1OZ0A

Crystal structure of the homodimeric bifunctional transformylase and cyclohydrolase enzyme avian atic in complex with a multisubstrate adduct inhibitor beta-dadf.
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bifunctional purine biosynthesis protein PURH
publication title Structure of Avian AICAR Transformylase with a Multisubstrate Adduct Inhibitor beta-DADF Identifies the Folate Binding Site.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
total genus 201
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2003-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1oz0A01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1oz0A04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1oz0A03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1oz0A02
1ZCZA 4A1OA 2X8WA 1THZA 1JDBB 1OZ0A 1T36A 3ZZMA 1CS0A 1PL0A 1S8AA 2IU3A 1S89A 2YVQA 1M9NA 1M6VA 4EHIA 2IU0A 2XW6A 2B1IA 1PKXA 2B1GA 5H3LA 1G8MA 1BXRA 1EGHA 1CE8A 1B93A 1C30A 1A9XA 1P4RA 1KEEA 1C3OA 1WO8A 1VMDA 1IK4A
chains in the Genus database with same CATH superfamily
2IITA 1W85B 5EHGA 2VHEA 1E89A 3LUPA 4LF6O 5I51A 3QNUA 1KU9A 1HSZA 3RUHA 5B7PA 3RVRA 3OPYA 3SIRA 1FSGA 3RSLA 4YUWA 1PR4A 3KJNA 1JT2A 5A2QN 4PHGA 3QTCA 2Q6AA 3A4LA 2HHJA 1FNBA 5CJJA 3QJGA 4EI9A 1QFJA 4OXNA 2P4SA 2XRYA 2BE7A 1WXHA 4RJIA 2X15A 1U96A 4L4ZA 1VPVA 5AVXA 3FAZA 1JFRA 1FFGA 3PFNA 3FOBA 4K46A 4X65O 4NP6A 3ZDRA 3FOEC 3K9SA 1N6HA 2BLLA 4BNYA 1J5EO 4OQXA 3TRFA 1QO0D 1CJTC 3G67A 3B89A 2CDCA 1YUBA 2UVDA 5SICE 5IC4A 4MWTA 2GKGA 3IQHX 2E4ZA 1JJIA 2VLIA 3H83A 4F8YA 3DHNA 1WVGA 1CT9A 3EZGA 1Q7TA 4YPVA 4Q4JA 1FLVA 5FOTA 2FE4A 3L4BA 1UXOA 1US8A 3ISTA 3E15A 1U0OC 1T43A 3PUYA 3HUTA 4UHCA 4BO1A 4HAXA 1P2VA 1FFDA 3BCUA 3NDPA 3QVSA 3KYIB 3CZPA 4BNGA 2IH2A 3GX1A 3BHJA 1GCUA 3EWNA 1T4CA 1ZIPA 1G38A 3ILXA 4P0TA 3JAWA 4C7KA 1W30A 3IT0A 3PCRB 3R0QA 2R65A 3VQXA 4RSRA 1T1RA 5FA6A 5AHWA 2CVZA 4GC5A 4KVFA 1GUZA 2BKEA 4V0OA 3BA1A 5ARBA 5DV9A 5E4FA 2IM9A 1N0NA 1UKVY 3OX3A 4PQEA 4CTJA 3BXHA 2AS0A 1AI4A 1R9GA 3GZTB 1K73W 1L1FA 1GPJA 2R7LA 2I9PA 3NI2A 3AB3A 1B8VA 3RWBA 4XLLA 5BORA 2HOQA 4PSCA 3EY4A 3B3JA 4S1OA 2ONJA 2NX8A 4JGIA 5EAIA 2IBMA 5REQA 2P3OA 4F5DA 1HDXA 1BD4A 3KELA 1XTUA 2GH1A 5D8DA 3TW8A 1TZKA 1KY4A 1KI6B 1J0CA 2WJ3A 3K9CA 3DMYA 4D46A 2TS1A 2JLVA 4QTXA 2A9JA 1U2QA 1W29A 3C6KA 5AJTA 2VTEA 4UVEA 2QGZA 2J7PD 1ZSYA 3JARB 2QYSA 3PUZA 3D3KA 4YY3B 2A7WA 1W34A 4MGZR 1PBTA 5DDIP 3LRXA 4RPJA 4U3FH 4RTSA 4OQFA 1BROA 4IZHA 4Q6GA 5ERGB 5JD4A 2FN9A 1XAIA 4EW3A 4WT7A 2FJUA 4DTIA 3LBHA 3EOAI 2QPAA 3B6ZA 1WETA 3ZEIA 2VZLA 4BGUA 2FSFA 3G4SV 5DFAA 4FM9A 2J30A 1XBLA 4U7GA 5K0TA 1IXRC 3UW1A 3LDHA 1ZO8A 1G6OA 1OH5A 1KARA 2F4VB 2XT0A 3Q8LA 1J06A 5B1BC 4D8YA 1OFUX 1OI7A 2CLCX 3ANNA 2FLWA 4P32A 3OAAA 5DGIA 4L22A 5J2UB 4PCLA 1Y8RA 2PKCA 5BQFA 1GITA 1CKEA 4GKKO 1YL7A 4ZMSA 2IKQA 3IEIA 2JBWA 1N4DA 2UZ4A 4B6QA 4CW7A 3QVOA 3RU3A 2P2SA 3KVOA 3OHMA 3W2IA 4F3KA 3RTAA 1XOUA 2IPLA 4ZEOA 3BY6A 5JFOA 5H68A 2LDBA 1OT5A 2WNIA 5DNUA 1BS9A 1LNZA 4CXMA 3OEYA 2W6JA 3KQWA 1ZXLA 3KE8A 4KXMA 3OCJA 2CTRA 3SHOA 2QTLA 1JGTA 2EZ8A 3R7BA 4RO2A 4U00A 1XUQA 2ZQMA 1KDTA 1LTKA 2LCIA 4XWYA 3KJFA 3PDWA 4GRAA 5LP6F 1QC5A 2I6GA 4IX9A 1SR8A 1J22A 2HHAA 4EG5A 3ROZA 3DBRA 5EZYF 1YHQV 3WWPA 3BABA 4V2IA 1N8NA 4BCBA 3TLEA 2GJ9A 3ZRWA 4PX9A 5AIBA 3WS7A 5COQA 1FP4A 1N32O 1D5WA 3WWDA 1SUIA 2Q8NA 3F5FA 5I7EA 2P65A 4FFSA 4MS4A 4B7UA 1ADFA 2RHTA 3CUUA 1K6JA 2XTJA 1Z9BA 2ZJFA 4PA7A 3OWOA 2V6GA 3WKEA 3TLCA 4FS8A 1CJVC 1HYEA 2GHQA 3ANYB 4O8ZA 2X14A 1XYYA 4DJJA 1EAYA 1KQFA 2X13A 1Q0TA 3OQBA 4RE5A 4DVJA 4DRXB 5FCDA 1SKYB 4ND4A 2VL7A 1U9YA 5LNK1 4XLTA 4ACBA 2QL7A 1IXBA 1RZ3A 4MHOA 4R0VA 1JXMA 1UXJA 3JAMN 4X63A 5JNLA 4NV3A 2HKOA 3FDZB 4W9NA 4UB6Z 1JSLA 3S2FA 3ESRA 4PPYA 2J9ZB 3PFFA 3KQOA 3S55A 3M9XA 3AQ4A 4BNXA 3CC2V 1WBJB 4REQB 3KQVA 1GD1O 5BSFA 2JCVA 1NH2B 4KIUA 4EIWA 1E2QA 3A11A 2XQVA 4D6TH 2X76A 4N3GA 2C8VA 3AG4C 1NVGA 3U5TA 1WY5A 5EIWA 5CA1F 4YMVA 5HUJA 4CMJA 1XC7A 2F8TA 3M33A 5BN3A 4NWIA 5CH3A 2O8DB 4CQMD 4EUNA 4O2BF 4FVTA 4PZYA 5LXTF 2LVBA 5AI5A 2XE7A 3GRKA 5H6QA 4HDMB 1CR4A 4MP6A 2V0NA 1H23A 4Z0PA 2BGJA 3VPSA 3LUTB 3KU4A 4N5LA 2AHRA 2QXUA 3TSCA 4PPQA 2GRUA 2ZYSA 2JH3A 2YY7A 2O19A 1MRNA 2GHYA 2H1VA 4ZU6X 3PEVA 1J56A 3FBTA 3RBAA 1MOSA 4ZK2A 3RRJA 4YDRA 5K1ZA 2HHCA 5EJ6A 1E1QA 2JJ1G 2BZGA 1RSZA 1XELA 3CO0S 4UVIA 2CT8A 1C9NA 4M1YA 3DZGA 1H0KA 3UZUA 2C61A 2GM9A 3RH0A 4HI0E 3N39C 4D9KA 3K1AA 4RM2A 5HG0A 5EWLB 3UKJA 3UKOA 4R7ZA 4GF5A 3DXRB 1W4AA 2AR9A 5GM1A 3JQFC 3T7JA 4MJ3A 4HYEA 1QMGA 2GCPA 3P9XA 3WWCA 1WP4A 1I13A 1BE0A 4ARVA 3IQEA 3RUFA 3CB4A 5TMDA 2OKGA 2ZUSA 4OATA 4CEJA 4JJ6A 3AG3C 4HWPA 3D8BA 2IELA 5L3VA 3NWBA 3GLIA 2ZSAA 4ZHQF 2XUFA 1R0SA 4NU0A 1EZ1A 3PC7A 3OX2A 2IU4A 4DMUB 3KQSA 3ZQ4A 1URFA 4PHFA 3K2QA 2EX0A 3ZGNA 4QE7A 4N03A 5HM8A 4DYDA 1UK8A 1W4CA 2H2AA 3OFND 3WVNA 3WDLA 4X66O 2DYSB 3CH7A 3EVTA 5DM0A 5HX7A 3QELB 3UJ8A 5ABPA 4AS1A 3R8XA 3LT1A 5DHTA 1JSCA 1ZJZA 3SDSA 1ZI9A 3X2FA 4E94A 4CIBA 3RVYA 2JA1A 1NUSA 3K6SA 4CT4B 4BECA 1I2ZA 1GU0A 3Q5GA 4YRSA 1XHLA 3NGLA 5FAKA 2D1SA 1P61B 5A4IS 2AZDA 4DIFA 2JJ2G 1YFKA 1H0RA 4FLYA 3GA7A 1C3OA 5LNK6 1AGNA 3SC6A 3S3WA 2FLVA 4PTLA 3W3AA 3I05A 2AG1A 2G5CA 1T9GS 3JR7A 3KWFA 3MT9A 1GGHA 3NT2A 4C3OB 5B1AB 2NTJA 5AVYA 4R1UA 4XVHA 3TB4A 4X64B 3Q72A 3PDUA 1BZYA 1QDEA 1OZ0A 1HC7A 3MTQA 2W6QA 5B1DA 4JKYA 4RVSA 2AOTB 4A5OA 4KQJA 2QWOB 2REQA 4I9FA 2FSVA 2R68A 3L9XA 3F8WA 3OU6A 2HZBA 4D02A 3PXXA 4A5UB 1ZCAA 5ADWA 2QB5A 2ZNRA 3AIOA 5FR2A 1LZLA 4PINA 3V4LA 1GGFA 3TRHA 1NXPA 2Q2OA 3RB8A 4B43A 2MSLA 2NOAA 2VA8A 1JIKA 2A0WA 2PDAA 4EKGA 3D3EA 5BWNA 2B4RO 1QRSA 3PRYA 4GM0A 2K6GA 4KE6A 2ZETA 4F3WA 1K68A 3GFTA 1YRWA 3JQAD 3HH8A 4RJJA 4DARA 3OUSA 4JF3A 1DWQA 4A2QA 2Z5LA 5B6IA 4JOQA 4DXDA 1RHMA 2OWEA 2RC6A 3P26A 1QVAA 2OESA 3M70A 4FEYA 2E4AA 5LP6B 5J4VA 5ALOA 3N27A 4LJAA 4U63A 2G5TA 1P4AA 4HEHA 5EZYB 2ADOA 1DKOA 3A6HA 3T4UA 1P5RA 4MWBA 2B2XA 2PMDA 4WGFA 2BGIA 2RAVA 1T2FA 3KZIZ 1T15A 2EGGA 5DBEX 4F6RB 1OREA 3G89A 3HVRA 1LTHR 4UM5A 3GUUA 4BU0A 4V0MA 4RPIA 3DLHA 1E63A 1HOXA 1VSVA 4XDKA 1SN7A 1X8JA 2BFEA 1C30B 3TFWA 3K5NA 2WKQA 2B7LA 3IL2A 4M0PA 5IK2D 4IHQA 1WZCA 5BR7A 4AMYA 3HA3A 2XCUA 4G5XA 1FX0B 1FF9A 3HJAA 2O5EA 3D2BA 2J46A 3HBJA 1FS0G 5B53A 3KK0A 3KOOA 4JL8A 2XNJA 2C8LA 4BNIA 4K8RB 4RM3A 4AZ0B 4CH6A 5JQGA 4TS3A 1IZ3A 1Y1RA 2FWNA 1MDBA 2VT6A 1YASA 2BJVA 2FCRA 5BNIA 2YH2A 3ZV6A 1YKFA 2OHGA 3KRTA 2QUAA 4JVNA 1DQNA 2YZNA 5KUKA 1KMQA 2JGNA 2VH1A 1V25A 3MBOA 3NP7A 1QGDA 2JW5A 3PT9A 2VJBA 2I34A 5IC6A 1IHDA 2DB3A 1G5HA 4CMEC 1EK2A 3PENA 1BO6A 4PC2A 4GOND 4ILEA 1BCSA 3SIWA 4W9MC 3GO4A 5CA1B 2DFTA 1ZJYA 1LPBB 4JELA 2ZCEA 4INZA 3PX3A 4AK9A 4O2BB 1ILWA 3FGZA 3LBNA 3ZRVA 5LXTB 1P8AA 5ALKA 2I87A 2OK8A 3T6KA 1Z8FA 4LDQA 3MHHC 3IA7A 2M6SA 4N8SA 4QNNA 4YAWA 2FJPA 3ZZUA 4P22A 1RBMA 3BJEA 3THSA 3DMNA 3LX8A 2DFNA 4WFQA 2NO1A 1YD7A 3O8BA 1HG0A 4MUMA 2EZPA 4EMSA 3KT8A 5LFAA 4OEHA 4BJ3A 4EO4A 4OHFA 3EFFK 5KQPA 4YQYA 1WDTA 4ZEVA 2XGSA 4D3SA 2IC5A 1PWXA 3KZXA 2J0EA 1A72A 4A15A 2NADA 3PXUA 1PEDA 3TAUA 1WLSA 5H81A 1JEOA 1MIOB 2VHYA 2JB9A 1NAHA 1MAVA 2BI7A 1ZFNA 3FCXA 1H8EA 1L4KA 1CVIA 1RWQA 1JBQA 3FRJA 2OYCA 2ZYIA 2UKDA 3HJRA 1JDZA 3GJRA 3MUNA 2GM4A 2OO5A 4JT8A 4PW0A 3FTNA 5T3UA 3MIZA 1QANA 4TROA 2ISCA 3AJ9A 4G4SO 1FYDA 4OFWA 1H4VB 3PIRA 3VZBA 4ZHQB 2HW8A 2QENA 4XQGA 4MICA 3B8EA 2J3JA 2ZJBA 5DEIA 5EUCA 4J49A 2IXBA 2PRZA 2WSSD 3G9XA 2AG6A 4M46A 1OXMA 2JGMA 3A6FA 3CUWA 2RKOA 2WG2A 2Q7HA 4RJLA 3T06B 3A7DA 2B92A 5DT2A 2RI1A 5EIOA 5CT8A 3QEAZ 3PTAA 4OX9B 3QVWA 3EG9A 3MCUA 2BKUA 5JRDS 3L8GA 3W1EA 2QS9A 4TYPA 4ZO8A 2YVAA 2GCGA 1CJKC 2ZYGA 2FPPA 3UV6A 1VGQA 2QWXA 2OIEA 1F48A 3JASA 4EMTA 1KRXA 2XSZA 2QRLA 5CG1A 1CEXA 1X38A 4AJKA 4YJHB 3VHQA 2AR0A 1Z2GA 2JLRA 3NH9A 2BGGA 1V39A 3AUYA 2DTXA 2HA0A 1P2DA 4YP6A 3RKSA 4ZZ2A 4LN1A 4F9FA 5G02A 3U3DA 4GIBA 2AFIA 2X2FA 2CJYA 4NV0A 3N2KA 2APJA 3KJQA 4U2EA 2BSXA 5FPQA 3TVDA 3U7JA 2I1QA 1FIUA 1UC8A 1TPYA 4CJXA 1DTOA 1TEXA 3OH8A 4R98A 3F6BX 4EUKA 4KR3A 2PI5A 3HJGA 1H65A 3OSZA 1OX4A 3IKTA 3EDOA 5FT9A 1DQPA 1JQBA 1NQOA 1GQOA 4D10F 3VYRB 3L0IB 3HMQA 3W5SA 4WN9B 4DCJA 3MJTA 4EL5A 5J2TA 3LVFO 3U9TA 1VL0A 4IQ0A 4S0XA 5FQOA 1PJCA 1CUBA 1U7PA 3QE2A 1GNPA 2PLRA 4X93A 3M5PA 1KEZA 1DC6A 2R751 4Q39A 2D7DA 2ZRNA 1IX9A 4A5SA 1Q1NA 1G5IA 2FP4A 1GZDA 4EEZA 4JASA 1NUTA 2YUTA 3KT0A 5IN4A 1T8PA 3AL0C 3E8GA 1N2HA 5T8KA 2B0CA 3C7CB 3ZGOA 4OPHA 2RE8A 1GFWA 1Q77A 1TIKA 3D4BA 3R09A 4JSTA 2LGJA 2HNBA 4J0DA 1ENVA 1CUGA 4Y6OA 1YR7A 2YFQA 3VU9B 5C34B 3IV9A 4NTYA 4D3DA 2VZ9A 2EIMC 1TU4A 1FNCA 3WLQA 2JLZA 5FYQA 2PH3A 1C3JA 4O63O 1T8SA 3KG2A 4F9GA 3RSZA 3UHPA 3M82A 1Y4SA 3ND9A 2F1HA 2GDJA 3LK6A 2OBFA 1KMCA 1RVV1 1L3CA 1A3CA 5DLYA 3EQ6A 3GOQA 3MCTA 4CH4A 5HTOA 1EFLA 3UJNA 5EC2C 1KFKB 3RRXA 4Y9TA 1UT5A 2PX3A 4ZFTA 1OU4A 3ET5A 4MOWA 3EZLA 3AONB 2DUNA 1K06A 1XL1A 3KTDA 3EUFA 2WDZA 3GI1A 4C3ZA 2EFCB 2C2MA 1CUHA 1TM2A 5EJ5A 5JI2E 1WZUA 4G4SP 2C88A 5FRDA 1Q43A 1A9PA 1A76A 2YZ7A 3I0MA 4DXHA 3WL5A 2YW2A 4WCDA 4AJHA 1HW7A 3KEQA 3K3PA 4JZYA 2GPBA 4HN2A 3APQA 1G6HA 2GZHA 4KAJA 1J00A 2Q5QA 2WKSA 5AW0A 1CV2A 5CPBA 1I5YA 4ZQCB 3R4VA 3L73H 1XK6A 2HA3A 5I47A 1JLRA 1P81A 5FUBA 4PAWA 4UDOA 5KYXA 3NDIA 1DLJA 3BG5A 1YO6A 3U61B 1JAZA 3O26A 4GT1A 2POQX 4PGHA 2D3OW 3P8ZA 4HXFB 2JARA 1TVKA 1L3BA 1SXPA 2HK6A 1N5DA 1R0ZA 1TB4A 1ZIYA 1I1NA 1DCTA 5EBWC 4S04A 3D7MA 3OIYA 3C3MA 1HI9A 3TUJC 2JFVA 1GA4A 2P9GA 3HCPA 3FKSA 1OA1A 3A37A 5KKAA 3SBOA 3SFZA 2I4IA 2WLMA 4U2DA 4HQ6A 5K2OA 5CG2A 1Z6QA 3OZFA 1UPBA 1YR8A 3I42A 4Z51A 1KH3A 5T4EA 4BIIA 2ZM6B 2G0NA 1JVBA 1KEEA 4GYCB 3IE1A 2WUGA 1YNOA 4II3A 2I2WA 1ZA1A 2C78A 2NM0A 2SKDA 2WHEA 2ZB3A 4G0NA 1CW2B 4AXBA 4YFYA 5DOZA 2Q45A 2RIPA 2AT1A 2AD1A 1V7ZA 4IVQA 1E3JA 4LC5A 4P93A 4AUKA 6ABPA 1NMZA 1QTIA 3MT7A 3KKNA 1NT2A 2I9KA 3HR8A 4XB1A 1XZEA 1XV5A 1NW4A 1V1JA 2B5VA 5LQAA 4JLAA 1S89A 2WVGA 2NP7A 2NZUG 3EC1A 3G2MA 3E5NA 3OOJA 2IS4A 3UAOA 4IXWA 4CKWB 4QTYA 1S5LZ 1UMBB 1QZXA 1U9JA 1X2EA 1SC6A 2ZBFA 1X9HA 3NDRA 4PAMA 5A3QA 4AG6A 4M9CA 3OZVA 4MINA 2AUMA 4RPGA 4UTVA 3CT6A 3KKQA 5DRYA 1ZRMA 3WYFA 3H2GA 3VO8A 4FIPC 2IJHA 4KPYA 2RSLA 2C97A 3EFHA 3CLVA 1XTVA 3L6OO 3T54A 2O3RA 1T2CA 3NAQA 2ZPTX 2QZZA 1X13A 2Q5OA 2VK1A 5B64A 4JMLA 3CLTC 4YREA 2EJBA 2XBLA 5DEOA 2JFYA 1FUKA 5EXSA 5KYUA 1VB3A 1JUDA 5G40A 3BAAA 1OPXA 1UX0A 3HZHA 2NO0A 4QPJA 2QRHA 2XMQA 1KJJA 2JDIG 1HGXA 4WBSA 5HCIA 4DG8A 2PUDA 5TEWA 2NT3A 2B1GA 2QM3A 4O2AA 4KITB 4I0WB 1ZI6A 4OHZA 4HDKB 5GIOE 2WQ6A 2GEBA 1FQWA 3MTBA 3AF6A 4UBOA 2Q4RA 5HBGA 3GUZA 2Q0HA 1YB6A 4AZSA 2AHOA 4TMFA 2JKYA 5DYWA 1V7QA 3SJZA 1V1RB 4TL6A 2VPQA 3T34A 1Z26A 3BWEA 4DV4O 4NQZA 3GNQA 1HE8B 3FIJA 1GPMA 3A70A 4CM8B 1EXWA 4JLJA 3BE8A 4ZBMA 1E99A 3WLSA 1U5BB 3OLWA 2ZFUA 2Y0CA 1M56C 4X9QA 3E9RA 1CJSA 2M6KA 1TT5B 2H29A 1UFQA 2VRWA 4O3FA 4BB6A 3E1UA 3GLIE 3SPGA 3CCRV 3IXMA 4FFVA 1DTWB 2H1IA 3JRNA 4YCCA 1VE9A 2J67A 2OAP1 3DFKA 4LY9A 1A1SA 4GXRA 1M54A 3PITA 1KGDA 3DFFA 2B3JA 1ND5A 2FKAA 1THTA 3LS2A 1XNQB 5H7XA 3ZKWB 3FDXA 3I56V 2QSAA 2P2ZA 2MR6A 4K9QA 3GW8A 1PJBA 4OO3A 3STLC 3ZQUA 1RE1A 3DV2A 2AWNA 1NH2D 1U94A 4Q3LA 4WCFB 4AP6A 3VPFA 4EGJA 2IHJA 2UYQA 1VKZA 2OP1A 1Z6XA 1NQXA 5E95A 2EZUA 4LXYA 2X2PA 4RPLA 4DB2A 1OIVA 3LHKA 3CH5A 1VMAA 3CLUD 2PYDA 3FR8A 2RH9B 1GPLA 3K9HA 3AEXA 1KKUA 5I6DA 2ZDQA 5KYYB 4YV2A 1U9IA 5CTJA 3ZY3A 4DV6O 4GMFA 3UTDA 3I4LA 2AG5A 4QJIA 2EZ4A 3LDDA 2VT2A 4BATA 4HNTA 1B04A 1GDTA 1K2VN 2VPYA 3EVZA 3QFFA 3ME5A 1JH9A 3FE2A 3PXCX 2XQGA 4DR2B 3KU1A 2H51A 3ULKA 4G5GA 5F1OA 3HP7A 2G6VA 5SY4A 3G80A 5BN4B 5KZMB 4WA7A 5FTJA 3ND7A 4OWPB 5BVGB 1NURA 1T1GA 3QU4A 4YXWA 2KQUA 1FXVA 4OLFA 4J9VA 3WNZA 5K3OA 4GR9A 4ZMBA 4TWJA 1QRUA 2JS7A 2X4DA 2PY6A 4DCTA 4ZV7A 2HA7A 3VPCA 3KT6A 3H5TA 1KSHA 4W5QA 1C7ZA 3K0SA 3NC1C 3EVNA 4O2RA 1JQLB 1S2NA 3UH1A 3FNEA 1J5PA 1SUSA 3QPWA 1JFLA 3Q4GA 1C1YA 1F3LA 2Q3CA 3Q6IA 3GRCA 1FFCA 1SUEA 3TZBA 3EXEB 4XIJA 1XZFA 1UBUS 2CJWB 3SX2A 2N74A 1X42A 2XNDD 4HQ0A 4LFAB 1UKAA 4NENB 2CHEA 3D8RA 4HRQA 1P3JA 3MAGA 1ZL8A 1Q1QA 3VZSA 2I3AA 3U1VA 1EX7A 3E61A 3T0FA 4JUFA 4DQUA 5EINA 1IQUA 5AVRA 3T7KA 4DF3A 3IKMB 4KQMA 5ES4B 1TM3E 3H9GA 5JDCA 2NV0A 1TC1A 4U9IS 5FX2A 4UHKA 4MDYA 1ZP6A 4MW2A 1L7BA 4IINA 2LD4A 3V3KA 4HEJA 2A9OA 1L8QA 4V0ME 4F0JA 3L6EA 1KWGA 2NN3C 4BDTA 1XAHA 4DNOA 5TB5A 1DEXA 1V3VA 1E3IA 4L5CA 2Z2JA 3QEKA 4P9NA 5C81A 5IYBO 4QSMA 4FYWA 1IXZA 3DNPA 2OFWA 3MJEA 2BRUA 3C8DA 2VP9A 2V1XA 3CRAA 1U0RA 1BTOA 4K0KB 5FV4A 3QVJA 4J43A 1PFUA 1FCJA 3DMRA 2FEKA 4W6ZA 4XJSA 2YV2A 1YDGA 4L51A 4Y6SA 4OQPA 2G63A 4PAQA 2IK8A 3ZGLA 3A6EA 2RGRA 3KE9A 1VC2A 2YMLA 4LVUA 3SCZA 4F9TA 2YSUB 1K1EA 4WXEA 3KZ1E 4XEUA 4UXIA 4L72A 1QIMA 1P8JA 4FMCF 3KKZA 4LHXA 3WNVA 1WB5A 4HC4A 4RANA 2GF9A 2GTIA 2GAJA 3V7FA 2AX4A 2AMVA 3QKSA 2RHMA 1GN6A 4LF5O 1R66A 2WB4A 3FYSA 3LUDA 5ITSA 2G3YA 4HS4A 2R8PA 2VPIA 1XD2B 4JB8A 2Q3LA 4IGGA 1W1IA 1DX9A 5J4HA 4HH3C 4KP7A 1SA0A 3EMKA 4EX7A 4TT3D 3BXXA 5IHXA 1G41A 1EXVA 3NKLA 2VT7A 2YWCA 4N3AA 2VDKB 3D7KA 1P77A 2BUAA 2V7XA 4EFEA 1KU6A 2JFFA 1I4OA 4O8XB 2P2LA 4BB9A 3QKUA 3LM8A 2D5CA 3OU7A 3LRTA 3LYLA 1Z8DA 1Y5IA 3I5AA 3K9WA 1SBQA 3JVVA 1GV1A 2HNAA 4I08A 5K6AC 4YN3A 4IH1A 3A1NA 3FOFC 1W46A 4WIFA 2BJWA 4MMZB 4CKEA 3IH5A 2B1JA 4PS1A 2VJOA 1RHUA 3WKDA 5LLDA 4EUSA 2CMKA 2CUNA 3MYRA 1N6LA 1PZGA 3QNMA 3K53A 4I4IA 2J1LA 3GJXC 2GK4A 4ERNA 2HMAA 4EFMA 4KPUA 3OPXA 4RTJA 4I1VA 3W7UA 3ADKA 1BNCA 3RW9A 2PLNA 1D2RA 4DWJA 4V38A 3UT6A 1I2AA 3QXJA 3PD0A 4AWXA 5HF9A 1CBUA 3D4NA 3K06A 2PUFA 1Z08A 4XZ3A 4PA3A 3ENVA 3NJ8A 4E7PA 3JALA 5IBPA 3OMIB 2UXCB 3B9BA 1CQZA 1C7QA 2ERXA 2RARA 4PGMA 1COWG 5JVDF 4ZOCA 3RTBA 1NYRA 1U0LA 4AMGA 1W5BA 2BIFA 1IBCA 3SF8B 4KQWA 1PUIA 4X71A 3LP5A 4GLOA 4V24A 2Y1FA 4RUKA 3ZHXA 1R0WA 2Z5FA 3CGWA 1HEUA 2R2AA 1P5FA 3GP8A 2B0JA 2DFDA 3GGPA 2H85A 2HSWA 4WKBA 1QKKA 1JQEA 3M5WA 5L3CA 3C8MA 4MMYB 4QXQA 3HY4A 4PLFA 1RKXA 5D00A 3V7YA 2X1VA 3EZ9A 1FRNA 1V1MA 2JVDA 1ZS9A 4IG4A 5KAPA 3DWIA 5JTTA 5E1MA 2PZEA 3HKBB 3Q2IA 3SPHA 1RWNA 1YZNA 3I01A 1IN4A 1DVRA 2YIMA 2JD1A 4CG1A 1H6AA 4RACA 2FH5B 3AP2A 5CX1A 3SS7X 2DP4E 1YKSA 1FXSA 5FOSA 1A5AB 2OG2A 3WISA 4UBLA 1J49A 1YBVA 2PZSA 1JIXA 4MVJP 1D2MA 1KF0A 1WMBA 2BM0A 2DMXA 2Z2YA 3WQRA 3TR0A 4EJ6A 1DCKA 1K7SN 3UK7A 3WZ2A 1TD1A 1M10A 1BMTA 4CKXA 5FWDA 4LS3A 1UL1X 3ZTYA 1URPA 1O7JA 2JCSA 3NETA 5HYVA 3RUIA 1LK5A 1KP9A 3EFBA 4D1YA 1AF4A 1JR3D 2R7MA 1P44A 3ABLB 1DUIA 3K92A 1O5TA 1NXWA 2GN0A 4GMKA 5B6JA 3H6HA 2BTOA 5JHGB 3D54D 4IOMA 4CRWB 1Z88A 2Q0AA 3AYZB 2YS7A 1H93A 2IOHA 3B1FA 3DM9B 4DKXA 5E1BA 2XMBA 3QLEA 4IQ4A 4ECAA 2R1ZA 3L02A 1RLUA 3C3TA 5LGNA 2ZXWB 4W8GA 3V4FA 4HLDA 2Y0PA 2JBAB 3MPZA 1BHO1 3ZGZA 4TMTA 4BBJA 4LDZA 5CVDA 3APOA 4R6XA 1KVSA 4IHJF 5CFMA 3SC2B 2B3DA 5AKKA 3WGLA 3RFVA 3HJTA 3RIYA 1LS6A 1ROPA 3MFQA 1WLEA 3JPYA 3W90A 1WCIA 2XB6A 5G4KA 2YJZA 3K9LA 4YJFB 4LYDA 2O0HA 1SUAA 2F6RA 2QPLA 3O21A 3V2HA 5AVSA 2B82A 3CLRC 3L04A 4RZHA 2PMEA 3J80A 2BC9A 1S0VA 4GPIB 3I5UA 5M7EA 1E5TA 2GLTA 2D0IA 1ZUIA 3O83A 2G08A 2WV9A 3ZE2B 4EUFA 3IHWA 3BH7A 3WGVA 2XXBA 3CUEF 1GXSA 3DOUA 2YR0A 4D4GA 3QHPA 5J47A 1E1LA 3TN7A 3CXUA 4B6PA 1F17A 4TMWA 2Z3VA 4F3TA 3DB1A 3FCEA 3EY9A 2QJFA 5L3BA 1UKEA 4IIVA 5GY7A 3CNLA 3FVWA 3CRMA 2H1CA 2LKDA 1QPZA 1YS2X 3ZD7A 4YRNA 1S8FA 1JYEA 1X7WB 1RJ9B 3JD0A 5CVJA 2AW9A 1Q3TA 3BERA 3QHQA 4KLAA 3AW8A 4EUHA 4FMCB 3IAXA 2E5LB 1CUIA 3OIDA 4OAQA 3IT1A 3FYUC 2VP5A 4JIMA 2VNJA 4MR8B 1E5VA 5DCLA 2IYFA 2DHQA 3NC4A 4ZAVA 1NF9A 4A82A 3PZBA 4NK4A 4DSUA 4CLRA 2OOKA 3Q11A 2ANBA 1QBZA 1M2VA 4QYMA 5ERYA 3FVQA 3FM9A 3K04A 5L9AA 4IHAA 3U26A 2XUAA 4HXYA 4AJEA 1KI1A 1PZXA 2BBOA 4O02B 2MSKA 5CDTA 2B99A 1IZZA 5ED0A 4LH7A 3SR2C 2RMKB 1RD4A 3I9V6 4KNYA 3RS2A 1LC3A 1TZ2A 5MHTA 1O6ZA 4H1HA 1Y5LA 1VE7A 3HQ4O 3QFSA 2DQKA 4I3FA 5THXA 3OCYA 1XFAA 1U3CA 1V5EA 3B6EA 2W6JG 1II8B 4ZVSA 1G17A 3ZWOA 3AF4A 5HQJA 3X2SA 5CA0A 3RODA 2PL9A 4TKMA 5B1NA 2QMOA 2GETA 1WVMA 4C2BA 4D7AA 2Q0SA 2I6SA 2V98A 2HHLA 1SVSA 1BE8A 1E7SA 5CLFA 3C6MA 2ZDHA 3CMCO 2ISQA 5EXDA 2XUDA 1MOPA 3EZXA 4YHHB 2WLIB 3KJZA 5IVDA 2F4NA 2NR5A 1F7YA 5B37A 2HO4A 3DV0B 4P34A 4X5OA 3M1IA 3T3HA 2AC2A 1PQPA 2OCCB 1ICIA 4M86A 3DTVA 1KUQA 3NX4A 3ETQA 2PS0A 1T9HA 3HUEA 4BAYA 1P7GA 1EVLA 4LYYA 2B8JA 4EVRA 4LOHA 2FW1A 2HA4A 2DBQA 4QRDA 4IW3B 3QLUA 3X1MA 1F8UA 1DC5A 2F64A 3DZJA 1NVEA 1S4QA 2OIGA 2EP5A 4F7DA 2Q2NA 4O4LB 5JVDB 1NXTA 1RACA 4QPKA 1X7XA 2IUEA 5BW6B 3ZZ1A 1FDVA 4KRXA 4CBVA 1PVVA 4LA4A 3COZA 2XVYA 4LWOA 3GLFB 1MX9A 1AB6A 2ZB4A 2YV5A 1KMMA 1XALA 1VFPA 4N40A 2ZXFA 1YE3A 1XLWA 4CR6A 3LWNA 1FJXA 1IBKO 1VQ1A 3AH8A 1YJAA 5FBKA 2J9GA 2RH4A 4TWZA 4BO8A 4ZVMA 4NFLA 5IBCA 2YKGA 5ER9A 4RK4A 4D82A 1E2IA 3GCDA 1S96A 4C0LA 4OGWA 4C6TB 3WLOA 1LBTA 1CEQA 4QICA 3PNLA 3WL4A 4MWSA 4S05A 1K33A 5CVVA 1OCOC 4QVGA 3WQQA 2NWQA 3C8UA 2MYPA 1DWOA 3L18A 4JV5O 4M99A 4GLFA 1EM1A 2OSVA 5K03A 5FL7A 3CX3A 1SELA 3MSCA 2VO1A 4AYWA 5ILGA 1H1DA 1XZKA 2XEXA 5K45A 1OFGA 3BCRA 3PHIA 2CUZA 2OENG 3L93A 4QATA 2BMVA 1YA4A 5JNRA 4KKXB 4FOSA 1WLYA 4LP8A 1GEEA 3VR4H 1Y7IA 2PL3A 4PPNA 2WD8A 2NVOA 4YAFA 4DLTA 4C07A 5CDYA 4JQCA 3KWJA 4MJ7A 5AUQA 1X7HA 4DV1O 5CJPA 2BJHA 2QLNA 5AKXA 3GIWA 1BFUA 4DOMA 1HLDA 3AJAA 3HYRA 2XCQA 1EE2A 1WCWA 4B5KA 5IASA 2ZR9A 4JUDX 2X0FA 4C5BA 4V02A 1TO6A 4PZDA 1OBCA 2VJMA 3P27A 1P4SA 1SMKA 2G1KA 3QVGA 2WJGA 3EGXB 3AUTA 1KTVA 1AROP 5ICCA 1JFFA 3CE6A 1XVLA 5A5VA 5DGDA 4BQPA 3BTSA 4IHJB 4PZEA 3SPIA 4RPCA 3H11A 3ZHYA 3DE0X 3CCQV 4DO2A 4NF2A 4Y0NA 2W98A 4EPWA 1KC1A 1XPUA 3AFMA 2R7KA 1VJRA 2EGUA 2VHCA 1QYXA 2CHGA 1Z4JA 2DFLA 3A9TA 5IDYA 5GADl 1XF1A 1B7GO 3ER8A 2JZNA 1SUFA 4GKAA 3WK9A 5LBQA 1HNXO 4JFAA 1MB3A 1BMFA 1BYUA 1CQWA 4EG6A 2B25A 5ITVA 5I9LA 1K75A 2ZAOA 4C76A 1JDUA 3B4SA 4ED9A 4PYKA 1SQ6A 3K2BA 1U2ZA 4GBMA 3C5VA 1MP0A 2WP8J 5JE8A 4HGQA 4J1TA 1NONA 4NCBA 1SKUA 1DXOA 2H1LA 1JPJA 1KOGA 4DR4O 1LS1A 4OMDA 2YCBA 3A1CA 1GN2A 5L4SA 3BWDD 3FHCB 4PLVA 5TR9A 4Z8XA 1JDBC 2AF4C 4CL3A 1O4VA 3RIEA 4A8JB 2LP4Y 2D2IA 2ZRCA 2CK3D 1WUKS 2R60A 1XDCA 4MR9B 4DLPA 1KOLA 1FBNA 3CG0A 3SEFA 2XF2A 4BMYA 1P72A 1X7ZA 2YNMC 4BWFB 3OJCA 4I9NA 2Z4SA 4PWYA 5DYNA 3CCLV 2DX7A 2PX8A 3KUCA 4OXKA 3VTAA 1O94A 2D5BA 1QYRA 4K2HA 2RGWA 5A9SA 1IM5A 2BEUB 1Y1LA 4RYLA 1L0BA 4PO3X 4UAGA 4MO9A 4MI3A 1NBOA 1QX3A 2FW0A 1Y4MA 5BN5A 3ROEA 1N8RW 2CDNA 4LRYA 4BKRA 1YDXA 1Z7GA 1IN6A 5BR8O 1K5GA 4E4YA 5AW3A 1SXHA 4IMRA 4JJGA 1ID8A 4R1QA 3WG7C 3SSNA 2P6NA 1HBJA 4OPAA 4H33A 1ISHA 3W5DA 1JEYB 3NHLA 3IHKA 2Q0XA 3EZFA 5EIXA 5K8UA 3B1JA 3AK4A 2KJQA 2GN9A 1Z2OX 4YT4A 5IXSA 2W4LA 1JE0A 3TLKA 2PUSA 3BCSA 3THWB 4MB0A 3ZG6A 1B93A 1GPDG 5DHSA 1AA6A 2IOFA 1XO1A 2BEWB 2UXBB 2WU8A 4FGKA 3WKBA 2GEDA 3EQ7A 2HF7A 5IG2A 1IURA 2FPOA 1NBIA 3LBIA 1AJEA 1V4NA 4IIFA 4DDUA 1NIPA 1G6UA 4NMXB 2P6JA 4PXSA 4RMIA 5ILQA 3D7RA 3DJFA 3ITDA 4MS3B 2QN7A 3U09A 1PO7A 1QHYA 2PQ2A 3QMMA 1V37A 5CLLA 4ZVTA 1AJQA 2Z3YA 5P8WA 1ZD4A 4HUQA 5B2FA 4B3TB 3K4HA 3ZE0B 5FLYA 1PEKE 1EVEA 1XRPA 5ALQA 2C98A 3WGHA 2HLPA 1S2DA 3HMKA 2UU9O 4PN3A 2CXHA 3U2QA 5KOHA 3F6CA 3FNRA 1H2SB 4O4HF 3OQOA 3KXIA 2VPZA 4F2GA 3U49A 1ODJA 5IX8A 2NX2A 3I0ZA 3OT4A 4KC0A 2ECPA 3WMEA 2HSEA 1MDFA 5BYAA 1Q1ZA 3HKDA 1DKUA 2LCQA 5D84A 1H2EA 1ZZEA 3M4ZA 1WP8A 2Q6IA 5AOAA 3E05A 2WJWA 3IPRA 2O5RA 3P9ZA 4IGEA 3GN1A 1P1CA 4A2PA 4X62B 4DG9A 1P2TA 2C59A 4JTAB 5H9WA 1LRJA 2NMVA 3UT5B 3BICA 4Z53A 1F12A 1A2QA 1Q84A 1IK6A 2H57A 4M36A 4R40A 2BBWA 3CZ9A 3DE2X 1M6VB 3OIGA 4TSRA 4QEZA 4DLLA 4MQ5A 2BM8A 3DMFA 1WULS 2R6GA 2XCSB 5FWYB 2XWQA 3R3HA 1YBMA 4M0FA 2FR1A 4QVIA 2WWTA 4Q37A 2D6FA 3AINA 5KDOA 1GUYA 4LXGA 1X7DA 2Y27A 2JGJA 4DR5O 2JHFA 3ZV4A 1RAAA 2PIDA 3IAM1 4MWCA 2O2SA 3BF7A 1D0IA 3CKMA 4F1WA 2O2HA 2Q29A 4UNQA 3L8FA 2PSJA 4LI0A 3DDCA 1Q5PA 1T26A 3WG9A 2YV4A 2H4YA 5DMXA 3TKAA 1WKVA 3HRHA 1ZL0A 3S1LA 2D2EA 2JFWA 2W2MA 4EMUA 4NARA 5KDDA 3RQSA 1JAYA 4JLWA 3T0GA 4R9UC 3ZVLA 3DC7A 4R8MA 3ML1A 4DV3O 1TF7A 1OH7A 5ITZA 1QG6A 1U99A 4MROA 1MO4A 3RV3A 3JQEA 2F7SA 5ELXA 1ZOLA 1PD3A 4URWR 5BV7A 3FXAA 2BDEA 5KPJA 4KFCA 3F78A 1AH2A 2CUKA 2QTFA 1OI3A 1W87A 1H8EG 4H3KB 5B3LA 2B9EA 4YK7A 2FV8A 4INOA 4OQDA 2AFHA 4NXNB 1K3TA 4BASA 3KQHA 3EEOA 5D5QA 1BN7A 3BFJA 1NOJA 2V6BA 1Y6QA 4ZPJA 1JCHA 1AY0A 5JSFA 4G0UA 1L3IA 4CC5A 5JZBA 4OM8A 3MBKA 4JLPA 1Q0PA 4R6WA 3BHMA 1E6EA 3MOIA 4PAOA 3I6MA 2O3JA 5B30A 1BYIA 1P0FA 1U1DA 4X1IA 3AP1A 2KSDA 4C21A 1X70A 2ZEJA 2PUHA 1DE0A 4DA8A 1DIAA 3VKHA 1WCV1 2PGXA 4K8OA 2Q6OA 4UUOA 3EQ8A 2OCHA 1V54C 3GGSA 2A30A 3ILYA 3Q3EA 4F06A 4LJYA 3A6PC 4P81A 1Y4AE 5IC5A 3GEPA 1Y6FA 1ZD2P 3RGBA 1ISSA 3DPUA 1XKQA 1I4DD 1ZTEA 2K1EA 4NJEB 4XASA 2WVJA 3AXSA 2RB5A 1PJTA 1ISPA 3AF3A 1YEWA 5EIAA 5M2QA 1QNMA 2QNRA 2XWPA 3DD5A 3AP3A 1DO0A 1V6CA 2FWMX 3KSMA 4M0UA 4S1PA 2HHHO 1OW3B 1AR4A 3I23A 2YY6A 3ANSA 3U7FB 4H6WA 3O1LA 4AMUA 2X58A 3I55V 4P3YA 2H6EA 1JIJA 2OORA 3G1TA 2Z8YA 4RZSA 1UJ2A 4PHTA 1U3UA 3FF1A 4RFSA 2WM9B 3NBQA 3SFVA 3OQNA 2QN2A 4TM8A 3L5OA 4C78A 1ENOA 3OBIA 1XLTC 1PT6A 1RPTA 3MPOA 4IH4A 1W9MA 3DKIA 2RGCA 1H6DA 3W7TA 3IAHA 1QB7A 2WD9A 1C9JA 1OWMA 4GZMA 3AKYA 3OVMA 4KB5A 4MQEA 1CS0A 2WIBA 4QODA 1VIVA 5FA5A 3EIHA 3SNKA 1DARA 5DK4A 3IAM6 1WXIA 4FHGA 4XCVA 4TWAA 3IMFA 1Q7RA 3WLEA 4M0KA 3CRVA 3ZY2A 1GNTA 2ZNIA 2V3WA 4LDRA 1XAJA 8ADHA 1G66A 1Z28A 3TX6A 3CUKA 3SZUA 3TB6A 3L75H 3TZCA 2ZB8A 2QXTA 3N05A 2CLMB 3GIDA 2XMDA 2H54A 1RSOB 1NI4A 2ZJ2A 1QCCA 3ABUA 2D1RA 3EJWA 3TRDA 3P2OA 4QJ4A 3BCCH 5IZ4A 1BCCH 2CZGA 3H04A 4JWTA 2B9VA 2WWFA 3FDIA 1Z29A 1RAFA 1MZPA 3AUFA 3R0ZA 1CY4A 1KO5A 3GLKA 4P31A 1VIDA 3USCS 4O4JA 3MAJA 3HBMA 1MH9A 4UD6A 5FQNA 1J8FA 1AXRA 4XXHA 3MS7A 1GU7A 3NHKA 3A4YA 2Y1XA 1YS1X 4WXHA 4CU5A 4FIZA 1E6UA 3L0BA 2P6PA 1UFRA 4H16A 4LZWA 2WMOB 5JXIA 1NFQA 1GUDA 2VYFA 1D5AA 3NPAA 4KQHA 4MUKA 2GVDC 1A5ZA 4ZIRA 3EEFA 1K4DC 4L57A 3REFA 3P94A 2JEZA 2J3KA 1F8FA 1M8GA 4GZ5A 1F8XA 4O4HB 3C1TA 5THKA 4LH6A 3INNA 1EP9A 2GN1A 2VI5A 1U04A 4O25A 2G07A 1G291 4ZYXA 1T2UA 3W2FA 4TLCA 1EFCA 2IA5A 1X39A 3IIEA 4Y6PA 1PU2A 2D7JA 2C2ZA 1M7BA 4ABYA 4RSHA 2R25B 2XH8A 1PJSA 5JRZA 2SNIE 4EGSA 4LF7B 5TJHA 4XJVA 5BUQA 3BH0A 1A4UA 3ELDA 3QXSA 3B3GA 1CPYA 3OMLA 4EO9A 3PD7A 1FXKB 2BBSA 2I3BA 4CV0A 2VYNA 4Y2TA 1BMQA 1P2GA 3LXRA 3DKRA 3L6DA 4LFCO 1OCRC 4UEQA 4YDQA 1MRZA 2CV1A 1RRVA 2I22A 1CTTA 3UAZA 1Z6PA 4NRDA 4FZ5A 5AVOA 1R0RE 1VKNA 2NYTA 4CS3A 2QD3A 4J9YB 1YJ5A 2QR5A 3FB6C 1RXWA 4KE7A 5EQTA 5K0ZA 3X43A 1CK4A 3NBYC 3NEYA 2JK0A 4NMWA 1X94A 3EUWA 3P1JA 3Q0TA 4G5QA 4FBMA 1ZMOA 1XOIA 4BO2A 5KMGB 1KMHB 3THXB 3C3BA 4BVBA 3H1HH 4MW6A 4MW3A 1U7WA 3IP6A 1VHTA 3ICOA 5JAZA 4JYZA 1B1AA 3LUAA 3RADC 2ZS7A 3SPCA 4CZZA 3VNVA 3A4IA 4K03A 3RFXA 2CVQA 4F38A 5HGXA 3MS4A 4WY8A 5JEEA 4N47A 2HRBA 4H59A 2A2ZA 2G04A 2J3QA 1VYHA 2VRCA 4JIGA 2QDXA 1AT1A 1L4FA 3EF1A 1RADA 1JB1A 1V8DA 3TMKA 3ROFA 1QBGA 4OCMA 1QVFU 2JEUA 2CMHA 5BVHA 4NK5A 1FS6A 2ZYWX 2I78A 2DUUA 1JIIA 3OFJA 1NJ6A 3EA5A 4UTRA 3Q9LA 2Z4TA 1KJYA 5IYZF 3NOQA 4YECA 2PCLA 3B85A 2WJYA 2Z1MA 1F7VA 2YYYA 1CY0A 3SR0A 3VSAA 2AQ8A 3OCVA 4QC2A 2W2NA 2YV1A 4CS2A 4DR1O 2L82A 3KOMA 2BDTA 2HRRA 2JIZA 2ZBQA 1NVFA 4WJLA 2DG2A 4FKBA 4U7JA 1Q6IA 5BUZA 2B5WA 3D6HA 2C5AA 2XUOA 4XUEA 4YRRA 1ZXXA 4H77A 5EMHA 2YQ4A 1N2JA 4ZEXA 3QV2A 3UNXA 2H1SA 1N4AA 3QI7A 3VU0A 4XOIA 1SXGA 4K9DA 4LCUC 3IELA 1A8PA 3I64A 1BKDR 3FCCA 2X0IA 4H4EA 4A8HA 1SNYA 4H7JA 5AKJA 1K9MW 3M4YA 1D2CA 4UUQA 1IIRA 3P20A 2GWRA 2Q3FA 2ZIEA 1XZPA 3KSZO 4ZJPA 4JMPA 1KO8A 1TLLA 1AI5A 4EEQA 4KK3A 4QNHB 1C7RA 4HX9A 3OEWA 1S9DA 2WMYA 1DCMA 5J63A 3R0JA 2R8EA 1IE3A 5AW7A 4BFXA 4IDPA 5LHGA 3C6BA 3RK4A 4FVMA 3EW7A 1NLZA 3NM5A 4MGEA 2V8OA 3VH4A 5DWVA 3LIIA 5KNDA 4MQLA 4K88A 5IUJC 1ZC3A 2KB1A 1YQUA 4XW2A 1VDZA 4BTLA 4CN8A 4W5HA 4HWKA 2IYOA 2B8WA 4OYRA 3T4EA 4JU9A 2YICA 4YX9A 2C2BA 4G3MA 3U39A 1L4UA 4XPIB 5AK6A 3S44A 5DF1A 1MVLA 2YASA 1Q1GA 2GUWA 4ZYYA 5KUMA 2BOVA 2GCOB 3NG1A 2P9QA 4BJ5A 3PXDA 3Q8KA 1F2DA 4PYIA 1XZBA 4NV1A 1C4WA 4UDYX 2F93B 1BDMA 4PLTA 3DBHA 3V4PB 2IBTA 2V7UA 2XHEA 2Q3EA 1QVZA 2WMNB 4MSUA 3RGGA 4ZPXA 4A1FA 8OHMA 4EG7A 3PPWA 3WI7A 4XWTA 1XL4A 1Z4MA 5CT5A 3TQRA 2ASEA 1I1HA 3C6ZA 3IIIA 1ZYUA 2F17A 4MK4A 4DJFC 1KJ8A 1G55A 4OB8A 2HQ1A 1VF5B 4QQFA 3H8JA 5K3FA 4RHFA 3EVEA 3REOA 4IUDS 3UH0A 3C7AA 1VLHA 3LT2A 3ADDA 3C5HA 4AW9A 4IZ6A 2QRKA 1KQOA 2IUFA 2G1AA 4CDRA 2GBGA 2V0CA 1VP3A 1W5TA 3KJGA 3PYXA 3PNYA 4HWGA 2OG1A 4DUZO 3VYVA 2DQ3A 2PUVA 1EM8A 2JEYA 4ISBA 5AESA 3IP8A 1PLKA 3RWOA 4HP8A 2XB9A 3N2LA 2HMYB 1UJBA 2VWHA 1X14A 4NBSA 3TIIA 3Q1KA 3GEBA 1P73A 1YU9A 4BDSA 3F7OA 4HMPA 3F4BA 3NUQA 2GUZB 4YXWG 4UFOA 4LTNA 2XZDA 1V71A 2DHRA 1DG9A 5CBGA 4TQUS 3PXEA 4JVSB 2GF0A 2KW5A 4OFXA 2CV0A 4LWQA 3IUSA 4V03A 2FFHA 2HF2A 1QP4A 2WYHA 1XMOB 1XDSA 2PBLA 2BN4A 1C7FA 1Z0SA 2IDMA 2HLDA 2N47A 4R69A 2NSJA 3UPTA 4LAFA 4CQJA 1H2HA 4RHYA 1VF7A 1ZOPA 1GZ3A 3GRRA 4YQZA 3V4OA 3DDHA 3L9WA 5CPFA 4Q9IA 3VZDA 4AJ1A 2IV7A 2W58A 4PF1A 4FUQA 3OPNA 2C1XA 4XX0B 3MJFA 3A25A 1N0VC 2POCA 1X1EA 3ONVA 3H3JA 2LGWA 3UY4A 2HC9A 1JALA 3G8CA 2UYOA 3T0IA 3L8DA 3ZTWA 1E2JA 4L73A 1HNWO 3G13A 2OCLA 1HT1E 3WAGA 3SLGA 4M54A 5DSTA 4UATA 3OESA 1TIYA 4ZQGA 2H8PC 1U8TA 2XQJA 4JI2B 2G83A 4K87A 2F59A 4BQIA 4MDEA 3ZTTA 4UEKA 3KAJA 1FFXA 5EIHA 2GB4A 1YJ8A 1II9A 1T5IA 1Z2DA 3FFXA 4QNMA 1RJGA 2X4LA 3RYIB 1NP6A 1LR1A 3SJUA 4B76A 4QDXA 1TUEB 4XQEA 3HDHA 5DASA 1B74A 3KV3O 2AZMA 4IAOA 2YIDA 1X1CA 1HKHA 1UFVA 1GJRA 1F4PA 2DLDA 5MN5A 5HCNA 3ASOC 1PR9A 4MVMA 4MKRA 4CMHA 4DNFA 1ZONA 4JBNA 3DWGA 1LNQA 5FO1A 3ZCTA 3RVLA 1ATIA 1FP2A 3ZGYA 5IDVA 5CIYA 3WAJA 3MWGA 3ZWWA 4TS1A 2PZGA 2W8BA 2O8EA 3CUVA 1SO8A 2D5AA 2Z6VA 3S81A 4YQEA 2HU8A 2I80A 3RG8A 5IYZB 4C7UA 5FOQA 5H9CA 3FNGA 4LBEC 4OXXA 1T3GA 3D8HA 2ZYAA 3QOXA 1P7ZA 4B9EA 1KPHA 4G2TA 2IJKA 4IGAA 4G1BA 1W5EA 2MMGA 1LDBA 2V54A 3BD8A 1IN5A 2W2VA 4XFDA 2WM2A 1F4LA 3PE6A 1ZW1A 3QU2A 4HDNB 2IHVA 3WRYC 3NXSA 5AJVB 1T0BA 3AFOA 4YTEA 3O31A 4XTRA 2HVVA 4J10A 2B2NA 1FAFA 1QLEC 5LN1A 1QMPA 3G0GA 2JLQA 3UTCA 2AZXA 1OKKA 3FFQA 4YUXA 4ARZB 3D3NA 3DEYX 1NQVA 1A8HA 4Q9LA 4PCVA 1N9ZA 1VYVA 2W8ZA 3H1GA 2FSUA 3UC5A 1UKZA 2YJ6A 5GVRA 1B6QA 1WF3A 2AN1A 1W9HA 3PUXA 2VJPA 3UKMA 2C9OA 1TW2A 3O2NA 2HJHA 3W34A 1YB7A 4Q1DA 4RD3A 2VR1A 1WIWA 1WL8A 3S1AA 4D97A 4RPHA 2D0PB 1T8TA 1QR2A 3EGWA 2C1ZA 4R1SA 5FPSA 3L92A 3DQQA 3JX9A 1ORVA 1OCZC 5HKAA 3I0NA 5A03A 1R8SA 1DEKA 5LQNA 4JOBA 1GZ4A 1KFCB 1T5SA 1BGYH 4UEWA 3R9KA 4DA4A 1NLMA 1N36O 1DAHA 1KJIA 4XQ9A 1Z36A 1BOOA 4V1CB 1VI5A 4M0MA 1SQVH 3GBPA 4C0QC 1OB5A 3EMBA 3KZMA 4A0FA 5CBHA 4RTOA 1T4DA 2QTBA 2OB1A 2AFHE 3QPBA 2R8ZA 3HJFA 2DQSA 4J0JA 3KPUA 4N5NA 5KHOC 2Z8ZA 1VSBA 5BWBA 5LWQA 3SKVA 4F11A 4C43A 5GJVC 3NYRA 1OBOA 1PNKA 4JWKA 5D85A 1RVDA 4BVHA 3U19A 3QIVA 3QKTA 3ABQB 1PD0A 1OVGA 1PNTA 5SZHB 2YC2C 3KFVA 5FL3A 2ES4A 1DIBA 1A9RA 3T1HO 1W6UA 4ZYVA 3TGWA 2RGXA 3S0JA 4MSQA 2QRZA 5KWJA 3IQGX 4MEBA 1VK9A 4RD6A 4MRNA 1NVPD 3LKZA 4IX1A 4Q4CA 5EN4A 1W0JA 4ZARA 3LT4A 4IGIA 2WMDA 4MUBA 2IXTA 2DOKA 5CT9A 2ERYA 4R3WA 3WADA 4ZOQI 3C3SA 3P3PA 4YYEA 3T3OA 4B3MB 4KVGA 1T5HX 3MGBA 2GEVA 2RGYA 1WN7A 3IEVA 2PKWA 3ML0A 2JL1A 1DB3A 3HJCA 4IO1A 1RFGE 3FZQA 2Q6TA 4UM9B 3NTOA 5BSKA 2XYGA 2Q8PA 5AQEA 4KR9A 4PX2A 3AM4A 3A2MA 3DDNA 4KU4A 3VR2D 3P97A 2P3LA 3SJAC 4X6XA 2ZJ0A 4TMVA 1UPFA 1ZAYA 5EHZA 1YIJV 4NL4H 4X45A 3GELA 4DB4A 4JAUA 3G17A 4LSMA 3FTQA 4JKIA 5GM2A 3A36A 1M83A 1Z0KA 1WMFA 5BUCA 5LYJA 3L7KA 3EQZA 2YYZA 3VR3D 2IYEA 3L0SA 2PR7A 4D4MA 5HMLA 3BCHA 2ZU0C 1CQIA 4HB4A 1CZHA 1R4NA 1OYVA 4OGQB 1LX6A 1FRVA 3G2JA 1B16A 2PI4A 5FHRA 4MTOA 3ZHSA 4XCQA 4QGAA 4D44A 2O5VA 4N6OA 4UBNA 1V7CA 1UT8A 5AI6A 1BHJA 5FDFA 3AYXB 3NWOA 1XL6A 2IP1A 4MI1A 4EDFA 5EMNA 5JZ9A 2KG7B 4KSBA 5A7FA 2VF2A 4I4TF 1Q0UA 1IXMA 1E8NA 4ZAGA 4BNUA 2J09A 3IUQA 5HK8A 4RY8A 2HR3A 1H2RS 1GNLA 4JI1B 4H1UA 1BWSA 1VIMA 1YKGA 3E22B 2KBEA 1Q7YW 4QULA 1TJ3A 4PBTA 2D8MA 5DBIA 2Q4PA 2W4IA 3ZPCA 3PC4A 3NBFA 2HDOA 4ZI2A 1Y4DE 4HH0A 3NT5A 5F7OA 1WDWB 3BXOA 1NBWB 4UHFA 3K32A 4EYKA 3LD9A 3GVIA 3OZTA 4KFUA 5C1PA 3GVPA 3R3WA 4F4FA 3IQFA 4RLQA 2IYUA 4DV0B 2AFIE 3H87A 5DNDA 1UCFA 5IWCA 1YB1A 4TQGA 1UEXC 3VBEA 2QM4A 2XGJA 2GSWA 4J16A 4JI0B 4O0LA 1A77A 4ZAXA 2UUCO 1G8PA 2P5TB 1CUCA 2YHSA 2FG7C 3RS7A 2Y76A 1YOVB 1D2AA 4UW9A 3A9SA 2E7ZA 3B8FA 5JNSA 1R73A 1PJZA 2NSLA 5AXAA 3SYLA 1A97A 3N76A 4PG7A 1RS0A 4RTRA 1W7AA 1KVRA 1PP4A 2NLOA 2FW9A 3SQNA 5BUSA 1V8FA 4QA9A 2L42A 1M0WA 1UOEA 2F66C 2CKMA 1TMGE 2Y1EA 2BTQB 1QU3A 1Y0BA 2YWEA 3LCVB 4AP5A 3LA6A 2IP2A 4QDTA 2H1FA 2GT1A 3M5DA 2C3YA 3ANTA 1TK9A 4JCCA 4ZCMA 3KQNA 1YL6A 3C3DA 3V9PA 4H1WA 2IEAA 1UWVA 2WQ7A 1DGSA 1M2OB 3ILVA 4IDNA 1QF6A 5LQKA 2CL0X 2R1VB 3WWOA 2YJNA 1WU8A 3IP9A 4UOQA 2Q1WA 1S2OA 2BLNA 1U0SY 4Q6WA 4I7EA 1OWLA 1MMMA 3ENKA 3PV0A 5JNUA 1R7RA 2CVHA 3MYYA 4CPDA 2O8CA 1JTEA 3OZDA 4NQLA 1NJFA 4M1ZA 3ZVMA 5HF8A 5IDWA 5HZHA 2EL7A 5IJ9A 1PSDA 3MWJA 4OJTA 1OQAA 1ULBA 3OTIA 4OL0A 5AM1A 3I37X 3MWKA 2VXYA 3WGQA 3NUZA 1VQ7V 4ENRA 3DMOA 1DAKA 1G21A 1MJHA 1B8OA 4K3UA 2OUKA 2OD2A 2Y2VA 3W6NA 1P84F 1EGAA 3PPXA 2BPOA 3B3AA 3HNOA 3KKEA 4H27A 2OAEA 4HCJA 3ZHOA 3VYTB 5HFAA 2IY9A 4N4AA 1T13A 4P08A 1OJHA 4XD2A 1P2FA 2IUUA 1RPNA 3FPKA 4Q20A 5AUOB 3TD9A 3PQ5A 4X92A 3EBLA 3CEAA 4WZ6A 3GV0A 5T5QA 4BJHB 1YRAA 4C04A 1W0KA 1D2HA 1CXZA 4UE2A 2AH5A 3F90A 3RR2A 4D4IA 4MQ6A 2WVHA 1D2EA 1JG6A 3T52A 4NYJQ 3U3XA 1DRUA 5ALPA 1Z2AA 3AF2A 4LXIA 1TW3A 3AXTA 3DBOB 1VL5A 3S8MA 5CVCA 5DRTA 1B26A 1XEQA 2AYYA 4I50A 3GT7A 1K6XA 4Q3CA 3ZBTA 1S2GA 3IP3A 5DCWA 3VR5H 5K0FA 4IOKA 2FN8A 5I7OA 4GMGA 2G5PA 3PP8A 1N6PA 3DSQA 2AUNA 1XJCA 3DAGA 1OVMA 5G0TA 4I9HA 2ATCA 2WAYA 5JZSA 1KERA 1PWYE 2J87A 1I0HA 4I9QA 2QTNA 2ZAYA 1SUPA 3OEHD 3GLHB 1U5CA 3OAAG 3HLKA 1UFOA 4MKZA 2QJWA 1TGOA 3ADCA 1PQ4A 4R9NA 2MSEB 2A1IA 2BGNA 1EG2A 3E1KA 1IB6A 5HRCA 1JF8A 4PCAA 4F21A 3PCTA 4RSGA 1YUNA 1QPBA 3DCIA 4LXXA 2Z2IA 2XV1A 2ECOA 3C24A 1U98A 3LFTA 5DYYA 2NU8B 1YGYA 2AJDA 5AHKA 4ZEWA 2RGNA 4RZIA 1NW6A 4KSCA 4D8XA 4DQVA 1VPEA 4L3OA 3ABKC 4RA9B 4DLUA 1CY8A 2XF8A 4KFMA 2OTJV 1W35A 1OXUA 3PVCA 3N8IA 4K7JA 1CERA 3A6DA 2AWOA 2A5JA 2VK2A 4DGQA 2VAXA 1YRHA 2QMQA 5IY5B 6YASA 4BW9A 4RFVA 1DC3A 3IO3A 5FL7G 1VZ2A 1NRXA 5BSUA 2J8ZA 3WAKA 4FLVA 3JZMA 2HV8A 4X1KA 2WJ4A 4ND5A 2H2IA 2A06H 4TTPA 5AT1A 3TW0A 3F7MA 4GWKA 4UBJA 1BQ3A 2JAQA 1B00A 1HZZA 5KNCD 3EGDB 5KNBA 2IX9A 4B0PA 3AR7A 2EYUA 2QD5A 4IYHA 5BP7A 4I4TB 3GNTA 5IWAB 2NU7B 5HEKA 1UQUA 4IDFA 4UD2A 5CB8A 2D74A 4AM8A 4UHJA 1X9IA 2Q41A 1XCLA 1BGXT 3LECA 1MPTA 5F3WB 3H1JH 2HWUA 3CD6V 4FB4A 5T41A 3LZCA 4MGKR 2W6ZA 5DMHA 3BBLA 5B5SA 4RXMA 4KI7A 2V6MA 1UJNA 4JI6O 3AVQA 1BXZA 2G9VA 2P6RA 5IT9A 1YS9A 4OUDB 2YWXA 3TSOA 4PV1B 4NTXA 2JHGA 1ZRHA 4AO8A 3EULA 3OQVA 4CTNA 4F56A 2C29D 2DY1A 4MKFA 3DFZA 4R6ZA 4NVPA 2V9CA 4P3KA 1Z39A 1YU6A 2XCLA 4QWWA 5JSKA 3SC3A 3KUKA 1B42A 3A2KA 2OXCA 1IUNA 2PAFA 1QOPB 3AK2A 3KQPA 3SHQA 4BBPA 4OH7A 4LJ7A 3U10A 3VR6D 5F9HA 4B09A 5FUWA 4XB6B 2VQFB 3ZPGA 2GBIA 1IM2A 4JI3O 2HCTA 4QFBA 1ZH6A 3NYIA 3D0RA 2C5FA 1DJLA 2QD2A 1PZHA 3BPZA 1PX0A 1GPWB 5EY5B 4L2IA 4P4SA 1BWPA 3R9XB 1YMQA 1DOAA 3L6BA 4TPKA 2OV2A 2AVNA 5ESWA 1FW8A 1Y1KE 4V0QA 4COOA 5TF0A 4OIFA 4AJNA 3QEOA 1SQSA 1EUCB 4HAWA 3QBDA 3L1IA 4RVFA 1TMYA 2Q07A 3RTEA 1FUIA 3GWGA 1E1QG 1I94B 4I1RA 2EQ5A 4YI5A 1S01A 1EUYA 1K0UA 3TSYA 5DXAA 1CRQA 1I9CA 2PZFA 5CXXA 2Z2KA 4KXNA 4EMBA 4AI8A 1U0HC 4JB0A 2OPHA 3KTOA 1HDOA 1DZIA 4UNSA 1Q22A 1O0CA 3AR2A 5DCUA 4KQ6A 3IA2A 3R66A 4WL0A 4N0PA 2WD7B 5L6MB 2X7XA 3SU8A 5JNVA 2VDWB 4L8WB 3UQ8A 3I9NA 4JLMA 2V6IA 1J9EA 1P6QA 2VDLB 3DSRA 2OZLA 1QHIA 4AF6A 1SD1A 4BC1A 3EPJA 2G4LA 4A6DA 2EKDA 2VTKA 3ZUPA 3COVA 4FLEA 1PNVA 4UMEA 2WFLB 4C05A 3BD9A 3BOSA 2IP4A 4L08A 2H63A 4KP4A 4BLTA 5C5CA 1NW8A 4MEAA 2P9HA 4GOXA 1H85A 4EM6A 3PR2B 1FMFA 2H11A 1OX5A 2ZI4A 3RBZA 5HILA 2PD4A 1NW9B 4F4HA 1RBQA 5C93A 4UUPA 4TV9F 5SV2A 2V4ZA 1CC1S 3RFCA 4D5EA 2KLHA 2WG0A 4HAOA 2JFQA 2C9MA 2IQIA 2QZJA 5FTWA 3HR7A 3T7SA 4NSNA 4OHPA 3V8QA 1ZSPA 1E58A 5U1PA 1ZUNA 3QRWA 3V97A 4FGSA 3G88A 3VO2A 3GCGA 1APBA 3DHVA 2LR0A 3RNOA 3MWEB 5H3LA 3SXUB 3CVWA 3DC6A 2BELA 3PUJA 5HW0A 1XRRA 2BWJA 3SHVA 2XAAA 1OE0A 3ICEA 4OTZA 3GP3A 2WZCA 1P3DA 5G1PA 4D4LA 1XTKA 3ZDFA 1GGMA 1QHGA 3T5BA 4Q9KA 1QBKC 3N07A 4FDAA 2OM6A 3SLRA 4OI1A 3SIXA 4Y1RB 2CVOA 1KNXA 2OQIA 1RM1B 3EHEA 1KEWA 4BP8A 2RGAA 1UT6A 5AXCA 5D2CA 4J0CA 1UPUA 2HCRA 1T9DA 1OLSA 1OH6A 4DDHA 1IFXA 3D43A 3OETA 3SNHA 1KR2A 3I5YA 3H86A 1L0LH 3OQIA 3QBVA 3F5DA 3KL4A 3FSGA 1W76A 3OFKA 3IODA 3URMA 1VYUA 5B1YA 3JCUZ 3ESQA 3KDAA 1KOJA 2PK3A 3BKWA 3LBYA 3MQ4A 1FLDA 3KFXA 4HQNA 1YIDA 4ID3A 2DH6A 4YBRA 2PV0A 2XEDA 2ZZMA 1AI7A 3E4DA 1DXHA 4KHZA 3AY0A 3HTXA 1LKZA 1SB8A 1NTRA 1UKYA 2AOUA 2ZAIA 4EQ6B 4JZ2A 4G1FA 3B8HA 2XXJA 3TQOA 4OP2A 4WFEA 1IRIA 4CDGA 2ZINA 2XUKA 4B83A 4ZI7F 1T36A 4FW9A 3R7WA 3IC5A 2WPDA 3V42A 3TTTA 4AY2A 5EE0A 1W2HA 3CP1A 2QRNA 5G3YA 2Z5VA 3UMSA 4WBNA 1SUCA 1D9XA 4XJXA 3AEUB 2GXUA 1C9KA 5ESXA 4TN5A 3R6DA 3GJ5A 1RW4A 1X19A 2I0FA 5TVGA 1Z7EA 3ZHCA 3H5OA 5ITWA 2DHDA 3IOMA 2OQ2A 3CWZA 1EVKA 1YULA 4L28A 5DGXA 4C4AA 2WA4A 4FGJA 1WHTA 3CX5F 5KWSA 3OZXA 4B4DA 1ORWA 3GUYA 1JPVA 1COWD 4NZNA 4H4CA 5LL6P 2ZS8A 3RS4A 4B84A 5JRJA 4OL9A 2BUCA 3UAVA 4JYAB 1X0VA 3ZI0A 2ZE5A 4TRMA 1MC4A 2QL6A 1JT9A 1CY6A 1CRLA 4NNOA 2GJAA 5KOIA 1EFVB 3GR6A 2XNKA 4D7TA 3ZCRA 4LNUB 3BIJA 2DQZA 2O7QA 4MWZA 4DNXA 2IZ6A 1EBFA 4NOLA 3GPLA 2ZRPA 1WP9A 3RFRA 1HFEL 2FMUA 5L3QB 1QQTA 3LCJA 3HXOA 4AJJA 1RM3A 1L7AA 4I5GA 3RJZA 4PQRA 2J4FA 4FC6A 4OXIA 3CHXA 3V7NA 2XAGA 1NVPB 3FVTA 4YHBA 3II6X 5JFGA 4JQYA 2CY0A 1X59A 4YLGA 3C6QA 1JJOA 2X8WA 1UBLS 5GOZA 3HB9A 3TCKA 2EWWA 4UVCA 3IBYA 4WIAA 2Q8QA 1P5ZB 1EK6A 3WQSB 3Q6NA 2ITDC 2XITA 3VVBA 3IXLA 2XJ4A 1ISGA 3CLUC 1DAMA 4JI4B 3VPDA 1A0OA 2N9UA 1VKHA 2WWVD 1ZICA 4EYEA 4X20B 1GDDA 2NYAA 3K59A 1V8OA 4TKZA 4L50A 4KYTA 4OUKX 1IG3A 2MYTA 3EVDA 1GRVA 1BRTA 4IIJA 2P87A 4QGBA 1WWKA 2P1RA 3P9RA 2JKVA 4RVGA 4MV0A 2X6AA 3A1DA 2P8JA 1SIBE 2A1UB 2XWBF 4PC7A 2CVPA 3QA9A 4B0OA 2EU8A 3U44A 1L5OA 2O07A 5JWRA 5KTKA 2RJOA 1NI5A 2HRCA 2PXHA 5IBRA 2VTDA 3B38A 1JNYA 4F4JA 3HKCB 4PA4A 1SQQH 3D02A 1FUYB 2ICAA 4Q0MA 3OTOO 5EZQA 4DCUA 1BU8A 3UK2A 5GZ1A 1QYIA 2HD4A 4IBOA 1PUJA 3U60B 3L7OA 3K0KA 3IBTA 3DVAA 3OURA 4G0MA 2QR3A 3RD5A 3WRXA 1E32A 3HO1A 1M1NB 4GKJO 3U0BA 1Z5UA 3PICA 1EFPB 5AD1A 3KAQA 3WBKA 4U7DA 3LPLA 2W2KA 1YT5A 2OFFA 1XU7A 4AROA 4AZ3B 5B6PA 2VHVA 5CURA 5B3KA 3W77A 5HE9A 3CZRA 1ZGCA 3JSXA 1KMNA 2YIVX 1YBAA 2WTBA 4ALLA 2Q1UA 1TTPB 4UM9D 3V1KA 5FB3A 3EAGA 3K0CC 1PJLA 4P4GA 3AI1A 5EEHA 3ZC3A 3EX7C 1PS8A 4A6EA 2DYSC 2GBCA 1ZWLA 3ACBA 2DWEC 4E5VA 4TV9B 3DZKA 4NG4A 1DELA 2J08A 3B9RA 4PJ0Z 2BHRA 1ZA2A 1P7CA 3VOTA 4E6EA 2GZ1A 3ROTA 4YCJA 5A3VA 4F3NA 1V16A 1KPGA 4GE3A 2PVCA 3I9MA 3PR1A 1NU6A 3GLVA 2RK6A 1M75A 1J0BA 3MINA 1W5AA 2JHPA 2ODQA 4Y2PA 3AKCA 1REQB 1LFDB 1ST2A 2LTAA 3G9TA 1S5JA 5E79Z 4O1HA 4B75A 1PTJA 2QEXV 1WZEA 4E0BA 5DW3A 3DZ8A 1A2BA 3TNJA 5B1AC 721PA 2EG5A 3LQ2A 4M37A 1IBMO 1RYDA 3NXKA 1SETA 4XWOA 1ZMRA 3ZLVA 3SDZA 1BXGB 3IPXA 3CNBA 1Q7EA 1UINA 1UKBA 4XARA 1O77A 4RAOA 1BVRA 4G6ZA 2JJQA 3NHPA 1AMUA 4II7A 1K88A 1DEAA 5BW5A 4G1EB 3MHSC 1E5XA 2QUIA 1ZK1A 4TTSA 1U2DC 5C7YA 3BL5A 1Z6TA 5A1JA 3NAZA 4EAQA 2H8GA 2OM2A 3D7SA 2FQXA 2QI9F 4TV8A 1E9CA 4FHFA 4ZIBA 4LHYA 1P7WA 1I7SB 1V4BA 3GDOA 4DREA 3ND8A 2FPRA 2VQEO 4A2CA 2HVWA 1EFRA 4BYGA 2DJ5A 2XE8A 4RVNA 3MMNA 1CF9A 3SY8A 1G21E 3VOAA 2XCTB 3FHTA 1ZIDA 4E2LA 3WFJA 1GLGA 2H2GA 5B7NA 4ZI7B 4GLLA 3ZLUA 5LP6C 3EGEA 3DA8A 1RXUA 5MF6A 1JB9A 2X5XA 1DP4A 3PBKA 1SQXH 4R2HA 3ROXA 1TM4E 3FMIA 5DI9A 3TIGA 3ZW7A 3O8QB 2OQVA 1PJQA 5CCEA 5DT9A 1RCUA 3PLAE 3F3KA 1ODLA 2HM7A 3UJAA 2PWAA 3EXIB 4D57A 1GT91 2WSMA 2UVQA 3KTAB 2XHZA 2G9ZA 4RK7A 2TMGA 3ZS8C 1SH7A 4G2NA 1FE8A 1QGYA 4OHWA 2QRGA 1O9HA 5FPOA 4HNSA 4P4UA 2H52A 2PV7A 2EIHA 3VC1A 1NJ1A 3CF2A 4KX3A 2PWPA 3K20A 5JV5A 2FSGA 4B44A 3BWBA 4FR5A 3RE1A 3PGXA 1LJ8A 4L6AA 2XOKA 3EVGA 4FR2A 3HR4A 2VHQA 3E48A 5KDLA 4IWXA 3K57A 4C0JA 1I5RA 2XWJI 3TW6A 1WJZA 1LEHA 1GG5A 3ER9A 3RC8A 1VHLA 2FPXA 4GL2A 4B87A 5KYWA 3UUWA 1N5KA 2Q69A 5EJFA 4UTNA 3ZK7A 3FX7A 3MJSA 3AKZA 5BQXA 2JIZG 1V3QE 2W48A 3KIPA 3ZN2A 1GNQA 1S7GA 3ZXXA 4EYSA 2CXRA 2JH8A 5B57C 4GX5A 1XQVA 3IV7A 1ZHHA 3PC8C 1GG9A 2CFSA 3KNZA 1E2DA 4LKRA 4AKGA 3IRUA 4UNRA 4U3JA 3RHTA 1R5TA 5LDHA 3D3WB 2WTUA 3ZZTA 5FR1A 4R2JA 2PQ0A 3D36C 1FEZA 1ZKMA 3ZXUB 3FKSG 3BMOA 3HYLA 4QREA 3PFBA 1GTG1 1Y74A 4KV7A 3MOSA 3T4PA 4HNRA 3K5MA 5PGMA 3NVDA 1BZKA 2AN9A 1NY6A 5B1EA 3U7IA 2ZIMA 2YXHA 1DAOA 1RT9A 2QWPB 3DAOA 5L3GA 5FI1B 5E8RA 3PL5A 1ATZA 5L7WA 4LHVA 1SCJA 5KAIZ 1I6WA 3ORSA 4IIGA 5J5AA 3GYBA 3DXXA 4PBRA 5KREA 2B21A 3D6MA 3V33A 4F60A 4HV4A 1M5RA 4TMXA 2DJVA 3LC1O 3RGWS 3VAYA 4MXDA 3FF4A 4ZD4A 1E4VA 4QOIA 2V4MA 2IV3A 1EPUA 1VB5A 2NTNA 3MEQA 3OG9A 1Y1PA 4KPFC 3LL4A 3AUAA 2FMKA 3PUHA 5AHOA 4HAZA 3HXQA 3TTXA 3H9EO 1GL7A 2HGSA 3MWDA 3G9ZA 3VUFA 2RHJA 5INTA 4P9CA 2L19A 1J90A 1QIJA 1P6OA 4DJDC 1L4BA 3QF7A 4GI5A 4HB2A 3W7BA 4MWGA 4RTLA 1JFSA 5JSZB 5B1OA 1BQ4A 5IARA 5JHHB 4J9ZB 2RHOA 1WNTA 1IOLA 1BVHA 4ZCTA 4ZYWA 5AW2A 2J45A 4MUAA 4PG5A 1MQSA 3IQXA 5CDGA 1K5DA 2PXXA 1KORA 3AX6A 4CDNA 4FE7A 3GEDA 4N21A 3UXEA 1Q12A 5KVQA 1YS6A 2ATIA 4B7CA 4CNQA 4K6KA 3ZX4A 4V0LA 1YVPA 1GPAA 1JU3A 1Z4IA 3IIJA 3VH2A 4IG9A 3ZWBA 4UVGA 2Y1CA 4ND8A 4FR0A 3H9JA 1Q95A 4HQRA 3OLYA 5K3EA 1C8BA 1PQYA 2HA5A 3G0BA 2O2DA 5IZCC 2JJ1D 5FNVA 1HDIA 2EILB 2ZROA 2YIBD 5FBWB 4Z3OA 2FAXA 3NHMA 3ZMZA 5ALNA 5FV7A 1MZVA 4CF5A 3K7EA 1JECA 4AJPA 3BMQB 1WUYA 5HRUA 4P84A 3WLRA 2EIKC 2IHNA 2W6CX 3IO5A 4IJVA 3ORFA 4MLDA 3H1AA 2RNBA 2GJKA 1Z3AA 3ETDA 4FB5A 2ZRBA 2YJ3A 3R5TA 3HP1A 1FA9A 1O87A 4B3JA 3F5WC 4FFBB 1L4GA 1QR6A 4HZGA 1XEWY 4BUCA 1RWPA 3RDPA 1G6Q1 3V1NA 1V5WA 2H2FA 3X3HA 2I2DA 1E0SA 2EJRA 1MU0A 3MCZA 2FLKA 2O8BA 1ODSA 1OV9A 1U1IA 4O33A 2A7QA 3MHPA 4WZBA 4EF6A 3IJ5A 2X40A 2HPVA 1XTZA 3RRMA 4UE6A 4LYFA 2O50A 1AKQA 3LQYA 3S8YA 2X41A 5EERA 4NTWA 2HO5A 2YBDA 3IBFA 4D81A 2HLDG 1T2AA 2CW5A 1VEWA 5E6SA 3FPFA 5EVCA 2HG5C 4RESA 2D8AA 2YWHA 4KE9A 3H0CA 1BX0A 3WGYA 3JQGB 4XVUA 5EBMC 4FZ1A 3WZLA 2A79B 3HVHA 4N49A 3X1ZA 1N5MA 5AYVA 4LCEA 2WHPA 1HETA 1YVDA 2JJ2D 1VQOV 4LECA 2QTOA 4JJIA 2QTHA 2BFDA 4CF3A 1QIHA 2V8BA 3HJBA 5BQ5A 2I1VB 4C2AA 1AUOA 1J0XO 3BFVA 4D8UA 5H82A 5JAPA 5ANRB 3OE1A 4B4WA 3B60A 2QSUA 4UMVA 3VQTA 1FNSA 2PYJA 1J7KA 2WSIA 4TYMA 3D5QA 3T1OA 2E87A 5DM70 2PUGA 4H0CA 3TETA 2X19A 1KYQA 1FS5A 3BSYA 5U4QA 3QK7A 4E31A 3K08A 1O96B 1ULHA 1OHHA 1IWBB 5CGZA 1M8JA 3QVUA 3TSAA 3TTSA 1R00A 3KFLA 2CDBA 2P11A 1HE5A 5K09A 2A1TR 3MUFA 2P41A 1NP7A 3C4QA 2HIGA 3U4DA 3NCHA 5EUBA 3T5MA 3TJTA 1PS9A 3UC9A 3RSGA 1P7YA 2FGJA 4QUDA 5K3AA 2RHHA 3JZIA 1VJ1A 5TV2A 1WSBA 4QJ3A 3ZQ6A 4CWAA 2RFLA 1AUVA 4EX6A 3DTTA 3I73A 4OH1A 2EW8A 5EPUA 2YS8A 1GLNA 4GH5A 1VIYA 3QWIA 2IS1A 3DT8A 3L79A 5TIIA 4BP1A 1EGVB 2D3WA 3B2EA 3RROA 4PLGA 1WJGA 4AXXA 1ZU4A 3CSXA 5ALWA 1PEYA 1LD3A 4E46A 4HPWA 2M1ZA 2WYIA 1BS2A 2FRDA 1AQNA 3OA0A 1UOQA 4KIJA 3B09A 2Y69B 4C7OB 1AXGA 2XD4A 4P0PB 1JDPA 3RQIA 3OICA 1NF2A 4HEA1 5CUQA 4IRUB 2X9VA 1VKOA 4JT4A 4IDCA 1M5UA 5TEVA 5HUHA 1DZ3A 3FROA 4LPSA 3CA8A 3A32A 3UUEA 1O97D 1R6XA 1SRRA 5AM2A 5LM3A 3O92A 1DBIA 4QARA 2R00C 3GGGA 1ADGA 1PDWA 2P2NA 1CCWA 1F0PA 2W00A 3DDZX 2I91A 4NPCA 3TDMA 3E3AA 4HADA 4Q93A 3NP9A 2ZT8A 3QOFA 1TAGA 1Y7PA 1T5LA 3IT3A 1HTBA 4J41A 3KLMX 4PA9A 2X3YA 3C3EA 3O91A 1RQNA 3ETLA 3IC7A 4WD3A 5HFLA 4NBLA 1BOFA 4UMFA 521PA 2D1YA 1E4EA 3H9VA 3IJFX 1P2UA 2YJ4A 1XQXA 4DAEA 1SVLA 1BXRA 4RDHA 3M3DA 4RD0A 2WZDA 1JKJA 2V3VA 1N5OX 3H2HA 2R4TA 3H99A 2NGRA 2IW5A 1H8ED 1W36B 3N2ZB 3NW9A 4NXMB 5IDJA 1LSOA 4D9IA 3DXFA 3P19A 2HCJB 1Y76B 3X0DA 2A9FA 4HY3A 2E6KA 4KE8A 1K7XB 4NCKA 4CIXA 2Y9MB 1NBAA 2XW6A 2B3TA 4LEIA 2CXXA 4TKLA 2L2QA 4BQEA 1BS3A 1W52X 1VLMA 2Q21A 2FMLA 1WPGA 4GI3A 3WL6A 1I3NA 4DR7O 2DXIA 1YMVA 4YMUA 4NBTA 2WHYA 3MCWA 3KKMA 5FPHA 4GZ3A 1U6JA 4TZTA 4DV5B 5F5LA 2X5KO 5FKJA 3HSSA 3KTFA 3OPYB 3DTNA 2QWQB 1D2GA 4Q9AA 2PZJA 1EFKA 4ABMA 2M32A 4ONEA 3DTUB 1PGOA 1OJLA 4MTXA 4QBGB 2UXXA 1WV0A 3LIPA 4MS1A 3CURA 1NWCA 5CNIA 3QWAA 1MW8X 1Y3DE 3VISA 3B5IA 3LYAA 1DBQA 2BMJA 1XMJA 4GDMA 2E5FA 5CB6A 3ZZMA 4P80A 1I9GA 1VL2A 2XODA 2XZPA 3HSYA 5DX1A 2LIVA 2X9LA 4KODA 2I7TA 2AHYA 3Q9SA 4PRZA 3S2EA 5M3BA 3L1HA 1MTOA 3H65A 1XQ9A 2YHBA 3OIVA 2VEDA 4WJKB 2IEDA 1SZDA 5LD2B 2FFBA 3U17A 5E4YA 3FPHA 2B9ZA 3NASA 1Y3CE 1RQ7A 4B8ZA 2DWOA 2C2GA 3ECSA 4EHFA 3C5CA 4Q4JB 1H8HA 3GAZA 1G42A 3A14A 4QSHA 2Z6AA 2E21A 1US8B 2N05A 4YRQA 4L5IA 3QKIA 5C32A 3H1EA 1E9EA 2EDAA 4TWKA 4Z9XA 4HRWA 2DFKB 1W4ZA 2O52A 4CBCA 4LRWA 3W5AA 1T4CB 3PYLA 3J7AC 1JJ2U 2IXDA 1EDDA 3JAWB 1JG2A 3L7JA 3EJ6A 4Z4FA 1JEEA 4MVOA 4JLKA 3KR2A 3ZGXA 3R8CA 3GJ0A 3BKXA 4LGVA 1Z12A 4ITVA 1R5OA 2HNKA 5EYPA 1QV9A 2EARA 3OT7A 4E1BA 5CFNA 2ZDIC 4L9RA 2BCCH 1QDUA 4FD3A 4DK1A 3JQDA 3H5IA 5C2JB 3DO6A 5C5IA 1V3TA 2PRSA 4DMHA 2OWDA 5THQA 4GOLD 4WCFC 3OT1A 2G5GX 3RJ5A 1ZMTA 4FE3A 3BK7A 3OZIA 4FYXA 2BEKA 1N1DA 3Q9NA 3TNYA 1T9KA 5REQB 1NJGA 3R3YA 3IAS1 4EI2A 3OC0A 4E13A 5A9GA 3TM4A 3PLNA 3TJMA 2G1UA 3TW8B 1M8KA 2OV4A 4XUDA 4BNNA 4AUEA 3R6LA 3LFHA 3V1YA 4DJ5X 3NHAA 3FOZA 4CKCA 2QW0X 5AJYA 3EVKA 2HV9A 4F2PA 5BSRA 3FGNA 1XU9A 1WSAA 2EKQA 3ZHBA 4JI8O 2COUA 1SVMA 1VCNA 1W6RA 1KC3A 2GEUA 4Y3UA 4BZPA 1P5JA 1EGQA 2H1HA 4FDMA 3K71B 4OV6B 1QK5A 3PN1A 1E66A 4YONB 5B1IA 2CNWA 2I4MA 2QTZA 4NC9A 4XUCA 1F3OA 4H4DA 5CH8A 2QVBA 3ZLJA 2QRPA 2F1OA 2H1WA 3CCBA 2VYVD 4E5MA 1NMQA 1XDGA 4ZKEA 4NFHA 1D9ZA 4OSOA 4EKWA 2D5IA 2IPAB 1R18A 2GGSA 5HF5A 1T5EA 3UMGA 4JCOA