Q;  4M77 C;  2GFA A;  5IXF A;  3CCS Q;  2EIF A;  2EJF A;  5CKH A;  2P0P A;  2QEX A;  1PHT A;  4ZN3 A;  1UGS B;  3QZ9 B;  2JTF A;  2ZPF B;  2PU9 B;  2QXF A;  2OX7 A;  3BDU A;  5GAN 3;  3QHS A;  1RAE B;  1H8K A;  3A8L B;  3O5Z A;  1U5S A;  4ZN1 A;  2KYB A;  2RI2 A;  2GTO A;  4OB2 B;  5GAM g;  4L59 A;  2AHJ B;  3PTA A;  4IIM A;  4MZP A;  2L8D A;  4QQ6 A;  5GAN 8;  1ZUY A;  2PVO B;  4JUV A;  1M3B A;  5GAO l;  2PVD B;  2R5A A;  3JB9 I;  2AT1 B;  5AYF A;  4J7F A;  3M59 A;  4JZ4 A;  2I2L A;  4LD6 A;  5GAN 7;  2LNV A;  4QVC A;  4FIB A;  2NUZ A;  5KYW A;  1ABO A;  3VS4 A;  4JPB W;  3OYL A;  1Q81 R;  1TG0 A;  4RG2 A;  1IRX A;  4J5Y A;  1I5O B;  1VQ7 A;  1BU1 A;  1Q7Y U;  4PJN A;  1JJ2 S;  4XU0 A;  1KQS S;  2WSC E;  2W0Z A;  5CKD A;  2GCX A;  5D6X A;  2RF0 A;  1QKX A;  4E7L A;  5GAN j;  4EMK B;  3I35 A;  2DIL A;  1XOV A;  3A5Z B;  1Q82 C;  2K7A A;  1M1K R;  4HXJ A;  2B8A A;  5FWB A;  1S1N A;  4J9F A;  2AIR B;  5LJ5 e;  1M2V B;  3CBO A;  1VQN A;  3CC4 T;  3GBQ A;  1YIJ T;  3NHN A;  3M57 A;  4E7K A;  2CYZ B;  3EG2 A;  2RHU A;  1AZG B;  4BE2 A;  3DKM A;  5I21 A;  4EMK A;  1K8A C;  3HTR A;  2XDP A;  1NBE B;  3M55 A;  2DL4 A;  5EC7 A;  3AHU A;  3CCM T;  1JXO A;  1T3L A;  1QWF A;  1MMA A;  1BCM A;  1B3Q A;  1H3H A;  4HCZ A;  2O88 A;  3RNJ A;  1ZLM A;  1YHQ A;  1TUD A;  2RA2 A;  4HVW A;  2FRW A;  4OF1 A;  2K57 A;  2EKH A;  3S3M A;  2OTL A;  5GMK e;  2M02 A;  4F16 A;  1NJI R;  3CCR A;  2MYS A;  1NLO C;  4PFP A;  5CO7 A;  5LJ3 e;  1VQN Q;  4EMG A;  2JTM A;  3PMT A;  3G4S T;  4RTW A;  4AFQ C;  3I55 A;  1XTD A;  3LWI A;  4GLK A;  1VQL A;  1BB9 A;  1JEG A;  3FRN A;  1CKB A;  4J9H A;  1ZSG A;  3MCA B;  2NUT A;  3RMS A;  3OS1 A;  3G6E Q;  2K2V A;  2YUO A;  5CIU A;  4C92 F;  1YHQ Q;  1S72 A;  1VQO T;  1UEC A;  2DTI A;  2HD0 A;  1TS9 A;  4LXC A;  4C92 B;  4NL3 A;  3EFR A;  2OTL Q;  1KG1 A;  1ZHI A;  3CC2 T;  4E7I A;  4F7U F;  4OMN A;  4A54 A;  1C6V X;  2JOY A;  1U1T A;  2KSS A;  4F7U B;  2QQS A;  4FSS A;  2KYM A;  2L0A A;  3I55 Q;  2KXD A;  2KDS A;  4HKE A;  5CQX A;  1VQL Q;  4C92 A;  4J6X A;  1AVZ C;  1ZBJ A;  4A4G A;  4AG2 C;  5LL6 S;  4OMO A;  1Q82 U;  2DYI A;  1LJO A;  1D3B A;  1Y71 A;  2ED1 A;  1YJN T;  1Q86 R;  2OTJ A;  2LNH B;  2P0Q A;  5GAN d;  1PSF A;  2HKQ B;  5DLQ E;  4C5H A;  1SHF A;  1T0J A;  3ZEH A;  4JJC A;  4KRT A;  1OV3 A;  4OB1 B;  5KYX B;  3E9G A;  5HY6 A;  1K8A U;  2LP5 A;  1UE9 A;  2DD5 A;  4KGZ B;  3OYN A;  1VIF A;  2NUP B;  3V7S A;  1WX6 A;  1X27 A;  1R8O B;  1UUE A;  2F1L A;  3OYA A;  2E3H A;  1GCQ A;  5KCH A;  3MEW A;  1U1S A;  3JCM h;  1Q81 C;  5IHN A;  2MCN A;  4DA4 A;  2DX1 A;  2LQ8 A;  4XAX B;  5GMK h;  1VQP A;  5KYX A;  3JSC A;  2LX9 A;  2OTJ Q;  2EQI A;  3OYI A;  2DER A;  3LW5 E;  4JS4 A;  1YJW T;  2J6F A;  2VB6 A;  1VQ8 T;  2A37 A;  4FL6 A;  4BI8 B;  3OSS C;  1QVG S;  1MMD A;  3RES A;  1YWO A;  5L8R E;  1UB4 A;  4IUV A;  1M1K C;  3RKW A;  3JCM J;  4C5G A;  1R77 A;  3RR6 A;  2JUF A;  1YI2 A;  1OU9 A;  5CKB A;  5ECA A;  4BI4 A;  3M4Y A;  2K9G A;  2J6K A;  4KBM B;  1PKT A;  4MDW A;  4J9C A;  3QJ6 A;  1OQK A;  1TWB A;  1VQM T;  1X69 A;  3CCQ T;  2G3R A;  4KUD K;  2V1R A;  1W6X A;  1NE8 A;  3CCV T;  4OMM A;  2RPN A;  1M8M A;  2DJZ A;  4J83 A;  4X1V A;  4E7S A;  2V1Q A;  4CC3 A;  1OI1 A;  2DRM A;  3HRU A;  1G83 A;  1MUZ A;  1NJI C;  2WSF E;  5I2M A;  1YI2 Q;  3PVL A;  1B34 B;  2V26 A;  5KYN A;  1QKW A;  3EHQ A;  2X3X D;  2CP6 A;  4ORZ A;  1QLY A;  1BIB A;  2EQM A;  3GLX A;  4R55 A;  1NM7 A;  4MML A;  1RAH B;  3FJ5 A;  1EIF A;  1PKS A;  2FO0 A;  2I0N A;  3A98 A;  4RUG A;  2HQX A;  1EZZ B;  3JCM Q;  1XJW B;  2ZZD A;  5LJ5 d;  3OMG A;  1BIA A;  3VV0 A;  4C5E A;  5GAO m;  2LT1 A;  4MZT A;  1W2B P;  1GFC A;  2RN8 A;  2ATC B;  1MNE A;  1E7O A;  3O8V A;  2DKG A;  2MWP A;  3GNG A;  2JTE A;  3RDV A;  3CPW S;  1Q81 U;  2YUP A;  4FW1 A;  4BD3 A;  1KIK A;  5M9O A;  1W2B A;  4J9D A;  2W10 A;  5C0M A;  4K11 A;  1IGU A;  3QBY A;  2DXB A;  2K3B A;  4EDU A;  1KQ1 A;  1UGR B;  4LDU A;  3OYM A;  3OYB A;  2FEI A;  5LJ5 g;  1M1K U;  1K73 C;  2KI7 A;  4BE1 A;  4HVV A;  2K6D A;  1UFF A;  1Q86 C;  4C8Q D;  2CT3 A;  4L6V 5;  4F04 B;  3NGP A;  4JLG A;  2LVM A;  4ME7 A;  3E1S A;  2O4X B;  4M75 E;  4PJO E;  1VQ4 T; 
#chains in the Genus database with same CATH homology
 3OSV A;  3M54 A;  4IUP A;  1M5Q 1;  2DXC A;  2OTJ T;  2JZ2 A;  2MAM A;  3DB4 A;  5D6W A;  5GAM h;  2X4W A;  3JCM e;  3CPW A;  3CCJ T;  4FM4 B;  2XDB A;  4O6J A;  2VXF A;  2XD0 A;  3J80 E;  3MP8 A;  2EAY A;  2R5M A;  2GQV A;  3PT9 A;  2LTO A;  1GXI E;  3MET A;  3FB9 A;  3QDR B;  4QQG A;  4Y28 E;  3J81 E;  4XTX A;  5FRN A;  3OYG A;  4QVD A;  4KT0 E;  3FC3 A;  4B9W A;  3X25 B;  2EFI A;  3P8H A;  3JCM g;  4Y91 A;  3OS5 A;  2DEQ A;  4XU1 A;  1VQN T;  1KC8 C;  4M7A E;  3RIR A;  4M7D C;  4PJO D;  4ELZ C;  2RHY A;  1VQ5 T;  2CZ0 B;  2K5F A;  3UPU A;  1LOJ A;  2VC8 A;  5D6Y A;  1VIE A;  3R6O A;  3QJY A;  5LJ5 f;  3JCM c;  5CK9 A;  3RKX A;  3VYH B;  3MEU A;  1HK9 A;  5A2Q E;  2XU8 A;  3OB9 A;  2R58 A;  1QP3 A;  1Y96 A;  4M77 C;  5CQY A;  4XQ3 A;  2GFA A;  3ZBD A;  4A4K A;  5LJ3 g;  1NJI U;  3JB9 D;  3L42 A;  2DAQ A;  1YJN A;  4YTL A;  2EIF A;  5GAN f;  1YIT T;  2EJF A;  5CKH A;  2QQR A;  3QG1 A;  2P0P A;  2QEX A;  4Z02 A;  2LCC A;  4ZN3 A;  1UGS B;  3QZ9 B;  3TEE A;  2JTF A;  2V8J A;  2ZPF B;  2PU9 B;  1VQP T;  3G6E T;  2QXF A;  4IKF A;  2PUK B;  2RHI A;  3BDU A;  2KY9 A;  4E7J A;  5GAN 3;  1YHQ T;  3QHS A;  4P5N A;  5GAN 5;  2FVU A;  2RD1 A;  4BE0 A;  3A8L B;  2DTH A;  4IUQ A;  2EQU A;  4ZN1 A;  1X6O A;  1N8R C;  1M90 U;  2RI2 A;  2FB7 A;  4OB2 B;  5GAM g;  4UC4 A;  3WXM B;  4L59 A;  2OTL T;  1KQ2 A;  5IT9 E;  3EAE A;  5I2S A;  2AHJ B;  3PTA A;  3Q1J A;  1OZ3 A;  4MZP A;  1M9S A;  2L8D A;  4QQ6 A;  4TVR A;  5GAN 8;  2DIQ A;  1MGQ A;  1YCY A;  3JCM f;  3CCE A;  2PVO B;  4JUV A;  5GAO l;  2PVD B;  2R5A A;  4OB3 B;  3JB9 I;  2E70 A;  3VJP A;  2LDM A;  4J7F A;  5AYF A;  3M59 A;  4PNO A;  5C6S A;  2I2L A;  3OYD A;  2X4J A;  2ZPE B;  4LD6 A;  2XIC A;  1KD1 U;  5GAN 7;  1I5L A;  2LNV A;  2YLB A;  3CD6 T;  4M78 C;  2O01 E;  5LJ3 f;  3I55 T;  3QZ5 B;  1OYX A;  1WJQ A;  4FIB A;  4QVC A;  2ZGW A;  3LLR A;  2HBP A;  2EJG A;  5FRO A;  2F69 A;  3OYL A;  1VQL T;  2V8K A;  3M53 A;  4IUT A;  4BI3 A;  1BI1 A;  3L2Z A;  4OGE A;  4RG2 A;  2LC4 A;  2CKK A;  4J5Y A;  1QVP A;  3A8O B;  3OYE A;  3LYI A;  4HT9 A;  4HA8 A;  2M0O A;  2IG0 A;  1VQ7 A;  2E41 A;  3KXT A;  1Q7Y U;  1JJ2 S;  4XU0 A;  2EYQ A;  2XG8 D;  3X20 B;  5LJ5 j;  3A8M B;  5DM7 R;  1KQS S;  2XI9 A;  2E65 A;  2WSC E;  5CKD A;  2DIG A;  2GCX A;  2D9T A;  5A0L A;  5D6X A;  4M7D E;  5EG2 A;  5GAM f;  1VQ4 A;  4E7L A;  4DQ2 A;  5GAN j;  3TCJ A;  4EMK B;  3CMA T;  3JB9 J;  2RJC A;  4F7U A;  2A7Y A;  3MP6 A;  4R56 A;  4NS5 A;  3BY7 A;  3L2Q A;  4M77 E;  4IUU A;  4M75 A;  1XOV A;  3A5Z B;  1Q82 C;  3ME9 A;  3SWN B;  5DLO A;  3OYF A;  2B8A A;  4C8Q E;  4OP0 A;  3TU4 K;  1YJ9 A;  1K73 U;  5LJ5 e;  2K5I A;  1VQM A;  4N0A A;  2CS7 A;  2M9U A;  3LGF A;  3CBO A;  1VQN A;  4M7D D;  4O5V A;  2LT4 A;  3SWN C;  1RI0 A;  1YBY A;  2E1H A;  1Q86 U;  1BKB A;  3CC4 T;  5GAN e;  1YIJ T;  1VQ5 A;  3M57 A;  4XK8 E;  4E7K A;  3GIB A;  2CYZ B;  3PMI A;  5IN1 A;  1QW1 A;  4BAC A;  2RHU A;  2LRQ A;  2JN0 A;  3A8G B;  3RMQ A;  4BE2 A;  3DKM A;  2X4Y A;  4NL2 A;  2P4T A;  2IVW A;  4M77 D;  5I21 A;  4JJN K;  4EMK A;  1K8A C;  5CAI A;  2DZC A;  3DLM A;  3FJP A;  4N4G A;  4M7A A;  2XDP A;  4DOW A;  5GMK j;  3M55 A;  3SDZ A;  3QYG B;  3JRZ A;  4ZGJ B;  3OYC A;  1MHN A;  2DK3 A;  3AHU A;  3CCM T;  3P8B B;  1I4K 1;  5LJ3 j;  1FX7 A;  3G71 T;  4BDY A;  1JJ2 A;  2PUO B;  1Y96 B;  2E6N A;  2PQW A;  2EKO A;  4HCZ A;  3I56 T;  1KQS A;  1YHQ A;  2WSE E;  5GAO n;  1G5V A;  2RA2 A;  5J26 A;  4XTW A;  4OF1 A;  4M78 E;  1KC8 U;  2K57 A;  2BKD N;  2XKO C;  3S3O A;  1K9M C;  3S3M A;  2OTL A;  5GMK e;  3PFS A;  3PGG A;  4LDX A;  1M1G A;  3RUX A;  3CCR A;  3GNF B;  3QYH B;  1NZ9 A;  3QII A;  3CC7 A;  2EQJ A;  2Y90 A;  5CO7 A;  5LJ3 e;  3E9F A;  3OYH A;  2XID A;  3HFN A;  5GAM j;  4EMG A;  2P0K A;  2JTM A;  3PMT A;  3G4S T;  3GF5 A;  2C06 A;  1I8F A;  3M4G A;  4M78 D;  4ZGD B;  3BFM A;  3I55 A;  4J8O A;  1XTD A;  3LWI A;  4A4H A;  4J7I A;  2RJF A;  4GLK A;  1WQW A;  3VYG A;  1VQL A;  3ASK A;  5GMK m;  3FRN A;  3JCM W;  1N8R U;  3MEV A;  3M5A A;  3MCA B;  2WAC A;  3MHX A;  3X26 B;  1H64 1;  1ZBX A;  2OAU A;  5GAM e;  2RK1 A;  1UGP B;  3RMS A;  3OS1 A;  2QA4 T;  1W4S A;  2FL7 A;  2K2V A;  3VKI A;  5CIU A;  4C92 F;  5FU7 B;  3S6W A;  2QQB A;  1S72 A;  1VQO T;  4C92 G;  2DTI A;  1KHC A;  2HD0 A;  4C92 B;  3OS2 A;  2OTJ A;  1JRI A;  3CMA A;  1XNI A;  3EFR A;  4NL3 A;  5FLX E;  4X9D A;  1KG1 A;  4JRP A;  1ZHI A;  3QKJ A;  4OVA A;  1VQ9 T;  2E6Z A;  2MF2 A;  3CC2 T;  3VUB A;  4E7I A;  1UEB A;  3H8Z A;  5KH6 A;  2KVQ G;  3C4S A;  1BI3 A;  4F7U F;  2QTX A;  5HK0 A;  2RB6 A;  3BDL A;  4A54 A;  2KQW A;  4F7U G;  2E5Q A;  3PNW C;  1YI2 T;  2JOY A;  4BDZ A;  1U1T A;  2KSS A;  4F7U B;  2PVG B;  2M16 A;  4M75 F;  5CR2 A;  4PJO F;  2QQS A;  2CGH A;  3G7Z A;  3QXE B;  3N5B B;  5FU6 B;  4FSX A;  4M75 G;  4VUB A;  3V8K A;  4PJO G;  2KDS A;  4M75 B;  4HKE A;  2RH2 A;  4C8Q A;  4PJO B;  3CCU A;  5CQX A;  2DTO A;  2VYT A;  3OMC A;  4C92 A;  4J6X A;  1M8V A;  4A4G A;  1VQ6 T;  3JB9 F;  3MEA A;  1JBM A;  5LL6 S;  5HK3 A;  4RMO A;  3INZ A;  2KAF A;  3HKS A;  3JB9 G;  4M75 C;  5A0D A;  1UGQ B;  2RHX A;  5GMK i;  1M90 C;  2EJ9 A;  1G3W A;  1G3Y A;  1Q82 U;  4HCB A;  4M7A F;  1BI2 A;  4E7H A;  2RJD A;  1VQK T;  3V7R A;  3QO3 A;  1LJO A;  4N0A C;  1D3B A;  1Y71 A;  4PLL A;  3G71 A;  4ATO A;  4M7A G;  4M7A B;  4C0Z A;  2KMT A;  3FIF A;  3NTI A;  1X01 A;  4A4F A;  4BY6 B;  4E47 A;  1B34 A;  1YJN T;  2P0Q A;  3WVD B;  4C0F A;  5GAN d;  1PSF A;  3T9N A;  4ZGE B;  2QEX T;  2VV5 A;  5DLQ E;  2R57 A;  1IRE B;  2ZPB B;  4XU3 A;  3CCJ A;  2FHD A;  4C5H A;  4PJO A;  4EMH A;  3ZEH A;  3CC4 A;  2RI3 A;  4EMK C;  4M7A C;  1YIJ A;  2CZ7 B;  4OB1 B;  3JCM V;  2QDY B;  3E9G A;  5HY6 A;  1K8A U;  2YRV A;  1AHJ B;  4EPC A;  1WJS A;  2VXE A;  2D0Q B;  4C0G A;  2DD5 A;  3OYN A;  1U8R A;  4LDW A;  3G4S A;  1N9S A;  1VIF A;  3V7S A;  1O75 A;  3CBP A;  1R8O B;  4LDY A;  1ZQ1 A;  4C5I A;  3M58 A;  3OYA A;  5KE2 A;  3QSU A;  2H3J A;  3X28 B;  3JCM d;  3HP9 A;  4JS5 A;  3CCE T;  4MDX A;  3GPL A;  2K5L A;  5KCH A;  3MEW A;  1U1S A;  1YIT A;  3JCM h;  4D6W A;  2ZPG B;  1HXD A;  1Q81 C;  4DA4 A;  3S3N A;  4HCC A;  2LQ8 A;  3LGL A;  2RK2 A;  4XAX B;  1K9M U;  1BYM A;  2HNI A;  2E64 A;  4OMF B;  4GY5 A;  5GMK h;  1VQP A;  3WVE B;  3G6E A;  5LJ3 d;  3HSB A;  2LQK A;  2QQA A;  3A8H B;  3JSC A;  3OYY A;  4WF2 A;  4XU2 A;  2LX9 A;  3UT1 A;  4JRI A;  1N9R A;  1VQO A;  4J6Y A;  3DB3 A;  3OYI A;  3OS0 A;  5GAO r;  3LW5 E;  4JS4 A;  1O9S A;  4KUI A;  1WPY A;  2RO0 A;  2YHT A;  1YJW T;  1VQ8 T;  1VQ7 T;  1WNL A;  3C95 A;  4FL6 A;  4BI8 B;  3CEY A;  3OSS C;  1NPP A;  3L2U A;  3OQ5 A;  3RES A;  1QVG S;  1VQ9 A;  3CC2 A;  5L8R E;  1UB4 A;  2X4X A;  2DXU A;  4RKU E;  4IUV A;  3HFO A;  3SFM A;  1M1K C;  5DY9 A;  4QW2 A;  3RKW A;  4BUG A;  4MMK A;  4QVZ A;  5GAM d;  2MMP A;  4C5G A;  5GMK l;  3JCM J;  1YI2 A;  2JUF A;  2Y4X A;  2Y4Y A;  3H6Z A;  3GP8 A;  3JB9 H;  2VUB A;  3CD6 A;  4M7D F;  5CKB A;  4ELY C;  2MI6 A;  3QPH A;  2V8I A;  4M7D G;  2EWN A;  4QQD A;  3M4Y A;  4BI4 A;  3BW1 A;  4M7D B;  1G3T A;  4KBM B;  4MDW A;  2QQ9 A;  1LNX A;  3RKY A;  4IUR A;  4M77 F;  2K3X A;  1YJ9 T;  1NPR A;  3QJ6 A;  3LH0 A;  4MZM A;  1VQM T;  1VQ6 A;  3CCL T;  2L89 A;  4M77 G;  3CCQ T;  4PL6 A;  1Y7X A;  2G3R A;  3M56 A;  4M77 B;  4KUD K;  5CVI A;  4M75 D;  3UDC A;  3V8J A;  2GFU A;  3ZFJ A;  2E12 A;  4A53 A;  1NE8 A;  4C8Q F;  2XHC A;  4CRI A;  3LWH A;  4C8Q G;  3CCV T;  4XTV A;  1WQ7 A;  2JNG A;  4C8Q B;  2L3R A;  2DVE A;  2O4X A;  2DJZ A;  4J83 A;  1FWZ A;  4N4I A;  3CME T;  3SD4 A;  1XQH A;  4JRK A;  1VQK A;  3CCS T;  2BUD A;  3CBM A;  3V7C A;  5CCA A;  3OYK A;  3MP1 A;  3QUI A;  4X34 A;  1OI1 A;  5FU7 C;  1BI0 A;  2MWO A;  4C8Q C;  2RHZ A;  3HRU A;  2QI2 A;  4JDS A;  4M7D A;  4C92 C;  2DD4 A;  1I81 A;  4XTY A;  3HL8 A;  4M7A D;  2LCL A;  2E10 A;  3M9Q A;  3ER0 A;  5A0G A;  1M1F A;  4JRQ A;  1QVG A;  1NJI C;  1D3B B;  2WSF E;  5CKE A;  4M77 A;  5I2M A;  4PLI A;  1B34 B;  5J39 A;  3HPW A;  3JAM E;  1X75 C;  2F5T X;  3V8L A;  2DPP B;  1BIB A;  2EQM A;  3GLX A;  3CPF A;  4R55 A;  2RM4 A;  5KE3 A;  2DXT A;  3X24 B;  5HKC A;  3L2R A;  1RL2 A;  4MML A;  3GOX A;  1W2B S;  2VGM A;  4M78 F;  3P8D A;  3TRE A;  3CCR T;  1QVF S;  1P92 A;  1WGS A;  3CC7 T;  1EIF A;  2YLC A;  4M78 G;  3MO8 A;  2F5K A;  4M78 B;  2A3L A;  5FU6 C;  3CXC S;  2XDD A;  2HQE A;  1WJR A;  2CZ1 B;  2HQX A;  3VU3 C;  3JCM Q;  3J7A F;  4PJO C;  5GAN 4;  3FDR A;  2KK4 A;  3JCM b;  3OBW A;  1PSE A;  2ZZD A;  1IZ6 A;  5FRM A;  3OW2 S;  1VUB A;  4X9C A;  3CCM A;  4PKC C;  1H3Z A;  3FEO A;  3NFC A;  5LJ5 d;  4C0D B;  2EQK A;  3OMG A;  1BIA A;  3OYJ A;  3HRS A;  2XK0 A;  1DJ7 B;  5GAO p;  3NTH A;  1N6A A;  1QP2 A;  3FLG A;  3VV0 A;  4C5E A;  5LJ5 h;  3LX7 A;  4CI0 C;  4LDV A;  5GAO m;  3EFS A;  3I56 A;  2HAX A;  4V2S A;  1SSF A;  2RJE A;  2BIV A;  1N27 A;  2LT1 A;  3OA6 A;  2FYK A;  4B9X A;  4BB7 A;  4MZT A;  4C0D C;  5GAN h;  4ZTJ A;  1V29 B;  5GAO q;  1KD1 C;  4RG8 A;  3L2W A;  1YJW A;  2DZ9 A;  1VQ8 A;  2ZPI B;  3UWN A;  4BY6 C;  3PIP A;  3L2V A;  4M78 A;  4FT4 A;  1S72 T;  3O8V A;  2GF7 A;  2JVV A;  3E19 A;  2DKG A;  3HHT B;  2MWP A;  3GNG A;  2NLU A;  4XTZ A;  2ZPH B;  2X35 A;  3CPW S;  1Q81 U;  4II1 A;  3SB2 A;  3KBG A;  4FU6 A;  3JCM X;  4BD3 A;  5M9O A;  3DLL A;  1Q7Y C;  5J3B A;  5KCO A;  4RCB A;  1W2B A;  4FT2 A;  1Y07 A;  4A4E A;  5GAN 2;  1QVF A;  4KUL A;  3C94 A;  5C0M A;  2M1H A;  3QBY A;  3RER A;  2DXB A;  3CXC A;  2K4Y A;  2CZ6 B;  3NTK A;  4C92 E;  3CCL A;  3CCQ A;  2ZCF B;  5CKF A;  4EDU A;  1KQ1 A;  2DO3 A;  1UGR B;  5GAN 6;  4JLI A;  3F70 A;  2QA4 A;  4LD9 K;  4LDU A;  3URG A;  1OZ2 A;  3OW2 A;  3CCV A;  3OYM A;  3CCU T;  5LJ3 h;  4NOY A;  3OYB A;  4XTU A;  4N4H A;  3VUZ A;  2K3Y A;  2L5Q A;  5LJ5 g;  3CME A;  1M1K U;  1K73 C;  3PIO A;  3C12 A;  4BE1 A;  3CCS A;  1G3S A;  2D6F A;  1KHI A;  4ZTF A;  4DOV A;  3OY9 A;  4HT8 A;  1TH7 A;  2VGN A;  5IAY A;  5GAN g;  1Q86 C;  4OGC A;  3HRT A;  4RCC A;  4C8Q D;  4F7U E;  3L1A A;  4L6V 5;  3KUF A;  2RI5 A;  3SWN A;  4JLG A;  4C92 D;  2LVM A;  4ME7 A;  1FXX A;  4L5G A;  3E1S A;  2O4X B;  4OB0 B;  4M75 E;  4Q5W A;  3JCM P;  3OBY A;  4PJO E;  1JB0 E;  1VQ4 T;  4J6W A;  1M4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...