1OYXA

Crystal structure of 3-mbt repeats of lethal (3) malignant brain tumor (seleno-met) at 1.85 angstrom
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
313
structure length
313
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title Malignant brain tumor repeats: a three-leaved propeller architecture with ligand/peptide binding pockets.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 70
structure length 313
sequence length 313
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oyxA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oyxA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1oyxA03
2EQKA 3OYFA 2EQJA 2GF7A 3P8DA 5KH6A 3ZEHA 3CEYA 2R57A 4N4HA 3UWNA 5FRNA 2LCCA 1SSFA 4IUTA 2RI2A 3OYCA 3DB3A 3LLRA 3NTIA 4IUVA 4Z02A 4C5EA 3S3OA 3MEWA 2GFUA 4QQ6A 2X35A 3H6ZA 4BE1A 3GOXA 4BACA 2G3RA 4OVAA 2WACA 3MEVA 4BE2A 3LYIA 2M1HA 2K3YA 3BDLA 3DB4A 2GFAA 2RHZA 2F5KA 3ME9A 3OYLA 4B9XA 4BD3A 3OMCA 3FLGA 2O4XB 2CKKA 3P8HA 3QJ6A 5J26A 4BDYA 5M9OA 2E6NA 2JTFA 4Q5WA 1RI0A 3FEOA 1WJSA 3C4SA 4ZTFA 5C6SA 3O8VA 4PL6A 4PLLA 5IAYA 4A4EA 5CIUA 4A4FA 4A4HA 3LGFA 2MWOA 3OYIA 3KUFA 4IUPA 2RJCA 2R5MA 3L2VA 2LDMA 1G5VA 3PMTA 3LX7A 2P0KA 3OYEA 3FDRA 1WJQA 4QVZA 3L2UA 1OYXA 4PLIA 4C5GA 1KHCA 5C0MA 3S3MA 3Q1JA 2RI3A 3QBYA 1WGSA 5D6XA 3OS0A 4E7HA 3OMGA 4BE0A 3NTKA 3MO8A 4NS5A 2RJFA 3OYGA 3META 2LVMA 3OS1A 3OYNA 2EQUA 4HCZA 2XDPA 3PNWC 3MEUA 4QQDA 4QQGA 4A4GA 5FRMA 2BIVA 3M9QA 2LTOA 2HQEA 4E7JA 4C5HA 3E9FA 4BDZA 4RG2A 2RI5A 2L89A 3OQ5A 3OYJA 3OA6A 4IKFA 3MP6A 3L2QA 2RHXA 4EDUA 5KCHA 3OYAA 2EFIA 3FC3A 3OYHA 3ASKA 4LD6A 2D9TA 2QQRA 4C5IA 2M16A 2NLUA 5D6YA 3OYDA 3NTHA 2RO0A 2L3RA 2LRQA 4E7LA 2K3XA 2XK0A 4E7IA 2DIQA 2RHIA 2DAQA 3L2WA 2EKOA 3H8ZA 5IN1A 4QW2A 4FL6A 1N27A 1WJRA 5KE2A 2X4YA 2E5QA 3OB9A 3OY9A 4IURA 2X4WA 2YRVA 2RJDA 3SD4A 3EAEA 3QKJA 2PQWA 3UT1A 4L59A 2BKDN 2RHYA 3PMIA 2R5AA 2MWPA 2VYTA 2RHUA 4FU6A 2HQXA 2X4XA 4GY5A 4X34A 3MEAA 5J39A 3L42A 4II1A 1H3ZA 1OZ3A 4N4IA 1OI1A 1OZ2A 4B9WA 3OYBA 4IUUA 5KCOA 2R58A 3OS2A 2RJEA 3E9GA 2DIGA 3S6WA 3L2RA 1XNIA 2JZ2A 3OYKA 2O4XA 3MP8A 5D6WA 1MHNA 4UC4A 4IUQA 4CRIA 5KE3A 2FHDA 3DLMA 3PFSA 2EQMA 4E7KA 3QIIA 5FROA 3OYMA 2BUDA 4N4GA 2B8AA 2QQSA 2IG0A 2L8DA 3F70A 3S3NA 3LH0A 4ZTJA 3MP1A 3LGLA 2M0OA
chains in the Genus database with same CATH superfamily
1SRMA 4OMNA 2OTLT 2D8HA 3GP8A 5FRNA 1Y96A 3HKSA 1BU1A 2ZPEB 3LLRA 5GAN6 2EYWA 2D8JA 2GFUA 1NLOC 4E2FB 4BE1A 4BACA 4M7AE 1TUGB 1UGQB 1IRXA 1X6BA 2K4YA 2M1HA 3CC7Q 1T3SA 3R6NA 3U23A 3QZ5B 2CSQA 2EJFA 4KGZB 4M75F 4CC7A 2RF0A 1RLPC 4PLLA 2XKOC 2SRCA 3OYIA 2RPNA 2XU8A 3CMAA 1PKTA 4LUEA 3NFCA 1ZUUA 4NOYA 4JJNK 2OTLA 2VVKA 2FG0A 3CCRQ 2JMAA 4ESRA 2EQIA 4M75C 5FRMA 2OAWA 2V1QA 3TSWA 4MMLA 2EYYA 4DOWA 3OA6A 3LWIA 2B86A 4M7DG 1KFZA 1NM7A 3LW5E 1C0MA 2E1HA 4M78G 4C5IA 1VQ5Q 1S72T 4F14A 3CQTA 2AKKA 1T0HA 3PIPA 2XMFA 3H8ZA 3QZ9B 2FPFA 1GFDA 1N27A 1SRLA 2E5QA 2RH2A 4XU1A 1M4ZA 2X4WA 2RJDA 5AYFA 5GANg 2XICA 1MMGA 1PRLC 3HTRA 2QTXA 3JCMf 3CCMT 1CKAA 5GAOm 1M2OA 3PE0A 1RI9A 4DA4A 2NUPB 1YBYA 5IHIA 1VQ6Q 1GFCA 4LDXA 5GJVB 2WSCE 5GANd 1D0XA 4C0FA 1M30A 2RNAA 1S72A 4HVUA 1QVGS 1RAGB 4X9DA 1QKWA 1QKXA 2FZKB 5GAOp 3UA7A 4AG2C 4C5EA 2DM1A 5HK0A 3GOXA 1W2BP 4BE2A 3LYIA 1R8OB 1T0JA 1U5SA 4LNPA 3DB4A 2DBKA 1PHTA 4B9XA 1UHCA 4CC3A 3CCMA 4FYXB 3OMCA 4MZPA 3M56A 5GAMf 5I2MA 3CCJQ 2EWNA 5GAMe 5CQYA 2D1XA 3O8VA 4C92F 5IAYA 4C8QF 3JSCA 2KYMA 3L2VA 4JDSA 4PLIA 1KHCA 4YTLA 4PJOE 1BCOA 3BFMA 1UEBA 4OP0A 2RJFA 1HJDA 3META 1JBMA 4M78C 3M9QA 4EMKB 2QTVA 2F5TX 4BDZA 5CVIA 4C92C 2VGMA 4RG2A 3O5ZA 4C8QC 3L2QA 4EDUA 3FC3A 3EG9A 1TUDA 3OSVA 4R55A 2QI2A 2ZAEA 3HRSA 1KJWA 3H41A 4MZMA 3EG1A 4DBHA 2X3XD 4JJBA 2MAMA 2NUTB 5IT9E 3M0QA 5GJWB 4ANJA 1QVGA 4FCYA 1O75A 3R6OA 1VQ9Q 3CMEQ 2ECZA 4PFZA 1H3ZA 2XIDA 3OYBA 1ZA1B 3L2ZA 2EYZA 4LD9K 3KBGA 1UDLA 4E7SA 2DMOA 3OYKA 2COZA 4AFQC 2DZCA 4M7DA 4AMCA 2YRCA 2ZPIB 4M78A 1JJ2P 2HL3A 3BY7A 2V26A 2HEQA 3RMQA 2JTMA 3EHRA 1YITQ 2CT4A 1PCXA 1VQ7T 3VS2A 5HK3A 5ECAA 2PVOB 4BB7A 3NTIA 4C0DC 4BUGA 2FRYA 2X35A 3H6ZA 4FT2A 3JCMQ 1M2VA 1OOTA 4KUDK 2CT3A 4J6WA 8AT1B 3KFVA 3CC4T 1TG0A 1GBRA 4Q5WA 3FIFA 3JCMW 2RK1A 2DKGA 5HKCA 1ZSGA 1K9MR 1VQKQ 4M77G 5GMKe 2IIMA 5J3BA 1G3YA 2PUOB 3H0HA 1Q7YR 3A98A 5GMKi 3CPWS 1VQLT 2LC4A 1V1CA 5FWCA 3OS1A 3HRTA 2QXFA 1M1FA 2ABLA 1K0XA 3V8JA 2KY9A 3CC4A 1WHKA 4D8KA 1WHGA 4CC2A 4BI3A 3I55Q 1YIJT 2JUFA 2K5FA 1SG5A 2QEXQ 3BW1A 2RM4A 1KSWA 5LJ3e 1KC8U 3M55A 3CCLA 3I5RA 5CKFA 4QVDA 1D3BB 3A8HB 4RTZA 3CC2Q 2CYZB 3JB9D 4FM4B 2ZGWA 3CBMA 1S1NA 5I21A 4JJCA 3REBB 3RKYA 1YHQT 2M51A 3VYGA 4V2SA 1MMDA 3DLMA 1K73U 4M7AF 3EGXA 3QIIA 4FIBA 2IVWA 1FXXA 3QDFA 1KC8C 2VXFA 4PJOD 2IG0A 1SHFA 2PVDB 1Y0MA 3UWNA 1X6GA 5EG2A 4HVVA 5LJ5g 3SFMA 2CH4W 5DLQE 2KROA 1K73C 1WXTA 1KK7A 4QT7A 2HCKA 2E4HA 4M7AC 2E70A 1X43A 4M77C 3LH5A 3RKWA 2JTFA 5LJ5d 2NWMA 3RR6A 4DEXA 1X69A 2MYSA 4RTWA 2EYXA 1EFNA 4HA8A 5KYUA 4A4EA 5GAMj 1U1TA 1G83A 1B7TA 2QQAA 1Y71A 2VB6A 2GNCA 3FDRA 1IO6A 2F2VA 1OYXA 2ZPBB 2M9UA 1LVKA 2RQVA 3JCMX 5A2QE 2E64A 3OYNA 1D0ZA 3A8GB 4NL2A 3KXTA 5FU6C 2DETA 3GNGA 3X26B 3M0UA 2HDAA 3T9NA 2KVQG 2ZPFB 4RTUA 2MOXA 2I0NA 1QVFS 3D7SB 3C0CA 1QW1A 4TVRA 3NTHA 4EMGA 2L3RA 2CP5A 2LRQA 1B07A 1M3CA 4E7IA 1VYUA 1QQJA 1WFWA 4ZN3A 2XD0A 3E2UA 4M77A 3QSUA 2X4JA 4JRIA 2JJ9A 4RKUE 2MIOA 4L5GA 4X34A 2P4TA 4PNOA 2ROTA 1YI2Q 4M7DE 1R77A 2JW4A 2QGGA 3EH2A 1K8AU 3RBBB 1VQ4Q 2FL7A 1QCOA 3OYMA 4QKUA 1VQMT 1FWZA 1K1ZA 1KQSP 3P8DA 1PM3A 3ZEHA 1VIFA 4A4KA 3JB9F 2EBPA 5GAOl 4HKEA 1K8AC 1B34B 5GAN5 1WYXA 1Z9QA 3OYLA 1D0YA 2K2VA 1YFNA 2LQ8A 2YRDA 2F1LA 1RI0A 5EC7A 1BCMA 2FVUA 3I56A 4JRKA 4A4HA 3CBPA 4PJJA 2RD1A 2X9HA 1VQ8A 2P4RA 2LT1A 1VQMA 3LX7A 5GMKj 2BZYA 3CD6T 3A8LB 1PRMC 4E7HA 4AFZC 2AIRB 2RK2A 3CCVT 2HQHA 4PJOB 4XTVA 1U1SA 1UB4A 2KR3A 3HPWA 1OX8A 1ABQA 1BI2A 1KQ1A 3QWYA 4Y91A 1K76A 3VS0A 2DIQA 4JZ3A 4QW2A 1JXMA 3GPLA 3CD6A 3QWXX 2V8IA 3EG2A 3VS6A 1WLPB 1NBEB 2CZ6B 5LJ3j 2BE7D 4M75G 1W2BA 1NLPC 3CCVA 2ESWA 1UJYA 4CC4B 1OPLA 4HXJA 3MP8A 2LNHB 1YJNT 3VUZA 4AG1C 2KT1A 4ZGJB 5FROA 2E12A 3VS3A 2C0TA 2DL7A 1GCQC 1UE9A 3THKA 4FSXA 1M1KU 1BK2A 1JU5C 1Y96B 2RQWA 1NJIU 2YDLA 4LUDA 4DBFA 5GAMh 3MEWA 1VQPQ 3DKMA 1A0NB 3CCEQ 3CXCP 2DXBA 5GMKl 1ZSZC 3G4SQ 3SDZA 5J26A 3V8LA 1M1KC 2NUZA 1NJIC 3KUFA 2ED1A 2LP5A 3VV0A 2L3SA 1G5VA 3ER0A 3NGPA 3VRZA 3EHQA 1WGSA 2OTJT 1AOJA 3H0IA 1OPKA 1X2QA 5FLXE 4M7DD 5IXFA 3OYGA 1UGRB 3HFOA 1Y07A 1TUCA 1GCQA 2HNIA 3E9FA 4BI8B 2VWFA 2FZCB 4IKFA 5D7UA 2OAUA 2CP6A 2JS2A 2CGHA 2CP3A 3PVLA 4RMOA 1JJ2A 3MHXA 4J9GA 1ZBJA 2X4YA 2P0PA 3SD4A 2VC8A 1FX7A 2DK3A 3AHUA 1H3HA 1YJ9T 2OTJA 3PMIA 4DBRA 4GY5A 1D1CA 4OMLA 2DVJA 1RL2A 1IGUA 4C92G 1XJWB 4C8QG 4OB0B 2E65A 4OMOA 2HZYA 4ORZA 2LX9A 4WF2A 4F7UE 3G71T 2HMAA 5GAMg 3S3NA 1YNZA 1I0CA 2X3WD 3OSSC 2M0OA 5GAN4 1MMAA 1SPKA 1MGQA 3JCMe 3HRUA 2RI2A 4PFPA 3S3OA 5GAMd 3MEVA 2FRWA 1OU9A 2K3YA 1YJ9A 3UA6A 2GFAA 4VUBA 2F5KA 5GMKh 1G3TA 2QA4T 2O4XB 3QJ6A 4M75A 1QP3A 4O5VA 3VS5A 2KDSA 1VQNT 4N0AC 1RAIB 3LGFA 1RAHB 2C0IA 2BTTA 3MJXA 1WXBA 1E6GA 3RIRA 3GIBA 3OYEA 1KC8R 4C5GA 2A28A 3QBYA 1WHHA 1RABB 2GQVA 1V29B 2PVGB 2BE9B 3MO8A 3CCLQ 4GLMA 2DL8A 3HL8A 3PNWC 2EPDA 2RQTA 4KRTA 2VV5A 1E6HA 4C5HA 2M0YA 2J6OA 3QYGB 2D6FA 4AFSC 1K73R 4J9FA 1AT1B 1LJOA 2XDBA 3OYHA 5L8RE 3CCST 4HCKA 2NLUA 3EG9B 1TU0B 1ZUKA 5LJ3h 1I4K1 3N5BB 1DJ7B 1PSEA 2OX7A 4NL3A 4J9HA 1MNDA 3HHTB 2H8HA 2DL5A 5KYNA 4N0AA 2HSEB 4EMKC 1E7OA 2OJ2A 5GANf 5GANe 4HCCA 1FMVA 1U8RA 2DD5A 2HQXA 3MEAA 1AWOA 5I2SA 1OI1A 5KYXB 3CC7T 1H92A 5IH2A 5A0GA 2HKNA 1MHNA 4IUQA 4ZGEB 2LCSA 3CCSA 3E19A 3OBYA 3UATA 4M7DB 4ZTJA 3QJYA 5CCAA 1VYVA 3RKXA 1H8KA 2VGNA 3A5ZB 3OW2P 1B3QA 1EZZB 1V76A 1WA7A 2R57A 2YT6A 4JZ4A 3G1JA 3M4GA 4Z02A 3X25B 2E5KA 4QQ6A 1G8XA 4Y28E 3CCQQ 1OU8A 1M2VB 2LCLA 3CCRT 2FPDA 3CCUQ 1RACB 1BIAA 1F1BB 4EMKA 4ZN1A 1I5OB 4BY6B 1KD1U 2OI3A 4A54A 4C92A 2J05A 4C8QA 1VQ5T 1AVZC 2QDYB 2O31A 1RAAB 1QWFA 1WNLA 1ZBXA 4E47A 1W1FA 3L2UA 5C0MA 2DTHA 3FJPA 3RDVA 2JVVA 1ZA2B 2NUTA 4Y92A 2LJ3A 1KD1C 3J7AF 4XTYA 5LJ3g 2DPPB 3WVEB 2A37A 1K8AR 4M7AG 5DM7R 5KCHA 3M0PA 1VQ6T 1I8FA 1JB0E 1VYTA 4EPCA 5LJ3d 4PFOA 2G6FX 2EKHA 1VQ7A 2LX7A 2K5LA 2EIFA 4R56A 1KQSA 3NPFA 1R0CB 4J7FA 1IZ6A 2RHYA 3EG3A 2MWPA 2K3BA 4Z89A 2E41A 2EJ9A 2AZVA 3VS4A 2WSEE 2EGCA 2C06A 2COYA 3VS1A 3I56Q 4CRIA 3GF5A 4XTWA 1D1AA 2EQMA 3CCJT 1WIEA 1VQ6A 2BUDA 1ZLMA 1PKSA 4XK8E 2QYZA 3ZFJA 3F70A 3G6EQ 1VQ8Q 1UGSB 2JS0A 2YUQA 2BZXA 3EGUA 1VQLA 1P92A 1CKBA 1VQOQ 3H9NA 2DE0X 2O9VA 2QQBA 1IGQA 3RERA 3EH1A 4M75E 4MDWA 1PG5B 2A3LA 4ZTFA 4C0ZA 5CIUA 4XTUA 1YIJA 3WVDB 1OV3A 4KUIA 2BZ8A 4QVZA 1WJQA 2O01E 3Q1JA 2E10A 3J81E 2J06A 2ZCFB 2F2WA 3OMGA 1TOVA 2GQIA 3PVQA 4BI4A 4NS5A 2LVMA 1QVPA 2K9GA 3JV3A 4OB1B 2RMOA 2LT4A 2LTOA 5IHNA 1VQ9T 3M54A 1D3BA 3CMET 4OMFB 3CPFA 1I81A 3LWHA 1YHQA 3RMSA 3OYAA 1Q81U 1BI3A 3ASKA 4J9CA 3HFNA 2DFUA 3QUIA 2EAYA 1M1KR 4XU0A 3JB9G 1WI7A 3GNFB 1NJIR 1AWJA 1Q82U 1G2BA 5FU7B 4IURA 1YITT 2EGAA 1Q81C 4F7UF 1CSKA 4J9BA 4RCBA 4IIOA 2V8JA 2R5AA 1YJWQ 5FW9A 5GANj 1OZ3A 3CXCA 2LQWA 3SWNB 3L2RA 2LNVA 1QMCA 4MZTA 1Q82C 1VQ9A 4J6XA 3CMEA 5D6WA 2P0QA 2CSIA 2QGFB 4M7AA 2KK4A 4PJLA 1NEGA 2B8AA 1ZUYA 1VOMA 4LE9A 3AT1B 1VQKT 3OYFA 4F7UB 1WZOA 2AK5A 5LJ5f 3VYHB 2YUPA 5LJ5e 3DB3A 1KG1A 4LXCA 2QK0A 2DILA 2G3RA 3EFOA 2DF6A 4M78E 2H3EB 3OS5A 2GBQA 4C92E 3I5SA 2KI7A 3CMAQ 1I1JA 4A4FA 4IUPA 2RJCA 4P5NA 1PNJA 2OTLQ 1W2BS 4X1VA 1R0BG 1WXUA 1WQWA 3I55T 3S3MA 3EGDB 2CREA 3OS0A 4L6V5 2QEXT 1D09B 1GRIA 2PUKB 3NTKA 4ZNXA 2HL5C 4QVCA 3MEUA 4PJOF 1NYFA 1NPRA 3BDUA 2VASA 2RI5A 3OQ5A 3OYJA 1IHVA 2FPEA 2QAZA 3CC2T 1BYMA 2K7AA 2RHXA 5CO7A 4KGVB 2YLBA 2YLCA 3PGGA 4R0KA 3V7SA 3QDRB 3TREA 2K3XA 4FW1A 2O2OA 2VUBA 1M3AA 2DRMA 1IHWA 1SSHA 4M75D 4PJOC 2MMPA 2JNGA 1UG1A 4JS5A 2CP0A 2DL3A 2QEXA 1JRIA 4RCCA 2D0NA 2RHUA 4PJNA 4KBMB 3L42A 5KYYA 1WQ7A 2FB7A 3E1SA 4IIMA 3V8KA 1OZ2A 4F04B 2XI9A 3URGA 3TEEA 2R58A 2JN0A 3E9GA 1S72Q 1RAFB 2J6FA 1NG2A 1XNIA 1U06A 3CC2A 2FHDA 1RADB 3M0RA 1LCKA 3EG0A 4FT4A 1RLQC 3JCMh 2HKQB 1N8RU 4FW2A 2EW3A 3LGLA 4OGCA 2IPOB 3A8MB 2I2LA 5A0LA 2CH4A 3CCMQ 1M90U 1HYOA 4DQ2A 1UJ0A 2DYBA 1JJ2S 3ME9A 1N8RC 4ELYC 4BD3A 3FLGA 1AHJB 4J6YA 3CPWP 3FEOA 1EIFA 3J80E 2L0AA 1M90C 1XOVA 2EJGA 3CBOA 3X20B 1HK9A 2KE9A 1VIEA 1JXOA 1K4US 1UHFA 3M53A 3PMTA 2P0KA 2E6ZA 4JLGA 1X2KA 2RI3A 2CDTA 1Q95G 2CUBA 1BIBA 1W4SA 2CZ0B 1YN8A 2L2PA 1WHMA 2K79A 1WPYA 4ZGDB 2P84A 1YI2T 2V8KA 2JM8A 1YJNA 1PD1A 3SEMA 2DXCA 2MI6A 1C6VX 5GANh 1VQ4T 1ZQ1A 4FYVB 2LQNA 3RUXA 3WXMB 1QCFA 2DTIA 4E6RA 1WJRA 2CUDA 3OY9A 4M78D 4MDXA 3ZBDA 2YRVA 3OW2A 1YWPA 1QWEA 2L3PA 2Y4YA 2MF2A 4C92D 3M57A 5GAOn 3JCMP 4C8QD 1H641 2BKDN 3PT9A 3JCMg 1YCYA 1KD1R 3JB9H 3QYHB 2F69A 2H3JA 3OS2A 4E7ZA 1PWTA 4M77E 4EIKA 2YWWA 1AD5A 1YI2A 1MMNA 2E3IA 1ZSZA 3PFSA 4E7KA 5KYWA 4N4GA 3JCMd 3IQLA 1TH7A 2JMCA 1VQ4A 3CEYA 5CQXA 6AT1B 4IUTA 1WDXA 3OYCA 4IUVA 2HAXA 1D1BA 5LJ5j 1G3WA 2QQ9A 3ULRB 3JCMJ 2AHJB 2YXYA 2D0QB 4KULA 4BDYA 4LDVA 5M9OA 4RTYA 3JCMV 4M75B 3C4SA 5C6SA 4PL6A 1UGPB 5A0DA 2ENMA 2MWOA 2KXDA 3QG1A 2CZ7B 3M4YA 4PKCC 1VQ7Q 4XTZA 4RTXA 1SF9A 1QVFP 3C12A 3P8BB 2LQKA 2ATCB 3TQ7P 1HXDA 4RG8A 1FYNA 5GAN8 1GL5A 4FYWB 2DBMA 4QQGA 2YHTA 3CC4Q 2AZSA 4OGEA 1O9SA 2Z0WA 1TS9A 1MNEA 4ATOA 1GBQA 1KIKA 3G71A 3TCJA 4JS4A 4HVWA 4J9IA 4JLIA 1ARKA 4OMPA 3M5AA 4E7LA 5CKHA 2RHIA 2DRKA 2EYQA 4ELZC 1PSFA 4KT0E 4OB2B 4RTVA 1SEMA 2C0OA 1VQLQ 2XDDA 1BB9A 2L5QA 2LZ6B 9ATCB 4JRQA 1YCSB 4OF1A 2NUPA 3JAME 3A1PA 2PU9B 2KGTA 2QA4A 1VQPT 1VQNA 2KRMA 3CCET 2JXBA 2A0FB 4O6JA 2DA9A 2O4XA 1FMWA 3JB9I 2K57A 3G4ST 5KE3A 4M7DF 1YIJQ 4M78F 4XAXB 5GAOr 3VRYA 2J7IA 3V7CA 2A08A 2EQKA 5KH6A 3JB9J 2ZPHB 2LCCA 4JPBW 2PZ1A 3G7ZA 2A36A 2RN8A 3REAB 4CI0C 1IB8A 2DVEA 1Q81R 5L23A 2COWA 2JT4A 1QP2A 1VUBA 1YP5A 4M7DC 1YHQQ 1QCNA 1KQSS 1Q86R 1VQPA 3NHNA 4M78B 3CCEA 1JQQA 1U3OA 3GLXA 2K2MA 2GTOA 2DJQA 4C92B 5CKDA 3G4SA 2KSSA 1Q82R 4C8QB 4X9CA 2R5MA 4HT9A 4J7IA 1UUEA 1M3BA 2KRNA 1Y57A 1FMKA 1ACMB 2KRSA 4M7AD 4BE0A 4PJMA 3A8OB 1X27A 4BY6C 4M77D 5FWBA 4QQDA 2BIVA 4C0GA 2HQEA 3CC7A 2EVRA 4OMMA 1WHJA 1BBZA 3MP6A 1ABOA 5KYXA 1HD3A 3PTAA 2EFIA 2DL4A 5IXBA 2HBWA 2KEAA 3OBWA 1UFFA 2LJ1A 4D6WA 1NEBA 1MV3A 1TXQA 2DJZA 5GMKm 2XK0A 2A7YA 1OEBA 2EKOA 2KXCA 2LMJA 2YSQA 2VKNA 2ROLA 2RQRA 4DOVA 2PQWA 4OB3B 1SHGA 3QHSA 3CCRA 4GLKA 1IREB 4WCIA 4Z8AA 2WSFE 5GAN3 3EFSA 4C0DB 1QLYA 2RJEA 5LL6S 1UECA 4F16A 1BKBA 4KH0B 2JOYA 4UC4A 2ED0A 2O88A 1VQ5A 5LJ5h 2VXEA 2FYKA 3LH0A 1GCPA 2EQJA 1NZ9A 2J6KA 1MUZA 1K0SA 2DYIA 4MMKA 2V1RA 1TSFA 3HSBA 4OVAA 2WACA 2DTOA 3CCLT 2ZZDA 3TU4K 3JCMc 2GTJA 4F17A 3P8HA 3QO3A 3EGXB 3C94A 4RTTA 1VQMQ 5I11A 2GGRA 4K11A 2AT1B 4F7UG 2CP2A 3CXCS 4KGXB 1IXDA 3GBQA 4J83A 3JRZA 2HBPA 2DO3A 4D8DA 1NE8A 5LJ3f 4HCZA 2XDPA 4J5YA 3L1AA 3VU3C 3TSZA 1JO8A 3M59A 4M4ZA 1N8RR 2DXUA 2QQRA 3I35A 5KYUB 3PIOA 3CCJA 5HY6A 2JTEA 2MPXC 4LN2A 2DAQA 3UF4A 3CD6Q 3L2WA 3M58A 1M90R 4XU3A 4A63B 4FL6A 2XHCA 1EX4A 2XG8D 4M77F 5GAN2 4DBQA 3OB9A 2PNIA 3FJ5A 1W70A 4WTOB 2F2XA 1VA7A 2NYSA 4L59A 3CCVQ 3CCQT 1M8VA 1NPPA 2LJ0A 5HCKA 2CZ1B 4Z88A 3CCUT 1Q86U 2K6DA 4LDYA 2JZ2A 1G3SA 3CPWA 1X75C 1JEGA 5FU7C 3INZA 2MK5A 2MCNA 4M7AB 3NMZC 2SEMA 4M77B 1I07A 1C1AA 1NYGA 1N6AA 1AWWA 1QVGP 1SSFA 1Q86C 4PJOG 4PK4A 3SWNC 8ATCB 2QG9B 5CK9A 5GAOq 2RQUA 3BDLA 3EFOB 1LPLA 1K9AA 1RAEB 4FYYB 4JJDA 1YJNQ 3CCQA 3VJPA 2E3HA 5FU6B 1WJSA 3CCUA 2M02A 4LDWA 5CAIA 5DY9A 4J9EA 1YITA 2DNUA 2RA2A 2KT8A 1X6OA 3X28B 1LOJA 1J3TA 2ZPGB 3I9QA 2KQWA 1BI0A 4DEYA 3DLLA 4OMQA 1ZX6A 4JRPA 4C8QE 4XQ3A 4A4GA 4XTXA 1M27C 4E7JA 1I5LA 2L89A 1Z9ZA 2KNBB 4LD6A 1LNXA 2GCXA 1HSQA 3SWNA 3EFRA 5D6YA 2DEQA 1UGVA 3I56T 1VQKA 5DLOA 1UTIA 5CKEA 3G6ET 1K9MU 1VQ8T 2OTJQ 4LDUA 1Y7XA 5KE2A 2JM9A 3X24B 2FO0A 3H0FA 4F7UA 3EAEA 1M1GA 3QKJA 1Q7YU 1VQOT 2VYTA 4FU6A 3JCMb 5AT1B 1MV0B 1PD0A 1BI1A 1M8MA 3OYYA 2YUOA 2Y4XA 4B9WA 5KYYB 2X51A 4IUUA 5KCOA 3UPUA 1K9MC 3S6WA 3FRNA 4GBQA 1N9RA 1AWXA 4XU2A 2DXTA 2KYBA 1Q7YC 2DD4A 3I55A 4J9DA 2GF7A 1W6XA 4ME7A 4N4HA 1YWOA 1XQHA 1QVFA 3G6EA 1ZHIA 1YJ9Q 3EGDA 1B34A 3RNJA 1AZGB 5GAN7 2CS7A 2RHZA 1VQOA 3ZL7C 2L3QA 2QASA 3QPHA 2CKKA 3OW2S 2E6NA 3G71Q 2DLPA 1XTDA 3VUBA 4HCBA 1X01A 3FB9A 3MCAB 5I22A 2KMTA 2LDMA 2DX1A 3RESA 3M0TA 1N5ZA 2K5IA 4HT8A 5D6XA 3VS7A 5IHKA 3SHWA 4RUGA 2EQUA 2FEIA 3UDCA 4PJOA 1N9SA 3QXEB 2QA4Q 1WHLA 1KQ2A 2CP7A 1YJWT 5CR2A 1VQNQ 1OX9A 2Y90A 2QDLA 4A53A 2AKLA 2FZGB 4EMHA 2D9TA 4JUVA 3VKIA 2M16A 3OYDA 2RO0A 2HD0A 1PC0A 7AT1B 4B6MA 2W10A 2EGEA 3HP9A 4KH1B 5IN1A 3V7RA 3M0SA 2DEUA 2HSPA 1TTHB 3MPUB 2DERA 2KAFA 3TVTA 1WX6A 1M9SA 4FSSA 3SB2A 4AT1B 1OQKA 2YUNA 1OULA 2DZ9A 3UT1A 3BE3A 1KHIA 2X4XA 5J39A 4II1A 1TWBA 4N4IA 3CCSQ 1YJWA 2DIGA 1AZEA 1T3LA 2KBTA 4J8OA 1AEYA 3MKDA 2RB6A 1GXIE 1SKUB 2PTKA 3C95A 1RUWA 4AFUC 5CKBA 1ZSZB 3CMAT 2QQSA 2L8DA 1M5Q1 5KYWB 3MP1A 2O9SA 2W0ZA
chains in the Genus database with same CATH topology
2EQKA 3P8DA 5KH6A 3ZEHA 2OTLT 1VIFA 3JB9J 4A4KA 2ZPHB 3GP8A 1Y96A 3HKSA 2LCCA 5FRNA 1VQLA 1P92A 3JB9F 5GAOl 2ZPEB 3G7ZA 3LLRA 5GAN6 4HKEA 2GFUA 1K8AC 1B34B 4BE1A 2QQBA 4BACA 4CI0C 5GAN5 2DVEA 3RERA 4M7AE 1UGQB 2K4YA 2M1HA 4M75E 4MDWA 1QP2A 3OYLA 1VUBA 3QZ5B 2A3LA 2EJFA 4M7DC 2K2VA 2LQ8A 1KQSS 1VQPA 4M75F 1RI0A 4M78B 3CCEA 2FVUA 3GLXA 4JRKA 3I56A 4ZTFA 4PLLA 4C0ZA 2XKOC 5CIUA 4A4HA 4C92B 5CKDA 3G4SA 2KSSA 4XTUA 4C8QB 3WVDB 3OYIA 1YIJA 4X9CA 3CBPA 2R5MA 2RD1A 4KUIA 1VQ8A 2LT1A 2XU8A 4J7IA 4HT9A 3CMAA 1VQMA 3LX7A 4QVZA 1WJQA 5GMKj 3CD6T 3A8LB 2O01E 3Q1JA 3NFCA 2E10A 3J81E 4NOYA 4JJNK 2OTLA 2ZCFB 4E7HA 3OMGA 4BI4A 4M7AD 4BE0A 4NS5A 2LVMA 2RK2A 3A8OB 4BY6C 4M77D 1QVPA 4M75C 4OB1B 4QQDA 5FRMA 2BIVA 2LT4A 2LTOA 4C0GA 3CCVT 2HQEA 3CC7A 4PJOB 4MMLA 4XTVA 4DOWA 1VQ9T 3M54A 1D3BA 3OA6A 1U1SA 3CPFA 1I81A 3MP6A 4OMFB 1UB4A 3LWIA 3LWHA 3HPWA 1YHQA 4M7DG 3RMSA 3LW5E 2E1HA 1BI3A 1BI2A 2EFIA 4M78G 3OYAA 3ASKA 4C5IA 3PTAA 1KQ1A 4Y91A 1S72T 3OBWA 3HFNA 4D6WA 3QUIA 2DJZA 5GMKm 2XK0A 2A7YA 2DIQA 2EAYA 3PIPA 2EKOA 3H8ZA 3QZ9B 4XU0A 3JB9G 3GNFB 4QW2A 1N27A 1Q82U 5FU7B 2E5QA 2RH2A 4IURA 4XU1A 1M4ZA 2X4WA 1YITT 2RJDA 3GPLA 3CD6A 1Q81C 4F7UF 5AYFA 2V8IA 5GANg 4DOVA 4RCBA 2PQWA 4OB3B 2XICA 2V8JA 2R5AA 3QHSA 2QTXA 3JCMf 3CCMT 3CCRA 2CZ6B 5LJ3j 4GLKA 1IREB 5GAOm 4M75G 5GANj 1W2BA 4DA4A 1OZ3A 1YBYA 2WSFE 5GAN3 3EFSA 3CCVA 3CXCA 4C0DB 2RJEA 3SWNB 5LL6S 3L2RA 1BKBA 2LNVA 4MZTA 1Q82C 1VQ9A 4J6XA 3CMEA 4LDXA 3MP8A 2JOYA 5D6WA 2WSCE 4UC4A 5GANd 2P0QA 3VUZA 1YJNT 1VQ5A 4C0FA 4M7AA 4ZGJB 5FROA 2KK4A 2VXEA 5LJ5h 1S72A 2E12A 2B8AA 2FYKA 3LH0A 1QVGS 4X9DA 1VQKT 3OYFA 2EQJA 4F7UB 1NZ9A 5GAOp 4FSXA 5LJ5f 3VYHB 1M1KU 1Y96B 5LJ5e 1NJIU 3DB3A 4MMKA 4C5EA 1KG1A 5GAMh 3MEWA 5HK0A 3HSBA 3GOXA 2G3RA 4OVAA 2WACA 4BE2A 3LYIA 1R8OB 3DKMA 4M78E 2DTOA 3DB4A 3CCLT 4B9XA 3CCMA 2DXBA 5GMKl 2ZZDA 3TU4K 3OS5A 3JCMc 3OMCA 4C92E 3P8HA 3M56A 4MZPA 5I2MA 5J26A 3SDZA 5GAMf 3QO3A 2EWNA 3V8LA 5GAMe 3C94A 5CQYA 1M1KC 3O8VA 4C92F 5IAYA 1NJIC 4C8QF 4A4FA 3KUFA 3JSCA 2RJCA 4IUPA 4P5NA 1W2BS 3L2VA 3VV0A 1G5VA 4F7UG 1WQWA 4JDSA 3ER0A 3I55T 3CXCS 3S3MA 4PLIA 1KHCA 4YTLA 1WGSA 4PJOE 3OS0A 4L6V5 2QEXT 3BFMA 2OTJT 4J83A 3JRZA 2HBPA 1UEBA 2DO3A 2PUKB 3NTKA 5FLXE 4M7DD 4OP0A 4QVCA 2RJFA 1UGRB 3META 3OYGA 1NE8A 5LJ3f 4HCZA 2XDPA 1JBMA 3MEUA 4M78C 4PJOF 3HFOA 1Y07A 3M9QA 1NPRA 3L1AA 4J5YA 2HNIA 4EMKB 3E9FA 3VU3C 3BDUA 4BI8B 2F5TX 4BDZA 5CVIA 4C92C 3M59A 2VGMA 2RI5A 3OQ5A 4RG2A 4C8QC 3OYJA 4IKFA 3L2QA 4HCCA 3CC2T 1BYMA 2RHXA 5CO7A 4EDUA 3FC3A 2OAUA 2DXUA 2YLBA 2QQRA 3PIOA 3CCJA 3OSVA 2YLCA 4R55A 3PGGA 2QI2A 5HY6A 3V7SA 3QDRB 3TREA 3HRSA 2K3XA 2CGHA 4RMOA 4MZMA 2DAQA 1JJ2A 2VUBA 3L2WA 3M58A 3MHXA 4XU3A 4FL6A 2XHCA 2XG8D 2X4YA 4M77F 5GAN2 2MAMA 3OB9A 4M75D 2P0PA 4PJOC 2MMPA 5IT9E 3SD4A 2VC8A 2JNGA 4JS5A 1QVGA 1FX7A 1O75A 2DK3A 4L59A 3AHUA 2QEXA 1YJ9T 2OTJA 3PMIA 1JRIA 4RCCA 4GY5A 2RHUA 3R6OA 4KBMB 3L42A 1WQ7A 1H3ZA 2FB7A 3E1SA 3V8KA 3CCQT 1OZ2A 1RL2A 2XIDA 1M8VA 2XI9A 1NPPA 3URGA 3TEEA 3OYBA 4C92G 2R58A 2JN0A 2CZ1B 3L2ZA 3E9GA 4C8QG 3CCUT 1Q86U 4LD9K 4LDYA 3KBGA 2E65A 1XNIA 4OB0B 2JZ2A 3OYKA 1G3SA 3CPWA 3CC2A 2DZCA 1X75C 2FHDA 2LX9A 4WF2A 4M7DA 5FU7C 4F7UE 3INZA 2ZPIB 4FT4A 4M78A 3G71T 3JCMh 4M7AB 5GAMg 1N8RU 3BY7A 3S3NA 4M77B 3RMQA 2JTMA 3LGLA 4OGCA 3OSSC 2M0OA 5GAN4 3A8MB 1N6AA 1VQ7T 5HK3A 2I2LA 5A0LA 1SSFA 2PVOB 4PJOG 1MGQA 1Q86C 3JCMe 1M90U 3HRUA 2RI2A 4BB7A 3NTIA 4DQ2A 4C0DC 3S3OA 4BUGA 3SWNC 2X35A 3H6ZA 4FT2A 3JCMQ 5GAMd 5CK9A 3MEVA 5GAOq 4KUDK 1JJ2S 2K3YA 3BDLA 3ME9A 2GFAA 4J6WA 2F5KA 4VUBA 1YJ9A 1N8RC 5GMKh 1G3TA 4ELYC 4BD3A 3FLGA 2QA4T 1AHJB 4J6YA 3CC4T 2O4XB 3CC7T 3QJ6A 4M75A 1QP3A 4O5VA 3CCQA 2KDSA 1VQNT 4Q5WA 3FIFA 3VJPA 2RK1A 3FEOA 3JCMW 4N0AC 1WJSA 5FU6B 1EIFA 3J80E 3CCUA 2DKGA 5HKCA 1M90C 1XOVA 2EJGA 3CBOA 4LDWA 3X20B 3LGFA 1HK9A 5CAIA 4M77G 5GMKe 1VIEA 5J3BA 5DY9A 1G3YA 3RIRA 3M53A 3GIBA 3PMTA 2PUOB 2P0KA 3OYEA 1YITA 2E6ZA 2RA2A 4C5GA 4JLGA 3X28B 1X6OA 2RI3A 3QBYA 1LOJA 2GQVA 2ZPGB 2KQWA 1V29B 5GMKi 3CPWS 1VQLT 1BI0A 2PVGB 2LC4A 3DLLA 1BIBA 3MO8A 1W4SA 2CZ0B 3HRTA 3OS1A 3HL8A 2QXFA 3PNWC 4JRPA 4C8QE 4XQ3A 1M1FA 4A4GA 2VV5A 4XTXA 4E7JA 4C5HA 1Q81U 1I5LA 3QYGB 2D6FA 2L89A 1WPYA 4ZGDB 1YI2T 1LJOA 2XDBA 2V8KA 3V8JA 3OYHA 1YJNA 4LD6A 1LNXA 2GCXA 2KY9A 5L8RE 3CCST 3CC4A 3SWNA 2NLUA 3EFRA 5D6YA 2DEQA 2DXCA 2MI6A 5LJ3h 3I56T 1I4K1 5GANh 1VQ4T 3N5BB 1VQKA 1DJ7B 1PSEA 1ZQ1A 4BI3A 5DLOA 5CKEA 2JUFA 1YIJT 3RUXA 3WXMB 2DTIA 4NL3A 3G6ET 1K9MU 2K5FA 1VQ8T 1WJRA 3HHTB 3BW1A 1Y7XA 4LDUA 3X24B 5KE2A 3OY9A 4M78D 4MDXA 4N0AA 2RM4A 2YRVA 3ZBDA 4EMKC 3OW2A 4F7UA 5GANf 5LJ3e 2Y4YA 3EAEA 2MF2A 1M1GA 3QKJA 4C92D 3M57A 5GANe 5GAOn 3JCMP 4C8QD 1H641 1Q7YU 2BKDN 1VQOT 1U8RA 2VYTA 3M55A 1KC8U 2DD5A 4FU6A 2HQXA 3JCMb 3CCLA 3PT9A 3JCMg 3MEAA 5I2SA 1YCYA 5CKFA 1D3BB 3A8HB 4QVDA 3JB9H 1BI1A 2CYZB 3JB9D 1OI1A 3OYYA 4FM4B 2Y4XA 2ZGWA 3CBMA 3QYHB 2F69A 4B9WA 2H3JA 4IUUA 5I21A 5KCOA 3OS2A 3UPUA 1K9MC 3RKYA 3S6WA 5A0GA 4M77E 3FRNA 1YHQT 1N9RA 1MHNA 1YI2A 4IUQA 3VYGA 4XU2A 3DLMA 3PFSA 4ZGEB 1K73U 4M7AF 4E7KA 2DXTA 3QIIA 4FIBA 3CCSA 2IVWA 1FXXA 3E19A 3OBYA 4N4GA 3JCMd 2VXFA 1Q7YC 1KC8C 4ZTJA 2IG0A 4M7DB 4PJOD 3QJYA 2DD4A 5CCAA 3RKXA 3I55A 2VGNA 2PVDB 3A5ZB 1TH7A 1VQ4A 2GF7A 3CEYA 4ME7A 2R57A 4N4HA 3UWNA 1XQHA 1QVFA 5EG2A 1ZHIA 3G6EA 5CQXA 5LJ5g 3M4GA 1B34A 4IUTA 3SFMA 3OYCA 5DLQE 4IUVA 4Z02A 2HAXA 3X25B 4QQ6A 4Y28E 1K73C 5LJ5j 5GAN7 2QQ9A 1G3WA 2CS7A 2RHZA 3CCRT 2LCLA 1VQOA 3JCMJ 4M7AC 2E70A 2AHJB 3QPHA 4V2SA 2D0QB 1BIAA 2CKKA 4KULA 4EMKA 4ZN1A 4LDVA 4M77C 5M9OA 2E6NA 3RKWA 3OW2S 2JTFA 4BY6B 5LJ5d 1KD1U 3JCMV 4A54A 4M75B 1XTDA 4C92A 3VUBA 3C4SA 4HCBA 1X01A 5C6SA 4C8QA 3FB9A 4PL6A 4HA8A 4A4EA 1UGPB 5A0DA 5GAMj 2QDYB 1VQ5T 2MWOA 1U1TA 3QG1A 3MCAB 2CZ7B 3M4YA 2QQAA 2KMTA 4PKCC 4XTZA 1Y71A 1WNLA 2LDMA 1ZBXA 3FDRA 4E47A 3C12A 3RESA 2K5IA 1OYXA 2LQKA 3P8BB 5C0MA 3L2UA 2DTHA 4HT8A 2ZPBB 2M9UA 3FJPA 5D6XA 1HXDA 4RG8A 2JVVA 1KD1C 3J7AF 3JCMX 4XTYA 5GAN8 5A2QE 2E64A 3OYNA 3A8GB 2EQUA 4NL2A 3KXTA 3UDCA 4PJOA 5LJ3g 1N9SA 2DPPB 4QQGA 5FU6C 2YHTA 3GNGA 3QXEB 1KQ2A 3X26B 1YJWT 4OGEA 1O9SA 3T9NA 3WVEB 5CR2A 2KVQG 2ZPFB 4ATOA 4M7AG 5DM7R 2Y90A 1QVFS 5KCHA 4A53A 4EMHA 1QW1A 2D9TA 4JUVA 3VKIA 1VQ6T 2M16A 4TVRA 1I8FA 3G71A 3TCJA 1JB0E 4EPCA 4JS4A 3OYDA 4JLIA 3NTHA 2RO0A 4EMGA 2HD0A 2L3RA 2LRQA 3M5AA 5CKHA 5LJ3d 4E7LA 4E7IA 2RHIA 3HP9A 5IN1A 3V7RA 1VQ7A 4ZN3A 2K5LA 2XD0A 2EYQA 4M77A 3QSUA 4ELZC 1PSFA 2EIFA 2X4JA 4JRIA 4KT0E 4OB2B 2KAFA 4R56A 2XDDA 1KQSA 4RKUE 1M9SA 2L5QA 3SB2A 4J7FA 4L5GA 2DZ9A 1IZ6A 4JRQA 3UT1A 2RHYA 4X34A 2MWPA 2P4TA 4OF1A 4PNOA 1KHIA 2X4XA 3JAME 5J39A 4II1A 2PU9B 2QA4A 2E41A 4N4IA 1VQPT 4BDYA 2EJ9A 1VQNA 4M7DE 3CMET 1YJWA 3CCET 2WSEE 2DIGA 4O6JA 2C06A 2O4XA 4J8OA 3JB9I 2K57A 3G4ST 4CRIA 3GF5A 4XTWA 5KE3A 2RB6A 1K8AU 2EQMA 2FL7A 3C95A 3CCJT 1GXIE 4M7DF 3OYMA 1VQ6A 4M78F 5CKBA 2BUDA 4XAXB 4XK8E 3ZFJA 5GAOr 1VQMT 2QQSA 3F70A 2L8DA 3CMAT 1M5Q1 1UGSB 3V7CA 3MP1A 1FWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQK A;  3OYF A;  2EQJ A;  2GF7 A;  3P8D A;  5KH6 A;  3ZEH A;  3CEY A;  2R57 A;  4N4H A;  3UWN A;  5FRN A;  2LCC A;  1SSF A;  4IUT A;  2RI2 A;  3OYC A;  3DB3 A;  3LLR A;  3NTI A;  4IUV A;  4Z02 A;  4C5E A;  3S3O A;  3MEW A;  2GFU A;  4QQ6 A;  2X35 A;  3H6Z A;  4BE1 A;  3GOX A;  4BAC A;  2G3R A;  4OVA A;  2WAC A;  3MEV A;  4BE2 A;  3LYI A;  2M1H A;  2K3Y A;  3BDL A;  3DB4 A;  2GFA A;  2RHZ A;  2F5K A;  3ME9 A;  3OYL A;  4B9X A;  4BD3 A;  3OMC A;  3FLG A;  2O4X B;  2CKK A;  3P8H A;  3QJ6 A;  5J26 A;  4BDY A;  5M9O A;  2E6N A;  2JTF A;  4Q5W A;  1RI0 A;  3FEO A;  1WJS A;  3C4S A;  4ZTF A;  5C6S A;  3O8V A;  4PL6 A;  4PLL A;  5IAY A;  4A4E A;  5CIU A;  4A4F A;  4A4H A;  3LGF A;  2MWO A;  3OYI A;  3KUF A;  4IUP A;  2RJC A;  2R5M A;  3L2V A;  2LDM A;  1G5V A;  3PMT A;  3LX7 A;  2P0K A;  3OYE A;  3FDR A;  1WJQ A;  4QVZ A;  3L2U A;  1OYX A;  4PLI A;  4C5G A;  1KHC A;  5C0M A;  3S3M A;  3Q1J A;  2RI3 A;  3QBY A;  1WGS A;  5D6X A;  3OS0 A;  4E7H A;  3OMG A;  4BE0 A;  3NTK A;  3MO8 A;  4NS5 A;  2RJF A;  3OYG A;  3MET A;  2LVM A;  3OS1 A;  3OYN A;  2EQU A;  4HCZ A;  2XDP A;  3PNW C;  3MEU A;  4QQD A;  4QQG A;  4A4G A;  5FRM A;  2BIV A;  3M9Q A;  2LTO A;  2HQE A;  4E7J A;  4C5H A;  3E9F A;  4BDZ A;  4RG2 A;  2RI5 A;  2L89 A;  3OQ5 A;  3OYJ A;  3OA6 A;  4IKF A;  3MP6 A;  3L2Q A;  2RHX A;  4EDU A;  5KCH A;  3OYA A;  2EFI A;  3FC3 A;  3OYH A;  3ASK A;  4LD6 A;  2D9T A;  2QQR A;  4C5I A;  2M16 A;  2NLU A;  5D6Y A;  3OYD A;  3NTH A;  2RO0 A;  2L3R A;  2LRQ A;  4E7L A;  2K3X A;  2XK0 A;  4E7I A;  2DIQ A;  2RHI A;  2DAQ A;  3L2W A;  2EKO A;  3H8Z A;  5IN1 A;  4QW2 A;  4FL6 A;  1N27 A;  1WJR A;  5KE2 A;  2X4Y A;  2E5Q A;  3OB9 A;  3OY9 A;  4IUR A;  2X4W A;  2YRV A;  2RJD A;  3SD4 A;  3EAE A;  3QKJ A;  2PQW A;  3UT1 A;  4L59 A;  2BKD N;  2RHY A;  3PMI A;  2R5A A;  2MWP A;  2VYT A;  2RHU A;  4FU6 A;  2HQX A;  2X4X A;  4GY5 A;  4X34 A;  3MEA A;  5J39 A;  3L42 A;  4II1 A;  1H3Z A;  1OZ3 A;  4N4I A;  1OI1 A;  1OZ2 A;  4B9W A;  3OYB A;  4IUU A;  5KCO A;  2R58 A;  3OS2 A;  2RJE A;  3E9G A;  2DIG A;  3S6W A;  3L2R A;  1XNI A;  2JZ2 A;  3OYK A;  2O4X A;  3MP8 A;  5D6W A;  1MHN A;  4UC4 A;  4IUQ A;  4CRI A;  5KE3 A;  2FHD A;  3DLM A;  3PFS A;  2EQM A;  4E7K A;  3QII A;  5FRO A;  3OYM A;  2BUD A;  4N4G A;  2B8A A;  2QQS A;  2IG0 A;  2L8D A;  3F70 A;  3S3N A;  3LH0 A;  4ZTJ A;  3MP1 A;  3LGL A;  2M0O A; 
#chains in the Genus database with same CATH topology
 1SRM A;  4OMN A;  2OTL T;  2D8H A;  3GP8 A;  5FRN A;  1Y96 A;  3HKS A;  1BU1 A;  2ZPE B;  3LLR A;  5GAN 6;  2EYW A;  2D8J A;  2GFU A;  1NLO C;  4E2F B;  4BE1 A;  4BAC A;  4M7A E;  1TUG B;  1UGQ B;  1IRX A;  1X6B A;  2K4Y A;  2M1H A;  3CC7 Q;  1T3S A;  3R6N A;  3U23 A;  3QZ5 B;  2CSQ A;  2EJF A;  4KGZ B;  4M75 F;  4CC7 A;  2RF0 A;  1RLP C;  4PLL A;  2XKO C;  2SRC A;  3OYI A;  2RPN A;  2XU8 A;  3CMA A;  1PKT A;  4LUE A;  3NFC A;  1ZUU A;  4NOY A;  4JJN K;  2OTL A;  2VVK A;  2FG0 A;  3CCR Q;  2JMA A;  4ESR A;  2EQI A;  4M75 C;  5FRM A;  2OAW A;  2V1Q A;  3TSW A;  4MML A;  2EYY A;  4DOW A;  3OA6 A;  3LWI A;  2B86 A;  4M7D G;  1KFZ A;  1NM7 A;  3LW5 E;  1C0M A;  2E1H A;  4M78 G;  4C5I A;  1VQ5 Q;  1S72 T;  4F14 A;  3CQT A;  2AKK A;  1T0H A;  3PIP A;  2XMF A;  3H8Z A;  3QZ9 B;  2FPF A;  1GFD A;  1N27 A;  1SRL A;  2E5Q A;  2RH2 A;  4XU1 A;  1M4Z A;  2X4W A;  2RJD A;  5AYF A;  5GAN g;  2XIC A;  1MMG A;  1PRL C;  3HTR A;  2QTX A;  3JCM f;  3CCM T;  1CKA A;  5GAO m;  1M2O A;  3PE0 A;  1RI9 A;  4DA4 A;  2NUP B;  1YBY A;  5IHI A;  1VQ6 Q;  1GFC A;  4LDX A;  5GJV B;  2WSC E;  5GAN d;  1D0X A;  4C0F A;  1M30 A;  2RNA A;  1S72 A;  4HVU A;  1QVG S;  1RAG B;  4X9D A;  1QKW A;  1QKX A;  2FZK B;  5GAO p;  3UA7 A;  4AG2 C;  4C5E A;  2DM1 A;  5HK0 A;  3GOX A;  1W2B P;  4BE2 A;  3LYI A;  1R8O B;  1T0J A;  1U5S A;  4LNP A;  3DB4 A;  2DBK A;  1PHT A;  4B9X A;  1UHC A;  4CC3 A;  3CCM A;  4FYX B;  3OMC A;  4MZP A;  3M56 A;  5GAM f;  5I2M A;  3CCJ Q;  2EWN A;  5GAM e;  5CQY A;  2D1X A;  3O8V A;  4C92 F;  5IAY A;  4C8Q F;  3JSC A;  2KYM A;  3L2V A;  4JDS A;  4PLI A;  1KHC A;  4YTL A;  4PJO E;  1BCO A;  3BFM A;  1UEB A;  4OP0 A;  2RJF A;  1HJD A;  3MET A;  1JBM A;  4M78 C;  3M9Q A;  4EMK B;  2QTV A;  2F5T X;  4BDZ A;  5CVI A;  4C92 C;  2VGM A;  4RG2 A;  3O5Z A;  4C8Q C;  3L2Q A;  4EDU A;  3FC3 A;  3EG9 A;  1TUD A;  3OSV A;  4R55 A;  2QI2 A;  2ZAE A;  3HRS A;  1KJW A;  3H41 A;  4MZM A;  3EG1 A;  4DBH A;  2X3X D;  4JJB A;  2MAM A;  2NUT B;  5IT9 E;  3M0Q A;  5GJW B;  4ANJ A;  1QVG A;  4FCY A;  1O75 A;  3R6O A;  1VQ9 Q;  3CME Q;  2ECZ A;  4PFZ A;  1H3Z A;  2XID A;  3OYB A;  1ZA1 B;  3L2Z A;  2EYZ A;  4LD9 K;  3KBG A;  1UDL A;  4E7S A;  2DMO A;  3OYK A;  2COZ A;  4AFQ C;  2DZC A;  4M7D A;  4AMC A;  2YRC A;  2ZPI B;  4M78 A;  1JJ2 P;  2HL3 A;  3BY7 A;  2V26 A;  2HEQ A;  3RMQ A;  2JTM A;  3EHR A;  1YIT Q;  2CT4 A;  1PCX A;  1VQ7 T;  3VS2 A;  5HK3 A;  5ECA A;  2PVO B;  4BB7 A;  3NTI A;  4C0D C;  4BUG A;  2FRY A;  2X35 A;  3H6Z A;  4FT2 A;  3JCM Q;  1M2V A;  1OOT A;  4KUD K;  2CT3 A;  4J6W A;  8AT1 B;  3KFV A;  3CC4 T;  1TG0 A;  1GBR A;  4Q5W A;  3FIF A;  3JCM W;  2RK1 A;  2DKG A;  5HKC A;  1ZSG A;  1K9M R;  1VQK Q;  4M77 G;  5GMK e;  2IIM A;  5J3B A;  1G3Y A;  2PUO B;  3H0H A;  1Q7Y R;  3A98 A;  5GMK i;  3CPW S;  1VQL T;  2LC4 A;  1V1C A;  5FWC A;  3OS1 A;  3HRT A;  2QXF A;  1M1F A;  2ABL A;  1K0X A;  3V8J A;  2KY9 A;  3CC4 A;  1WHK A;  4D8K A;  1WHG A;  4CC2 A;  4BI3 A;  3I55 Q;  1YIJ T;  2JUF A;  2K5F A;  1SG5 A;  2QEX Q;  3BW1 A;  2RM4 A;  1KSW A;  5LJ3 e;  1KC8 U;  3M55 A;  3CCL A;  3I5R A;  5CKF A;  4QVD A;  1D3B B;  3A8H B;  4RTZ A;  3CC2 Q;  2CYZ B;  3JB9 D;  4FM4 B;  2ZGW A;  3CBM A;  1S1N A;  5I21 A;  4JJC A;  3REB B;  3RKY A;  1YHQ T;  2M51 A;  3VYG A;  4V2S A;  1MMD A;  3DLM A;  1K73 U;  4M7A F;  3EGX A;  3QII A;  4FIB A;  2IVW A;  1FXX A;  3QDF A;  1KC8 C;  2VXF A;  4PJO D;  2IG0 A;  1SHF A;  2PVD B;  1Y0M A;  3UWN A;  1X6G A;  5EG2 A;  4HVV A;  5LJ5 g;  3SFM A;  2CH4 W;  5DLQ E;  2KRO A;  1K73 C;  1WXT A;  1KK7 A;  4QT7 A;  2HCK A;  2E4H A;  4M7A C;  2E70 A;  1X43 A;  4M77 C;  3LH5 A;  3RKW A;  2JTF A;  5LJ5 d;  2NWM A;  3RR6 A;  4DEX A;  1X69 A;  2MYS A;  4RTW A;  2EYX A;  1EFN A;  4HA8 A;  5KYU A;  4A4E A;  5GAM j;  1U1T A;  1G83 A;  1B7T A;  2QQA A;  1Y71 A;  2VB6 A;  2GNC A;  3FDR A;  1IO6 A;  2F2V A;  1OYX A;  2ZPB B;  2M9U A;  1LVK A;  2RQV A;  3JCM X;  5A2Q E;  2E64 A;  3OYN A;  1D0Z A;  3A8G B;  4NL2 A;  3KXT A;  5FU6 C;  2DET A;  3GNG A;  3X26 B;  3M0U A;  2HDA A;  3T9N A;  2KVQ G;  2ZPF B;  4RTU A;  2MOX A;  2I0N A;  1QVF S;  3D7S B;  3C0C A;  1QW1 A;  4TVR A;  3NTH A;  4EMG A;  2L3R A;  2CP5 A;  2LRQ A;  1B07 A;  1M3C A;  4E7I A;  1VYU A;  1QQJ A;  1WFW A;  4ZN3 A;  2XD0 A;  3E2U A;  4M77 A;  3QSU A;  2X4J A;  4JRI A;  2JJ9 A;  4RKU E;  2MIO A;  4L5G A;  4X34 A;  2P4T A;  4PNO A;  2ROT A;  1YI2 Q;  4M7D E;  1R77 A;  2JW4 A;  2QGG A;  3EH2 A;  1K8A U;  3RBB B;  1VQ4 Q;  2FL7 A;  1QCO A;  3OYM A;  4QKU A;  1VQM T;  1FWZ A;  1K1Z A;  1KQS P;  3P8D A;  1PM3 A;  3ZEH A;  1VIF A;  4A4K A;  3JB9 F;  2EBP A;  5GAO l;  4HKE A;  1K8A C;  1B34 B;  5GAN 5;  1WYX A;  1Z9Q A;  3OYL A;  1D0Y A;  2K2V A;  1YFN A;  2LQ8 A;  2YRD A;  2F1L A;  1RI0 A;  5EC7 A;  1BCM A;  2FVU A;  3I56 A;  4JRK A;  4A4H A;  3CBP A;  4PJJ A;  2RD1 A;  2X9H A;  1VQ8 A;  2P4R A;  2LT1 A;  1VQM A;  3LX7 A;  5GMK j;  2BZY A;  3CD6 T;  3A8L B;  1PRM C;  4E7H A;  4AFZ C;  2AIR B;  2RK2 A;  3CCV T;  2HQH A;  4PJO B;  4XTV A;  1U1S A;  1UB4 A;  2KR3 A;  3HPW A;  1OX8 A;  1ABQ A;  1BI2 A;  1KQ1 A;  3QWY A;  4Y91 A;  1K76 A;  3VS0 A;  2DIQ A;  4JZ3 A;  4QW2 A;  1JXM A;  3GPL A;  3CD6 A;  3QWX X;  2V8I A;  3EG2 A;  3VS6 A;  1WLP B;  1NBE B;  2CZ6 B;  5LJ3 j;  2BE7 D;  4M75 G;  1W2B A;  1NLP C;  3CCV A;  2ESW A;  1UJY A;  4CC4 B;  1OPL A;  4HXJ A;  3MP8 A;  2LNH B;  1YJN T;  3VUZ A;  4AG1 C;  2KT1 A;  4ZGJ B;  5FRO A;  2E12 A;  3VS3 A;  2C0T A;  2DL7 A;  1GCQ C;  1UE9 A;  3THK A;  4FSX A;  1M1K U;  1BK2 A;  1JU5 C;  1Y96 B;  2RQW A;  1NJI U;  2YDL A;  4LUD A;  4DBF A;  5GAM h;  3MEW A;  1VQP Q;  3DKM A;  1A0N B;  3CCE Q;  3CXC P;  2DXB A;  5GMK l;  1ZSZ C;  3G4S Q;  3SDZ A;  5J26 A;  3V8L A;  1M1K C;  2NUZ A;  1NJI C;  3KUF A;  2ED1 A;  2LP5 A;  3VV0 A;  2L3S A;  1G5V A;  3ER0 A;  3NGP A;  3VRZ A;  3EHQ A;  1WGS A;  2OTJ T;  1AOJ A;  3H0I A;  1OPK A;  1X2Q A;  5FLX E;  4M7D D;  5IXF A;  3OYG A;  1UGR B;  3HFO A;  1Y07 A;  1TUC A;  1GCQ A;  2HNI A;  3E9F A;  4BI8 B;  2VWF A;  2FZC B;  4IKF A;  5D7U A;  2OAU A;  2CP6 A;  2JS2 A;  2CGH A;  2CP3 A;  3PVL A;  4RMO A;  1JJ2 A;  3MHX A;  4J9G A;  1ZBJ A;  2X4Y A;  2P0P A;  3SD4 A;  2VC8 A;  1FX7 A;  2DK3 A;  3AHU A;  1H3H A;  1YJ9 T;  2OTJ A;  3PMI A;  4DBR A;  4GY5 A;  1D1C A;  4OML A;  2DVJ A;  1RL2 A;  1IGU A;  4C92 G;  1XJW B;  4C8Q G;  4OB0 B;  2E65 A;  4OMO A;  2HZY A;  4ORZ A;  2LX9 A;  4WF2 A;  4F7U E;  3G71 T;  2HMA A;  5GAM g;  3S3N A;  1YNZ A;  1I0C A;  2X3W D;  3OSS C;  2M0O A;  5GAN 4;  1MMA A;  1SPK A;  1MGQ A;  3JCM e;  3HRU A;  2RI2 A;  4PFP A;  3S3O A;  5GAM d;  3MEV A;  2FRW A;  1OU9 A;  2K3Y A;  1YJ9 A;  3UA6 A;  2GFA A;  4VUB A;  2F5K A;  5GMK h;  1G3T A;  2QA4 T;  2O4X B;  3QJ6 A;  4M75 A;  1QP3 A;  4O5V A;  3VS5 A;  2KDS A;  1VQN T;  4N0A C;  1RAI B;  3LGF A;  1RAH B;  2C0I A;  2BTT A;  3MJX A;  1WXB A;  1E6G A;  3RIR A;  3GIB A;  3OYE A;  1KC8 R;  4C5G A;  2A28 A;  3QBY A;  1WHH A;  1RAB B;  2GQV A;  1V29 B;  2PVG B;  2BE9 B;  3MO8 A;  3CCL Q;  4GLM A;  2DL8 A;  3HL8 A;  3PNW C;  2EPD A;  2RQT A;  4KRT A;  2VV5 A;  1E6H A;  4C5H A;  2M0Y A;  2J6O A;  3QYG B;  2D6F A;  4AFS C;  1K73 R;  4J9F A;  1AT1 B;  1LJO A;  2XDB A;  3OYH A;  5L8R E;  3CCS T;  4HCK A;  2NLU A;  3EG9 B;  1TU0 B;  1ZUK A;  5LJ3 h;  1I4K 1;  3N5B B;  1DJ7 B;  1PSE A;  2OX7 A;  4NL3 A;  4J9H A;  1MND A;  3HHT B;  2H8H A;  2DL5 A;  5KYN A;  4N0A A;  2HSE B;  4EMK C;  1E7O A;  2OJ2 A;  5GAN f;  5GAN e;  4HCC A;  1FMV A;  1U8R A;  2DD5 A;  2HQX A;  3MEA A;  1AWO A;  5I2S A;  1OI1 A;  5KYX B;  3CC7 T;  1H92 A;  5IH2 A;  5A0G A;  2HKN A;  1MHN A;  4IUQ A;  4ZGE B;  2LCS A;  3CCS A;  3E19 A;  3OBY A;  3UAT A;  4M7D B;  4ZTJ A;  3QJY A;  5CCA A;  1VYV A;  3RKX A;  1H8K A;  2VGN A;  3A5Z B;  3OW2 P;  1B3Q A;  1EZZ B;  1V76 A;  1WA7 A;  2R57 A;  2YT6 A;  4JZ4 A;  3G1J A;  3M4G A;  4Z02 A;  3X25 B;  2E5K A;  4QQ6 A;  1G8X A;  4Y28 E;  3CCQ Q;  1OU8 A;  1M2V B;  2LCL A;  3CCR T;  2FPD A;  3CCU Q;  1RAC B;  1BIA A;  1F1B B;  4EMK A;  4ZN1 A;  1I5O B;  4BY6 B;  1KD1 U;  2OI3 A;  4A54 A;  4C92 A;  2J05 A;  4C8Q A;  1VQ5 T;  1AVZ C;  2QDY B;  2O31 A;  1RAA B;  1QWF A;  1WNL A;  1ZBX A;  4E47 A;  1W1F A;  3L2U A;  5C0M A;  2DTH A;  3FJP A;  3RDV A;  2JVV A;  1ZA2 B;  2NUT A;  4Y92 A;  2LJ3 A;  1KD1 C;  3J7A F;  4XTY A;  5LJ3 g;  2DPP B;  3WVE B;  2A37 A;  1K8A R;  4M7A G;  5DM7 R;  5KCH A;  3M0P A;  1VQ6 T;  1I8F A;  1JB0 E;  1VYT A;  4EPC A;  5LJ3 d;  4PFO A;  2G6F X;  2EKH A;  1VQ7 A;  2LX7 A;  2K5L A;  2EIF A;  4R56 A;  1KQS A;  3NPF A;  1R0C B;  4J7F A;  1IZ6 A;  2RHY A;  3EG3 A;  2MWP A;  2K3B A;  4Z89 A;  2E41 A;  2EJ9 A;  2AZV A;  3VS4 A;  2WSE E;  2EGC A;  2C06 A;  2COY A;  3VS1 A;  3I56 Q;  4CRI A;  3GF5 A;  4XTW A;  1D1A A;  2EQM A;  3CCJ T;  1WIE A;  1VQ6 A;  2BUD A;  1ZLM A;  1PKS A;  4XK8 E;  2QYZ A;  3ZFJ A;  3F70 A;  3G6E Q;  1VQ8 Q;  1UGS B;  2JS0 A;  2YUQ A;  2BZX A;  3EGU A;  1VQL A;  1P92 A;  1CKB A;  1VQO Q;  3H9N A;  2DE0 X;  2O9V A;  2QQB A;  1IGQ A;  3RER A;  3EH1 A;  4M75 E;  4MDW A;  1PG5 B;  2A3L A;  4ZTF A;  4C0Z A;  5CIU A;  4XTU A;  1YIJ A;  3WVD B;  1OV3 A;  4KUI A;  2BZ8 A;  4QVZ A;  1WJQ A;  2O01 E;  3Q1J A;  2E10 A;  3J81 E;  2J06 A;  2ZCF B;  2F2W A;  3OMG A;  1TOV A;  2GQI A;  3PVQ A;  4BI4 A;  4NS5 A;  2LVM A;  1QVP A;  2K9G A;  3JV3 A;  4OB1 B;  2RMO A;  2LT4 A;  2LTO A;  5IHN A;  1VQ9 T;  3M54 A;  1D3B A;  3CME T;  4OMF B;  3CPF A;  1I81 A;  3LWH A;  1YHQ A;  3RMS A;  3OYA A;  1Q81 U;  1BI3 A;  3ASK A;  4J9C A;  3HFN A;  2DFU A;  3QUI A;  2EAY A;  1M1K R;  4XU0 A;  3JB9 G;  1WI7 A;  3GNF B;  1NJI R;  1AWJ A;  1Q82 U;  1G2B A;  5FU7 B;  4IUR A;  1YIT T;  2EGA A;  1Q81 C;  4F7U F;  1CSK A;  4J9B A;  4RCB A;  4IIO A;  2V8J A;  2R5A A;  1YJW Q;  5FW9 A;  5GAN j;  1OZ3 A;  3CXC A;  2LQW A;  3SWN B;  3L2R A;  2LNV A;  1QMC A;  4MZT A;  1Q82 C;  1VQ9 A;  4J6X A;  3CME A;  5D6W A;  2P0Q A;  2CSI A;  2QGF B;  4M7A A;  2KK4 A;  4PJL A;  1NEG A;  2B8A A;  1ZUY A;  1VOM A;  4LE9 A;  3AT1 B;  1VQK T;  3OYF A;  4F7U B;  1WZO A;  2AK5 A;  5LJ5 f;  3VYH B;  2YUP A;  5LJ5 e;  3DB3 A;  1KG1 A;  4LXC A;  2QK0 A;  2DIL A;  2G3R A;  3EFO A;  2DF6 A;  4M78 E;  2H3E B;  3OS5 A;  2GBQ A;  4C92 E;  3I5S A;  2KI7 A;  3CMA Q;  1I1J A;  4A4F A;  4IUP A;  2RJC A;  4P5N A;  1PNJ A;  2OTL Q;  1W2B S;  4X1V A;  1R0B G;  1WXU A;  1WQW A;  3I55 T;  3S3M A;  3EGD B;  2CRE A;  3OS0 A;  4L6V 5;  2QEX T;  1D09 B;  1GRI A;  2PUK B;  3NTK A;  4ZNX A;  2HL5 C;  4QVC A;  3MEU A;  4PJO F;  1NYF A;  1NPR A;  3BDU A;  2VAS A;  2RI5 A;  3OQ5 A;  3OYJ A;  1IHV A;  2FPE A;  2QAZ A;  3CC2 T;  1BYM A;  2K7A A;  2RHX A;  5CO7 A;  4KGV B;  2YLB A;  2YLC A;  3PGG A;  4R0K A;  3V7S A;  3QDR B;  3TRE A;  2K3X A;  4FW1 A;  2O2O A;  2VUB A;  1M3A A;  2DRM A;  1IHW A;  1SSH A;  4M75 D;  4PJO C;  2MMP A;  2JNG A;  1UG1 A;  4JS5 A;  2CP0 A;  2DL3 A;  2QEX A;  1JRI A;  4RCC A;  2D0N A;  2RHU A;  4PJN A;  4KBM B;  3L42 A;  5KYY A;  1WQ7 A;  2FB7 A;  3E1S A;  4IIM A;  3V8K A;  1OZ2 A;  4F04 B;  2XI9 A;  3URG A;  3TEE A;  2R58 A;  2JN0 A;  3E9G A;  1S72 Q;  1RAF B;  2J6F A;  1NG2 A;  1XNI A;  1U06 A;  3CC2 A;  2FHD A;  1RAD B;  3M0R A;  1LCK A;  3EG0 A;  4FT4 A;  1RLQ C;  3JCM h;  2HKQ B;  1N8R U;  4FW2 A;  2EW3 A;  3LGL A;  4OGC A;  2IPO B;  3A8M B;  2I2L A;  5A0L A;  2CH4 A;  3CCM Q;  1M90 U;  1HYO A;  4DQ2 A;  1UJ0 A;  2DYB A;  1JJ2 S;  3ME9 A;  1N8R C;  4ELY C;  4BD3 A;  3FLG A;  1AHJ B;  4J6Y A;  3CPW P;  3FEO A;  1EIF A;  3J80 E;  2L0A A;  1M90 C;  1XOV A;  2EJG A;  3CBO A;  3X20 B;  1HK9 A;  2KE9 A;  1VIE A;  1JXO A;  1K4U S;  1UHF A;  3M53 A;  3PMT A;  2P0K A;  2E6Z A;  4JLG A;  1X2K A;  2RI3 A;  2CDT A;  1Q95 G;  2CUB A;  1BIB A;  1W4S A;  2CZ0 B;  1YN8 A;  2L2P A;  1WHM A;  2K79 A;  1WPY A;  4ZGD B;  2P84 A;  1YI2 T;  2V8K A;  2JM8 A;  1YJN A;  1PD1 A;  3SEM A;  2DXC A;  2MI6 A;  1C6V X;  5GAN h;  1VQ4 T;  1ZQ1 A;  4FYV B;  2LQN A;  3RUX A;  3WXM B;  1QCF A;  2DTI A;  4E6R A;  1WJR A;  2CUD A;  3OY9 A;  4M78 D;  4MDX A;  3ZBD A;  2YRV A;  3OW2 A;  1YWP A;  1QWE A;  2L3P A;  2Y4Y A;  2MF2 A;  4C92 D;  3M57 A;  5GAO n;  3JCM P;  4C8Q D;  1H64 1;  2BKD N;  3PT9 A;  3JCM g;  1YCY A;  1KD1 R;  3JB9 H;  3QYH B;  2F69 A;  2H3J A;  3OS2 A;  4E7Z A;  1PWT A;  4M77 E;  4EIK A;  2YWW A;  1AD5 A;  1YI2 A;  1MMN A;  2E3I A;  1ZSZ A;  3PFS A;  4E7K A;  5KYW A;  4N4G A;  3JCM d;  3IQL A;  1TH7 A;  2JMC A;  1VQ4 A;  3CEY A;  5CQX A;  6AT1 B;  4IUT A;  1WDX A;  3OYC A;  4IUV A;  2HAX A;  1D1B A;  5LJ5 j;  1G3W A;  2QQ9 A;  3ULR B;  3JCM J;  2AHJ B;  2YXY A;  2D0Q B;  4KUL A;  4BDY A;  4LDV A;  5M9O A;  4RTY A;  3JCM V;  4M75 B;  3C4S A;  5C6S A;  4PL6 A;  1UGP B;  5A0D A;  2ENM A;  2MWO A;  2KXD A;  3QG1 A;  2CZ7 B;  3M4Y A;  4PKC C;  1VQ7 Q;  4XTZ A;  4RTX A;  1SF9 A;  1QVF P;  3C12 A;  3P8B B;  2LQK A;  2ATC B;  3TQ7 P;  1HXD A;  4RG8 A;  1FYN A;  5GAN 8;  1GL5 A;  4FYW B;  2DBM A;  4QQG A;  2YHT A;  3CC4 Q;  2AZS A;  4OGE A;  1O9S A;  2Z0W A;  1TS9 A;  1MNE A;  4ATO A;  1GBQ A;  1KIK A;  3G71 A;  3TCJ A;  4JS4 A;  4HVW A;  4J9I A;  4JLI A;  1ARK A;  4OMP A;  3M5A A;  4E7L A;  5CKH A;  2RHI A;  2DRK A;  2EYQ A;  4ELZ C;  1PSF A;  4KT0 E;  4OB2 B;  4RTV A;  1SEM A;  2C0O A;  1VQL Q;  2XDD A;  1BB9 A;  2L5Q A;  2LZ6 B;  9ATC B;  4JRQ A;  1YCS B;  4OF1 A;  2NUP A;  3JAM E;  3A1P A;  2PU9 B;  2KGT A;  2QA4 A;  1VQP T;  1VQN A;  2KRM A;  3CCE T;  2JXB A;  2A0F B;  4O6J A;  2DA9 A;  2O4X A;  1FMW A;  3JB9 I;  2K57 A;  3G4S T;  5KE3 A;  4M7D F;  1YIJ Q;  4M78 F;  4XAX B;  5GAO r;  3VRY A;  2J7I A;  3V7C A;  2A08 A;  2EQK A;  5KH6 A;  3JB9 J;  2ZPH B;  2LCC A;  4JPB W;  2PZ1 A;  3G7Z A;  2A36 A;  2RN8 A;  3REA B;  4CI0 C;  1IB8 A;  2DVE A;  1Q81 R;  5L23 A;  2COW A;  2JT4 A;  1QP2 A;  1VUB A;  1YP5 A;  4M7D C;  1YHQ Q;  1QCN A;  1KQS S;  1Q86 R;  1VQP A;  3NHN A;  4M78 B;  3CCE A;  1JQQ A;  1U3O A;  3GLX A;  2K2M A;  2GTO A;  2DJQ A;  4C92 B;  5CKD A;  3G4S A;  2KSS A;  1Q82 R;  4C8Q B;  4X9C A;  2R5M A;  4HT9 A;  4J7I A;  1UUE A;  1M3B A;  2KRN A;  1Y57 A;  1FMK A;  1ACM B;  2KRS A;  4M7A D;  4BE0 A;  4PJM A;  3A8O B;  1X27 A;  4BY6 C;  4M77 D;  5FWB A;  4QQD A;  2BIV A;  4C0G A;  2HQE A;  3CC7 A;  2EVR A;  4OMM A;  1WHJ A;  1BBZ A;  3MP6 A;  1ABO A;  5KYX A;  1HD3 A;  3PTA A;  2EFI A;  2DL4 A;  5IXB A;  2HBW A;  2KEA A;  3OBW A;  1UFF A;  2LJ1 A;  4D6W A;  1NEB A;  1MV3 A;  1TXQ A;  2DJZ A;  5GMK m;  2XK0 A;  2A7Y A;  1OEB A;  2EKO A;  2KXC A;  2LMJ A;  2YSQ A;  2VKN A;  2ROL A;  2RQR A;  4DOV A;  2PQW A;  4OB3 B;  1SHG A;  3QHS A;  3CCR A;  4GLK A;  1IRE B;  4WCI A;  4Z8A A;  2WSF E;  5GAN 3;  3EFS A;  4C0D B;  1QLY A;  2RJE A;  5LL6 S;  1UEC A;  4F16 A;  1BKB A;  4KH0 B;  2JOY A;  4UC4 A;  2ED0 A;  2O88 A;  1VQ5 A;  5LJ5 h;  2VXE A;  2FYK A;  3LH0 A;  1GCP A;  2EQJ A;  1NZ9 A;  2J6K A;  1MUZ A;  1K0S A;  2DYI A;  4MMK A;  2V1R A;  1TSF A;  3HSB A;  4OVA A;  2WAC A;  2DTO A;  3CCL T;  2ZZD A;  3TU4 K;  3JCM c;  2GTJ A;  4F17 A;  3P8H A;  3QO3 A;  3EGX B;  3C94 A;  4RTT A;  1VQM Q;  5I11 A;  2GGR A;  4K11 A;  2AT1 B;  4F7U G;  2CP2 A;  3CXC S;  4KGX B;  1IXD A;  3GBQ A;  4J83 A;  3JRZ A;  2HBP A;  2DO3 A;  4D8D A;  1NE8 A;  5LJ3 f;  4HCZ A;  2XDP A;  4J5Y A;  3L1A A;  3VU3 C;  3TSZ A;  1JO8 A;  3M59 A;  4M4Z A;  1N8R R;  2DXU A;  2QQR A;  3I35 A;  5KYU B;  3PIO A;  3CCJ A;  5HY6 A;  2JTE A;  2MPX C;  4LN2 A;  2DAQ A;  3UF4 A;  3CD6 Q;  3L2W A;  3M58 A;  1M90 R;  4XU3 A;  4A63 B;  4FL6 A;  2XHC A;  1EX4 A;  2XG8 D;  4M77 F;  5GAN 2;  4DBQ A;  3OB9 A;  2PNI A;  3FJ5 A;  1W70 A;  4WTO B;  2F2X A;  1VA7 A;  2NYS A;  4L59 A;  3CCV Q;  3CCQ T;  1M8V A;  1NPP A;  2LJ0 A;  5HCK A;  2CZ1 B;  4Z88 A;  3CCU T;  1Q86 U;  2K6D A;  4LDY A;  2JZ2 A;  1G3S A;  3CPW A;  1X75 C;  1JEG A;  5FU7 C;  3INZ A;  2MK5 A;  2MCN A;  4M7A B;  3NMZ C;  2SEM A;  4M77 B;  1I07 A;  1C1A A;  1NYG A;  1N6A A;  1AWW A;  1QVG P;  1SSF A;  1Q86 C;  4PJO G;  4PK4 A;  3SWN C;  8ATC B;  2QG9 B;  5CK9 A;  5GAO q;  2RQU A;  3BDL A;  3EFO B;  1LPL A;  1K9A A;  1RAE B;  4FYY B;  4JJD A;  1YJN Q;  3CCQ A;  3VJP A;  2E3H A;  5FU6 B;  1WJS A;  3CCU A;  2M02 A;  4LDW A;  5CAI A;  5DY9 A;  4J9E A;  1YIT A;  2DNU A;  2RA2 A;  2KT8 A;  1X6O A;  3X28 B;  1LOJ A;  1J3T A;  2ZPG B;  3I9Q A;  2KQW A;  1BI0 A;  4DEY A;  3DLL A;  4OMQ A;  1ZX6 A;  4JRP A;  4C8Q E;  4XQ3 A;  4A4G A;  4XTX A;  1M27 C;  4E7J A;  1I5L A;  2L89 A;  1Z9Z A;  2KNB B;  4LD6 A;  1LNX A;  2GCX A;  1HSQ A;  3SWN A;  3EFR A;  5D6Y A;  2DEQ A;  1UGV A;  3I56 T;  1VQK A;  5DLO A;  1UTI A;  5CKE A;  3G6E T;  1K9M U;  1VQ8 T;  2OTJ Q;  4LDU A;  1Y7X A;  5KE2 A;  2JM9 A;  3X24 B;  2FO0 A;  3H0F A;  4F7U A;  3EAE A;  1M1G A;  3QKJ A;  1Q7Y U;  1VQO T;  2VYT A;  4FU6 A;  3JCM b;  5AT1 B;  1MV0 B;  1PD0 A;  1BI1 A;  1M8M A;  3OYY A;  2YUO A;  2Y4X A;  4B9W A;  5KYY B;  2X51 A;  4IUU A;  5KCO A;  3UPU A;  1K9M C;  3S6W A;  3FRN A;  4GBQ A;  1N9R A;  1AWX A;  4XU2 A;  2DXT A;  2KYB A;  1Q7Y C;  2DD4 A;  3I55 A;  4J9D A;  2GF7 A;  1W6X A;  4ME7 A;  4N4H A;  1YWO A;  1XQH A;  1QVF A;  3G6E A;  1ZHI A;  1YJ9 Q;  3EGD A;  1B34 A;  3RNJ A;  1AZG B;  5GAN 7;  2CS7 A;  2RHZ A;  1VQO A;  3ZL7 C;  2L3Q A;  2QAS A;  3QPH A;  2CKK A;  3OW2 S;  2E6N A;  3G71 Q;  2DLP A;  1XTD A;  3VUB A;  4HCB A;  1X01 A;  3FB9 A;  3MCA B;  5I22 A;  2KMT A;  2LDM A;  2DX1 A;  3RES A;  3M0T A;  1N5Z A;  2K5I A;  4HT8 A;  5D6X A;  3VS7 A;  5IHK A;  3SHW A;  4RUG A;  2EQU A;  2FEI A;  3UDC A;  4PJO A;  1N9S A;  3QXE B;  2QA4 Q;  1WHL A;  1KQ2 A;  2CP7 A;  1YJW T;  5CR2 A;  1VQN Q;  1OX9 A;  2Y90 A;  2QDL A;  4A53 A;  2AKL A;  2FZG B;  4EMH A;  2D9T A;  4JUV A;  3VKI A;  2M16 A;  3OYD A;  2RO0 A;  2HD0 A;  1PC0 A;  7AT1 B;  4B6M A;  2W10 A;  2EGE A;  3HP9 A;  4KH1 B;  5IN1 A;  3V7R A;  3M0S A;  2DEU A;  2HSP A;  1TTH B;  3MPU B;  2DER A;  2KAF A;  3TVT A;  1WX6 A;  1M9S A;  4FSS A;  3SB2 A;  4AT1 B;  1OQK A;  2YUN A;  1OUL A;  2DZ9 A;  3UT1 A;  3BE3 A;  1KHI A;  2X4X A;  5J39 A;  4II1 A;  1TWB A;  4N4I A;  3CCS Q;  1YJW A;  2DIG A;  1AZE A;  1T3L A;  2KBT A;  4J8O A;  1AEY A;  3MKD A;  2RB6 A;  1GXI E;  1SKU B;  2PTK A;  3C95 A;  1RUW A;  4AFU C;  5CKB A;  1ZSZ B;  3CMA T;  2QQS A;  2L8D A;  1M5Q 1;  5KYW B;  3MP1 A;  2O9S A;  2W0Z A; 
#chains in the Genus database with same CATH homology
 2EQK A;  3P8D A;  5KH6 A;  3ZEH A;  2OTL T;  1VIF A;  3JB9 J;  4A4K A;  2ZPH B;  3GP8 A;  1Y96 A;  3HKS A;  2LCC A;  5FRN A;  1VQL A;  1P92 A;  3JB9 F;  5GAO l;  2ZPE B;  3G7Z A;  3LLR A;  5GAN 6;  4HKE A;  2GFU A;  1K8A C;  1B34 B;  4BE1 A;  2QQB A;  4BAC A;  4CI0 C;  5GAN 5;  2DVE A;  3RER A;  4M7A E;  1UGQ B;  2K4Y A;  2M1H A;  4M75 E;  4MDW A;  1QP2 A;  3OYL A;  1VUB A;  3QZ5 B;  2A3L A;  2EJF A;  4M7D C;  2K2V A;  2LQ8 A;  1KQS S;  1VQP A;  4M75 F;  1RI0 A;  4M78 B;  3CCE A;  2FVU A;  3GLX A;  4JRK A;  3I56 A;  4ZTF A;  4PLL A;  4C0Z A;  2XKO C;  5CIU A;  4A4H A;  4C92 B;  5CKD A;  3G4S A;  2KSS A;  4XTU A;  4C8Q B;  3WVD B;  3OYI A;  1YIJ A;  4X9C A;  3CBP A;  2R5M A;  2RD1 A;  4KUI A;  1VQ8 A;  2LT1 A;  2XU8 A;  4J7I A;  4HT9 A;  3CMA A;  1VQM A;  3LX7 A;  4QVZ A;  1WJQ A;  5GMK j;  3CD6 T;  3A8L B;  2O01 E;  3Q1J A;  3NFC A;  2E10 A;  3J81 E;  4NOY A;  4JJN K;  2OTL A;  2ZCF B;  4E7H A;  3OMG A;  4BI4 A;  4M7A D;  4BE0 A;  4NS5 A;  2LVM A;  2RK2 A;  3A8O B;  4BY6 C;  4M77 D;  1QVP A;  4M75 C;  4OB1 B;  4QQD A;  5FRM A;  2BIV A;  2LT4 A;  2LTO A;  4C0G A;  3CCV T;  2HQE A;  3CC7 A;  4PJO B;  4MML A;  4XTV A;  4DOW A;  1VQ9 T;  3M54 A;  1D3B A;  3OA6 A;  1U1S A;  3CPF A;  1I81 A;  3MP6 A;  4OMF B;  1UB4 A;  3LWI A;  3LWH A;  3HPW A;  1YHQ A;  4M7D G;  3RMS A;  3LW5 E;  2E1H A;  1BI3 A;  1BI2 A;  2EFI A;  4M78 G;  3OYA A;  3ASK A;  4C5I A;  3PTA A;  1KQ1 A;  4Y91 A;  1S72 T;  3OBW A;  3HFN A;  4D6W A;  3QUI A;  2DJZ A;  5GMK m;  2XK0 A;  2A7Y A;  2DIQ A;  2EAY A;  3PIP A;  2EKO A;  3H8Z A;  3QZ9 B;  4XU0 A;  3JB9 G;  3GNF B;  4QW2 A;  1N27 A;  1Q82 U;  5FU7 B;  2E5Q A;  2RH2 A;  4IUR A;  4XU1 A;  1M4Z A;  2X4W A;  1YIT T;  2RJD A;  3GPL A;  3CD6 A;  1Q81 C;  4F7U F;  5AYF A;  2V8I A;  5GAN g;  4DOV A;  4RCB A;  2PQW A;  4OB3 B;  2XIC A;  2V8J A;  2R5A A;  3QHS A;  2QTX A;  3JCM f;  3CCM T;  3CCR A;  2CZ6 B;  5LJ3 j;  4GLK A;  1IRE B;  5GAO m;  4M75 G;  5GAN j;  1W2B A;  4DA4 A;  1OZ3 A;  1YBY A;  2WSF E;  5GAN 3;  3EFS A;  3CCV A;  3CXC A;  4C0D B;  2RJE A;  3SWN B;  5LL6 S;  3L2R A;  1BKB A;  2LNV A;  4MZT A;  1Q82 C;  1VQ9 A;  4J6X A;  3CME A;  4LDX A;  3MP8 A;  2JOY A;  5D6W A;  2WSC E;  4UC4 A;  5GAN d;  2P0Q A;  3VUZ A;  1YJN T;  1VQ5 A;  4C0F A;  4M7A A;  4ZGJ B;  5FRO A;  2KK4 A;  2VXE A;  5LJ5 h;  1S72 A;  2E12 A;  2B8A A;  2FYK A;  3LH0 A;  1QVG S;  4X9D A;  1VQK T;  3OYF A;  2EQJ A;  4F7U B;  1NZ9 A;  5GAO p;  4FSX A;  5LJ5 f;  3VYH B;  1M1K U;  1Y96 B;  5LJ5 e;  1NJI U;  3DB3 A;  4MMK A;  4C5E A;  1KG1 A;  5GAM h;  3MEW A;  5HK0 A;  3HSB A;  3GOX A;  2G3R A;  4OVA A;  2WAC A;  4BE2 A;  3LYI A;  1R8O B;  3DKM A;  4M78 E;  2DTO A;  3DB4 A;  3CCL T;  4B9X A;  3CCM A;  2DXB A;  5GMK l;  2ZZD A;  3TU4 K;  3OS5 A;  3JCM c;  3OMC A;  4C92 E;  3P8H A;  3M56 A;  4MZP A;  5I2M A;  5J26 A;  3SDZ A;  5GAM f;  3QO3 A;  2EWN A;  3V8L A;  5GAM e;  3C94 A;  5CQY A;  1M1K C;  3O8V A;  4C92 F;  5IAY A;  1NJI C;  4C8Q F;  4A4F A;  3KUF A;  3JSC A;  2RJC A;  4IUP A;  4P5N A;  1W2B S;  3L2V A;  3VV0 A;  1G5V A;  4F7U G;  1WQW A;  4JDS A;  3ER0 A;  3I55 T;  3CXC S;  3S3M A;  4PLI A;  1KHC A;  4YTL A;  1WGS A;  4PJO E;  3OS0 A;  4L6V 5;  2QEX T;  3BFM A;  2OTJ T;  4J83 A;  3JRZ A;  2HBP A;  1UEB A;  2DO3 A;  2PUK B;  3NTK A;  5FLX E;  4M7D D;  4OP0 A;  4QVC A;  2RJF A;  1UGR B;  3MET A;  3OYG A;  1NE8 A;  5LJ3 f;  4HCZ A;  2XDP A;  1JBM A;  3MEU A;  4M78 C;  4PJO F;  3HFO A;  1Y07 A;  3M9Q A;  1NPR A;  3L1A A;  4J5Y A;  2HNI A;  4EMK B;  3E9F A;  3VU3 C;  3BDU A;  4BI8 B;  2F5T X;  4BDZ A;  5CVI A;  4C92 C;  3M59 A;  2VGM A;  2RI5 A;  3OQ5 A;  4RG2 A;  4C8Q C;  3OYJ A;  4IKF A;  3L2Q A;  4HCC A;  3CC2 T;  1BYM A;  2RHX A;  5CO7 A;  4EDU A;  3FC3 A;  2OAU A;  2DXU A;  2YLB A;  2QQR A;  3PIO A;  3CCJ A;  3OSV A;  2YLC A;  4R55 A;  3PGG A;  2QI2 A;  5HY6 A;  3V7S A;  3QDR B;  3TRE A;  3HRS A;  2K3X A;  2CGH A;  4RMO A;  4MZM A;  2DAQ A;  1JJ2 A;  2VUB A;  3L2W A;  3M58 A;  3MHX A;  4XU3 A;  4FL6 A;  2XHC A;  2XG8 D;  2X4Y A;  4M77 F;  5GAN 2;  2MAM A;  3OB9 A;  4M75 D;  2P0P A;  4PJO C;  2MMP A;  5IT9 E;  3SD4 A;  2VC8 A;  2JNG A;  4JS5 A;  1QVG A;  1FX7 A;  1O75 A;  2DK3 A;  4L59 A;  3AHU A;  2QEX A;  1YJ9 T;  2OTJ A;  3PMI A;  1JRI A;  4RCC A;  4GY5 A;  2RHU A;  3R6O A;  4KBM B;  3L42 A;  1WQ7 A;  1H3Z A;  2FB7 A;  3E1S A;  3V8K A;  3CCQ T;  1OZ2 A;  1RL2 A;  2XID A;  1M8V A;  2XI9 A;  1NPP A;  3URG A;  3TEE A;  3OYB A;  4C92 G;  2R58 A;  2JN0 A;  2CZ1 B;  3L2Z A;  3E9G A;  4C8Q G;  3CCU T;  1Q86 U;  4LD9 K;  4LDY A;  3KBG A;  2E65 A;  1XNI A;  4OB0 B;  2JZ2 A;  3OYK A;  1G3S A;  3CPW A;  3CC2 A;  2DZC A;  1X75 C;  2FHD A;  2LX9 A;  4WF2 A;  4M7D A;  5FU7 C;  4F7U E;  3INZ A;  2ZPI B;  4FT4 A;  4M78 A;  3G71 T;  3JCM h;  4M7A B;  5GAM g;  1N8R U;  3BY7 A;  3S3N A;  4M77 B;  3RMQ A;  2JTM A;  3LGL A;  4OGC A;  3OSS C;  2M0O A;  5GAN 4;  3A8M B;  1N6A A;  1VQ7 T;  5HK3 A;  2I2L A;  5A0L A;  1SSF A;  2PVO B;  4PJO G;  1MGQ A;  1Q86 C;  3JCM e;  1M90 U;  3HRU A;  2RI2 A;  4BB7 A;  3NTI A;  4DQ2 A;  4C0D C;  3S3O A;  4BUG A;  3SWN C;  2X35 A;  3H6Z A;  4FT2 A;  3JCM Q;  5GAM d;  5CK9 A;  3MEV A;  5GAO q;  4KUD K;  1JJ2 S;  2K3Y A;  3BDL A;  3ME9 A;  2GFA A;  4J6W A;  2F5K A;  4VUB A;  1YJ9 A;  1N8R C;  5GMK h;  1G3T A;  4ELY C;  4BD3 A;  3FLG A;  2QA4 T;  1AHJ B;  4J6Y A;  3CC4 T;  2O4X B;  3CC7 T;  3QJ6 A;  4M75 A;  1QP3 A;  4O5V A;  3CCQ A;  2KDS A;  1VQN T;  4Q5W A;  3FIF A;  3VJP A;  2RK1 A;  3FEO A;  3JCM W;  4N0A C;  1WJS A;  5FU6 B;  1EIF A;  3J80 E;  3CCU A;  2DKG A;  5HKC A;  1M90 C;  1XOV A;  2EJG A;  3CBO A;  4LDW A;  3X20 B;  3LGF A;  1HK9 A;  5CAI A;  4M77 G;  5GMK e;  1VIE A;  5J3B A;  5DY9 A;  1G3Y A;  3RIR A;  3M53 A;  3GIB A;  3PMT A;  2PUO B;  2P0K A;  3OYE A;  1YIT A;  2E6Z A;  2RA2 A;  4C5G A;  4JLG A;  3X28 B;  1X6O A;  2RI3 A;  3QBY A;  1LOJ A;  2GQV A;  2ZPG B;  2KQW A;  1V29 B;  5GMK i;  3CPW S;  1VQL T;  1BI0 A;  2PVG B;  2LC4 A;  3DLL A;  1BIB A;  3MO8 A;  1W4S A;  2CZ0 B;  3HRT A;  3OS1 A;  3HL8 A;  2QXF A;  3PNW C;  4JRP A;  4C8Q E;  4XQ3 A;  1M1F A;  4A4G A;  2VV5 A;  4XTX A;  4E7J A;  4C5H A;  1Q81 U;  1I5L A;  3QYG B;  2D6F A;  2L89 A;  1WPY A;  4ZGD B;  1YI2 T;  1LJO A;  2XDB A;  2V8K A;  3V8J A;  3OYH A;  1YJN A;  4LD6 A;  1LNX A;  2GCX A;  2KY9 A;  5L8R E;  3CCS T;  3CC4 A;  3SWN A;  2NLU A;  3EFR A;  5D6Y A;  2DEQ A;  2DXC A;  2MI6 A;  5LJ3 h;  3I56 T;  1I4K 1;  5GAN h;  1VQ4 T;  3N5B B;  1VQK A;  1DJ7 B;  1PSE A;  1ZQ1 A;  4BI3 A;  5DLO A;  5CKE A;  2JUF A;  1YIJ T;  3RUX A;  3WXM B;  2DTI A;  4NL3 A;  3G6E T;  1K9M U;  2K5F A;  1VQ8 T;  1WJR A;  3HHT B;  3BW1 A;  1Y7X A;  4LDU A;  3X24 B;  5KE2 A;  3OY9 A;  4M78 D;  4MDX A;  4N0A A;  2RM4 A;  2YRV A;  3ZBD A;  4EMK C;  3OW2 A;  4F7U A;  5GAN f;  5LJ3 e;  2Y4Y A;  3EAE A;  2MF2 A;  1M1G A;  3QKJ A;  4C92 D;  3M57 A;  5GAN e;  5GAO n;  3JCM P;  4C8Q D;  1H64 1;  1Q7Y U;  2BKD N;  1VQO T;  1U8R A;  2VYT A;  3M55 A;  1KC8 U;  2DD5 A;  4FU6 A;  2HQX A;  3JCM b;  3CCL A;  3PT9 A;  3JCM g;  3MEA A;  5I2S A;  1YCY A;  5CKF A;  1D3B B;  3A8H B;  4QVD A;  3JB9 H;  1BI1 A;  2CYZ B;  3JB9 D;  1OI1 A;  3OYY A;  4FM4 B;  2Y4X A;  2ZGW A;  3CBM A;  3QYH B;  2F69 A;  4B9W A;  2H3J A;  4IUU A;  5I21 A;  5KCO A;  3OS2 A;  3UPU A;  1K9M C;  3RKY A;  3S6W A;  5A0G A;  4M77 E;  3FRN A;  1YHQ T;  1N9R A;  1MHN A;  1YI2 A;  4IUQ A;  3VYG A;  4XU2 A;  3DLM A;  3PFS A;  4ZGE B;  1K73 U;  4M7A F;  4E7K A;  2DXT A;  3QII A;  4FIB A;  3CCS A;  2IVW A;  1FXX A;  3E19 A;  3OBY A;  4N4G A;  3JCM d;  2VXF A;  1Q7Y C;  1KC8 C;  4ZTJ A;  2IG0 A;  4M7D B;  4PJO D;  3QJY A;  2DD4 A;  5CCA A;  3RKX A;  3I55 A;  2VGN A;  2PVD B;  3A5Z B;  1TH7 A;  1VQ4 A;  2GF7 A;  3CEY A;  4ME7 A;  2R57 A;  4N4H A;  3UWN A;  1XQH A;  1QVF A;  5EG2 A;  1ZHI A;  3G6E A;  5CQX A;  5LJ5 g;  3M4G A;  1B34 A;  4IUT A;  3SFM A;  3OYC A;  5DLQ E;  4IUV A;  4Z02 A;  2HAX A;  3X25 B;  4QQ6 A;  4Y28 E;  1K73 C;  5LJ5 j;  5GAN 7;  2QQ9 A;  1G3W A;  2CS7 A;  2RHZ A;  3CCR T;  2LCL A;  1VQO A;  3JCM J;  4M7A C;  2E70 A;  2AHJ B;  3QPH A;  4V2S A;  2D0Q B;  1BIA A;  2CKK A;  4KUL A;  4EMK A;  4ZN1 A;  4LDV A;  4M77 C;  5M9O A;  2E6N A;  3RKW A;  3OW2 S;  2JTF A;  4BY6 B;  5LJ5 d;  1KD1 U;  3JCM V;  4A54 A;  4M75 B;  1XTD A;  4C92 A;  3VUB A;  3C4S A;  4HCB A;  1X01 A;  5C6S A;  4C8Q A;  3FB9 A;  4PL6 A;  4HA8 A;  4A4E A;  1UGP B;  5A0D A;  5GAM j;  2QDY B;  1VQ5 T;  2MWO A;  1U1T A;  3QG1 A;  3MCA B;  2CZ7 B;  3M4Y A;  2QQA A;  2KMT A;  4PKC C;  4XTZ A;  1Y71 A;  1WNL A;  2LDM A;  1ZBX A;  3FDR A;  4E47 A;  3C12 A;  3RES A;  2K5I A;  1OYX A;  2LQK A;  3P8B B;  5C0M A;  3L2U A;  2DTH A;  4HT8 A;  2ZPB B;  2M9U A;  3FJP A;  5D6X A;  1HXD A;  4RG8 A;  2JVV A;  1KD1 C;  3J7A F;  3JCM X;  4XTY A;  5GAN 8;  5A2Q E;  2E64 A;  3OYN A;  3A8G B;  2EQU A;  4NL2 A;  3KXT A;  3UDC A;  4PJO A;  5LJ3 g;  1N9S A;  2DPP B;  4QQG A;  5FU6 C;  2YHT A;  3GNG A;  3QXE B;  1KQ2 A;  3X26 B;  1YJW T;  4OGE A;  1O9S A;  3T9N A;  3WVE B;  5CR2 A;  2KVQ G;  2ZPF B;  4ATO A;  4M7A G;  5DM7 R;  2Y90 A;  1QVF S;  5KCH A;  4A53 A;  4EMH A;  1QW1 A;  2D9T A;  4JUV A;  3VKI A;  1VQ6 T;  2M16 A;  4TVR A;  1I8F A;  3G71 A;  3TCJ A;  1JB0 E;  4EPC A;  4JS4 A;  3OYD A;  4JLI A;  3NTH A;  2RO0 A;  4EMG A;  2HD0 A;  2L3R A;  2LRQ A;  3M5A A;  5CKH A;  5LJ3 d;  4E7L A;  4E7I A;  2RHI A;  3HP9 A;  5IN1 A;  3V7R A;  1VQ7 A;  4ZN3 A;  2K5L A;  2XD0 A;  2EYQ A;  4M77 A;  3QSU A;  4ELZ C;  1PSF A;  2EIF A;  2X4J A;  4JRI A;  4KT0 E;  4OB2 B;  2KAF A;  4R56 A;  2XDD A;  1KQS A;  4RKU E;  1M9S A;  2L5Q A;  3SB2 A;  4J7F A;  4L5G A;  2DZ9 A;  1IZ6 A;  4JRQ A;  3UT1 A;  2RHY A;  4X34 A;  2MWP A;  2P4T A;  4OF1 A;  4PNO A;  1KHI A;  2X4X A;  3JAM E;  5J39 A;  4II1 A;  2PU9 B;  2QA4 A;  2E41 A;  4N4I A;  1VQP T;  4BDY A;  2EJ9 A;  1VQN A;  4M7D E;  3CME T;  1YJW A;  3CCE T;  2WSE E;  2DIG A;  4O6J A;  2C06 A;  2O4X A;  4J8O A;  3JB9 I;  2K57 A;  3G4S T;  4CRI A;  3GF5 A;  4XTW A;  5KE3 A;  2RB6 A;  1K8A U;  2EQM A;  2FL7 A;  3C95 A;  3CCJ T;  1GXI E;  4M7D F;  3OYM A;  1VQ6 A;  4M78 F;  5CKB A;  2BUD A;  4XAX B;  4XK8 E;  3ZFJ A;  5GAO r;  1VQM T;  2QQS A;  3F70 A;  2L8D A;  3CMA T;  1M5Q 1;  1UGS B;  3V7C A;  3MP1 A;  1FWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...