1OZ0A

Crystal structure of the homodimeric bifunctional transformylase and cyclohydrolase enzyme avian atic in complex with a multisubstrate adduct inhibitor beta-dadf.
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
590
structure length
590
Chain Sequence
b'RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional purine biosynthesis protein PURH
publication title Structure of Avian AICAR Transformylase with a Multisubstrate Adduct Inhibitor beta-DADF Identifies the Folate Binding Site.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
total genus 201
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2003-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1oz0A01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1oz0A04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1oz0A03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1oz0A02
1T36A 1OZ0A 1S8AA 2YVQA 2X8WA 1EGHA 1PL0A 1IK4A 2IU0A 1KEEA 3ZZMA 1A9XA 1P4RA 1PKXA 1CS0A 1S89A 2B1IA 2XW6A 1G8MA 1THZA 2B1GA 1BXRA 1B93A 1VMDA 1C3OA 4A1OA 1C30A 1ZCZA 1M6VA 1JDBB 2IU3A 1WO8A 1M9NA 1CE8A 5H3LA 4EHIA
chains in the Genus database with same CATH superfamily
2XCIA 1VQ6V 2WKRA 5KTNA 1M6VB 1ZMBA 3T5MA 5I7AA 3DAGA 4UW9A 4OOEA 2VDJA 3GDHA 3VC7A 5HZGA 4F6LA 3ADOA 1NVPD 5TT1A 2GZDA 5DEOA 4PZLA 4LNUB 2WB4A 4V0QA 3U3ZA 3QTLA 3E81A 3G2KA 2ZDGA 1YDEA 4ANFA 2Z3IA 5HZMA 2CXHA 3W04A 1N34B 3B36A 3QG5A 3CPJB 3NP7A 4PYJA 1Z0UA 1K4CC 4G9GA 3V9PA 2GARA 4E4TA 1EFUA 4JJEA 1XN1A 4CBCA 1B23P 1U2QA 3PFKA 5ES3A 3VYWA 4MQBA 2P75A 3HM2A 2H7VA 5ES4B 3IXMA 4QOFA 6Q21A 1UBUS 3RRNA 1JFFA 2H1CA 1Q2UA 3L8YA 3RK0A 1NJ8A 1ZRNA 1CJMA 4TVKA 3H18A 2F4VB 1DV2A 2UVDA 4RH1A 2TMKA 4FMPA 2W11A 4FFBA 3V4LA 4FR5A 2YY5A 4HH0A 2HW8A 1AK1A 1E2FA 4BV9A 3RREA 2B35A 2GRUA 1CV2A 2QSAA 1CJBA 5AMXA 3TLYA 4RSMA 5IM4A 1T9HA 1A8HA 2CCGA 1GSHA 3Q0TA 1VBMA 2YCLA 2ZIXA 1PRYA 2PSHA 3UV6A 1JU4A 2XB2A 3NCTA 4XI9A 4QQ8A 1CEEA 3AHHA 5J3JA 3FN4A 5BRAA 1XZIA 3LRPA 4KK3A 4YJKA 3PV0A 1CVIA 2JD1A 4QWWA 5G1OA 2Q5HA 2QN1A 3U4AA 1Y6JA 1U5BB 3O2QB 3THSA 4ZD4A 1UZNA 1T2FA 4M76B 5LZ5A 2D13A 4ZT2A 2P5YA 4CKCA 1ORHA 3OU6A 5LQSA 1XVTA 2LBPA 3VR3A 3H4IA 3A6GA 3AIKA 1D09A 1K2WA 2HZ7A 3CPSA 1XRQA 3CLTD 3P2KA 3KSZO 3QFSA 1U4SA 3EXIB 2YZNA 3X2QC 4IDPA 3ZCUA 1C4XA 4E46A 3TO5A 2X6BA 5DTMA 1CZNA 1XHZA 2R86A 4WLFA 1ETUA 1R16A 1A2QA 3ODPA 4RXUA 4NAVA 4BNDB 1QC5A 3TRIA 4C0HA 3N39C 3W6ZA 2Q2WA 1N33B 1FU8A 1NLYA 4IKPA 3BWEA 1AMOA 1ISJA 2A7XA 5C52B 2Q9LA 1LQ2A 3OJLA 2ZJ0A 3IXLA 4QXOA 3DONA 1EUDA 3FIJA 2XYQA 3RTGA 4WZAB 1AS0A 5E9WA 4WXPA 2FB5A 1N2CA 3E8MA 2UU9B 3MAJA 5BQ5A 3U3JA 4ADSG 3W5BA 1ZGCA 2DPMA 2BWJA 3C7AA 4NR0A 2GZSA 3LBAA 1SBCA 4UU7A 4ZXPA 5DXJA 4WLNA 2QXTA 3ZCRA 1LF5A 1F6WA 2H7CA 1EK2A 1FNBA 1F38A 3N7AA 4WKOA 1P1CA 4ARAA 4HDSA 4TT3D 4MWSA 1R74A 4XGQA 1GPKA 5CVCA 4RADA 4F4HA 1NKTA 2ETVA 2ZINA 4YALA 3WBJA 2Z9BA 3WLNA 5AI5A 3THOA 5GJWC 3R40A 4WKPA 5FBRB 3D3WB 4FCWA 4F4JA 3IFSA 1Q8IA 4C4YA 4ISBA 2ILTA 4NCNA 3N3AC 4CIXA 5JAOA 4XJTA 4K35A 3O03A 5K6RA 4BMSA 4QPZA 3LK6A 2NYRA 4NEQA 5KX5A 2EGGA 2BH9A 2V7UA 3C14C 4GPTA 5BSUA 1V3UA 2FETA 3K1AB 2BFBB 2GZRA 4O8YA 3PUVA 1MQ0A 4FPPA 4MKIA 4G5FA 2YXNA 4ALMA 5F98A 1V96A 1YXMA 4DQKA 1L7BA 4MRAA 5B5EZ 4UXJA 2E1RA 4PFKA 2QYSA 1S3JA 2M1XA 2HRBA 3ZK7A 3PLNA 3K9NA 4U9UA 1B74A 5E3JA 1K3FA 1DQPA 4TLAA 4LRQA 3L79A 4UQLA 1J6UA 2FLKA 4LF6B 1R73A 3BBLA 1TAUA 2AN3A 3IX7A 2CEAA 2J4FA 1A1VA 4J7UA 2OP1A 2H3OA 2UYYA 1NJ6A 1RTTA 3R7AA 4Q3CA 5IXSA 2OCXA 3CPEA 2Q49A 1L7PA 4ZRMA 4TKMA 2WUVA 2JW5A 2ZE8A 2V8OA 3IRUA 1II8B 3AY7A 3N8HA 3M3HA 1BWPA 1E1MA 3EZXA 1NMZA 1MZPA 3BA6A 5JWRA 1NT2A 2PZAA 2EF1A 3KLOA 3ABMB 2YXPX 2XGOA 1A4UA 3UJ3X 4R8LA 4F1WA 3OT7A 1D0VA 1PSZA 1MJFA 1QFMA 1J8YF 3HCFA 3J81A 1S1MA 2CYCA 3DZGA 3WO0A 1XCBA 3T35A 1O7JA 4DR1B 5DEDA 2Y6UA 4N5LA 4O4IB 2FSVC 4LX0A 2ETXA 1N5KA 5L4SA 2AEEA 2X9VA 3MJTA 4WGGA 3TD2A 2BEKA 2I4TA 5IYZF 4N4AA 4PCUA 2OWEA 4EJSA 2FPSA 3DVAA 3B9BA 4HLQB 2AQIA 5F33A 2OHFA 3IE2A 4IOKA 1RI5A 2IBZH 1E4YA 4RSGA 4TKZA 2QWPB 1GQRA 3K58A 1X59A 2IYAA 4RMIA 5B5SA 1G3RA 2IU6A 1DOAA 4BO6A 4CEJA 5FOSA 1YRQA 5JH7B 3PPXA 2C83A 1Z33A 2O8EA 1NUHA 5BYAA 2JFYA 5ALJA 1L7VC 2QMUA 3CC8A 1XL6A 4WF9V 1TK9A 4YRPA 1HGXA 3ISTA 3EG5A 1JAIA 4A3SA 3ZNNA 2AE1A 2BFFA 1U9IA 5EIWA 3WQRA 2Y2UA 4E4YA 2XXJA 1GN3A 4BIZA 3H97A 1GA6A 1ENYA 5CMLA 4EO7A 4Z3OA 3L0DA 1ZJZA 3P45A 3AEIA 4G9BA 1QZUA 1BH6A 1VKHA 3JQ6A 3EXEA 4MMYB 2J0QA 3G2NA 3ZWXA 3OQNA 4YMSA 3AIMA 4QPJC 4XDHA 1IVNA 2ZXUA 2JHGA 1P74A 1H9CA 1SUIA 3MGGA 1IY1A 5HCNA 3AQIA 3QO7A 2I9PA 3KD2A 4I50A 1ZX1A 1CE8B 1WTAA 3TL2A 4KXQA 4LW8A 4IL5A 3F7NA 3SHQA 1VQ9V 3AVPA 1PIWA 4K9LA 3DAFA 4OUKX 5LLSA 1USIA 1Y3AA 5K4HA 1WRBA 4RQAA 3DTYA 3T2MA 4C4AA 4IDGA 2C20A 5EINA 5E1MA 5JJBA 2E85A 1F8UA 1FX0B 3RIYA 4OLFA 2NNUA 2CNOA 4NHEA 1UOOA 3TLBA 3VPXA 4KOAA 4D9KA 2EP8A 1JYEA 3H5VA 4XD2A 4RTMA 3L7KA 3FW1A 3FZGA 2IY7A 3UA3A 3A05A 1QHGA 2RC5A 3TEJA 3IMEA 4X66B 1TAEA 2HJGA 3LCUA 3STZC 3FCEA 4NU6A 1GGNA 1XCPA 2AA3A 3NYRA 2VLBA 5CIYA 5D3MA 1PNQA 3VVBA 4KTTE 1TEHA 3SIWA 4K5QA 3SEAA 1JDBC 3JVIA 2GILA 2OLEA 4MVRA 1AURA 3IMGA 3ASNB 3T34A 2W2OA 4V2IA 2OIGA 4J1QA 3T1VA 3L49A 2O8DA 3NONA 1IXSB 3G3EA 4UATA 5JBNA 4Y2VA 2C97A 4KYIB 4CKZA 3K0KA 1VQ1A 3ZI4A 3LECA 3DOHA 3IMCA 3CA8A 4CL8A 1A4RA 1URFA 1M6VA 4R1QA 4TWKA 4LBEC 4J3JA 2R0QC 4IICA 3FRJA 1P5ZB 4YECA 3WGMA 3IPXA 4BWVA 1IQPA 1DEXA 3IOCA 2I4MA 4CCSA 5ALVA 4OHCA 3CE9A 4RV9A 3N0XA 1E9DA 5ECYA 5IWCA 5KTOA 3VRHA 5LQMA 1OT5A 3EF1A 1WMSA 2IHKA 3ZMVA 4BZPA 4TMFA 4BEVA 3S8MA 1JPUA 5KYXB 1JXOA 3K9WA 1FSZA 3MM4A 5KAPA 4YPVA 1TYCA 2IXAA 1QCCA 3AI2A 1V39A 1PFGA 1KF0A 3Q6NA 1F8YA 4UQOA 5DTRA 4YJ2A 4NZPA 3O74A 3K8OE 4HUTA 5JS8A 2UYHA 3NC0C 1UBNA 3OR6C 2X15A 4DHEA 1RFGE 5J5CA 1JXAA 3N6XA 3GJRA 3BXGA 3I4LA 2GKGA 1EP1B 3I2GA 3NWJA 3P9YA 2OQIA 1JJAA 2CJWB 3OGCC 3H2BA 1KDTA 2VRZA 3NANA 5C8YF 1WKCA 3GUCA 2HA3A 3L7JA 3IQXA 1KI1A 4LPKA 4K86A 5TC4A 3URKA 3PWTA 1W4BA 3RJ9A 4DF3A 3LOUA 3G2JA 3IR6A 2WHYA 4TQAA 1L1RA 2EARA 5DHUA 3PA6A 4O6VA 1W93A 1J99A 1REQB 3K1ZA 2OQ2A 3BIJA 2IUSA 1JW9B 1VPVA 2I55A 1AKTA 3AEKB 2HM7A 1HG1A 1Q0HA 3T7RA 4E6PA 1YMVA 5JARA 4RTOA 2DJ5A 3F6RA 2O7QA 2ZT8A 2WJ4A 4G8CA 1ZR2A 4JQOA 3GMTA 5CJJA 3L46A 1AI5A 5E1AC 3GGCA 4MKRA 1UXKA 4FLWA 1S8NA 2BFDB 1YITV 4JOQA 2X0LA 1Y4ZA 1RWVA 5JZBA 4PDLA 3EXIA 4OCLA 4UXNA 4BNVA 3DLCA 1KSFX 2IEBA 1Y5LA 1CNEA 5DCYA 4EKWA 5DNEA 4PX3A 4NC9A 1W36D 1QB7A 5SZJA 2GN1A 2KPOA 1BU5A 1HYQA 4TV8F 4DCSA 1ZIOA 1V2HE 3HP1A 4QOIA 3JZIA 4LA4A 5IBPA 3TSCA 4Q6BA 3M5PA 3HEAA 2PMDA 1Q0PA 2C2XA 4MGEA 4MPTA 1E2MA 2V3VA 5IDWA 1DP4A 3KZOA 4IG9A 4BN4A 4WZAA 4ZTZB 3OTIA 4ZVNA 3COZA 4J7AA 1HQDA 4OXQA 3UHJA 1Y1PA 2ZRKA 3V7WA 3G2MA 4K6KA 4CN9A 4XTCS 4MR8A 1OAAA 5C35A 4GYWA 3N8KA 4B4OA 1N2HA 1SU7A 5IMSA 4C88A 4JXEA 2LFSA 3C15C 1B8PA 4RTPA 4M38A 3S4YA 2J07A 4HX9A 2FUG1 4E4EA 3ABSB 4DPLA 1P2UA 4RHYA 4YIKA 4BIUA 2CW5A 1NI8A 2MU1A 1OV9A 1L4FA 2AWNA 4OH7A 1G42A 5KC9A 1GRQA 3EIOA 2ZRFA 4F04A 3D3WA 2QENA 1B76A 3R5XA 2I3GA 5ILGA 3IR7A 2DQ3A 1G2PA 1T9DA 1IXZA 3TNJA 1Y5RA 1N4CA 2ORED 4JSRA 4AYWA 1LQUA 1IJFA 2DPHA 1BYIA 4XB2A 1BD4A 2NV2B 4YTEA 2FPKA 2GO1A 3FI9A 4DIFA 3DS8A 2PLNA 3DXFA 1OSNA 3ZV4A 3V2IA 1B0UA 1I2DA 3VR5H 3K1AA 3OCJA 5JCZA 2QF7A 4WFFA 4M49A 2UXDO 2ORVA 3U40A 4G0NA 1YZYA 2GSWA 3THYB 5I5EA 3OZEA 5FBZA 3SJAA 5CX4A 3RYHB 1OAOC 3NAQA 3CONA 1R3JC 4CUJA 2CHEA 1WUIS 1U2GA 4AJEA 4JTAB 4DNXA 1BHSA 1T5EA 3HCRA 4HQLA 4YT4A 4LRTB 1UOEA 4XR9A 3BXPA 6ADHA 3OETA 2C4MA 3B6JA 3UCSC 1TX4B 2VDLB 1WN7A 3JCZA 4ITUA 3MCZA 3FWPA 1YQXA 2QMZA 2B20A 5DEIA 4UVBA 2ARKA 1YCDA 2Z5FA 5EHXA 1GTZA 2QS9A 3VUEA 2AW5A 4CS4A 4O25A 4M7RA 3BMOB 3RSZA 4YJDA 4N8SA 2E5FA 5BR8B 4J0FA 4BO8A 5DMHA 4PBTA 4DBLC 4HJRA 2FPUA 2D1TA 3NOXA 4TLMB 2XDQB 1F60A 3GFGA 2BUCA 3AK4A 2CHVA 3ENNA 1BE1A 2RKWA 3UHFA 4DUZB 4B7AA 4NK5A 1ZRHA 2G40A 2BM0A 4KIGA 2EP5A 1ZG3A 3QQPA 1E9RA 3F6CA 1VLHA 4W82A 1EHIA 2INGX 4XDZA 3JQGA 5DFAA 2QM7A 1SU6A 4W63A 3F6SA 1RJDA 5C4GB 3I9OA 3UMYA 1EGMB 1MB9A 1RT9A 4O8XB 3QUCA 4WZBB 1K75A 3B1XA 4L8YA 2Z0MA 3DDOA 4P35A 1FJHA 2BSQA 3CCCA 4UEQA 1GM7A 3L7OA 5GQSA 3OA0A 4D41A 4TYPA 2H1IA 1QO9A 1QQBA 5EN4A 4NZYA 1RI4A 2F1KA 3NTUA 2GZMA 4KMSA 3LDHA 4ZRNA 3M7MX 4WN9B 4PXSA 3CFYA 3U4IA 1FBNA 4QXRA 2VCYA 4CLXA 2R1VB 2QTBA 2ZUVA 3HACA 3L7DA 5JH7A 2YWGA 2ZBEA 5LNK6 4PDVA 1N77A 3DWEX 4JVSB 3ZBQA 2AZ2A 621PA 3ZVNA 2OO3A 2J6IA 5EVCA 2P2GA 4BWAA 4ZZ2A 2CNWD 1YR6A 1V5WA 1T8SA 3WIUA 1RLIA 2JZOA 3NAZA 4BU1A 4XW2A 2V5AA 1DJPA 1QFZA 4RTNA 2PZBA 5DN6A 3ZRXA 1ZI6A 4BQNA 1LBIA 3BC1A 2ZW9A 5CG1A 2GAFA 3PEWA 4QE9A 1N6OA 4R5HA 2NVWA 3DMYA 3PHCA 2GASA 4BEWA 3RE1A 2E4WA 1J9GA 2HSJA 2YWJA 1ZVMA 4OHZA 3F5MA 2V7EA 1D8AA 3M6FA 2JEUA 4DCTA 1Q6IA 4P4SB 3CJHB 5SY9A 5AVUA 1U2RA 1C2YA 5G02A 2P9FA 3BULA 2HLDD 4TL9A 1ZXBA 2PQ6A 2O0HA 4J03A 2R11A 5FYQA 1CE8A 1BL8A 2B25A 3ET5A 3KR9A 2GO7A 2O2GA 4GRDA 4AYTA 3MMNA 1FFDA 3OM0A 4BE7B 5EJ7A 2ZYUX 4RA6A 3TFWA 5A7HA 4OU4A 4MV4A 2BR4A 3G8DA 1QQ5A 3PTZA 4L7VA 4IIHA 3PFFA 4ZGBA 4TUYF 1FFWA 3CIFA 3D7SA 1FJ2A 5LBTA 1OIXA 1VQ8V 4OSOA 1WW2A 5FV7A 1FX0A 4G4GA 5IBCA 1HNWO 1GTSA 5KQRA 3C39A 3ICVA 1Q11A 4FHDA 1ZK1A 4MGYR 4KLNA 3S55A 1SBYA 1OZHA 2GZAA 3CMCO 2FJUA 5CLQA 1RQPA 2XDYA 2GJKA 1W4AA 1IURA 3GJQA 2QU7A 3IIKA 1PW5A 1X7XA 4EY7A 1XKLA 4BB5A 2H4XA 3ZIAA 1BKYA 2LFRA 3FMVA 2ZYDA 1T3LA 3F4BA 1C41A 3AIIA 1U99A 5E79Z 1NF2A 1E6UA 1V54C 2ZUBA 2E82A 3WGYA 5DYTA 4KNWA 4EIWA 2ZUDA 4ZDWA 3BT7A 2P2YA 3LUBA 4DYHA 2ZRNA 4Q9DA 2A14A 3SFVA 2Q3BA 3K9SA 2TECE 3F67A 3D4LA 4U2FA 5K8CA 4LTDA 4Z4HA 2AF4C 4R8KA 4UVCA 4U63A 3K5PA 4DT1B 3C6KA 4DDHA 4IJUA 1GNRA 1UPTA 1SIUA 3GFPA 3CM0A 1XKXA 3B6EA 4NARA 3SVLA 2M7WA 5AVTA 1B0ZA 3V42A 4NICA 4LPSA 5IPFA 3M6WA 4JHXA 1XWIA 2R3SA 2BL4A 1OJHA 1ZS9A 5CA1B 1RZRA 3NDBB 5EJGA 3E4CA 2I65A 3R8CA 1N6PA 1I3NA 4PAWA 1N25A 4WX2B 3ER6A 4FN5A 4YGXB 3CPHA 5KYXA 1WF6A 1ZGHA 5LMUO 1TF7A 3DDSA 4QC2A 1RHJA 4J11A 1Y9ZA 2FPXA 5CFOA 3IOBA 4OWPB 5FPYA 4WY8A 4TWJA 4E1BA 3PKIA 2B30A 5JCXA 5FWNA 1N5LA 4CTOA 1GU7A 2FR6A 4C2BA 1SBTA 3RD5A 3QY9A 1VGVA 2TYSB 1X19A 1SR8A 4EQ6B 2AMJA 4A82A 2H85A 4TT3G 2NQTA 1SUWA 3DTVD 3IAHA 2NR5A 4ZD6A 4UVGA 4GIBA 4O2BF 4JT9A 3KXPA 1V8OA 1AQNA 2ODAA 1N5JA 2H4JA 3SBGA 1X0VA 4MIOA 5A3SA 3QVXA 1GJRA 2VTBA 3KO8A 3HY6A 1CUUA 5H59A 2FN4A 1PQPA 2C2YA 1RLUA 2F9LA 5FNVB 1B8VA 4Y2UA 1REQA 2AOTB 3H1PA 3NLLA 3AERB 4IUBS 3T8YA 1QRAA 4HTAA 4Y2TA 1NVVQ 2NYAA 5DBHX 5A5VA 4XX0B 2AMYA 3ND5A 3VR2A 4YRAA 1JG7A 3DULA 1R15A 4QNNA 1ORQC 2PU7A 5HRUA 2F8LA 1Y48E 3FSEA 1FLNA 4Y0VA 4KPUB 2EWVA 5ALOA 4BFZA 3ZV3A 2BFDA 4CKWB 3ZH9B 2J3EA 2YWCA 4G27B 2DHQA 2WTUA 3BXHA 3A1DA 3D6VA 2PPLA 5A0FA 3UOWA 4QASA 1UMBA 4IV5A 3VPGA 1G0NA 1QS0B 2JKZA 4DA8A 5HBRA 1UPFA 4R16A 4XTRA 4X24A 3AUAA 4QYXA 4IHQA 1QU2A 2FKXA 2YYZA 3GQVA 1I6LA 3P7MA 3GGGA 4MV5A 3ROFA 4BQRA 4TS3A 3BSYA 3V9AA 1P45A 4G1EB 2WG0A 4MWZA 2XTAA 1P5FA 1JQLB 4ZJYA 2DWPA 4DW1A 2QLJA 3MF4A 4X95A 2HDOA 1JIXA 1LRKA 1QX4A 3H8WA 2F67A 2JRCA 3KL4A 2FLWA 2LGQA 3IO5A 1M76A 4HH4A 4DR7O 4Q3BA 3BA1A 4WIFA 3N2GB 3BQ9A 3N58A 1KEPA 3K15A 4I5IA 4LTNA 3QBDA 4ENTA 5AESA 5AW2A 4BMZA 1A8QA 1NU8A 4FU0A 1WUJS 3G5TA 2Y9PB 2B0CA 3V8QA 3DP9A 2VBFA 4AW9A 2V7VA 1G2OA 2UXBO 2YJTD 3HKEA 3EK2A 3K9CA 1BTOA 4UAJA 4GICA 1GPUA 1OLSB 4EBFA 1ZLXA 2VDQB 3C1TA 3CUKA 1WZUA 1JPJA 3N8DA 3BHIA 1KK0A 2RH8A 2KW5A 3WV5A 4M1QA 3SXPA 5EJ9A 3Q1LA 4PLVA 3V6MA 4HWSA 4X7RA 2OA0A 4GPD1 1SZJG 2A59A 4PO3X 4KPFC 1LLCA 1ODLA 1ZWLA 1R4NB 3FLEA 4B7ZA 3G7SA 4UPEA 5CFPA 4P5DA 4RKWA 2WA3A 2J8ZA 3Q8LA 3PYXA 2ZWPA 3WYCA 4DLXA 1CIPA 4GX0A 3CMEV 1J4AA 3G67A 4CQNA 1PJ3A 1XRNA 4KHPB 1VL2A 3VGJA 2WVJA 2NLOA 3E9QA 2I6GA 4XDKA 3FYHA 3M9XA 4YY3B 1QP4A 2XIJA 1HSOA 1X13A 2FSIA 3V1TC 3H2SA 2WLMA 4W4LA 2WC1A 4K1LA 2D8AA 4F7OA 4CNQA 3VOUA 1XJQA 5JW6A 4RKRA 4QDOA 3T5BA 3ZZUA 5IVIA 3NV9A 1RABA 1U3VA 5AUNB 1W36C 4OBXA 4J0CA 1R3LC 4OFWA 2NNLD 5K8LA 2MSWA 2PUFA 1Y98A 1S2GA 3P2EA 2NU8A 5KYKA 4Y6PA 3DPUA 4I7EA 2AKEA 1WZNA 1M90W 4ETNA 2VAMA 5BQ3A 1OYWA 2PQ2A 3QW4B 2CDYA 2AR7A 3EVFA 2B1IA 4W7SA 2AHYA 1CS0B 4MWEA 1TDJA 3PI6A 4FZ3A 2XDQA 3UWDA 3PHBE 2IW3A 5E8RA 2ACKA 1VQPV 1JEAA 1LBQA 3KEQA 1H2BA 4LVNA 2P35A 5JDIA 1PJQA 1OXVA 1O94D 2FB9A 3VU1A 2JJMA 3CE6A 4BKUA 2C3PA 4AIIA 1CUGA 4UTXA 5T64A 2OSBA 4I3FA 2P5SA 3SIPA 2RHHA 5IK2A 1XZEA 4D4LA 4R3WA 2VRBA 4NG5A 4HLCA 4Z3DA 1GIAA 3JZFA 5IYDO 5D01A 2CB9A 4E5YA 3BCUA 3GH3A 5IY5C 3K04A 4RVUA 4X45A 4P9CA 4B32A 2AFHB 3E22B 4XGRA 1Z6TA 1P6QA 3HV0A 5LBUA 1M93A 2OBMA 3H1BA 1G0OA 1RACA 4NOLA 1JR3E 1SD2A 3TRKA 4FINA 3PZBA 3UO2A 2FZGA 4P4GA 2HI0A 4WN9A 2HU7A 3BBPA 4FQ8A 2OV8A 4M9XA 2PVSA 4FYIA 3A06A 4QOEA 4AZ0B 3NPMA 4C4SA 3S8YA 3E5HA 3WLIA 5JSFA 3SZLA 4GD3Q 4AJ2A 3LUTB 1TTTA 5JTTA 2DMXA 4AKGA 1GPJA 1ITZA 1DKPA 4L4XA 1OBOA 4ROSA 2ZRLA 1G8FA 4WK4B 1Z75A 2PKQO 2Y1CA 1T6YA 5MGBA 1M8PA 1LWNA 3BTVA 3DBLB 4QGGA 1KRXA 1MAVA 2QTCA 3W5HA 1EVKA 1FLVA 1SEPA 1CUAA 1ZM9A 4TXMA 5ESXA 3A6KA 4XQGA 1IJKA 1R6BX 4MW2A 4ZCMA 3VHLB 3D4OA 3JQBC 2P4EA 5K3BA 4IDBA 5HTOA 4N1AA 5D6NA 2HB6A 4I7ZB 5DXAA 4QPDA 4ZI7A 4MVWA 1O9HA 1SY7A 2ALJA 3CCEV 4TQ9A 4FE3A 4KFRA 2ZB8A 1L7XA 1NBOA 5D7NA 1E1QA 1ZABA 5L7YA 5JUWA 1YVPA 3EY9A 3JD1A 5EXEA 1R10A 1DB3A 2Z56A 3UY4A 2O1XA 3REQA 3UG7A 1KB9F 4TTSA 1KARA 5AK6A 2B5WA 4F2PA 3AG4C 3HWRA 5L53A 4AZ3B 2O2SA 3QEKA 3WTCA 4WGFA 4W1RA 2QAGA 5CLFA 4O08A 4FW9A 3BKXA 3TLGA 2BKEA 1H2RS 1DLJA 2FQQA 4XFDA 1RBQA 2F4NA 3QEJA 2VAXA 4IOLA 3ZJTA 2H92A 3VSCA 5KNCD 3VH1A 1VARA 4EMUA 2PL3A 4IJMA 3ZRSA 2CKDA 2QRVB 3EQ6A 3MELA 4V0LA 4BNLA 3WK9A 3U3DA 3AX6A 3FAKA 2HNAA 2WU4A 4I1OA 3Q5EA 3BGIA 4UNSA 2XH8A 4KYTA 1A2KC 2W2KA 3GPLA 3HY3A 2C92A 2FZKA 4KITC 4O8CA 3WKBA 5A4FS 1NATA 4ZAZA 4BNXA 3W6NA 3WLLA 3N76A 4EAAA 1YJ8A 2WINI 3C16C 5FEUA 1EM8A 1INLA 5K8IA 3A3YA 1M7BA 1XYYA 2VT3A 3U4QA 5A4DA 1VI5A 2LD4A 2O4UX 5FD8A 4I55B 3QKSA 4XIIA 1G6OA 1R3DA 5L3GA 4RD4A 2GB4A 1QYXA 4Q01A 1IOVA 3VZCA 2JARA 5B1HA 1G17A 1KO1A 1CPYA 4D8YA 2RKOA 4KSCA 3BN3A 4NZZA 3IAAA 4F5EA 1GK9A 1FSPA 4CQMB 1WUKS 2VF2A 3TAUA 1RE0A 1ICEA 4BECA 2JPDA 5CA1A 4GI7A 1CIJA 1HNWB 3CBQA 4YUXA 2IXTA 3S70A 3R5HA 1UKZA 1JMKC 2YIJA 1XTTA 1X3SA 3MWJA 4X3CA 4D42A 4FGLA 2HX1A 5ALWA 1SVMA 3VU9B 2DBQA 3DE3X 4W9MC 1ORRA 5IKEA 4PDMA 2XCQA 4KE6A 3R6GA 4OAOA 5BQPA 4AJPA 4OWPA 3PB3A 4CG2A 5CP8A 2Q1TA 3EEQA 5IULC 5CDYA 4U2EA 2BR3A 1IHOA 2NACA 5JDCA 3GY0A 3ZKAA 3ADDA 2RAVA 1AF2A 1ISSA 2FXVA 2RGGA 3GO4A 2VVTA 4EQ6A 4EKDA 3EBLA 4JNKA 1OX7A 2W58A 8AT1A 1VP3A 3HZHA 1A9RA 4YJ3A 1DJLA 4FN4A 3FZNA 3F7YC 5JZSA 3L4EA 4MW1A 1M8KA 2R8XA 2FG6C 1TCBA 5LQJA 4PS1A 2BLNA 2P6NA 1GG5A 3G1TA 1T9CA 1Q82W 3EWSA 5KYUB 3ECCA 4QRDA 5F4BA 2O0MA 3QVMA 4CGZA 1UFIA 3T3NA 4L5CA 1V37A 5E7IA 2OCGA 4LYJA 4GP6A 4JJAA 1NN3A 4IIYA 5FNVA 2WUGA 4JITA 4EEKA 4GC5A 3WQBA 2P90A 1O77A 2AOTA 5K1XA 3AERA 4N3GA 4P3XA 3SWWA 4XQ0A 3IA2A 2AC2A 3H5OA 3JD2A 3LUDA 2GBOA 2PKYX 1U3TA 3TJTA 1LU9A 1JKFA 3PHHA 3RTAA 5FL7A 4RW0A 3RRMA 3QX3A 3H2KA 3E18A 3E89A 4PLPA 5CITA 2J5KA 3OMWA 1O8CA 3BFXA 3WFIA 4KPUA 5EL0A 3PUZA 3A31A 3QFTA 3NBXX 2GN6A 2X9QA 5D6OA 4DRYA 1HEUA 2G17A 4WNIA 1CR1A 3V3KA 1PS8A 1USVA 3KJHA 1L2TA 1SBZA 4X64B 1PJSA 5EP4A 2YHIB 2I4RA 4L4YA 2EJ7A 1QS0A 4R68A 3A9SA 1KVQA 2AFIE 3BJRA 3PNLA 4UBNA 5LHIA 1IEQA 1L5VA 4E7PA 3EVNA 4ITRC 2HCJB 4JMLA 4IXWA 1FU7A 2ZS7A 3F96A 1S76D 2WVHA 1E3WB 3IBTA 4LGVA 1HT3A 3OD1A 3OFSA 4ERNA 4YMTA 2ATEA 2Q5IA 5JO9A 3KYCB 2IPLA 3SZOA 2E49A 3SI7A 2YFHA 1NPTO 3K94A 1YV9A 1CF2O 4AQDA 3GDWA 3PRYA 3SJQC 3INTA 4M1ZA 2WJYA 2B4QA 1DLIA 4X1IB 2DBZA 1R5NA 4U02A 3HBMA 1VPTA 3ZWWA 2VYVD 1L4GA 2V7XA 4UPVA 4BIIA 3AO0B 3LWNA 4A6PA 2BGWA 3B2EE 3BA8A 1B8NA 3QU9A 3N2GA 3QVNA 1PJCA 2P79A 1ZA2A 3FNGA 4J1SA 5DYIA 3E8GA 3OM1A 2ZXWB 1ENVA 2ZREA 1X1EA 5CYGA 5DX1A 1IBLO 8GPBA 2WDPA 3IEUA 3ABUA 1JS1X 3TQCA 1JBKA 3BD9A 5BUCA 2XMRA 2JAPA 3BY6A 4MX8A 4RWEA 2JLCA 1LDYA 2XT0A 2PU5A 2YJ6A 3BDIA 3K96A 3T3EA 4IBOA 1OLSA 2F23A 3ENWA 2X0FA 1C8KA 2LW1A 1YDHA 4LJ7A 1A2BA 4B3RO 1MGOA 2ADQB 4JK3A 4KVGA 5JANA 5DLQC 3ZXXA 4D8UA 4PS0A 3SZGA 1CRWG 1WQ1R 4PCVA 2CNDA 1E8MA 1NBWB 4XUEA 2SKCA 4DV3B 2FX5A 3ZS8C 3GAMA 5GAOA 1UBLS 4N8DA 2POQX 1JVNA 4HPJB 4TLLB 3T0IA 3H11B 4EHLA 5T8KA 2DPYA 5AHKA 1OJLA 2CXXA 3KKQA 3G8AA 3GNTA 2X8JB 1KEKA 4EEXA 1T8TA 1IDN1 3OF5A 4KG7A 3PGVA 3WZLA 2Q1XA 4QX6A 2GZ1A 3IGAC 3LC1O 1DKMA 4X92A 4M6WB 4LCNA 3LWBA 1OD6A 3ZGLA 1JU9A 5J47A 4X90A 3IUJA 4IL6Z 5JAQA 1NJ2A 1KAMA 4LS3A 3LVQE 4IWYA 4DSNA 5JJJB 4JB8A 2IZ6A 3RIEA 2UXBB 2HH9A 1DPGA 1GUDA 3ORSA 1SPXA 2HLDG 1Y6GA 5EP3A 1EFVA 3VDRA 4AG3A 2MSKA 4XSHA 2BHTA 4UTZA 4J4HA 3O75A 1WB5A 5A3QA 4P9NA 4D4KA 4TRMA 1DBRA 3D7RA 3WXMA 1CS0A 3WL3A 2DYSB 2VDUE 2YYSA 5IZ4A 1CWUA 4FOOA 1HLPA 2PKQP 2H1VA 4YQZA 3CWCA 3TSYA 1FFXA 2VWGA 3FWZA 3E2PA 2VLIA 1YC2A 4BFSA 1ORWA 2AH5A 1OXXK 5JZ9A 3OJ0A 1CUJA 5EZQA 5AK4A 4E21A 1Z4MA 4LF9O 1ZD9A 1IULA 3USCS 3HO6A 3VVMA 5IE9A 3GJ0A 3Q3GE 3H05A 2XUZA 5U4XA 2WFLB 2NXJA 2W0MA 2XZLA 2FEOA 4OKNA 5KWEA 2IS4A 2IY8A 1TU3A 1JJVA 1SBHA 1PHPA 1YOBA 3A0BZ 4L9SA 3RUPA 2AFHA 4K1RA 2GSMB 3E22A 2PSDA 3VNRA 1DADA 1JCHA 1PL6A 4OB7A 3GEMA 5DM70 2F17A 4NV3A 5LOVF 1Y6ZA 2G04A 1ZUWA 4MIKA 3ZS9A 3EVAA 4AZ0A 1JFSA 5LPNA 1HK7A 2IW1A 3AI7A 1E2BA 3VHQA 2Z08A 3S2GA 2J85A 2NYTA 3GK3A 3DZKA 3OIDA 1RTKA 5ITZB 4C7KA 1RYNA 1MNGA 4ZGGA 2DT5A 3ONDA 1M6YA 2R1ZA 4BMPB 1X94A 1CEXA 3P5BA 1Y81A 1MB3A 3OT1A 4OHPA 1ZRMA 3FUVA 1WSAA 2ATIA 1DK1A 4JCCA 1GDTA 5FOTA 3GVIA 1FXSA 3FLMA 4GC9A 2X7XA 3BWMA 1DXHA 2D2IA 5AH0A 4ZOAA 2HKIA 3GCXA 1SVNA 4MYHA 3VR5A 1HE8B 2SCUB 3R5JA 1G41A 2HCBA 2IF0A 1TD9A 2MR5A 3LQFA 4U8GA 1BFKA 4WCFC 4YDRA 4H1TA 3QOFA 2IX9A 3GNSA 4HGNA 1XMVA 4BVBA 1ZGBA 3CMMA 4DCMA 1NPYA 1O94C 4TPKA 4YUAA 1DO8A 4K6CA 4HBGA 3AXTA 2IQ5A 3WWOA 1Z45A 2L42A 1G8PA 3DDHA 3DEZA 4LJKA 3FYUB 1TAGA 3L9WA 5MFPA 1Z3IX 1YBFA 4R8VA 1IY8A 2Z5UA 2IX3A 3QUBA 1SWVA 2QRVA 5GPBA 4OPAA 2J32A 1CEZA 4I5GA 4Q0MA 4HYOA 4P9PA 1BU8A 1KAHA 1E98A 1RYYA 2V7TA 4LOJA 3LL4A 2Y2VA 2BTQB 5J2UB 5F52A 3HYRA 2X8WA 3OO1A 1CBUA 3AVQA 2A58A 3H75A 1QF9A 3EFFK 3W3AH 3C85A 1OREA 4FJ2A 4IJ6A 4U6NA 4AKEA 5TVGA 4C01A 1DC6A 3DV9A 2ENUA 3O2SB 3G6EV 3QTTA 1T9GR 3SAJA 4G09A 3CZ4A 5CVDA 3L9DA 3OZIA 4MUFA 5K0FA 4LJYA 3GFTA 4Y18A 4OPHA 1WB7A 1JFVA 4MUYA 1TO2E 1Z5PA 1GD1O 2P62A 4XM2A 1R6TA 4YVFA 1U7ZA 2J1LA 3KSBC 1Q92A 4B7KA 4H13B 4RK6A 4NFSA 2B36A 1ZICA 3OZWA 3F7OA 1USKA 2VTKA 2CDNA 2VRWA 4P4NA 5FOWA 3LKBA 5KOYA 1NQUA 1T26A 3Q6MA 4TLEA 7MDHA 3R44A 3CVWA 2R6CA 2WILA 4Z4GA 3EZGA 1QHSA 3O4GA 5CCEA 3BH0A 5EQTA 1G5FA 3GRRA 3CN7A 1YZVA 4D4MA 1JHRA 4C5BA 4WBNA 2MT9A 2XB6A 1ETHA 1YBMA 3EH2A 3F9CA 2RIRA 3BAZA 2XMPA 3ML0A 4JB2A 5D51S 1T3GA 2FUNB 2H2FA 1CT9A 2CMFA 3HG7A 3HFSA 4X62B 1MQ8B 2Y4UA 3A1SA 3ZWQA 1MXFA 2Q2QA 3KTAA 3UMCA 1Z5WA 1TM3E 2GJSA 1GT6A 4K9PA 2Q3HA 1TO1E 5G0TA 4UVEA 3EVBA 4LRSB 5J2TF 3MT9A 5EAIA 3AEUB 5JZMA 4QGFA 5IDXA 5KYUA 2V6JA 3D7KA 1MC1A 3ER8A 3FE2A 3EB9A 1E7SA 3FFWA 1CXZB 3THRA 3KRTA 3NDRA 5FBVB 3JATB 2HIMA 1XLUA 1NTOA 2IHVA 4YJGB 1XD9A 1P0FA 2AQHA 1TE2A 3QKRB 3LDFA 5JPDA 1R18A 3RBAA 3O4VA 3OIVA 4H16A 4BO3A 3ZWNA 4G84A 3LM8A 4Q1EA 1EDBA 3C5CA 3OFVA 2A9HA 1X1RA 3QEAZ 2NU6B 3AM1A 1X7ZB 5BMVB 3PUXA 2X1VA 1G16A 5K3FB 3OQIB 3FDJA 5CCDA 1DBQA 3F6EX 1TJNA 3OX4A 4DLNA 4Q4AB 1G7CA 2VHUA 2P9ZA 4F4DA 2O8NA 4QT4A 1WKQA 3GLIE 2F55A 4UE6A 4OHKA 4Y2QA 1Q7GA 4EF4A 4MSMA 3CCSV 1CK4A 3HB5X 1NUUA 5AQ1A 4J80A 1W5SA 3W8EA 1ISRA 4NQZA 3WGOA 1EFKA 4R1UA 1DEHA 1E3WA 4TZTA 5T41A 4LNUA 4PLFA 4X97A 3VPCA 2V65A 2V7PA 3KYCA 5DI9A 2IYEA 3EXFB 3I5AA 4RAIA 4H6WA 4PXYA 3Q72A 2DULA 1AP6A 4X1IA 5BT9A 3TG8A 3ZPXA 2EDCA 2Y4OA 4OBEA 2PL1A 3CP1A 4QVGA 2IVZA 3DYIA 1T4DA 2OT5A 3DGFC 1QVZA 4IEFB 3BHNA 3DLPX 4Y2YA 4XIFA 1XZCA 3KU1A 3ONWA 4DAOA 4WBSA 2NVBA 4G1UC 1AR4A 3MYYA 1ICIA 3U0ZA 2JG3A 1NZDA 5JIBA 3N53A 4LSWA 2EATA 1JDTA 2IS6A 4H7DA 4IEEA 1Q3HA 4UE2A 1FMTA 2H8KA 4HLNA 4QU0A 1MW9X 3QENA 1U0NA 1UFRA 1O4VA 5BV2P 4DQLA 3OTWA 4LF5O 1X7GA 5AVXA 2P7TC 1TIBA 2GOYA 1M2NA 1KAOA 2QSZA 3E0QA 1SG9A 2WHEA 1U0HC 2DOKA 3NEAA 1GDHA 2LO1A 1JFRA 1Y37A 4DXDA 1RZUA 2Q5FA 2YC2C 2GCEA 2XDWA 5HIJA 2WD7B 4L4SA 1S8FA 4H2DA 2AYXA 3LUAA 3L01A 1H2WA 2R65A 1XTJA 2G9UA 1U5BA 1RPAA 1XQXA 3I1IA 2IXFA 3GLFB 2L6LA 1NJSA 3DFUA 3QHAA 4JWTA 3WOHA 4UNQA 4YNBA 4XDJA 3BFKA 4Y8VA 2AJLI 4HS4A 5L45A 7YASA 4D74A 4BLWA 1FDUA 4KXFB 2FTKE 3NIDB 4R0VA 2AKAB 1IONA 1IBLB 4M6WA 3Q4HB 2EINC 3KKYA 1FW6A 1QB8A 3ZWKA 3TW8B 4YCCA 2N1BA 2VL7A 4BNDA 5ALHA 4IIFA 2DBRA 2XNSA 1KK3A 1IXYA 4LMBA 4IQ0A 1NVGA 5ICCA 4PC2A 1D1PA 5CW2A 3GLKA 2QE6A 4XLZA 1V9LA 3ADCA 1K4MA 2EZOA 2D3TA 3KQYA 1CUXA 1XZBA 4E5VA 1K4DC 2G6BA 2X6AA 1H0SA 5JCOA 2ZAYA 5TV2A 3M99B 2ISSD 1NASA 4JD5A 3GYGA 3LD9A 1FYEA 2O8CB 4B7XA 4QGBA 1C29B 1ULBA 2ZSBA 3TZLA 1WMAA 4CCAA 1RMQA 5LBQA 2E87A 5AVWA 5EJFA 1E1LA 3ZE9A 4DLUA 1O97D 4XWGA 4LSMA 1BWRA 1ZISA 2YI9A 5DGXA 4MQEB 4YIHA 3F78A 1VGQA 1QRTA 1WWRA 1RYZA 3T4EA 3UK2A 1KHHA 4F5YA 2KCQA 1A4XA 3MB8A 3UK1A 2Z0AA 4F2GA 1TOAA 5IJXA 3LBFA 4NJMB 3WYAA 4DANA 4MW8A 3OLCX 2A88A 5LZ2A 4D2IA 2ZYWX 3CSSA 3LQRA 1JU3A 2JBWA 1JEYB 2CCKA 4JLSA 3SYLA 1YDFA 1PFVA 4N48A 5DT2A 2N74A 2OCAA 1K7DA 4OAPA 2HN9A 3U11A 4RJTA 3AW8A 1GL3A 1Q1BA 4N0PA 2VDVE 2HNKA 2YH2A 3FVVA 3HSSA 4GQIA 2XUGA 1UWLA 2BFBA 3DHNA 3IHLA 5ITZA 2XUDA 2VXBA 1XRMA 1U63A 2NZVG 1II9A 3AKZA 3B1JA 1A2OA 4LF9B 4CMCA 1EP9A 5C0OE 4C4OA 4F84A 1YZGA 1MABB 1XLTC 4V1CI 5HX7A 5T4EA 1UIMA 3U19A 5CX1B 4JROA 3MPZA 3RR2A 4J2TA 3DMFA 3ETDA 4LHYA 2AOVA 2AEMA 3FB8C 4JEHA 2OHVA 2NX8A 3PNPA 2QDOA 2XUPA 4P9DA 3D9QX 5AKJA 3C74A 3ILXA 4ND6A 3KWJA 1TC2A 2A84A 4MUHA 1DF4A 4G07A 4F12A 4F92B 1NYRA 4QUIA 1K98A 3KB1A 1YJ9V 1B43A 2I7VA 3ENKA 4ZANA 1P0MA 1II8A 3OIUA 3JQ8B 3TSZA 3AI1A 1P9LA 3NVMB 3GFVA 1BDHA 5BW8A 5JC8A 1MBZA 3KQVA 5EY5B 4J3NA 5B4TA 1XGKA 4KUHA 1O6CA 3MUEA 1AUPA 3D31A 3WLMA 1U9ZA 4RQBA 5AM5A 3GEIA 3L7AA 1ZCJA 5AKKA 4Z3KA 2EKPA 1E2PA 2VYNA 1EDZA 2WWXA 5I48A 1V11B 3BTSA 4N82A 1YU6A 4AJ1A 4O4IA 4HZUB 4Z2WA 3OOSA 2CLEB 4N9QA 3PYLA 2CUKA 2W83A 1TM4E 4IH9A 1L8LA 2GDJA 2XADA 2BTQA 5J2UA 5IJZA 4DARA 1XRRA 2F95B 1PWEA 1ODFA 4OP1A 5IVDA 3FKSA 3LDUA 4PYRA 2R2AA 3OKAA 3EPPA 3GCDA 3IP8A 2XAFA 5IN5A 3R4VA 3THXB 4U3JB 4WOBA 5EXXA 4XB6B 1DTWB 5D7BA 3EEBA 1P17A 1TU4A 2OHXA 4KU4A 3PNVA 3OQMA 3QVKA 3FPBA 3S2FA 4OO3A 1ZCAA 1FMLA 3URMA 3PITA 1E3DA 4AM8A 1D1QA 4X6YA 4P2BA 3STYA 4NCXA 3D8RA 2OTJV 1G66A 1JP7A 3WX0A 3D36C 1ZUD1 3IUEA 4J29A 5SYAA 2JI6A 3W4JA 4P53A 2VWPA 4TRNA 2ZUFA 4JUCA 1H4VB 4I5FA 1FTQA 1WW8A 3CNHA 1SKAA 1CUWA 5LJIA 4BNIA 1A69A 3DT8A 1FQKA 1NXOA 1SKUA 4JU8A 1FEZA 2TMGA 3Q88A 2JGAA 2ANCA 3BJZA 4NS1A 2NIPA 1JVBA 2GYVA 3FLAA 2ZRCA 3SJBC 4AZWA 1GFIA 1R6NA 1XBTA 3OQPA 2Q6TA 1VE5A 4LYDA 3KDPA 4G5SA 1W48A 1QE3A 2I6XA 4S3MA 1LJLA 1HL3A 2DSNA 1NW4A 1IN8A 3DMGA 4BUJA 3M83A 1QCEA 5K0CA 2G0NA 1SXHA 4DB4A 1QF7A 2JS5A 1YDGA 3KQLA 4ALJA 1L8QA 4XQCA 4TS9A 4IR7A 3MJEA 2ETNA 3AEUA 2JDIA 5H7XA 2A0LA 3FDFA 3SYMA 1MORA 2K2WA 2JGEA 3B85A 4RJKA 3DUFB 2PGXA 3OUTA 1FA9A 1CXZA 4OH1A 5KLVH 3L7IA 3JATA 4TYMA 2FRXA 2OYSA 3DKRA 3EPKA 1UBCA 1YL7A 2IUFA 1TYAE 1VHWA 1FP4B 4Q9NA 1G63A 3ZCSA 1R7RA 4FKZA 1BHBA 2GLTA 4YJGA 2QL7A 1NF9A 4GMHA 1NF8A 3R5SA 1QTQA 1UX1A 1IM8A 2EZPA 5J1TB 2OWOA 2ZR7A 1T91A 4PG4A 1M72A 1E6CA 2ANBA 1DDIA 5LD2B 1X7ZA 3J7TA 3LQ1A 5K3FA 1K5GA 4MSWC 2A9VA 5ECDA 4FMBB 2M6KA 4AP6A 2RGNA 1YC5A 2BZGA 3UICA 4QFDA 1GN8A 2JFGA 1KJWA 3FD8A 3H2ZA 3IKVA 2X1MA 2NU7B 3ND6A 2O0LA 5EZ5A 3GJYA 4A2CA 2O0JA 4JIGA 2DQSA 2HK6A 1LDBA 1NYTA 2COUA 1JX9A 1UC9A 3AB7A 3EPJA 5DW3A 3EXFA 2J59A 3QMWA 2VKQA 3E48A 5IHXA 2XZPA 4ENVA 3RS5A 4XDYA 1V8DA 3OUUA 3PHGA 1N4AA 1APBA 3TPCA 2VNIA 5J5AA 4XRGA 2FNAA 4YXWA 3SEQA 2KWIA 3JASB 1A82A 5A5EA 1YQ9A 2CB0A 3GLGE 2G9QA 3W4KA 3OZSA 2ZATA 2PWZA 5JS7A 1Q84A 3DE7X 2Y1GA 4CH4A 3EWNA 3T3MB 3VZDA 4J7XA 1B16A 3IVXA 1NR1A 1OVMA 4AN1A 5H3LA 3HGMA 1IBMO 3KOOA 4DJJA 3UHAA 4OV6B 3U3RA 2YV3A 5GZ6A 2CJWA 2TMYA 1F7UA 1PAUA 4X8MA 5CURA 3ORRA 1AJPA 5IM5A 3AYZB 3R5KA 1UAQA 3FYIB 1KJYA 4N18A 3INYA 4KE7A 1RLJA 4NAHA 5CB6A 5E1BA 3HR0A 5DIFA 2HMAA 4J2HA 4B4KA 2HU8A 4G0XA 5FWDA 4C7MA 1JAYA 1USUA 4WCDA 5DM1A 3S29A 4UHEA 4X8HA 1A32A 3BSFA 4RF4A 4V24A 3WYBA 4I9FA 4BGIA 3EWAA 2RH5A 2IJHA 3HJTA 2WD7A 1Z06A 4FS8A 4MJ3A 1TEXA 3AEKA 4NBNA 2E21A 3TSAA 1XLWA 2X0RA 2ZTMA 3FZEA 4PYNA 4BJ5A 4QO7A 5GIOE 1FDTA 3RVNA 1SFRA 3G0DA 4OM8A 2CYBA 2XAHA 2R6HA 1L3CA 1OLUB 3CSDA 1A5ZA 2EIJB 3ZWVA 2IYQA 5D8DA 3D6JA 1X9GA 5EE1A 4JELA 2C1XA 3A3NA 4UHFA 1EFRD 1A72A 4RTKA 4ZQIA 5DJ5A 2BHLA 4JLBA 5A71A 3TW8A 4FHCA 1RWNA 4I8IA 1S5JA 4WMLA 1GYPA 3ASOB 4LF5B 5DH9A 4TL6A 1P1BA 1RC0A 4AIRA 4X3PA 3OWHA 4X00A 3NGXA 4ZAVA 1O58A 1YCFA 2D1YA 2J3KA 2EZUA 1Y7PA 1KAEA 4UHHA 2GD2A 3ZY2A 4LVOA 1U28A 1RAGA 3PLRA 1E79D 4I9UA 4Q93A 5F2KA 2ZOSA 3VOSA 4ZFTA 1GZ6A 2G0AA 2IXGA 2O1SA 4NEGA 1I14A 2JFWA 1H4SA 4LJ5A 2P4QA 4F1KA 3VM6A 1QIDA 2H2GA 2OY0A 1I7PA 1J2EA 1ZZGA 3GRAA 2CSUA 2RGCA 1UT5A 4CS2A 3MLAA 4NOMA 4JA0A 1Z0JA 5KVSA 3L8HA 1JHZA 4BX3A 4AZTA 4MS4B 4FFLA 5IDVA 3CNBA 1Z07A 4MQEA 4R7CA 1I1OA 2IC5A 1TJ3A 1L6RA 1ULZA 4YCDA 4IGGA 3GG9A 4NJMA 3JD0A 1DAPA 2Z58A 1M56B 3ZMUA 1I3OA 5D3ZA 3A4VA 4DG8A 1GUFA 5BWCA 1R37A 1M6EX 1YI0A 2X6RA 5ARCA 1H3FA 3E4DA 4MITA 4RSRA 4EFNA 2XXAB 2RMKB 3BE6A 1AQLA 2Y93A 2OVFA 1Z39A 3KHKA 3KOZA 3C41J 3D1LA 1E3TA 3EYAA 2G67A 3SE7A 1PHRA 3BGVA 3SKYA 1BKSB 2FRDA 3T1TA 3THYA 4B31A 3RYHA 1KH2A 2O3QA 3BKWA 2CBXA 3RSHA 1MABA 5DCUA 4DYLA 3O91A 3D8TA 1TUGA 4MGIR 3EHBB 1GR0A 1S2OA 2P9HA 1NY5A 5CX1A 4G0UA 3SYQA 5AJZA 4AAYA 2ZXFA 5ICEA 2QTGA 3JZAA 5DCLA 5BN3B 3QUQA 4HAWA 1NQXA 2PSEA 3BUSA 4PPGA 2CTPA 1AM4D 1MDFA 3T15A 4OQPA 1C7IA 2O2EA 4E15A 3TDNA 4LDJA 3GB9A 3ESQA 5KHJA 2I67A 4UJ5A 3BMOA 4CWAA 4UOEA 3G68A 2XQFA 1IWPB 4BLOA 3F4KA 1LRLA 4JB3A 3ROEA 2XOXA 3IT1A 5GJBA 1LFAA 3P26A 5EHIA 3V4SA 3R7FA 3JQ8A 2IJGX 3U39A 2YXEA 1E0SA 1XAGA 5FORA 3KAJA 4RVOA 1PZHA 4MYUA 4WIAA 3D1JA 4KR3A 1Y33E 2IYPA 2Q4RA 1FBTA 2IYOA 4J0KA 3WIDA 2YN4A 5GV7A 3RVLA 4UUMA 1VIDA 2OB2A 1EN6A 2UXDB 1V11A 3L8ZA 4Q3OA 4RWUA 1O97C 2ZR0A 3DGEC 3WWPA 4DDKA 2PXHA 4HY3A 4K9MA 4O8XA 1RYDA 3ICXA 4WZBA 2WJ6A 1DFHA 4TXLA 5FI1B 1SD1A 3H42B 1RRPA 4Y30A 1AA9A 3MIIA 1BVYF 4GWLA 4OQLA 2QTHA 3DZDA 2PMKA 3IC5A 4M2LA 4ZAGA 1U7OA 3S2SA 1QIIA 2Q5ZA 3MJFA 3B2NA 2B4YA 4XD7A 2AI3A 3THXA 4U3JA 4UUOA 3TB4A 5ELLA 3HUTA 3NHKA 3PKJA 1DTWA 2R1VA 5DZSA 1PT6A 3OZUA 4ABYA 4QG7A 2P1DA 3KT3A 1I5YA 4TM8A 3HJCA 4C06A 1R0BA 1VFNA 2R7LA 5BWNA 3BPSA 4TKVB 3DF7A 2ZS9A 3DVSX 2DYRB 4K7JA 1E3IA 1HH4A 3MLBA 2WMOB 1IK6A 1QQAA 1SIBE 3QWIA 2ZK7A 5EIBD 2VYCA 4CYMA 4MW0A 2FLVA 2RGYA 4P4LA 4US2R 1NMYA 3MWFA 3N2IA 4R6WA 4YRKA 4P4SA 3HY4A 3CJHA 2AZXA 1Q15A 1KZ9A 3LMKA 1Y1KE 4UHCA 4XZ3A 3L1KA 3K6SB 2PS9A 2GZHA 3HA3A 2HMYB 4WD3A 4BASA 3MOGA 4D9CA 2YHBA 3U4CA 3GI1A 4LECA 2V3CC 3R9XB 3V4ZA 4RDHA 1I4DD 4OEHA 3DD5A 1SHZA 3ACBA 2QY6A 4HB2A 4JVMA 4TYYA 5ADWA 2I1VB 3VTFA 4LZOA 1COWA 4MCHA 2N47A 2HFKA 3BGOS 4UHKA 4W5JA 4DIDA 2BHNA 2JLXA 2PKXA 3FG9A 3GBVA 4XA8A 3W9SA 1FXWA 4YEDA 4AYXA 4F8EA 4MMZB 2OHGA 3UB3A 3K9QO 1Z5GA 1RBYA 4PIVA 2VS0A 1Z5ZA 2EBUA 3V2GA 4Q7LA 4G9EA 1C8VB 4EEQA 1Y3FE 4KOEC 5GM2A 3CCJV 1DLBA 2DBYA 5HUHA 3EASA 5KDLA 4UCRA 1ZJWA 3TIIA 1KJZA 3LDCA 2I1QA 4U7WA 3QW2A 1WCIB 3P4UA 4BTEA 1ZVVA 4DLLA 5CEEA 3CE2A 3AONB 3MCWA 5ILOA 3BZBA 2J5XA 3GQBB 2BISA 5CDFA 1U8TA 5DM4A 2WKPA 3I6ZA 2MHCA 5JG7A 3ZQJA 3ZLVA 5LYJB 2ABWA 1ORTA 1Q5OA 5IKOA 4HEJA 2H65A 4QU9A 4BNFA 2FR8A 1N6KA 2Q69A 1ZSVA 4GOOD 4RM2A 4GZRB 1UXJA 4YCAA 1C1XB 4DT1A 2WSSD 3DDWA 1PZNA 4NVRA 1FDIA 1DQRA 3CCUV 4H18A 1XAJA 3GDOA 2NU7A 1KEEB 3GV0A 3GJ4A 4YAIA 2FZVA 4KXXA 3EX8A 5CH5A 2HBYA 2QJOA 2E4YA 4OQEA 3ZV6A 3IAM6 5PGMA 1CTQA 2HV9A 1R9MA 4H9GA 2JGKA 3AOEA 1M57B 1E2NA 1NZFA 1CS4C 4KP4A 4M1SA 1V3TA 2R2GA 3W3AA 2PMBA 5BR1A 1FXKB 4Q47A 3CJQA 3ZC3A 2QX4A 4W4KA 4MWTA 4B44A 2XE6A 4N54A 3MVEA 1JE0A 2PX3A 3SXUB 5M5BA 4JV5O 1C7EA 4BV2A 4CVNA 5E0OA 2X4LA 2VXOA 5M2QA 2Y48A 4C87A 3HXQA 4I5EA 2FMHA 1L4LA 2HU5A 4WOPA 3W2TA 4WCEV 1HL7A 4AMGA 1ARZA 4JJ4A 4RE5A 4K81B 5C5DA 4JYBA 4RK4A 3AJ9A 3GA0A 2QDXA 2HA0A 1AHNA 4MIEA 3ZGZA 2W2LA 3UKMA 1V0JA 4MJ7A 3R3HA 1Z4KA 4BB9A 1EFAA 4JUFA 5EPEA 5CYFA 4MWGA 5BWMA 3NTOA 3E9DA 4AO7A 3PNYA 4LF7O 1RR6A 4K28A 2YIDA 5IS2A 1A1SA 1FP6A 4YGYA 4RHEA 1B6GA 1M34B 3I04A 4XX0A 1V4BA 1OW3B 3QU5A 5LMUB 1HDJA 1HZJA 2I4NA 1F7YA 4HVCA 1EEHA 2XRYA 2VNKA 3TTYA 1BXZA 4ZKEA 2QJFA 1NNI1 3OEED 3NC4A 2NN3C 4E2WA 2Z5LA 5E95A 3GEPA 1KEUA 4GLFA 4CKWA 3S1SA 2JA1A 1V2GA 2PG3A 2CCJA 1Z82A 2IPOA 2G8LA 2FY8A 1HDRA 5EUBA 2Q1YA 5BXQC 1M5IA 1AQIA 1NE2A 4HAOA 2HIGA 1Z2GA 4EPWA 1MZEA 4KIJA 4E14A 2FZLA 3SBEA 1YWGO 3G6KA 1J2YA 1YVEI 1A5SB 4TWBA 1QFJA 4LYGA 2H59A 3UAZA 1NE7A 4QREA 3GPBA 1Z26A 3UKJA 2WM2A 4TXJA 4YAEA 2PSFA 3QU4A 4R7TA 4BQSA 2DBVO 2ZRGA 2XGMA 4IQ8A 2F90A 3MIZA 5B37A 1BGYH 2BMEA 1NUTA 2G8NA 3O2JA 4N0DA 1DRUA 4MQ5A 1M3SA 1UAYA 5TPZD 3MA0A 1GADO 3AEZA 4HEHA 2J0UB 1LF0A 5FUQA 3LT5A 1ZSPA 5AXCA 1CF9A 2VHQA 1NG9A 3CO0S 3PIDA 1N8KA 1E3MA 1GTOA 2E37A 1XZFA 5KHLB 4MS4A 1ZD2P 2QP9X 2FFAA 2IE8A 4JVOA 4P3KA 3NTQA 1M33A 3C24A 1ZP6A 2RB5A 3KYJB 4EUNA 1SXGA 1D5NA 3FMPB 1N0VC 3ZLTA 1AGRA 4EHKA 5L7TA 3FNIA 3LDGA 2H5EA 4H1HA 1G8KA 4D57A 1UMCB 5EZYF 4MVJP 3UJ6A 1H4TA 3FWKA 2WBLC 2GHYA 4RJJA 2Z95A 3HO8A 4MV6A 5JFTA 3EXHB 2G6VA 3IKLA 3CH6A 3HEMA 1R4NA 4C6TB 2IYUA 1BEZA 4OHRA 4E1VA 2WVAA 4KIFA 4KRFA 3FTFA 5FADA 4EJMA 3AVXA 3WGKA 4XX1A 2JVJA 2GYUA 3SBOA 3TTVA 1U04A 3AVYA 2RMKA 4PWZA 3JD4A 2ONCA 5DWDA 3OPYB 3ABZA 3AEQB 2CVOA 2FEKA 3OJFA 3AHEA 3OEHA 3FTEA 4E6EA 3FZYA 1S5HC 5BOSB 1JFTA 4YFYA 3RN4A 5DHQA 3B5JA 3BH1A 1SB9A 3I39X 4DR7B 2CLCX 1KYQA 2NVUB 4BLVA 3NOQA 5CA0B 4EJ6A 1G4YB 1K63A 4K2AA 2I7TA 3ICWA 3COVA 1PNLA 3RQIA 5BN3A 4OQNA 1LBEA 3MRXA 2OXEA 3LT1A 3E6AA 3CUWA 4WUVA 4AKSA 3KSMA 4JY7A 3TQRA 2DUMA 4CMEA 2DJVA 1RC1A 1MOPA 4FFSA 1VJ1A 2ONJA 1PS9A 4IMRA 5LN1A 5EJMA 2KG7B 1W4CA 5GTDA 4UM8B 3Q3HA 5TF0A 1YB4A 3ERCA 1JKIA 2A1TR 3PTLA 3Q7PA 4WY2A 4YLEA 4RHXA 2NXWA 3TGLA 1G64A 3GNQA 3FVRA 3WLEA 1Z56C 3NETA 2EILC 1ZMXA 2X2PA 2VC2B 3NEYA 1KKUA 5FYDA 3NAGA 2C7VA 2F1JA 1XZGA 3EW9A 4CDNA 5HJ7A 3TB6A 4Z9AA 2DFNA 2DHEA 1N92A 5EMNA 2B0JA 4LXGA 1IH8A 1MVNA 3ANYB 4L0DA 4FZ0A 3AUKA 5AW4A 1XPOA 2H48A 1P6OA 4BL5A 2B1JA 1P33A 5DNWA 2QWNB 3GRZA 3UW1A 2IOFA 3D59A 1MQ9A 4ZI5A 2PFGA 1FDOA 5ALXA 2WPDD 2W2QA 1M5RA 4DQVA 5C7OO 5DI3B 2ZAIA 2HOQA 4FOPA 3RSFA 1E3JA 1JZSA 3C90A 3OF3A 5LGUA 3OW2U 1MHPA 5KQPA 2RPZA 4ZVQA 3KOXA 4G0PA 4KE8A 5EJAA 4MQMA 3IV9A 2FR5A 5C53B 4Q82A 5TQ0B 1V41E 1Y82A 2G6TA 4QHSA 3K7EA 4OX9O 3KJNA 4KX3A 5HILA 4QYMA 1TA4A 5IG2A 1GGKA 3EOBI 1KIMA 3OLZA 1ZCBA 2X6CA 1WBJB 4GP9A 3CH5A 4L74A 1F51A 1T36B 2QG4A 4TKVA 4AT1A 4MULA 2HUNA 4PX5A 2UZ4A 2ZNIA 3DBLA 4RTQA 2QTFA 3HN2A 2JAHA 3H3XA 1YJAA 1IXKA 2ZSEA 3ZX6A 5LCXA 5K2OA 1HTBA 2DWEC 4P5PA 4F85A 1Z17A 3H5IA 1FFHA 2FMFA 2WAXA 4RDIA 3RV3A 1JI0A 2YIMA 4Z0PA 1F0NA 3V3TA 3ZVRA 4D9NA 5BVGB 4H60A 1NBMD 2C5EA 5CBFA 1S77D 4IT5A 3DT9A 1VI2A 3K6SA 1YF2A 4DUPA 2WM3A 5KYYB 1BO6A 3GPDG 3DE0X 5A9RA 3Q87B 4F4UA 2VDNB 3AC0A 5KHKA 1GCUA 3R9XA 1E92A 3GJXC 1C3LA 1E6LA 4E70A 5JPCA 1QFSA 4RMHA 1RCTE 1DRJA 1NAHA 3H4TA 3A8TA 5HQ3B 3O5AA 2AYZA 1U0OC 4LK2A 4AZ3A 2FRVA 1V25A 4G65A 5EERA 3LIIA 4ZICA 2PH1A 5PNTA 2AWOA 1KYWA 3DNPA 4Q1DA 3TUIC 4CMBA 5EJEA 3ZHRA 4JLDA 1UPBA 2A0XA 2W2NA 3WGGA 3O8DA 3IMKA 3PCXA 3GLHB 2WQ7A 4BVHA 1WCIA 3O73A 4DC0A 3NBZC 4MQ4A 3E03A 2PGJA 1EZ1A 5AOVA 4YWJA 3JR7A 4P08A 4CEIB 2BEVB 1NXPA 1HE4A 3VPHA 2WG1A 2GEDA 3N3BC 4TLDA 5JNUA 4W8GA 4B48A 1AB3A 1XQVA 3SYPA 3FROA 2DE0X 2P65A 1C1XA 4FX5A 1RKXA 4Q7EA 4G1FA 3DO6A 4I55A 1LC0A 5E8JA 3OM3B 1M1YE 4OMUA 4HAXA 1RWPA 3EBPA 3I1JA 3K79A 2XA9A 3SYCA 5BSHA 1RBMA 3DR5A 1EFRG 2PYLA 3QWFA 4ZRDA 4HQNA 1KEEA 2ADPA 3VZRA 3PU6A 3FGNA 5CDHA 2YBEA 4CQMA 3MJHA 4HN4B 5AKXA 1KQNA 1M2KA 5EIBC 3ETLA 4G24A 4NX2A 3M5WA 1MXHA 1GA1A 1RM0A 2XWQA 1URPA 3EFEA 5ED4A 3OIGA 1IUPA 2OD2A 3GROA 1GMGA 5HMLA 3VU9A 1JWLA 4M9UA 1WP8A 4JJKA 3ZHXA 4RQUA 2WQZA 5FXMA 4U7GA 2B9ZA 4LOLA 3USES 2CHGA 1FXKA 3FHCB 3FX2A 1VQ5V 4IY1A 3ST7A 1T43A 1E79G 2XUKA 1LY1A 4H7HA 3DE1X 2GPNA 2VFAA 5BYJA 2WOJA 3SXUA 4EY3A 2UZAA 4JYAO 3BWXA 2Y76A 3CCVV 2IM9A 4JX9A 3C5EA 1VA4A 1JSCA 1JG1A 5CTJA 4O1MA 3MERA 5AI6A 3I56V 5CFLA 4XARA 1AZLA 2JIBA 5KA5A 1Y63A 3SF0A 1S2MA 4P86A 3FYTA 4KL8S 1C81A 1NKDA 4GOXA 4KLRA 1P0PA 1J49A 1TMKA 4GI5A 5AYVA 1DINA 1C14A 1EBOA 2FHSA 5IT0A 1I9GA 4LDRA 4HDNB 3ANNA 1JHAA 5LKRA 1G20B 5J4KA 1V5IA 2XUIA 3I58A 5AICA 4FIDA 3M8KA 2WKWA 1FZTA 4MPDA 3D02A 4IIJF 1RP3B 1IU9A 5G4KB 3R9IA 3EZYA 2DW4A 1BXRB 1LDGA 2X7RB 1RAHA 1C0IA 4C7VA 3WLAA 1M34A 4HTFB 4CV0A 3K9AA 2IV2X 2DTDA 1ECBA 5LP6B 1R2QA 1Y89A 4IYIA 2M2IA 3G9QA 1OCEA 1CUIA 2FWJA 3I5YA 3OKPA 2FR1A 5K01A 4V0ME 3NUZA 4AP5A 3SZRA 2Q4EA 3VI4B 1UPAA 4RTRA 1PUIA 4H3HB 4CF5A 5HW0A 3NNSA 1XRSB 4JV5B 1G9XA 2XA2A 2ZYIA 1FTWA 2ZFUA 1UFVA 4F91B 2YHIA 1J20A 1LPOA 1OZFA 1WG8A 2NT4A 4RL4A 4WFIA 4AULA 2R8PA 1DAGA 1AI4A 3B20A 2ZD9A 1MO3A 1N1EA 3NHLA 3WK6A 5IP5A 3FJ1A 2O7RA 5BP7A 2IDJA 1UBGA 1GARA 3ZR4B 1NVWQ 4RWZA 4UNNA 4FI3F 1TF5A 3HN6A 4J16A 1OXKB 4HGYA 2FF5A 1SURA 1ZOSA 2B9EA 3ILSA 4PSVA 4LF7B 3RGGA 1C3XA 2IWHA 2D0OB 2Z2XA 1MKYA 4K8OA 4UVIA 2W90A 3LGAA 2GD0A 1WXGA 4FC7A 4NEHB 2J0UA 1T4CB 4Y1RB 3IQDB 4QUGA 1SQQH 4EHJA 1Y6QA 4NYJR 3KTFA 2UKDA 4AUKA 1XTKA 2JBHA 4LJ4A 4P8RA 4BJ3A 3FUXA 221PA 3QE3A 4EO9A 2EX3A 2VP2A 3DYVA 2HJFC 4HNHA 4PYQA 3FF1A 2A1IA 4L51A 3ZQ4A 3E83A 2REXB 4BJHB 1FAFA 2J48A 2D2CB 3SZ3A 3KKZA 3TBFA 4FSXA 2H11A 1MH9A 5F76A 5KCZA 1ACLA 1I4OA 1OBHA 1ORIA 2HSWA 2F8TA 1UMCA 2D1SA 4MQLA 2W2TA 2BCEA 2WMYA 3HH8A 1GVHA 1BIFA 4ERXA 1E8NA 1QVWA 1I7LA 4KPEC 4I1SA 2QEXV 4C6TA 1LWOA 4GI2A 1OCOC 2B1GA 2NU9B 2C7OA 4YCSA 2V6GA 3JQDA 5BUQA 4GLJA 1DRVA 4X84A 3FBTA 1I0IA 4A15A 1XZ8A 1DL5A 1ZNYA 3OPYA 3Q40A 3L6RA 2FPOA 3AEQA 2O2YA 3ONEA 4LRXA 1NKSA 3I9MA 1KXJA 3DZHA 3PBKA 3H11A 1NURA 3HB1A 5JAIA 1UPGA 4TWAA 4R2MA 1SM4A 2X8JA 3GEDA 1ZKDA 1EVYA 2NVUA 4EUKA 5CA0A 3OQVA 1SHLA 3L4KA 2ZIZA 4HNUA 1DELA 1MDBA 1GO3F 1TYEB 1L5OA 4S1PA 3HYNA 2PZJA 1S3SA 4TWRA 4HI0E 5GTIZ 1L5YA 2C29D 3O94A 2BD0A 2CXTA 3FMOB 2R5WA 4YN3A 5JS1A 3FB1A 2X0NA 5L9AA 1B0PA 3KPYA 4U2CA 1KYVA 1HQKA 4ISCA 2BDUA 3T1HO 3KTDA 4PC7A 4B3RB 1F7VA 2ID9A 3UANA 4PPQA 3HDTA 2CT8A 1MG5A 2A4KA 3L2OB 3K9LA 4X0EA 1DAHA 4ID9A 2YS6A 1HZZA 3AF2A 3F5TA 2EJRA 1TW2A 4UFZA 4R2IA 4OMDA 3WRVA 3D7MA 3BVPA 5EJ5A 3HL4A 3TJRA 1XU9A 3QO5A 4I8XA 3FPEA 3KPJA 2OC4A 4XWYA 3MGAA 3I05A 2WFLA 4XRRA 1KJIA 1ZIXA 4K8XA 3LWDA 5LDGA 1YHQV 5BNFA 4NCBA 1VE9A 1JTEA 2GBIA 1OIVA 5ALEA 5DI3A 4DVGA 1F1JA 3OURA 4MQFB 1RD4A 2B83A 1BFUA 1BHO1 1R5OA 4Y2HA 4ZU1X 1U7HA 5A6VA 1XVLA 1IOLA 3K05A 4G5OA 1TGOA 2R5NA 1QPGA 1UJ6A 3P30A 2V3WA 3U5ZB 3JVDA 3ICEA 1U1GA 1R5BA 1RB7A 1HLGA 2FZWA 1K0FA 2D8MA 1GZDA 2V7QD 4N5DA 4ZTBA 2HDWA 1JR6A 1RIFA 1EX7A 1NW9B 2GTPA 1N2OA 4MVJA 2C5BA 2H1OA 1NX6A 4R1PA 1AQJA 4O2AB 4RF3A 1KY2A 1LX6A 2WSSG 4S1VA 1Z2OX 3P2JA 3DEKA 1ZK2A 4EX6A 2Z8XA 4GS5A 3NP9A 1E4EB 4DHWA 4WXYB 1T36A 3B4SA 3A14A 4FX2A 5DP1A 1NPDA 4EWLA 3QXJA 4R2XA 4KJXA 1XZHA 2X2OA 1SCKA 1ZGGA 4LGCA 1G9TA 1WTCA 3KR2A 1OROA 2BJVA 2GEKA 5FOQA 1R8JA 2HHCA 4OCNB 3P9KA 2HSDA 3F3KA 1T1SA 1CQJB 2FOLA 4F11A 4OJTA 4H7PA 3LGSA 1XNHA 3VHXB 2GKOA 2DF8A 4X5OA 4OF4A 4PZAA 3GJ3A 2OOSA 4GOJA 3TOSA 1QQCA 3QJ5A 1W87A 1AI7A 4W8OA 3ZWPA 1RVDA 4C6RA 1XA3A 2YINC 4NMHA 3GW8A 4HH3C 4ZDJA 5ICGA 2I0FA 2P5UA 5LQNA 2SCUA 4XVUA 2PEZA 4CNBA 2DLNA 2G08A 4ZJPA 3RYCB 3PENA 1ZLZA 1RM3A 4HMOA 3N0WA 1RM1C 4OX9B 1ADGA 2P9YA 5HQ3A 2YNMA 2GCGA 3DMRA 1LBTA 2H9YA 2R6DA 3L84A 3W5CA 4HQRA 3W7VA 3PQ7A 3BDVA 4J0JA 3C7DB 3U2QA 5B7NA 4AWAA 1Z88A 1RJGA 1L5RA 3FPAA 1AKMA 1XCOA 2HWUA 2BV3A 2PMEA 3FYUA 5HF8A 5CA3A 3ZWCA 2FQ1A 4AJNA 4GGOA 3ZD6A 1SVWA 2QWXA 1XEQA 2A8YA 3TR5A 3H19A 1XC7A 4DDWA 4UTOA 4NU0A 4RHFA 1FYDA 3ZN0A 2RHJA 1N9GB 3PT5A 4C3UA 1RXWA 2DY1A 3GLHA 3GT7A 1P4RA 3OCCA 1ZGJA 2WAYA 4KSYA 2PCJA 4CXMA 1CP3A 2CXPA 5AI0A 1PEKE 1QIFA 4DQ0A 1AGYA 4B9AA 3U5TA 3LNMB 1OI4A 2C2GA 3NW9A 2CJXA 3UW3A 3VQYA 4PX2A 5DMXA 1S3FA 3W7BA 4HVLA 4N21A 4CEIA 3KU4A 2IGTA 1WB8A 3OEEG 4AMYA 3K09C 3H3JA 2J67A 3FFBA 1B3RA 3E7DA 3OBIA 3K5NA 5FPHA 1TI7A 3HJGA 3ISVA 1S02A 1DDOA 1SKBA 3OCZA 3NRJA 1FXHA 4EVRA 2AYYA 3P3NA 4EKNB 2QUAA 4KZKA 4DAEA 2FPMA 1E3SA 1AUXA 3M70A 3WWCA 3BRCA 2C4UA 3OMNB 4EHAA 1E1RA 1E9CA 1UBFA 5SZKB 5BSMA 2OUIA 4OCMB 1LUAA 4DR4O 3ES9A 1U6KA 4M0LA 4LY3A 4AJHA 1DC3A 3V1MA 1DCFA 1E9FA 2GD6A 4JJ7A 2ZAGA 3ZTTA 3VV3A 3FOZA 2PI4A 1Z15A 3HA2A 3LCRA 5SYNA 1EK6A 1U80A 4JKOA 4DIMA 3JWEA 3ZE7A 2K1EA 2YMPA 2O23A 4HV4A 5KI6A 3RODA 3H87A 3LHSA 1TM5E 1JQBA 4RMGA 3QMPA 2ZQYA 4W99A 1GNQA 2OG1A 4A2QA 3QLEA 1FZQA 3UJHA 2ZIWB 1XTZA 4OXXA 1Y8CA 3ZJYA 3AIOA 3ZNPA 5AM0A 1ZH0A 1CY0A 3QIVA 2XE4A 3ZNOA 4R2JA 4P0QB 3BE4A 3TCXB 1T3ZA 1RXCA 2YQ5A 1RPOA 1E20A 3LX5A 1RCUA 4EOGA 3RRYA 1JJFA 3MTIA 3GMIA 3KQUA 1ZTEA 1Z8NA 5CFRA 3WK7A 3WTBA 3CZCA 2L17A 1FRFS 1L5KA 5LLTA 3Q8KA 5KA6A 1Z5NA 2J7PD 4BFYA 3OJOA 2IZ5A 1LPNA 4HDNA 4HNRA 4NZOA 1G20A 1HBJA 2WU0A 1KMCA 1NLMA 2VR1A 1NVBA 2DFVA 1SBIA 2BFNA 1GPDG 1E6WA 4RGQA 5JRZA 2Y99A 3IGFA 2GZ2A 3WHLA 3HDVA 2W4MA 2P9GA 5G4KA 4S04A 4P58A 4I4LA 1BXRA 5KSYA 2ORYA 2FX2A 4XH9B 3QKRA 4OOFA 4ECAA 2P1ZA 1AF4A 4Q37A 3EMDA 3OEWA 5JXJA 3TXYA 5LP6A 1H9AA 5HZKA 2NAPA 3GZ4A 4WZ6A 2NU6A 1SPBS 5BMVA 4OFZA 1KMIZ 2P69A 4FM9A 1PTJA 2AHOA 3OQIA 5BQFA 1D2AA 3FHOA 4Q03A 3RC8A 3ZVKA 3WWZA 4RPIA 4NYMR 4Q4AA 1YB5A 5A9SB 1GM5A 4LQDA 3EZ2A 2E3CA 4ZYYA 4C0SA 2X23A 4CDGA 2MW2B 3AFGA 2C9DA 1Y3BE 2DWDC 3BG5A 5G1NA 4RYLA 3C3KA 4YRIA 1SBNE 1XQ6A 4W8HA 3H2GA 5K0SA 4GOMD 1ZU5A 3TSWA 4F6EA 5THXA 3ZI0A 4RMJA 5B55A 3M1AA 3NFRA 3X2QB 4FYHA 2V03A 4KWEA 1Q0UA 2W6JD 2VAPA 4GM1A 3DWIA 3UUFA 2AZ0A 2O2HA 5CDGA 3APOA 3E2MA 4GBGA 3RFFA 2UYGA 3K92A 1MNQA 3PHIA 2WZQA 4KXRA 3WMRA 4CE6A 4PLZA 1Y4MA 1PEDA 4IRUB 3WBFA 4R9UC 2AG8A 3U13A 3BFRA 1KSHA 2YN0A 4ZA2A 4PYKA 1GQOA 4LYAA 3T9BA 1WMDA 3JS5A 1CUYA 4QRIA 4AILC 4GWGA 3IIIA 3PG5A 4KMOA 3WB2A 4UUQA 4A6DA 4IJKA 3ZK8A 4QOHA 1T4CA 4Y1RA 1N2SA 1GNLA 1E2HA 3FKJA 4G0QA 3ZGXA 3VISA 3P0RA 4KQ6A 3KZNA 2Q4BA 4XDLA 2WPDG 5JECA 4DCPA 2H54A 2CH7B 3HLYA 4HOYA 3OUFA 1YR3A 2CHFA 2AIRA 2XF8A 5C7IO 2UYQA 4NCAA 2R9RB 2A5FA 3L7BA 2QYTA 1GV0A 2P2ZA 3SGLA 2ZETA 3CCLV 2IIPA 2G3YA 4UEWA 4IQ4A 4DR5O 5FBWB 4OXRA 3AKDA 1S1CA 4KQXA 2J9GA 2VHWA 2YJ5A 4CIDA 3H1LH 1PJBA 2E4UA 3UWKA 2JFNA 1NP3A 5FWYB 3FAVB 2DQKA 4Q24A 1C9DB 4HNVA 1FVFA 4RSHA 3A1UA 4JXJA 2WR8A 1RYBA 4DTIA 4EABA 2JCBA 1KGSA 5LNK1 1I5XA 4IXDA 2ET6A 4Z9XA 1IFXA 1VE3A 3GLFA 4YLYA 1GZ3A 1KI4A 3F47A 2IP4A 4JQYA 1ULTA 2X58A 1QBGA 5DBEX 3RBVA 1G4HA 4IYRA 3R7BA 1TUEB 2OB1A 4PV1B 2KX7A 5IFLA 2RGDA 4RAQA 3E9CA 3QV2A 5J40A 1WXEA 5T67A 3QYPA 2BMJA 3FSGA 1NJ5A 3DQPA 3Q4HA 4FHZA 1AE1A 5DHFA 4CIWA 3KETA 3MBIA 3HCWA 1A5TA 2LTAA 3QA3E 1ROPA 2ZJ3A 3OE7D 1N9ZA 1NBMG 4HMPA 3TRDA 1VCOA 1GR1A 3RK1A 4L22A 1XD2B 1NVXQ 5COAA 5F1OA 3ZY5A 3PFBA 1NSYA 3W8FA 1WLYA 2FZEA 4TM7A 4ZT4A 1DCKA 4GECA 4B7CA 5A2GA 2DUJA 3RVSA 5JNWA 1CNMA 4RHUA 3K9HA 2IUTA 3EAQA 2C4VA 3W9BA 5KWVA 3EN0A 3DB2A 1QWSA 3I5DA 1SC5B 2C88A 3VPBA 1CJVC 3FPFA 3S3TA 5HJEA 2QSUA 3S81A 1XREA 2JJ2D 4ENSA 2OZVA 2O8CA 4ESVA 2CD7A 4E0QA 4EITA 4MVJH 2WJVA 2ZBFA 3F1LA 2PIDA 4C03A 3WGZA 1HF3A 1VE1A 1DRKA 2QLBA 1BXKA 2PE5A 5AK0A 2GA8A 4ZT7A 3L3BA 2E1PA 4CG3A 2Q4PA 3W6PA 1K6IA 2C4TA 3ZJUA 3DC2A 4ESHA 2X5XA 3N2ZB 4PEVA 3PN1A 3AP1A 4GNKA 4N0MA 3H9EO 4ZQHA 1B6RA 2KQXA 4JI4O 1JEYA 1H1DA 1RHUA 4P3OA 1NDHA 2PSSA 3LYUA 3L0OA 4B6JA 1T5DX 2B98A 2J6BA 3T1HB 4O2AA 1R6DA 2W42A 1M7HA 1GZHB 4PPFA 4UHJA 5I9MA 3QK7A 1JJ2U 1E4EA 1MX5A 1UC8A 4MV8A 2LUOA 3SJZA 1V9CA 3AFIA 5FPPA 4AWXA 3W90A 5K0JA 1UWZA 1JQAA 3N2NA 1BA3A 4LIPD 1U4OA 4YONB 2J41A 3IB3A 1XPUA 1JVSA 4OCNA 3G49A 1DWQA 3A6DA 1ZNQO 2YKGA 2RN9A 4I46A 3A7DA 1VYVA 3IOMA 3NBKA 5TNXA 4OQZA 5L8VA 2GUWA 5TSDA 4BIOA 2EBOA 3SDBA 2QMOA 4Z2AA 3CYOA 3WGLA 3ZTWA 3KXIA 1MAHA 4GRAA 5KWIA 1JH8A 2E0IA 5F7JA 4GR4A 2C4HA 4ODIA 5DNUA 2VNAA 4LD2A 2XNDD 1A9PA 1YO6A 3NO4A 3DZ8A 2YZKA 4LHZA 1WW3A 3NQ41 1R0RE 1K7CA 1WEKA 3JARB 1RRKA 3UAYA 3P5SA 1W44A 1KRWA 2VYFA 2Q1WA 1OQAA 2JS3A 3SR4A 2QOEA 3A1CA 3I61A 1GQFA 5J9FA 1WNSA 1E8DA 2YJ3A 4BHTA 5TB5A 4LZWA 2Q1UA 5ER6A 3HV2A 3RAGA 3ZU5A 4BVKA 3MMZA 4G0MA 3QH4A 1PJAA 1E9EA 4KR2A 4RXTA 4G1BA 4CIYA 3P8ZA 4WNCA 4HZUA 5ALMA 2G5TA 4PF1A 4TS1A 1YBHA 3CISA 4LNHA 2G38A 1B04A 1E7YA 4QNRA 5ETJA 1PNOA 2WSMA 1DOHA 5H2FZ 1UJWB 1V5GA 4NTYA 3CXCU 4AJLA 4RULA 1IZZA 4OQXA 1IG3A 3EEOA 3NBAA 1HE5A 1Q1NA 1T29A 2FKNA 4BP3A 1V4VA 3KHTA 3H17A 1JDBB 1YU9A 1SUSA 2ZCUA 3DZJA 3DP7A 1EINA 1F6BA 1NY6A 4R9VA 3OPVA 5INTA 3PYMA 2W0SA 1E2GA 4IUDS 2EHJA 4UEKA 1MPXA 4MDEA 3C43A 3MCVA 3SPGA 3EGXB 4C6SA 3P0IA 3H8SA 2H29A 1AK2A 4DZRA 4X7BA 4B83A 1MAWA 5HOQA 2YOGA 2FMXA 3BICA 1VDZA 2C59A 3OY7A 3ANLA 5DSTA 2IZ1A 1PWHA 4II7A 4C5CA 1PZGA 2ST1A 3RASA 1XVVA 3CV3A 4EATA 2O3KA 4DKXA 3WBKA 2VK8A 3H2IA 2EJVA 1MFPA 2LP7A 1MD9A 3PGLA 1OR8A 1FRVA 1YQQA 1HDGO 1MO4A 2HF9A 4FWIB 3X0DA 1SESA 4LZLA 1T6ZA 1TJPB 4YV2A 3EIUA 4EB6B 5JSYA 4GG1A 4L0QA 3TZ6A 1QIGA 3LPLA 3PXUA 2TS1A 2XYRA 3UHOA 3VH4A 3FWNA 2GV9A 5IH7A 4B4WA 4GXNA 1CR4A 2XWSA 4LYHA 1RRMA 3A25A 5JATA 2DLDA 3NHBA 2VH1A 4LE2A 2LNDA 2GSDA 1NVAA 3ZZ1A 4RS4A 1EFPB 5AXAA 5CT4A 2P06A 3PVCA 3EXG1 1KP2A 3A9TA 3G9XA 1R8YA 3QFCA 2GVNA 4OGGA 2NSLA 3DUFA 3NNNA 4TLCA 2F1MA 2GPWA 4MEAA 4RA9B 2ZBQA 4DV5O 4ENQA 4R05A 4CL3A 3AF5A 4HRVA 1JQ3A 1PPJH 2ZULA 1JJOA 2EP7A 4CN8A 1FP4A 3DV2A 4BBZA 4PYLA 4IF6A 3C6YA 4GYJA 4BFLA 2NSJA 4DR4B 2O7PA 1GUYA 3A1WA 4NL4H 3BRWA 4RVSA 2GMWA 4Q5IA 3LSYA 4B1FA 4BMOB 2H06A 3WSTA 4UC0A 1RRGA