1OZ0A

Crystal structure of the homodimeric bifunctional transformylase and cyclohydrolase enzyme avian atic in complex with a multisubstrate adduct inhibitor beta-dadf.
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Avian AICAR Transformylase with a Multisubstrate Adduct Inhibitor beta-DADF Identifies the Folate Binding Site.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
molecule keywords Bifunctional purine biosynthesis protein PURH
total genus 201
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2003-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1oz0A01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1oz0A04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1oz0A03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1oz0A02
1C3OA 5H3LA 1PKXA 1CS0A 2XW6A 1OZ0A 1T36A 1A9XA 1M9NA 1WO8A 2B1IA 1BXRA 2IU0A 1IK4A 1M6VA 1PL0A 1G8MA 1P4RA 1B93A 2YVQA 4A1OA 1KEEA 4EHIA 2IU3A 1EGHA 1JDBB 2X8WA 2B1GA 1THZA 3ZZMA 1ZCZA 1S89A 1C30A 1S8AA 1CE8A 1VMDA
chains in the Genus database with same CATH superfamily
1SBCA 4IV5A 4RGYA 1TK3A 5AJZA 2ZE5A 5D7NA 1KBQA 4RA9A 3K0BA 1Q3EA 2Q3FA 3DDOA 4XRGA 5JG7A 4KBGA 3AG3B 5JS1A 1XCGB 1IUOA 2RH5A 1XHEA 5AICA 5DCWA 1PT7A 2AB0A 2BT4A 4BGIA 3MHTA 3FN4A 3PDIA 3PXXA 5BWNA 1TUBB 3FWPA 3ZEFB 1GAJA 3OX4A 2PKXA 2H51A 1PEAA 4XCQA 4ZRMA 2B6NA 4FQ7A 4EEZA 4WX2B 1M1XB 5CP8A 3GOQA 2NSLA 3PLRA 2E18A 2H4WA 3E9RA 1NP6A 1L1QA 2R25B 2C7PA 1PD3A 5LXTB 3TLGB 1YRQA 4ZOEA 2XAFA 3NDPA 1VKJA 5KTKA 1OV6A 5FTLA 2JFXA 4WXRA 4YRBA 3T9FA 4I43B 3EWSA 4LZPA 4DR6B 4S24A 2R7LA 3RSSA 4JYZA 1IBKB 1Y82A 2C7RA 4MZDA 2GEUA 5HIJA 3DMFA 4QG7A 3KZ1E 4HTAA 1SXJB 3UHJA 4X20B 4CN9A 4WESA 2IA5A 2RAUA 3FTEA 3TTUA 2C58A 2JW5A 3QXHA 1I51A 2QN2A 1TJ5A 4NFLA 4OHXA 3ETDA 4WFFA 1ZJYA 3OPXA 5DSZA 1ODTC 4FLWA 2WOOA 3IQHX 4LF8O 1HDRA 3BGWA 1DEOA 3T1OA 4C01A 3F3MA 5AIBA 1B8PA 4X91A 2ACWA 5HRCA 4AJ2A 1G98A 3QJGA 1ICIA 4DLTA 2WQ7A 4HDNA 3VR5A 1Z7YA 2JHAA 4DQXA 2KB0A 1G3MA 1Y4UA 4JGBA 3A9SA 2DETA 1ZK3A 3RUCA 1GNVA 2IXAA 3N8DA 3NASA 4LOHA 4N3NA 1H2WA 2PUTA 2PX2A 1WUIS 2XDYA 4ZI2A 1QOZA 4B7ZA 5BSRA 4K6MA 3B1KA 3VH4A 1Y7HA 1XEWY 1II8B 2W7TA 2XSZA 3BS4A 3KUCA 3LQ4A 1DO0A 5KYXA 4ZANA 3DC2A 2C2ZA 2CNLA 4MRMB 2P2CA 2H3EA 1NYRA 1Y98A 2DEUA 1BQZA 3RTEA 1JDBB 2R8OA 3OMXA 1ZNZA 1EIWA 3G6EV 5KOHB 4JJ4A 1UC8A 4YUYA 3G1UA 2V6JA 4Q7EA 3MTEA 4P5PA 3L7LA 1NFFA 1LY1A 3FNBA 3WZLA 6Q21A 5BUSA 4AKGA 4TT3A 2FG7C 2ONZA 3IFXA 4LGYA 4OTZA 3TW4A 3BT7A 1C0IA 1AI4A 1B04A 5CMUA 1GT91 3KJFA 3O8DA 4HLQB 3VU0A 1YF3A 1B15A 3ETCA 4HC4A 5EIOA 1XEWX 5HE9A 1VQ6V 3EA5A 3HR4A 1RRCA 3R9WA 2C3YA 1NHGA 4NOMA 1HE1C 1Q95A 3KYJB 3V4FA 4FZJA 4KXQA 5E95A 1E3MA 1ABBA 3MMNA 1EZ4A 3LT0A 2MHCA 3KLBA 4K7JA 3QELB 4CTJA 4TS9A 3QLVC 1RQNA 4XR4A 4CEIB 2GO1A 3DOEA 5E3JA 5TVKA 2FUCA 3PPVA 1XNJA 4UUNA 1NQOA 3PXEA 1ORHA 4MO9A 5I8WA 1GV0A 3L9WA 4XDYA 4B6GA 1Y66A 2RDMA 5BWBA 1Z0SA 2C8KA 4FOPA 1YR7A 2HVKC 3GC6A 2PUWA 2XOKA 1K08A 1YR6A 4Q9JA 1HQYE 2Z8YA 3K6RA 4I2VA 4NP6A 4RKFA 3OOYA 1ZD9A 1K7DA 2GYVA 3DLTA 3L8HA 3HADA 1RI4A 2NYUA 1GPKA 1K8XB 3ABZA 3L6RA 4U6NA 2MYPA 4FLMA 3OQOA 1YCGA 4A1FA 2OL4A 4R8CA 2A06H 4PA7A 5DHTA 4M76B 3NHYA 4XDHA 2GM4A 1VL5A 1XPUA 5K8VA 1ZM3A 2VRNA 2KWIA 1B7GO 2BKLA 2OZPA 2B8WA 2QLNA 4QL3A 2IOQA 4CKEB 3QLJA 1C4WA 3WY9A 1MJ5A 4ITRC 2ZIZA 3AXSA 4E70A 4N3CA 5IFKA 2C2MA 3K8ZA 4CQJA 3UTDA 1N92A 4I3FA 3M5PA 1NNEA 5CIWA 4KE6A 2UUAO 3WGVA 4YT8A 1SCKA 2V7EA 4QVKA 3RZUA 1ATZA 5IBRA 2WJ4A 2XOXA 5FUXA 4HVTA 4A27A 3U4QA 2ZWPA 3H2BA 3ZD9A 3U81A 3Q72A 3SF8B 3O38A 2H2GA 5EXTA 3AETB 3CF4A 2B83A 4JI5O 1EKXA 4B3IA 3C8ZA 2Q5CA 3IT2A 1XVLA 4O4LF 1X1SA 1WTCA 4A6EA 1HEIA 4IL6Z 4DV7B 1MCZA 2NWQA 4AO8A 1C7QA 1AS2A 4K28A 4DPMA 1XN1A 3M4XA 2G6VA 4LMRA 3JYQA 1JI0A 4F93B 4XGRA 4UUJC 3S7ZA 2AFVA 3SZLA 4AXBA 5LKRA 3MF4A 2FPUA 2HJDA 2W6QA 3HO8A 4GSLA 4QU0A 4MQEA 4GKJB 1C1DA 1NF9A 3OETA 4MUGA 3RI3A 3RG2A 3G67A 3AM4A 3E7FA 4N5MA 5LLSA 1JHUA 2GOYA 4ENPA 1K5HA 3L7NA 3LBAA 3BICA 4BNGA 3A1SA 4KE8A 3UWKA 3H11B 5DBGA 3MD0A 2GPNA 3H1JH 5JSKA 3DKPA 3M70A 4Z1VA 2EJWA 3D5QA 1AXEA 3AK2A 2WTNA 4G1MB 5BQOA 3SDSA 3ZNPA 5JTTA 4CL8A 1ZU5A 4HCJA 2I03A 4N5DA 5FPQA 3NHMA 3AV0B 3JQFC 2YYAA 1J0CA 3DOHA 3RRFA 3CKYA 3VR2A 3GAAA 3ZIUA 4CJXA 4D92A 5JQWA 2ZU6A 3RVRA 4EPTA 3SAJA 1Y9EA 2AWNA 4B7XA 3H5AA 2JKZA 5CH5A 1V3UA 2NU6B 2V8OA 2YNMA 2ZI9A 3LW8A 1OAKA 5HF9A 1E20A 1LLDA 1SB8A 4C0QC 4C20A 3EFBA 3HVJA 2W6MA 3F7MA 3L1UA 4OFXA 2H4XA 2IY7A 3SU8A 2VDOB 2XYGA 1P2SA 1ZK1A 2XKKA 4ZIBA 1GGEA 2P2LA 3QYFA 2FYUH 2DJVA 3PQFA 5DTRA 5M5BA 3TRFA 5FBRB 4B3MB 2HK9A 4BIIA 4G8JA 5EPOA 1IBSA 2XECA 1LDMA 3UPDA 3VPXA 3FPGA 4BCCA 2ARKA 4QLBA 1JQ5A 1ND5A 1LUWA 3VFDA 1GG5A 5IXJA 1YJNV 4AJJA 1XMSA 3FKJA 1GPBA 3GCWA 1OGIA 5LSAA 5LP6C 2EDAA 4EABA 4FOTA 1YJAA 1SKVA 1YD7A 3AM3A 4MYUA 3I58A 1U6JA 3O94A 4FVTA 4PLFA 3U6BA 3JQ6A 1XHXA 1EFVA 2WLIA 3AUXA 3RUIA 1DVRA 4OA5A 3GLIB 2YZNA 4WVLA 3FOEC 5EHGA 3ZS8A 4EG3A 4WBNB 4HNTA 3WG7C 3WLPA 1JKJA 3BSSA 4QLAA 1QHHB 2FFBA 4ZCRA 1GA6A 1XQ1A 4FYIA 2OPHA 4QTUB 3PIIA 1AQ6A 1YCDA 4GICA 4Q9LA 4XQCA 3GJRA 2VYND 1YFJA 4QJBA 3CRMA 2PANA 1OJLA 2H1LA 2R8ZA 1VQ7V 2V6BA 2ZUCA 4MDYA 1XIVA 3FSEA 3R8XA 4B6SA 4IHKA 4ENRA 3UICA 4MUBA 3NPMA 4LCOA 4UXNA 3N8GA 4YXFA 3HK2A 2ITCC 2P3SA 2XMCA 3G0OA 1JIVA 1SO8A 1YAJA 3HR0A 2W4MA 2WTMA 1FXWA 3BWBA 3X2SA 4GBGA 4CQLA 1ZVJA 4XUCA 3ITDA 2V0NA 1U0TA 4OOEA 5KQPA 2R5WA 2VT3A 2VZ0A 3L49A 3TTSA 4J8PA 3IAYA 3C6MA 3RC7A 5KHLB 2GCGA 4CQLB 2VK1A 3OHPA 1ABEA 1KEUA 4TWRA 1O6ZA 5SY9A 1YACA 1M2JA 2HLDD 3K30A 1KJ9A 4W9RA 1FSGA 2F4VO 3BFRA 2RGNA 3LP8A 4B0PA 4BFLA 2QYOA 2YZ7A 1F6BA 3PNBA 5DIZA 2OHVA 4CMCA 4IFEA 2X4DA 3NO4A 3O92A 3U7EB 3AM5A 1A5TA 4DUYB 5EXPA 4HDRA 4LAFA 5L53A 4HX9A 3LMKA 5EIAA 1U7PA 3WU2Z 4TSFD 3GJZA 3VZBA 1B74A 1GN9A 3GA5A 3AP1A 1GNTA 1J7JA 1A9RA 2CVHA 2BJHA 2H18A 1KYOF 3BY6A 4IMJB 1M8FA 1RRKA 4KFSA 3FTDA 3RS4A 1E6KA 3JQ9C 3IEVA 4MRVA 4IW3B 1SGWA 4UFZA 4KTTE 1B06A 1D5NA 1U0JA 1CVLA 1DTSA 5FBWB 4BEVA 3FNRA 4D9NA 3WGKA 3UWDA 2IUTA 2IKSA 2AN3A 4I0XB 3U0BA 5ERYA 1RM3A 1JHDA 5I7OA 1JR3E 2V0CA 3DDZX 3DG9A 2PT5A 3O9MA 1PDVA 2O2GA 5PNTA 3I55V 4CS4A 2HDHA 2OO7A 2X42A 4RUEA 4PCVA 3SHWA 3NM4A 1SXJD 4HTFB 3BRWA 3OX2A 3FYUB 4Y0NA 3HM9A 4D3YA 1WWKA 3LC7O 1RHUA 2XMGA 4CH3A 1T43A 1KBHA 1IAQA 1LNSA 2FHSA 2XUZA 4IRXA 3UXEA 1OH5A 3O7WA 4BVFA 2IPXA 1MD9A 3NDJA 3TK1A 1GRCA 2DAPA 3O2QB 3FUWA 4TTVA 1C9KA 2ERCA 3VU9A 3QXGA 5LHGA 3WXBA 1RLTA 3MPZA 1G6UA 1WXEA 3P52A 3O4IA 5BXZA 3PGLA 4XB6B 2Z3VA 2EHDA 2PYZA 5JRJA 4DQLA 2H29A 2VF2A 2ZAYA 4WK4B 1NJSA 2IYRA 3L0PA 4J90A 3D31A 1PFYA 1HDJA 4RQUA 1SKYE 2CJWA 5L9AA 4IZHA 3G9TA 4JLNA 1Z3CA 4PI2A 1CS4C 2WHQA 4FNGA 3LDAA 3V80A 3R9XA 2AVDA 4PGFA 4HNAA 2A8NA 4YV7A 2R8BA 2W2VA 4UVAA 3OJOA 5ILOA 4ASUD 3IV9A 1NVEA 4FT2A 4OSPA 4E5VA 4J7ZA 2PL1A 4X20A 4GX1A 2CVOA 5CEEA 3GLTA 1N2SA 1T2AA 4K46A 1UT5A 4F8EA 3G8YA 3KVNA 1H2AS 3B70A 4PO8A 4HAWA 4BO5A 1E3JA 1ZD2P 2HIGA 1ZJWA 1V54C 2PWAA 1VSTA 3ET5A 3GD5A 2IUYA 1DAHA 2D5LA 2G40A 3MEQA 3NAQA 4M99A 4MIOA 3S8EA 2JPDA 4DJJA 1G2IA 1H2EA 3UK1A 3EVAA 1U1CA 4MINA 1NFQA 1ZY2A 2AXEA 5JNUA 1PL6A 5KYUA 2BFEB 1U8AA 4N12A 3RWOA 4AJOA 1DJQA 3UGQA 3A14A 4BASA 5JXJA 1WVMA 2FGJA 1Y0BA 2CYAA 2FWRA 2XWSA 2ZRDA 3E48A 3LUCA 3RO7A 4YPVA 3KDAA 1SWVA 1WBBA 1TQHA 1Y3AA 2PUAA 2X1LA 2YJZA 1F12A 1L7MA 2J0UB 2VXYA 4BNHA 5KX5F 1ZHOA 4HDNB 1IBLB 1MO4A 3I9LA 1S5HC 1T3GA 2YW2A 3K09A 3SYTA 1DQYA 3VNAA 3CB2A 1Q84A 4LZAA 1M8KA 2GAAA 4BYMA 2G6BA 4EA9A 5I7EA 1KZ6A 5CK5A 1Z0KA 3O47A 2AL7A 5CVJA 1LD3A 3UNXA 1PP9H 2P2GA 1J8QA 2WNIA 3AFMA 5KHAA 3ZX4A 3B53X 4J80A 4J43A 3DVRX 4ZO6A 2HMWA 4DL9A 4NPHA 1KDYA 2V96A 3WP0A 5DOVA 1T4MA 5B1OA 3MOGA 1OSNA 3PVSA 1A2BA 2BCJQ 4BZXA 1M2NA 4TTIA 1SXJA 1BNCA 2QP3A 3WG9A 3H86A 2XGGA 5ALKA 2BHTA 3N0TA 3O1HB 3Q7RA 5U1PA 3SG0A 1ILEA 4JR1A 4YJDA 1CZOA 4XBFA 2QT0A 4GIBA 5IYZB 1SKYB 4EG0A 4AS3A 4BB0A 1SBQA 4E22A 3U4MA 5KOYA 1WUJS 3U7IA 4IAOA 2N42A 3CT6A 1OWLA 1ZVVA 4NH0A 5HIAA 3RVBA 4KR3A 1OCZC 1NYQA 4ENVA 3VYTB 4FGLA 1IWOA 5J63A 4YDQA 3H2ZA 4R1QA 2PXCA 1WU8A 4P4UA 3WGQA 1ORDA 2O2XA 1UPCA 1CERA 4IY1A 4TT3D 1DBRA 1DPGA 1V4BA 4ZEOA 4FFSA 3OZFA 3EIWA 3A1UA 4MUIA 1H9BA 4Q6WA 4NTYA 1HLFA 3UOAB 2X7HA 3P2KA 2B7LA 4UQLA 4MUFA 1DJPA 3KTOA 3ZY6A 3OPYB 4DADA 3JQEA 1NNSA 3JRWA 1SOWA 3DBIA 2BSKA 1XDZA 5ARDA 3R0QA 2DLCX 1CUZA 4LHEA 2G9UA 4G41A 2HK8A 2B9EA 4TV9A 1AR1B 4S3MA 1T5OA 4C0AC 4WRRA 4HK4A 3E82A 2O2SA 3OLWA 2VDMB 5AI5A 3M9XA 3W6OA 1ZMXA 2CUNA 3L0IB 4H3KB 4TL9A 4ER5A 3VOSA 3L82B 5HHTA 3EHEA 4UFNA 3IDOA 1KFBB 2V1DA 1EAYA 4UKDA 1GFZA 3SPIA 1W34A 1Z9BA 3OZGA 4MUJA 2JB9A 1N9ZA 3EVZA 5AKJA 3LLUA 3TOSA 1KMIZ 3WK6A 4JTAB 2HDOA 3LDUA 2RI6A 4IQ8A 1VF6C 4CC6A 4UUQA 2Q9AA 1N6PA 2LR0A 2QTAA 3IELA 5THKA 2WM2A 1E2GA 3O4JA 2HVVA 2ZPTX 3GXOA 4CF5A 2JH3A 3BWXA 4Y3UA 3ETGA 4NZOA 2AYYA 2J3JA 1ENPA 4JHXA 1MTOA 3CF4G 3GEGA 4P2BA 1Q2XA 2QM3A 3TAHA 5I7RA 4Q3CA 3SYOA 4X66O 3C7TA 4DCUA 2IF2A 1WBDA 3DNPA 1V1RA 2IQIA 2XNDA 5DWQA 2PX0A 4PNEA 5LD2C 1MX1A 3HRIA 2XUPA 3ND5A 1N0UA 1QBGA 2XB4A 2Q4TA 5TR9A 4AJPA 2C7QA 3BD8A 3RC8A 2AXNA 3IGFA 4TQFA 2C97A 2WAXA 4L8VA 4JI8O 4OJYA 1C3EA 4E09A 1YZTA 4PBRA 3RKUA 3KSZO 1L9KA 2ZZKA 3IUYA 3PC3A 1T34A 5DGHA 1ZL8A 4R8SA 2B7CA 2BEUB 2W5UA 4K3VA 4OOFA 4I55B 1X77A 3RFRA 3LUTB 1YKFA 1GRRA 2VK8A 4MW6A 4MYCA 5G2OA 1OVGA 3ZU2A 5MFPA 4RZ2A 2QR3A 1BFUA 3GRRA 3ZS8C 3C74A 2ODPA 1WEKA 4OX9O 3QFSA 3JD1A 4F2DA 1EBFA 1KOJA 1R6BX 1LH0A 1V4NA 2Q99A 2ZTHA 3CJRA 1RKBA 2XUFA 3I1IA 5LZ7A 1E1QG 2CV0A 5CEJA 3RYCA 4RD1A 4DDWA 3OFNG 2ZYWX 1EB8A 1FXKC 3F3SA 4OMCA 3U4QB 4ZHQF 1PNVA 1BHO1 3KQWA 2IW5A 1KFCB 2EVWX 2ZOSA 3BIOA 2YRXA 3H2HA 5KVAA 1X19A 3HUTA 1SD5A 3G2IA 2EKZA 4NDZA 4BKRA 4MVWA 4MSMA 1R5BA 4QC2A 1KSFX 2BGRA 3FPSA 4LNUB 1FYWA 3CN7A 5A4FS 1KTVA 3EUEA 1IWBB 4ZQGA 5L3EA 2VPXA 5KBYA 2JJYA 7MHTA 2AT1A 2HPAA 2YY6A 1NPTO 4EPVA 5K0EA 1EWQA 1GARA 2IEZA 2P4UA 2IYPA 3MCVA 1X94A 3W5BA 5KAMA 3VHXA 2YKGA 2BHRA 4YXWD 4Y0VA 2EKBA 4EJMA 3TW6A 1VLQA 4CH6A 2WYIA 3M1YA 4Z4CA 3FYSA 1MT3A 3CX8A 4TLEA 5JBIA 2GCNA 2GAJA 4RIHA 1XD8A 3NHFA 3L74H 1NJ5A 2QEQA 1CXZA 1WUKS 3E8MA 3RW0A 1E2KA 4QJIA 3VZRA 4PIVA 4DUPA 3F7TA 4B44A 4TMWA 1QC5B 2VHZA 1EFRA 4H7DA 1GUZA 2P9HA 3F4LA 1DRVA 1JDPA 1XL1A 2Z5LA 4U02A 2JGUA 1DCFA 1AKUA 1G66A 1B3BA 1GQQA 3PHJA 4GRAA 4L0CA 5D85A 4B7EA 2Q6TA 3B9PA 4TWKA 3KWMA 1HT1E 2FN7A 2Y9PB 3SJCA 3ISJA 4ZAGA 5LQRA 3L8MA 4RTOA 4PPQA 3AR2A 3LA8A 1VJ0A 1E7SA 1GZSA 4LFCB 1ENVA 1G8SA 2JAWA 1KYIA 2JI6A 1XC7A 1CE8B 2YV3A 3IOCA 4GVLA 4NU8X 4EW3A 3RNOA 5K9ZA 4EY5A 4BGEA 5L3SA 4H59A 4V0NA 4Q9HA 3BXGA 1BMFA 1LB1B 1XOIA 1QCZA 3C3EA 2H0AA 3G2MA 3H84A 3J81k 1IVSA 1U81A 2OHHA 4RDXA 3JAKB 3DP9A 5AVOA 2D3TA 4A15A 1WKBA 4CM1A 3QVGA 1QGYA 3IB6A 4GL4A 5AW6A 5CIQA 5T4EA 5EP3A 2P65A 5KOHA 4HN9A 3OJWA 2GEBA 4TSRA 5DRTA 3CNQS 4WUVA 4YRKA 2ZSUA 3WK4A 2BE9A 2ZRKA 3DW3X 5DI9A 1JIIA 4AF6A 4Z7OB 4EVSA 4P7KA 3PC4A 2J45A 3ABIA 1YOBA 2YQ5A 4I1IA 3K73O 5EE3A 3I2HA 4NICA 3QWFA 3AINA 1E6EA 2AIRA 4FFKA 2F3RA 2XE8A 3A1WA 4LWOA 4MT8A 4H37A 5FX2A 4TYQA 3HXMA 3G5LA 1CR0A 1NMXA 1R0XA 4R2JA 5FV7A 2XNCA 1NGSA 4LV6A 2E37A 1P7BA 4JZKA 4U3JA 1Q20A 3EIFA 3R1IA 2E49A 3C98A 5BV2P 1FSZA 2JZOA 1P4RA 4DR5O 1ISSA 3IJFX 1DFGA 4UHKA 1JQ0A 3ASVA 5LLDA 1K7EB 2P06A 3C3JA 1M2FA 4QM6A 1GKYA 2ZJZA 1VF5B 3E61A 1EN6A 5IYDO 2Y0EA 4M21A 5KWIA 1K66A 1TKRA 4KI7A 3KUDA 4NCXA 3F8SA 1AS3A 4J1QA 2ZTMA 2JVJA 4EW6A 3TJRA 1G63A 4AW9A 2JL1A 1JZQA 1RXSA 2YWJA 4C1BA 1KS2A 3A9VA 1M1UA 5B6PA 1PQWA 4EMSA 2PWPA 4OM7A 3W5HA 1TB4A 1OREA 3PFWO 1QDEA 1Z5NA 1H6DA 3ROQA 4DMLA 3HCRA 3D0QA 4G8DA 2I9KA 3R6GA 1CETA 4JAUA 1PNKA 1SC9A 3O9ZA 1P4HA 2HBRA 2W6ZA 3H42B 3PHBE 2BDUA 2EIKC 1D4ZA 3IAM1 3LF2A 4LXHA 3F2VA 4FILA 2C7BA 1K8RA 3WGIA 2B3JA 3CH5A 2K5UA 4UTXA 3NTQA 3UMGA 3SBGA 2XLBA 4BO8A 2IDJA 3Q2IA 7YASA 2O96A 4F04A 4X7MA 5IJ9A 3ND9A 3WR5A 3UKDA 4EYSA 1BQEA 1PWZA 1WUYA 4Q15A 2EFHB 2J0QA 3K2EA 1DKPA 2G63A 3ADOA 5I9MA 4NZNA 4YNBA 5JOQA 3NOXA 4INJA 5JATA 1CC1S 4K9PA 5A0TA 3UM7A 3AB7A 3T3EA 4C4PA 4ZIRA 2O8BB 3P27A 3H83A 1E96A 1ZRSA 5JDCA 5L3RA 3SVLA 1YA8A 4DJAA 2O5CA 4R98A 4C1NA 2JFVA 1FLVA 1FNDA 3HC7A 1QO0A 3SQNA 4DV5B 3TQSA 4QU8A 3EY4A 1TZMA 2FWIA 2PTMA 3FDZA 3L6CA 3IQDB 4F4CA 4KV9A 1M6WA 1XLTC 1K92A 2NU9A 4Y2JA 4F7DA 4RJIA 3ZMUA 3ZE6A 3GLHB 5BUZA 1T8PA 4GP9A 1C9DB 1JR4A 4S2EA 4YT4A 3U61B 1XILA 2QZJA 5DASA 2QTTA 1UWLA 3HEMA 5DXAA 1VYHA 4J4BA 3SC4A 2JBAB 3RVOA 3THWB 3U5ZB 2PZEA 2MJLA 4BE7B 2GF2A 2WNSA 3LA6A 1JDSA 1VJRA 3ZLBA 3AVWA 4GP6A 3LHDA 3JQBC 4GUDA 1LDBA 1P8AA 2QRPA 4NTXA 1MAHA 3DKKA 4P38A 3KV3O 2RI0A 2VYVD 5CXSA 4RE6A 5CCEA 4DPLA 2Q7GA 2AXQA 4AY5A 4HT3B 2B7BA 3U48A 2INGX 2Q3JA 2X13A 3ELDA 4NBKA 5AI8A 1ESEA 4HWOA 5C1PA 2AMYA 3THYB 1DE0A 4EJSC 4DM7A 1ZKDA 1AMOA 1Y4SA 3DWEX 3B85A 4AO7A 1U63A 4P3YA 4J9ZB 4LH6A 4ID9A 2EJVA 5GV8A 1E2FA 4PSKA 5AYVA 3WMRA 3SXUB 4NXNO 2MDTA 1PTKA 2OCKA 4KSYA 3TPFA 1W47A 1JQKA 2GNAA 1Q1GA 3U7JA 3VBBA 1VRVA 3UGTA 1YU6A 3FHLA 5ALMA 3MT0A 1W85B 4JR2A 4IVPA 1BFDA 2BV3A 2CXOA 1Z6AA 2Y27A 1YB1A 3ETJA 3FIJA 3N2LA 1FUKA 5KUKA 1GTRA 1A04A 1TZBA 2HRQA 4AFNA 4DNQA 3N39C 1EX9A 3ZNNA 1P4SA 2H1CA 2B82A 2UKDA 3JSAA 4L3VA 4QBIA 4F46A 3DR3A 1DOAA 2XNDG 3V8QA 2V9CA 4DNXA 2WIKA 4IM7A 1YHYA 5EJ2A 3OTFA 2DQZA 1KETA 3MTAA 1PM9A 4OQDA 5F4BA 3DLBA 1Y3FE 5J2UB 2Z2YA 4BRZA 3LGXA 4F5YA 3MUOA 3CX3A 3BMOA 4OHPA 5C81A 2ZT5A 4J16A 1KQNA 1KKCA 4X24A 1JEAA 4Z0TA 2JI9A 3OH8A 3WAGA 1KK0A 2B4KA 1SHUX 1KECA 4J49A 2CFRA 4MRAA 1I30A 1M2VA 2YC2C 3G2KA 4CLHA 4EGJA 4PA4A 1E32A 3B2EE 1OD6A 4M6WA 1PUXA 3IJPA 3ZJTA 4BFVA 5M52C 1LPOA 3LSSA 1FFCA 1SOVA 5D3KA 3Q0EA 2WWVD 3QUCA 3BREA 2GYYA 3GLKA 5MN6A 3I0ZA 5JYCA 5ITVA 2AN9A 3FFAA 2CMHA 3WSVA 4JBWA 3UM9A 4F6RA 3RFTA 2NO1A 3AI3A 1O6FA 1QYRA 3DTVB 5ARCA 4F38A 3FOWA 1VECA 2ZIFA 2H4ZA 3GARA 4XWYA 1QHIA 3E3OA 2V03A 2PZSA 1Q43A 1U7DA 2IXFA 4AJLA 2XY4A 2ZYGA 2F48A 1D7OA 1JU3A 2GJSA 2X76A 4NE9A 4O33A 4BVEA 2W2OA 3ER9A 3IE1A 3NTLA 5I7WA 2OTCA 4DRZA 2FW8A 4JYPA 1TCVA 1NTKH 5C18A 1DX9A 4EB6A 2NZYA 1FDSA 4GI1A 4KAJA 5BQ3A 3KEFA 2O1WA 1M34A 4A6DA 4XB2A 1CJCA 4BV8A 3Q41A 4ZDKA 4LXYA 2ZLBA 1E59A 3K4QA 1V5GA 5FFFA 3BRCA 1MW9X 2C0QA 3EQ9A 1ZL8B 2DY1A 3FVQA 3GRCA 5L3VA 5DNUA 1Z2AA 1YVWA 3CQ9A 4KYTA 4BBJA 3JQRA 1BROA 4EF6A 1DBWA 2JZCA 4KQ9A 3DGEA 3M6XA 1TTPB 2E89A 3OC6A 2O8VA 1ZH6A 2OHOA 4DR7B 2DTDA 2Q2NA 1TI7A 1MZEA 1KIMA 3TETA 3RSLA 3USCS 1ZMBA 3FAVA 2J5RA 4K6FA 4BX8A 5JLAA 1Y3CE 3F1KA 2O8DB 1MB0A 3IE2A 5CYGA 3PL5A 4RMNA 3LQ1A 1KJIA 4DCSA 4TSFA 4ABYA 2C5BA 2BFMA 1JGTA 1UBSB 2Z2JA 5H80A 3W6ZA 4CIDA 1HE3A 3MCUA 4CM9A 5C80A 2JLWA 4BLSA 1TLFA 4DPKA 1TF7A 2JIZG 3QU5A 4IDQA 2A9KA 4FPPA 1FZTA 4IIEA 5CBHA 3SICE 5HJ7A 1L7PA 3C70A 4HYYA 1Z34A 3VR4A 4AROA 4X92A 3WLRA 1UQRA 4RMHA 5IY5C 1F8YA 1VCHA 4B1FA 1W76A 2ACVA 1NXOA 1XDDA 2JH9A 4G1BA 4YMTA 5JZBA 3F97A 1W46A 2OCLA 4I3GA 5ECWA 3SJBC 5GQSA 3RREA 3RS7A 2Q0AA 3A6FA 2J0SA 3JZAA 1NKTA 2ONCA 4NOLA 1QHFA 4I8XA 3AFIA 5AFSA 2C9ZA 3TL6A 1S5LZ 2F1MA 5HFLA 2AKAB 3Q3EA 3UK0A 3ZPCA 1DV2A 1PD1A 5J9FA 3PRYA 4ROTA 3K8YA 2XYQA 3M2PA 5HOQA 4YRAA 1QBKC 4B48A 3LCMA 1MORA 2UXBB 4LDAA 2OLEA 3KQOA 2PAFA 4H0FA 3QK7A 5ANRB 5KPJA 1WSAA 1DAGA 2G04A 4PWYA 3V8MA 2AA3A 3MB8A 1U80A 4Y1GA 3DBVO 3W8FA 4FHCA 1QR9A 4XJTA 2WYOA 1R5OA 3ORFA 2HWUA 3W06A 4A8PA 4BVLA 4PSUA 2DKNA 1JTKA 3U37A 2CKMA 1QR2A 3VR6A 4YQEA 3HXOA 5FBVB 3BHIA 4DV5O 1TQ6A 1MLDA 2HF2A 1YI1A 4GKBA 4RLFA 4A7PA 1JAIA 3I5DA 1Y8QB 2KBFA 1HQDA 3DFMA 4BPRA 4JXEA 1P72A 3OJ0A 1X86B 3M83A 4HNQA 4BZPA 3H0KA 1P9RA 3O2JA 3TKYA 2X3FA 5C51B 2OQIA 1EBOA 4JNKA 3DOIA 3JYOA 1TRHA 3DW1X 2JIQA 5AVRA 1YGYA 5EZ5A 3N6VA 4QEKA 3AW9A 4FD3A 3HKDA 4I08A 1VYTA 2ET6A 1GPAA 3CNLA 4I81A 3KOUA 4Q4LA 1XQXA 1L5GB 3OF5A 5LB4A 4I36A 5SZJA 2DT5A 1IQ0A 1NRXA 1Q17A 5IMSA 3R09A 3EUFA 3I5AA 1XVTA 1M2EA 3WI7A 2J48A 2XHEA 2E4WA 3G68A 4HQ6A 1KMQA 1Z6GA 2R5FA 3Q85A 5AI9A 3KETA 5DNEA 3N3BC 4UHEA 4DZTA 1V1RB 1CNFA 1N2HA 2R85A 4F92B 1NUHA 4IDCA 1I3CA 4G5SA 3OZWA 2JEOA 3QU9A 2WSSG 1PFUA 3FX2A 2R6DA 4PONA 2Y8EA 1LDYA 1CY8A 2J46A 4N1AA 3NT2A 3DZKA 3ICCA 3ZE1B 2G4LA 2W2XA 4KVFA 5TT0A 4RHFA 3RB8A 3JALB 4K0KO 3C7KA 1Z35A 5J2UA 2CXPA 3H9QA 1YITV 5TE9A 3VSEA 4CM4A 1PL7A 4INOA 4PIMA 5CPFA 4P33A 4PRKA 1HLDA 2Y4UA 1LVUA 3ZX5A 1TJPB 3LSTA 5GOZA 5KTMA 3I5YA 1AF2A 3KSDO 4LYAA 4LFBO 1EGAA 1MDBA 2BBOA 1Y1PA 3KALA 5C3MA 4UQOA 1UDCA 3B6JA 3L4BA 4X6YA 4V2IA 4Y9DA 5AR1A 1LBHA 3IT0A 3OZXA 4MQ6A 3U44A 3HDJA 4C2UA 1PZNA 2F1KA 3AEXA 1ZCJA 1BRMA 1U0RA 3C3YA 3UBMA 4FMCF 2A0LA 5FLXA 3F78A 4JMPA 1H1LA 1NI4A 4QT0A 4WF9V 4FM1A 1OU0A 2ZULA 3IKJA 4B73A 1O4WA 2QQ5A 3JR7A 3OIUA 4J7CA 2ILMA 4NS4A 4QXRA 2ZEJA 1M67A 1O94C 1RAIA 2BI7A 2R8XA 4MVJE 1SC4A 4MLDA 5HVNA 4XWOA 1Y37A 2VYQA 1NTZH 2GZRA 3ZIAA 2P9ZA 3GBSA 2V55B 1VCIA 2WM8A 4MP6A 2WMDA 3IQFA 1F3OA 3U3JA 2IW3A 5F2NA 1J1ZA 3EFOB 4L7VA 4TWIA 3PNOA 3THYA 2R7MA 5LBUA 3QTBA 4Q4HB 5EXDA 1ZN8A 3R9KA 4MA5A 1IIBA 3ADDA 3KVYA 4NXMB 1NBMA 2FFRA 3NGMA 4WCVA 3RSFA 4DMKA 5FLYA 3HXLA 5IVIA 3FMGA 3U4IA 3T7DA 2QT9A 1VHLA 3UA4A 4TMTA 3NBXX 5B3LA 4OG2A 4BLOA 4F85A 1SULA 2O5EA 1JJFA 3IALA 4BB6A 3UT6A 4HUTA 6AT1A 4EKWA 5TARA 1EXNA 1CUXA 1KK1A 3PICA 4M54A 3W5IA 4DLBA 2X6QA 5CEFA 4AWXA 1SNYA 2HW8A 2H3HA 2H2IA 4K9SA 4DQDA 1QOQB 2F3UA 3TRHA 4M1EA 2C54A 1JKJB 2YMQA 3GMIA 4MVMA 1A9SA 2X1HA 3O91A 4X0EA 5LQMA 3ZIAD 1RE0A 3IAS1 4NS1A 3GP8A 1ACLA 3A3PA 4JYAO 1EJ0A 2VRCA 4X45A 1W0JG 3DZGA 5FDFA 3NIFB 3WIBA 3NIWA 2JGDA 2VWKA 4QUBA 1I3MA 1AJPA 3NHSA 1R6VA 4ZFRA 4FGJA 2VQDA 4Z86A 1SCNE 4XB1A 4M9CA 4F3YA 2GAIA 4HLUC 3LK7A 3GCXA 1G6OA 3SXPA 2WLSA 4HUQB 4AF7A 3K6KA 1JPNA 2Y05A 2PMEA 4Z51A 2W58A 3P9CA 1CJSA 5F73A 1M2VB 3MVEA 1X39A 2WV7A 4YCAA 4AZTA 4Z4HA 5KHHA 3L75H 2PYIA 2PXXA 3R44A 4YLGA 4AKHA 4YY3B 2CUGA 4D2IA 4G63A 1Q7YW 1G5IA 2BEKA 3OBBA 3K5IA 3HU1A 5JQGF 4MQUA 4PAMA 1FFHA 4IQFA 3N2KB 1Z75A 3LUGA 3OWHA 2WUEA 1LNQA 1LPPA 4FBGA 1J25A 2HTFA 4TLCA 1AOXA 5CXXA 1Y6ZA 4LNHA 1V95A 5EIXA 2V1UA 3H1EA 4RQBA 1OT3A 3AKEA 1WZNA 1RTKA 2QWNB 3ENNA 5GTHZ 1TYBE 2CD7A 1KZ4A 2YFKA 1KD1W 1FD9A 1JG1A 2AQ8A 2FUG6 2LGQA 1PJZA 1M2GA 1YR3A 4S0ZA 5DXFA 3DC7A 3GEEA 3FHCB 4IXNA 4P7FA 3W7UA 1F6DA 1H5NA 3S27A 3BA1A 5BV0A 2HVWA 4HQOA 1VHTA 2ZJ2A 4G0NA 1PGNA 4M1WA 5BNFA 1SCDA 6REQA 1W19A 1E4EB 1ZVKA 3DKRA 4CYMA 1H2BA 4FYMA 2GJAA 3NKVA 4QDZA 1XVIA 5JWOA 5KYNA 3L7CA 3H2KA 4LYDA 1U02A 3D3EA 4Q24A 4QOFA 5KJ1A 2RB4A 1QQCA 1OH7A 4IINA 2YWBA 2B3DA 1GGKA 1UXJA 2C4KA 5K3AA 2ECQA 2PDAA 4AWBA 2ECFA 3RAFC 2PD3A 1R5JA 3L2OB 1D7AA 3L4SO 1FW8A 1EJ2A 2FR1A 2XZPA 3H2GA 1D0VA 3IULA 3WYEA 4OBEA 5DW3A 4ZD4A 3RJMA 4AI6A 1TGOA 2GTPA 3AJDA 3FPLA 1TC1A 4OP2A 3V4OA 4ANFA 2EJBA 2EW8A 1SUCA 3VKUA 4KDEA 5HZMA 5BRJA 1E2DA 3IUSA 4TL6A 2O95A 3ABSB 3T7KA 1Z5UA 2GZAA 1PR3A 5AMXA 3E9DA 5KQSA 3MFQA 4H3HB 1B1AA 2X2PA 3HJHA 4R05A 1AP5A 2ASEA 3GVXA 5DTIA 3ZI7A 4ARUA 4CMHA 2VHCA 4CEJB 1P77A 4LXUA 4J4TA 4CM3A 2I34A 3OUSA 1U5AA 1KB9F 1FRVA 1N2XA 1PBTA 1H93A 1DTWB 1FFGA 2AD5A 2H1VA 2C0CA 1YB7A 2ODWA 3FYHA 4PLZA 4AIRA 1IY1A 3SYRA 3I3SR 3NWJA 4RTMA 4YTEA 4PPGA 1ONBA 1DBPA 2OB1A 2J09A 2ZJ6A 2Y1OA 1Z2CA 3DP7A 3LUKA 1U8CB 5ALDA 3N27A 3Q6NA 4C22A 3KYBA 1WX1A 2FHPA 4WSOA 5CNMA 5EJ5A 1VJCA 3FYCA 4WHMA 5G53C 4DMUB 3RADC 2EW1A 2QM0A 2OFFA 4KLAA 3EGOA 3N6XA 4RZHA 5HZKA 1OHHA 2ZD9A 2H7CA 4KIGA 3C97A 1EFLA 5DCUA 3PDCA 2VAMA 1QIKA 3FVTA 3K0CC 5LWHA 2F3QA 1JBEA 2I6TA 1SCJA 3BSYA 2PH7A 5EKDA 1RT9A 4FLFA 1PK9A 3BXXA 3GLFE 2MWMA 4Y2HA 1PFQA 3HB1A 3KOXA 3RSCA 3WK9A 4M4SA 1E9BA 1U8YA 5AOAA 1VQOV 3OT4A 3FAZA 2Y48A 4E5YA 1U4SA 1IZ7A 1EX6A 4OH7A 3N28A 2W2MA 2DXIA 2YUIA 1N2IA 1PJLA 2VAVA 3GRAA 3ESAA 1F14A 1L5WA 1S4QA 4E31A 4MX8A 4YRFA 2PZ8A 4ITVA 3W2GA 4JI7B 2B3ZA 4LYFA 1PUIA 2AJTA 1XBLA 3IIEA 2Y1WA 5B37A 4G8CA 1SEVA 5FI1B 3WDKA 3CW9A 1KAGA 4LDQA 5T6BA 2VTBA 1NJ8A 2IZ0A 1GZ7A 2F64A 2Q8NA 2QNBA 3WGTA 3ZZ0A 3U10A 3R7AA 3I4FA 2XQFA 3PFKA 5E7MA 4AYTA 1L1RA 3SVTA 1HGXA 3BMCA 5AKEA 5CHYA 1A8QA 3FWHA 3KB6A 1I1OA 3C7DB 1ULTA 5KX5B 3MOSA 3DAHA 2EX1A 3MRVA 1K6MA 1SCIA 1T1GA 2OHGA 2QVGA 3KJNA 4IX1A 1KQOA 4S0XA 4FVMA 5JH7F 2GTIA 4G56A 1QPBA 1TADA 1YDGA 1IZ8A 3WTCA 5EXEA 2HRCA 1QRSA 1M4UA 4FTWA 2YIMA 3FZGA 1CTQA 1WB9A 1OY1A 1SBIA 4E5KA 3TXQA 3JD4A 2QORA 4ZYUA 3TQRA 4UPEA 2JLCA 2V6IA 3I9FA 2IZ5A 5ESXA 5K51A 4BTLA 4IWNA 4QUIA 5I7HA 3MUFA 3R3XA 1U2GA 4NDAA 1U94A 4NHEA 1VHDA 3EMKA 4RJ2A 4ZODA 3ZXUB 4CG2A 2IUSA 3K0FB 4TV8B 1JYEA 4LJSA 2N04A 2CLDX 1FYFA 4NMHA 3WOVA 2F90A 1QIHA 1X8KA 3TOCA 1WLEA 3MN1A 1UBCA 3W8NA 3FOZA 2RK3A 4K1XA 2O07A 1M0WA 1JJAA 1NQ5A 1G38A 4L9RA 1C9NA 4GYCB 3EEQA 3QMMA 4GLJA 4NWIA 5A7GA 4F2GA 1S0VA 3OIDA 1TX4B 1Z39A 4O2BB 4UVBA 1R0SA 1TZCA 4GXQA 4OJNA 3R9IA 1FRNA 3VI3B 3PXBA 1SA0A 2MW2B 2YIBA 3L0BA 5EZQA 3AG6A 5FLEX 2I6UA 2QTZA 3ZY2A 1EZVH 1JKIA 1LDGA 3PEFA 3AH8A 2R6FA 2X0JA 3AHIA 1UZAA 3TQIA 2FW1A 3PGVA 2AQIA 4D99A 4AQ7A 2Z6QA 5IZ4A 1YZHA 1H66A 2QSJA 1IOWA 2E76B 1C30B 3JAMN 4WJKB 4J42A 2VDWB 3F6EX 4HDAA 3U3RA 1I7QB 1N8KA 2DFPA 2GJKA 1JXQA 1O8BA 3A11A 5THQA 3RK4A 3VZDA 1Z22A 5DCAJ 4HNRA 2CLOB 2XD4A 2L17A 3KKZA 1NVVQ 3K9LA 2VCEA 1WMSA 1XTQA 1UC9A 3OIYA 3U17A 1IPHA 3PPWA 4F5WA 2Z3GA 3IVRA 1U5BB 1XA3A 2Q4DA 1QV7A 2WJYA 2XUOA 4KPEC 2YWCA 1UBFA 2DULA 1HTBA 2HSGA 3I2KA 3UHAA 3FETA 4URFA 1MEJA 2AOUB 3AG7A 1IFXA 1P8JA 2B2CA 3ZU4A 1BMDA 3AJ9A 3KKLA 4AURA 4EWLA 2O52A 2D0PB 4FCTA 1PG0A 2LTAA 2UUOA 3HN2A 4IFIA 5D3QA 3V4RA 1SRQA 3ZJ5A 1COWA 4CT4B 4Z99A 3IMGA 4MWBA 2ZR7A 4PYIA 3SMQA 1XTZA 5JJJB 2PQ2A 4HGYA 4L5AA 4N3BA 3W5DA 5HGJA 3VPBA 1L4KA 1QQBA 3W3ZB 1JOYA 3HKBB 4UV8A 1H8EA 1DCMA 4CDGA 1VRWA 1MC8A 1D1SA 2MSEB 1XYVA 2Y4OA 2ZRQA 1I36A 4FW8A 4JB3A 4O4LA 1PW7A 1JL3A 1WF6A 3D3WB 4W9MC 1DAMA 3GHYA 5EUBA 2JIOA 2NGRA 4ODIA 1P1JA 2EEPA 4R50A 4RACA 3GZNB 1IN7A 4JI2O 1EXVA 1TO2E 5ESWA 3LP5A 1TF2A 2O8CB 1ESMA 1OI0A 3I8XA 4MR7B 2SECE 2UZ0A 2GD2A 3D2LA 4UPVA 3ZK8A 5TLSA 3TM5A 2FOXA 1U1GA 1WN6A 3WV5A 3PEVA 1N8RW 2FZCA 2H31A 3JVDA 5DM1A 2FRDC 3LDCA 5CA1B 3NEPX 1X1DA 3V6LA 4E2YA 1UXOA 2Q7OE 1FDIA 4DHEA 1GTSA 3OPYI 2P2DA 4GX0A 1KE2A 3EW7A 2QMYA 3H9GA 4FJCC 1NW4A 3L77A 3QJYA 2C83A 5G0VA 2W2QA 4CI9A 4UAUA 2FSPA 4YLYA 1ZX1A 1IQUA 4BLTA 1P2BA 2ZS8A 5EWJB 4ZYXA 3D7LA 2BBSA 3S2FA 3ZWXA 4P4SB 1A77A 1E1RA 4PS0A 5I01A 4R8LA 2BFBB 2WLKA 2HJVA 1JWBB 2C20A 4PXYA 5G4KA 1WZ2A 5DE3A 1WCWA 4R1TA 4DVJA 2CNWD 4EYGA 3ENQA 3LOPA 1U8ZA 2O7RA 1L3IA 4DWJA 3FZNA 3JPWA 3K5PA 4QGFA 4DT1B 1JQLB 3U80A 1F20A 3G2HA 4H27A 4MYHA 4OYHA 1CRZA 4FZ1A 1GP2A 1XXHB 3EPJA 4JB2A 2XKJE 4OQQA 2VRZA 1RI1A 1SUEA 2YH2A 3WWOA 4ARBA 2AG8A 4DJ5X 5KOIA 1XKXA 3HA2A 3W5AA 1T9ZA 4FONA 3FW1A 4PCAA 5BN5B 2JLYA 4MVYA 1WZUA 2P5UA 3BE5A 2I3DA 3BOSA 3NHPA 4G5OA 2VZ8A 1Q7GA 1FFXB 2BR3A 2FF5A 2BGNA 3DHEA 2Z1NA 2CXRA 3M8KA 3NXKA 4MUNA 4OHRA 5KUTA 1H2HA 5I4BA 1SQPH 5DK6A 2JGDB 3ZIDA 3ML1A 4WZBB 2GD6A 4HWRA 1CQIB 1LXCA 5ALNA 5IJ0B 1AGXA 3PHCA 2P1RA 3TTYA 5HX7A 3JVIA 4G2NA 1E6UA 5ES3A 3V2HA 3ZCQA 3IA2A 5KYXB 2M9MA 1JALA 2H54A 1YKSA 3Q3JB 1HYBA 2HCRA 1HLPA 4NMXB 1M57B 3ECSA 4W4KA 1BEUB 1K75A 3NR7A 2AJCA 5FNVB 2RB5A 1Z0IA 4L6CA 2CGNA 4RSGA 5FOTA 4QTYA 1CB7A 2RCNA 3TQCA 1JHPA 1J42A 2OR3A 5IW8A 4MVSA 1HI9A 1SJ9A 2HDWA 4CI0B 3WG7B 3WMEA 1YJ5A 1WD7A 2X0IA 2D2XA 3NEJA 5MGBA 4F86A 4HWSA 1WQ3A 5CNJA 5JE8A 2PUDA 1CZRA 3S55A 1ESCA 3NYIA 5AQEA 1AA6A 4OLHA 5LOVF 3LC2O 2QUBA 5BYBA 5DM60 1ZM2A 1QU2A 1GG9A 4I5DA 4JGGA 5F1KA 2AVNA 1HYEA 2YMMA 1VIAA 3WSTA 4RK0A 1W5SA 4RIFA 4D9GA 4D8XA 3LWNA 4NY1A 2QR2A 2PJRA 1EI9A 4G2KA 1KWGA 3HB5X 2ZRLA 3BB1A 2HA4A 4BGVA 3T1YB 1RAGA 4CL0A 1QF6A 4QQFA 2IXEA 1MX3A 3COYA 3A6JA 3KUXA 4JT2A 3SR4A 4C05A 4YMUA 3ZDCA 3D4PA 4ND3A 1GHTA 1S3SA 1T5BA 5K3OA 2ZP1A 4TWJA 1F48A 2OYSA 3FRIA 2VP3A 2ZCUA 1NVTA 2B4AA 1NR7A 4UUMA 1Y6RA 2Q3DA 5T4BA 1T9DA 4LP8A 1ZG3A 1AP6A 2WUGA 5LKAA 4NE7A 3GFVA 4IR7A 1ESDA 1QQ6A 5T4HA 1Z4KA 2X9VA 3UJ9A 1ZIYA 1MO6A 4WZAA 4PLHA 5JW6A 3W4JA 2G67A 5CFOA 2Z09A 4QOEA 1ZOPA 4IV8A 3CKLA 5AJUA 1XCJA 4KX5A 2E3JA 4FSDA 1U9IA 3ICWA 1ZISA 3MBIA 4YHBA 2MIIA 5SICE 3ZGYA 5C1DA 1JUDA 2NO4A 1JDJA 4Q4JA 5JFGA 2YEVA 2J6CA 4OJQA 4EVQA 1KFKB 3QV1A 3PGA1 4H7HA 4LCUC 2YHUA 2ZJ0A 5MN4A 1GXSB 3RG8A 2BUAA 4MS2A 3NC0C 2PEZA 1EIZA 3EZGA 5F2VO 3HBJA 3CCFA 3TJTA 1E77A 1YAHA 3NG1A 1US6A 5GADl 4IIJB 3TINA 4AMBA 3SJQC 1RD4A 3GRUA 3ZBPA 1GD1O 1Q7CA 5K5EA 2GO7A 3JS5A 4G1EB 4BKUA 1OGYA 5C35A 4M87A 1XFAA 4RETA 2EILC 2OP1A 5KYKA 3DZ8A 1GM9A 2IM9A 1C1XA 3OZVA 5JPCA 1L1EA 1R3LC 2WKPA 3RTAA 3ZHRA 2YHAA 1CD5A 4O2AB 1YL7A 2XCOA 5IKOA 2QPLA 3WLMA 4G28B 5AKYA 3AWIA 1JVBA 2X6TA 4RY9A 4DIMA 4H1WA 3PRJA 3J81A 3DKIA 5FHRA 3IPRA 1X13A 1A82A 4M9RA 3WB2A 4XD7A 5LU9A 1PJ4A 1RCUA 1I7SB 3WIEA 1JHXA 1PS8A 4FFLA 1K63A 3K71B 1OQAA 2E2WA 2PU7A 4R2WA 2XRMA 2XUAA 3X44A 1ZDMA 3M33A 4ALMA 3B3JA 1T35A 2Q41A 3G8DA 4G09A 3W0LB 3AHFA 4R5HA 1K6JA 3HB9A 5IUNC 5LMNB 1CHDA 3MWJA 3CC2V 5DP1A 2GD1O 3Q7PA 1P6QA 1DTWA 4LF6B 1YR2A 3MQ4A 2JS7A 3KPUA 2DZDA 2HLPA 2IV7A 1F4PA 3I6ZA 1RB7A 1MAWA 4LCNA 2R44A 3GB7C 2AN5A 4US2R 1EB9A 1ZL2A 3V8RA 3F8WA 4MROA 4CW7A 4ZJUA 4PPFA 4ZIRB 4TXJA 1UMBA 3PC8A 4A36A 2VTDA 3MJDA 3VH3A 1I13A 1IPFA 2XRFA 1RYDA 4JUBA 4EDFA 1V8DA 2NUAA 2PD6A 4NECA 2ZR8A 5K6TA 4U7TB 3BBLA 3W34A 3QKSB 3L3BA 5EIEA 1U8FO 2JFZA 2ZJBA 3BHJA 4QU5A 3OFND 2XVYA 3IPYA 1SG9A 2X4GA 1H0SA 1BEEA 3GL9A 4H4EA 3GJ7A 1XWIA 3BCHA 3VDMA 4L8LA 2MSNA 3H4IA 1YOVB 4AKIA 2LRHA 4DAEA 4CEJA 4HGPA 2WF5A 4DR2B 2Y67A 2GFHA 4JCCA 4F12A 3GJ6A 3QVSA 5DLPA 1IAVA 2VP5A 5IARA 6ABPA 1J0EA 3R20A 5D2CA 2YOGA 4JOBA 1WP7A 4A0GA 2LGWA 3KSRA 3LY7A 1A5SB 3PDWA 4G0XA 2EP7A 2O3SA 1C81A 2BP7A 1JEQB 1SVKA 2P68A 5EYPB 1XJCA 4JT4A 1EK0A 1ZUHA 3L0DA 4NCAA 4AULA 4MCJA 4HDMB 2FPIB 1FQJA 1LS1A 2IUUA 3G0BA 3Q7IA 3LPNA 3TTXA 4BVKA 4QASA 1OILA 2BOCC 1XNQB 1A8SA 2COKA 4BKPA 4UW9A 1FBTA 3EBOA 3NBMA 3ZTTA 2X14A 4NCHA 3CB4A 4OHMA 2HF8A 5K3CA 1R66A 4D0RA 1MOZA 4YASA 5HG0A 4AY2A 1RBZA 1IZYA 3GV0A 3JZMA 1M2KA 3Q0IA 3QU4A 5JSHA 1PLKA 4QIWF 3C4JA 3U11A 1QR6A 3G1TA 5JO9A 2H11A 1N9GA 1A4UA 2PH1A 2HUPA 2PGNA 1BJTA 2C0PA 3JATB 2C5FA 2GDJA 1QE3A 4LHSA 4EA8A 1FUEA 1L5LA 4AZVA 1X80A 5B36A 5FADA 1YI0A 2DM6A 2LIPA 4J3FA 3G2LA 1HV8A 1TO6A 1JNYA 1OCRB 1EK5A 3PE6A 1XG5A 3EXIB 4YXWG 2FMUA 2R8PA 5FWAA 2J30A 2Q8QA 2JD1A 3GCGA 4IFTA 1IU9A 2A5LA 4MV5A 4D0SA 2QV0A 4IMRA 4HYQA 1O3YA 1Y6JA 2J67A 4ZBMA 1EWYA 3GT4A 3L0SA 3STWA 5FI0B 4LF5O 4HUQA 1O9HA 4EUSA 3QKUA 1PDWA 1NQVA 1XAJA 4KHPO 3BQ9A 4XM2A 3ZCVA 4IZ6A 5I9BA 2JF0A 2KHZA 2G17A 5JZMA 2ID8A 5GTDA 4WIFA 2D2IA 3V1TC 3K1AB 1KJZA 1ISMA 1G2PA 4TMVA 1RACA 3UPTA 4V03A 3IEKA 4P58A 3WJAA 1TC2A 1GRJA 2YIBD 4E94A 4OKNA 5KEIA 1QF9A 1HFEL 1N0IA 3OM3B 1SD2A 1IN6A 1V2GA 2YTZA 3CC4V 4I9HA 3UKOA 1Z68A 1XX6A 4CCYA 3Q1LA 2A4KA 3E0XA 4RH3A 1VG0B 2YHBA 1N5IA 3R6LA 4IF6A 2DLDA 4L27A 4QGSA 3KP1A 3RS8A 5LQUA 3WFZA 2AHOA 2PEYA 5IY5B 1O96B 4BC1A 2VXBA 3AY0A 3ZDDA 3AL2A 2PGLA 2C1XA 1I01A 1PT8A 2OFWA 4CMAA 2X8BA 2YHSA 4D57A 5HOEA 4A2PA 4NMLA 3JVUA 5LYJF 3QVNA 2I6XA 1UUFA 4LRXA 5U4QA 3WLHA 4LE0A 2Q6AA 1A4IA 2DPMA 5FOXA 2X1MA 1ODKA 1KBOA 1IXRC 1NJFA 1Q11A 3AJAA 4O4HB 4OGQB 3FBGA 5E6SA 4PG8A 1OV9A 3QE9Y 4KXFB 1IXKA 3OEEG 2A5GA 1GNRA 1Y42X 1QFZA 1G17A 2CFCA 2K87A 1G60A 1W8DA 4QUGA 1XRSB 4JLSA 2EQAA 3U56A 4OI0A 3Q8LA 4CKBA 1WEHA 3L1VA 2ZSBA 4FX2A 3IR6A 1MPTA 4D0NA 3BSFA 4O8XA 4B9EA 1Y7IA 2VF8A 1XTBA 2XUDA 5AIAA 4YP7A 3V5NA 3N0VA 3AK4A 4CLEA 1E2HA 4M1TA 3DZDA 4OCNB 4QRHA 3ZE2B 5ELXA 4DABA 5JJIA 4B3DA 1R2QA 2FRDA 3ZOKA 3DKVA 3N2YA 5BVHB 2BBWA 2NTJA 5IT0A 2UYCA 1T4CA 1JG2A 3ZXIA 1YZUA 1TW2A 2DU8A 4MVOA 3NIDB 1OTHA 3GVMA 3NZEA 5CH3A 3UC9A 4BVAA 4ZVNA 3PVCA 2B98A 1UPFA 4KGVA 3IVXA 5J4LA 2ZVQX 1YSBA 5DGCA 5ESRA 5C8YA 2C94A 5D5PA 2JS5A 3UFXA 3EDRA 1RYMA 1FUYB 2I7TA 4S1NA 5DF1A 1QVWA 5BN1A 3QWBA 3EK2A 3S3TA 4Q7KA 2FDRA 5AKZA 3AESA 1I3OA 1H4SA 3HCWA 3U7QA 3Q3IA 3G8CA 3BB4A 1Z6ZA 3ESYA 1CZNA 1UZNA 4AL4A 3WHIA 1T8RA 4ENWA 4K40A 3A0RB 5ALRA 2IDKA 3T3OA 3L6OO 2AZMA 1J06A 4XQEA 4PX5A 1I5XA 1G4AE 2VSQA 2HMYB 2BZ0A 3FDZB 5AJHA 4WXPA 4ZU3A 4AZSA 4DZZA 1UQUA 1N0JA 5ALHA 4D56A 1ZUD1 4HUJA 5C8YF 2OILA 2C78A 2XAHA 2VWGA 3KJQA 4G5QA 3TE6A 4HRQA 4XWGA 1C80A 1R3JC 1GAQA 5IP5A 1L7VC 2FPXA 1F5SA 3STTA 4C87A 2GILA 4Z3OA 1FFTB 1KC8W 2YJ4A 1CQXA 1SHLA 3AKYA 1M5UA 3OZTA 3GR6A 4NYJR 4N54A 4AICA 4C88A 4DSNA 2WB2A 2VYVA 4GU5A 2A3QA 3AR7A 1ZK2A 4U39A 1PSDA 2XRYA 4HBGA 2MSDB 1SG0A 3DNFA 2CFIA 4L87A 1G9XA 1L4FA 4YRCA 5FEUA 4JVNA 5I7SA 2GTSA 2BFFA 2IHTA 1C9EA 1PJQA 2O5VA 4YAWA 3TZQA 5FOUA 3OMAB 2VP4A 2KQXA 1WLYA 2I66A 4MB6A 2R97A 3LDEA 1OE0A 3GDHA 4IUDS 3VOUA 4RFSA 4PV1B 5EC1C 2VRBA 3RVQA 1IZ3A 3H1IH 2P11A 3PEEA 4R8MA 1M1NA 2GSDA 3V8VA 1W5BA 3T1HB 1Y9JA 4OL0A 621PA 4UB6Z 1H2LA 1QV6A 1ZOLA 5TMPA 1YBAA 2NU7A 2O7NA 3S40A 5IAAA 3K58A 4F1WA 4MWDA 3O74A 5K0NA 3H87A 1YVDA 3IMKA 1LBSA 1U2GC 3AUKA 3ZS9A 4ZMBA 3UMFA 2QMUA 1R0WA 1SC3A 1BMQA 2GK6A 1T9AA 1ZRHA 2JIMA 3LPAA 3QA3E 4X41A 3JAWB 4U7JA 3B7PA 3VJMA 4Q1AA 4AF8A 2YYYA 4A8HA 4RTKA 2WTUA 4TWBA 4QSHA 5H82A 1O95C 1N0WA 1UP7A 4FM2A 2HPVA 5ESDA 4D3FA 1NJ2A 2ATEA 4HP8A 2Z83A 4L9WA 2BLLA 3C7CB 1PR1A 1I08A 3W04A 1XE3A 2O05A 4WFQA 2HLDA 3KTDA 2OTLV 4DR4B 1PQPA 1QWOA 5BN3B 1DDOA 1GU0A 3FWZA 3KE8A 3R23A 2PQMA 4U8HA 1A95A 1KEPA 5IKXA 4B4VA 5F3RA 3GMDA 3JSXA 1D9XA 5K3EA 4ETWA 4YIOA 3LOQA 3P0JA 3VR4D 2J3LA 1C0KA 4RXMA 4PPNA 2N47A 1JG6A 5FR2A 1N6NA 2AZTA 3KHSA 5FCDA 4PFKA 2RKBA 1LA2A 1EVYA 3BTUA 1PGOA 4IEFB 3RD5A 1SBHA 4C4AA 1ZUIA 3WLAA 4P9OA 4D9IA 1Q74A 4P32A 3ZRXA 3K35A 3II6X 1UMBB 4C3ZA 2BOVA 5E9WA 4BW5A 2VH5R 3EUAA 4RSRA 2PD4A 2HU5A 2RKWA 3I05A 1V9CA 2BZGA 2H5EA 2IH3C 1E3LA 2PR7A 3RVYA 1MP0A 3ZVRA 4GNRA 1SHZA 2RCVA 5SV2A 3JSNA 1AQYA 1OV4A 4PSDA 1RLIA 2WKWA 3D2AA 4C0SA 1F8XA 2K9PA 4KHZA 4ASUG 1XVVA 2VG8A 3NWEA 1E63A 1XRJA 4M1QA 5HKOA 2IP4A 3BE4A 3GG2A 3QP9A 2JIRA 4DEYA 1KO7A 3RBZA 3AP3A 2ZT8A 3DDHA 1L0LH 1JDVA 1TLLA 2WG2A 2ZJ7A 1JIXA 2ZRIA 4H6XA 4KQEA 3JQGB 5K8JB 3ZE8A 1AJEA 2QHXA 3IKVA 3LXUX 4BMCA 3K1JA 3R7WA 4Q1FA 4UTNA 4B3JA 1G8MA 2W2KA 4PR0A 2RAPA 2HYIC 3HDVA 1IG0A 3KPVA 5IS2A 4ZVVA 3ZU6A 3D6MA 1W5TA 4U2EA 2ZIXB 5I5GA 3WC4A 2TMDA 1YUNA 1QH8A 1L1FA 2IEIA 3WWYA 5HJ5A 1C4KA 4LOIA 1HDCA 3ZBHA 4R68A 3RC9A 4UBNA 1N1GA 1IONA 1FEZA 2BDTA 3AX6A 3BEDA 3IEPA 3V1YA 5DN6D 5B3JC 4BMVA 1GMGA 3ASOB 2M2IA 5HCIA 3WA7A 3A25A 3KXIA 3JASB 3FFXA 1RAEA 3S1SA 3EX7C 3PIDA 3QVJA 2I54A 3QO8A 4PLWA 4TGLA 4OU4A 1ZWLA 4LYGA 2FPLA 1YVEI 3E1GA 3I30X 4XDGA 2P4KA 2XASA 2ZB3A 2PUSA 2J9FA 5DGXA 4FLXA 1JIJA 3MSXA 4IL5A 2F3SA 1TPZA 2AV6A 3KUKA 3A1EA 2C77A 4H17A 3TQHA 4POOA 3NBKA 3NH9A 5LOVB 2A33A 3K9QO 1YVRA 2G0TA 2EJCA 3PNKA 3RT9A 3QELA 1T3HA 1U6IA 1V45E 2IOHA 1G8AA 2ZI6A 4GMFA 1GTZA 5EJEA 1XI1A 3EVCA 3FMIA 4JTDB 4QRDA 1KEZA 4UEWA 3IHLA 1AVMA 4YHHO 1EUCB 2LXNA 2WHPA 3JWPA 4B17A 2X3UA 3D6NB 1ESZA 3HBAA 4A8TA 4BNUA 1WMAA 3EN0A 1LQ2A 1UODA 2BH2A 2UXNA 4BAYA 1RXEA 1NSFA 1TTQB 3OF2A 2A9PA 4QPPA 1WA8A 2WJGA 1AUPA 4NDNE 4EY6A 4MWTA 1FDUA 1N2OA 3MTJA 5EE5B 3OQMA 3Q4GA 3TW8B 1RXYA 4I1SA 3WKAA 1R00A 1M7GA 2QVBA 5KS2A 3PPIA 1I6LA 1ODCA 2C3UA 2YFHA 5FJIA 1FFSA 2QMEA 2R79A 1NH2D 3F1LA 2CTQA 5BZBA 1X7WB 2OAQ1 1MUUA 2QB5A 1HNWO 1EUZA 4L9AA 3PRKE 1DLBA 5E1AC 3HDHA 4LJKA 3AEIA 5SYMA 3BYZA 1CK4A 4YRMA 2QLBA 4D6YA 4K3UA 5FUWA 4CTKA 4TKVA 2EHJA 3WB9A 4YXWA 1TNDA 3G8AA 4GOXA 3A7DA 3JRNA 3PGKA 3WMXA 1KQFA 2P6RA 3I9KA 3RSHA 2OQ2A 3LC0A 3RASA 1FJGO 2R87A 5KQRA 2JCBA 3SYNA 3AIMA 4MPDA 3ZKWB 3UAWA 1VGQA 3L7OA 4L8YA 2BFDB 2ZI7A 5EP4A 1M2WA 4JVSB 2ZWMA 1S1CA 4B4DA 3E7PA 4O4LB 3E9QA 3EOAI 1W59A 1FTQA 5GONA 4RQFA 4EQ6A 4BP3A 1FQWA 3FVWA 4LI3X 3TUJC 3QEJA 2X2FA 4C7UA 3NT4A 5TEWA 2QJRA 3AG2C 2WJ6A 3U3KA 3A9UA 3JQCA 2CEAA 1B6TA 1IHUA 2UYQA 2V7WA 1D6JA 3QBJA 4HI0E 4OBWA 5CFMA 2RIPA 1ICEA 4IIVA 4LRWA 3STYA 3MD9A 5FPYA 1YVPA 2QPOA 1NHWA 1ZABA 4M49A 5AKXA 4JI6B 3ELUA 3LYHA 1AROP 5KNBD 4RSHA 2WUVA 5D3ZA 2LKCA 3PE3A 4ZALA 3IO5A 5GONF 3TCNA 2G4VA 2ZK7A 1MSDA 1N3BA 4GKJO 1OWNA 1NDUA 2BZSA 4EKYA 3HVKA 3ICVA 1LDEA 1USKA 2X4IA 3OE7A 3DDSA 3OLXA 4PO3X 3TGPA 3HSKA 1SM4A 4C0WA 2YUAA 1BD3A 4OYYA 5KINB 1TKAA 1W9HA 2CHGA 2J5XA 1SR8A 1W1WA 1HDOA 2XF2A 4Y9RA 1P6OA 5L4LA 4HD8A 1G21E 3P9SA 5IJAA 5HRAA 4ZT4A 2B1GA 2OECA 1OUMA 5AKKA 2O2DA 3GDGA 2OCCB 2PRKA 2QTRA 3ESXA 1QFYA 5AM0A 2CL6X 1IDN1 3QLUC 2NTEA 5LQSA 2I3AA 2QI9F 3A9TA 3C3WA 1SIOA 5J43A 4DV6B 1Z4OA 2JC3A 1KAOA 4UCSA 3BVPA 5EQFA 3RBAA 2W6ID 3AY7A 3QWIA 5CK4A 2FK8A 1V47A 1WOYA 4L4SA 3CVWA 2YS8A 1JSCA 3DF7A 4MHSA 4HZUA 5DNDA 4E21A 2XYRA 5AVQA 3FAKA 3NC4A 3TSCA 4EA7A 1UKCA 1HBJA 3DLHA 1U2RA 1E4OA 4X3CA 5EUMA 1E6LA 1N6KA 3OMWA 1ZWKA 2J6BA 4ER0A 2FZVA 4MMYB 2VC2B 4WIGA 2AQHA 3BA9A 4ISBA 5AW9A 4DYVA 4P0QB 2R2GA 1NV8A 1UC5B 1GZVA 4CH5A 3GJ8A 1OOEA 4OCMA 4G0ZA 1BRTA 1A5BB 2QS9A 2XXBA 4GI2A 2FXIA 3FNFA 3TPZA 4B85A 4JIGA 3V1UA 5FULA 2G70A 4U3JB 1QHTA 4ND6A 4J9UE 5JAQA 5FV4A 2I2FA 2KX7A 4PHCA 4UZSA 2C7OA 1I2DA 4X1YB 1G3QA 2UU9O 2GD0A 5SY4A 1TUIA 1RE1A 1TM4E 4QO8A 3L02A 4W1PA 1BXZA 1SWWA 3PEWA 5HS6A 3X2FA 5HSGA 1J0AA 3HXTA 1NRWA 3RSZA 1EM8B 1NIJA 4F9GA 5T4FA 3VO1A 1NLFA 3G4SV 4R5MA 3JQ7B 3HJFA 4L7QA 5KYUB 2ZYSA 3G1WA 4RIGA 4LTMA 3BRQA 1TEZA 3HFRA 5J5AA 3EXG1 5JR3A 4JX9A 3GZJA 3EX8A 3M0EA 1DRJA 3AY3A 3MLAA 2ATXA 1W2WB 4FLEA 4YDSA 2OGWA 4J16C 1F1JA 5D5QA 1PVVA 2FUEA 3KVOA 4B2PA 1IHDA 2JRLA 3CINA 5BWLA 4PAWA 4Z9FA 4Z1OA 4LX0A 5B1DA 4DLRA 2FJUA 3CMEV 4YQFA 3JYLA 4LH7A 4JDPA 4LNAA 4MVJA 2HHHB 1LU9A 2FCRA 3QTCA 2QUAA 3CCEV 2ZTUA 4G0OA 3I0MA 3D7RA 1CLEA 1QIJA 3VQYA 2IPMA 1IJFA 2JEZA 2VNSA 4P9PA 1KSJA 3ZTYA 4I4CA 2AN1A 1XQ9A 2X6AA 3JAKA 1XZQA 1O1YA 2RGUA 2Q2QA 4LQCA 3VYUB 5JZOA 2QYHA 2WFLA 2C9OA 4H6PA 2IPNA 5LDHA 1R6KA 1KGSA 1LW6E 3AJ8A 3ILYA 3C3AA 2ZXWB 3DE5X 4QARA 3U0VA 4NKGB 3X1MA 2DHDA 4FHEA 5KAPA 1LC0A 4X1IA 2ZJAA 1C7JA 2MSCB 5L3BA 1GZ5A 1BN7A 2YIJA 2Y77A 4UU7A 3QHAA 1D2DA 3U4HA 5H81A 3WWZA 4DUGD 2XCQA 3COPA 1YA6A 1JIUA 1RM4A 1T24A 4RWUA 1FYJA 1H6BA 2XT0A 2KE5A 4HGZA 4PAGA 1TF5A 5CHEA 1NAHA 1KRXA 1QQTA 2FPGA 2A6PA 3HCBA 2R6AA 4Q00A 5D7BA 5AK4A 4IGAA 1FXSA 3WGUA 1UMCA 3G82C 2FTKA 1NL3A 5I6DA 2HVJC 2BFAA 4C07A 1PWEA 3JQBA 3PF8A 2A7WA 3K0HA 1RP3B 4EB8A 4FM0A 1UBKS 1XR3A 1SVIA 3MELA 4Y7DA 3CCUV 3B7GA 5K8CA 3X2QC 1ODJA 2EYUA 1RMTA 2FSIA 4OQEA 3SZ3A 5IKPA 4YDHB 2WYVA 4ZEVA 3FGOA 1UC4B 1GY8A 3I0NA 4ZOQI 2YWRA 4JQYA 3DQZA 2LFSA 3FUCA 1KDVA 2IOYA 3EE6A 2QY6A 2GSMB 3CRQA 1JHAA 2APJA 1J22A 1SS3A 1KIFA 1V35A 2WK1A 4N6GA 3RSGA 4S05A 1AGPA 1JEOA 1DEAA 3PKJA 4ZVUA 1M76A 5A3JA 5KMGA 3S0JA 1WXXA 1X2BA 3RHTA 2OWOA 3S4YA 3VNBA 1RYHA 1KYXA 3B6MA 2Z2KA 4DNOA 4X8AA 3DOCA 3GN1A 1L8QA 3ND7A 3V42A 1DL5A 4F4DA 3ICQB 1V9LA 4OK5A 2R7KA 4BX3A 5L45A 3K6SA 4LSZA 5D1NA 1KEEB 3DR5A 3R5KA 4EUFA 3CTMA 4NCIA 2PE5A 1NWHA 2RH8A 3VZCA 5M04A 1XI2A 1QFJA 4FZ0A 4B43A 1SOMA 1Z5PA 1G2OA 2WMOB 3A04A 3HFSA 1L5VA 3JQGA 5CR9A 3K0SA 5HK8A 2C04A 4A5OA 4B6OA 5FJJA 4E6EA 4ZZ3A 5I48A 5JY6A 1Z2PX 2FEMA 4DLSA 5JWPA 2WA3A 2IIPA 5AVYA 2PUCA 5AHXA 4FUQA 2Q9UA 2GBGA 1Y3BE 2Q4BA 3W8RA 2ODMA 1XD9A 3BIFA 2JRIA 4D4LA 3O9OA 4R7ZA 1KA9H 1XBTA 5TRTA 1NW6A 2R2AA 4UHJA 1GR0A 2ZJ5A 3A1NA 3TSWA 3K3PA 3ERCA 4JBYA 5IAKA 2QUJA 1KVQA 4NBWA 4EYEA 4GCZA 4WECA 3UA3A 3B78A 1VLVA 1E7RA 2QAGC 2X4LA 5AW7A 5IUKC 4EZIA 1ZITA 3SDLA 1BJRE 2SKEA 4TL7A 4NRDA 1YRYE 1BQ3A 1NI4B 2V4MA 4CXMA 2J0UA 1EXDA 3HDGA 2AOWA 4YAJA 2NQ8A 1ZINA 1KJWA 2IZZA 2R8YA 3OLCX 5F5LA 4BN4A 4V1CB 3U16A 5DX8A 3FB8C 2XB2A 1L7BA 1NDHA 1AHIA 1BW9B 1E8DA 2VDKB 4DV1O 1FP2A 2C98A 3CX4A 3D3KA 4FFWA 5JCZA 1PWHA 3SM9A 4A23A 1P3DA 3M1IA 5E3IA 4EI8A 4BO1A 1GDDA 5DDIP 3ZRWA 1UAQA 1SB9A 3O4RA 3BH6A 1H4TA 1KORA 4YCMA 1UL1X 2CB0A 4PHGA 3UENA 4RTJA 1AUXA 1EDOA 4OPAA 3G2JA 4R8KA 1D4AA 1A4RA 3RANA 3A3OA 5D84A 4YUWA 4HFJA 2OBMA 5CFPA 3ZLUA 1WQ4A 2CE2X 3SE7A 5JO0A 3AKCA 2P4SA 1V8BA 1Q0ZA 2I3ZA 3O1IC 4WMLA 1UDAA 1ZR4A 3E3AA 13PKA 2A0UA 4REQB 4JGSA 4G1UC 2FUG1 2BFNA 4L15A 1WCIB 5F2KA 1XROA 2XKBA 1M73E 4LPKA 1Y9DA 2PVPA 5A71A 3G88A 5LQKA 1BHAA 4U2DA 3NBQA 4K0RA 1SFRA 3UMVA 2V4UA 3K05A 5IKMA 5EMNA 4QJ4A 2B0JA 4FB4A 1NZDA 1D8AA 4DBLC 1ETUA 3I4CA 5DHFA 4BBZA 1XL6A 1XZJA 4X1OA 4MVQA 5KQGA 2HU7A 3BMXA 3GLSA 4M0UA 1GTOA 4XGIA 4Z3KA 1L7AA 4QOSA 1BCSB 3QY0A 1UFRA 2YV2A 3SJCC 2R11A 3O1LA 3PC2A 3ROFA 2ZIMA 4WFAV 4LVOA 1YE3A 4EAQA 4ZTUB 3F5FA 1U04A 3KYIB 5COQA 1SUWA 1OMOA 1QUEA 3K5MA 3LCRA 4YRJA 5A2GA 1MW8X 4D74A 1YJ8A 1K3UB 3LXMA 4V2UA 3R41A 1OXSC 1QZXA 3B3FA 4KXVA 3CC7V 2PKQP 2WJZB 2VJYA 2KCQA 3D8BA 2IBMA 4AMGA 2OP0A 5AM2A 1A8HA 3TGLA 3DMGA 2YW9A 3KIPA 4TYPA 4IXWA 2IEYA 5CTAA 1YS7A 4DCVA 4F6RB 4X66B 2IH1C 5EINA 4H3SA 1E3IA 2X8WA 4OHOA 1C50A 4X65O 4DUZO 3LE8A 4G3XA 4OX9Y 1GO2A 1DGSA 1VQPV 1X7YA 3PHLA 5AJVB 4BFSA 2VHTA 1XTRA 1ZBQA 2RHGB 1E92A 2FVYA 1WJZA 3HB0A 2E55A 3MIZA 4MOWA 5SZHB 2I99A 2RSLA 1EG2A 1HW7A 4HGNA 2J9YB 5CURA 2WJVA 3UHPA 1SUSA 2HMTA 2KPOA 5JI2E 3EGWA 5EVCA 1XLTA 1O95A 1RMYA 3IOEA 3PD1A 4FE4A 4QIHA 7ADHA 4OI4A 8ATCA 1FS4A 1XRPA 2CVPA 1MZVA 2I33A 2V6MA 2W9XA 5J9PC 1OYVA 1P1KA 1T2NA 3IBSA 4P3NA 1G4HA 5FBHA 3RRNA 2EIJC 1RKXA 2DJ5A 2NP7A 4FFVA 4RS4A 3T35A 2ANBA 5HA5A 4UMVA 2V54A 1DKUA 3R8CA 3I2FA 3V00A 4DDHA 4K03A 2ZBRA 3WZMA 3V32A 4A2CA 1O95D 4LDJA 3U4GA 2DKFA 1QONA 4NXMO 2PN1A 3SDZA 3AVOA 3OLZA 3B48A 4B34A 5K4GA 5DBOA 1OLUB 3K9SA 2PLFA 1Z37A 1R0ZA 4P31A 5HM8A 3FWKA 3X0DA 1TEVA 3H11A 4PZLA 1QZZA 5EY5B 3P0EA 1CPYA 1YQWA 4HYOA 4QD3A 1JJBA 2QN7A 3LLCA 3QOFA 4FYXA 4RH1A 5IG2A 3C5HA 4GPEA 1J00A 4RL4A 3TAXA 4B3HA 4YRTA 3GCDA 1SVWA 3D3IA 4CDMA 1BKYA 1E1MA 1HT2E 1EAMA 3ZY4A 3CGGA 2DW4A 4EOGA 1HE8B 2B0CA 2G07A 3LT1A 2FX2A 4KITC 1K0UA 5LMNO 1NPDA 2HCBA 3RT3C 4YJKA 3DWGA 3I09A 3WNQA 2CVZA 3GEBA 1L3BA 1BE8A 1DBSA 4E13A 3C3TA 2BD0A 3AF4A 3DQPA 2I55A 3WX0A 3MJVA 2XTNA 3JYNA 2QL6A 2UDPA 1A8UA 1Y74A 1EHIA 1CY1A 4X9XA 4LQLA 2NSDA 3IAM6 2P0AA 5FQNA 1XDGA 5ADVA 3KQVA 1BD4A 1KO4A 2QQEA 2WWTA 5EMKA 5H3CA 5KB3A 4EGFA 3H1BA 4MQBA 1XKLA 6CHYA 4DSUA 4NTWA 1N32O 2VAWA 2QTGA 5AVTA 2O2JA 3ZWNA 4UTZA 3HPQA 3DCIA 2B4QA 3A0UA 4NVRA 4UM8B 4CMJA 5B3SB 3L7MA 4NZ9A 1B6RA 4OSEA 4MGIR 2HXSA 1ZUWA 4ZVMA 5JFOA 1FMFA 5B3JA 2ZE7A 4OLJA 1GGFA 3UV6A 3NH6A 1PT9A 3OQPA 4WK6A 1DTOA 1YZGA 4RVHA 4XA8A 3AY6A 3R3HA 1U99A 2PL3A 3C3MA 3PPXA 4ZOLB 1YZFA 3UGKA 1G64A 5KJEA 1VGVA 1ONNA 1OGJA 1X74A 4HKTA 5GMOA 1JVMA 2CCGA 3UAXA 3ZXSA 5K7SA 1VE9A 1R1BA 2AFHB 4KQ2A 1Y48E 3ENZA 4H31A 4PQEA 3KAKA 4WA7A 1Y8QA 1GNQA 1OR8A 1YQ9A 3I9MA 4HPJB 1SD1A 3IAAA 4HNGA 2HP8A 2WWHA 2YJ5A 2ODBA 3SR3A 2YBEA 4MMXB 2DWDC 1TMKA 2V98A 2Y1GA 4WADA 1V1JA 5EZYB 1ZFNA 4N8EA 4PY2A 4Y6SA 4F3WA 1W581 3PUIA 4UCXA 3UOGA 2XBMA 3U1VA 1UOOA 5G3ZA 4OJTA 1EFTA 2I2CA 1P44A 1Q22A 1P80A 3ODPA 4A03A 2TMYA 3K96A 4IUYA 4G3MA 1LWNA 3T12A 4DHWA 4C7BA 2YASA 4LXTA 1HNXB 2QRVA 1EEXB 1OH8A 2Z2XA 2K2QB 4BWYA 1SQQH 1A9ZA 3A4NA 3DB1A 3E5MA 2JBHA 4M8NE 3R0JA 4KMOA 3KNZA 4PLGA 1KZHA 3T1YO 5CM9C 2FZGA 3LHIA 3OZDA 2Q28A 3L9DA 5AW2A 2WJIA 2Y99A 5CLJA 4EMUA 4OGKA 3T52A 3R5XA 2VBGA 4XIYA 3UIEA 4DLKA 4KWHA 5I4CA 4UTVA 3LKVA 1YZBA 1PZGA 4HBZA 1J09A 4AB1A 3CLHA 3UKMA 5GPBA 1RHMA 2W22A 1SIBE 4QYSA 5CPBA 3HCEA 3WKBA 3I72A 1VHQA 1XK7A 5AM4A 4A6XA 1MF7A 1W87A 2JARA 2JFFA 4W7SA 1PYGA 2JLSA 1T25A 2QTMA 3VTFA 3GLGB 4RAOA 4AJ9A 4FI3C 4BX2A 2V7PA 3ZCRA 5IJ0A 5GIPE 2VQFB 2DF8A 4F97A 3HN6A 3RYFA 1HDGO 3GO4A 1EZJA 2BMDA 4URZR 4P3PA 5DTEA 5IAEA 5A62A 1T36B 3T3NA 1SKUA 1DBQA 5EG5A 3DHYA 2GUGA 2P78A 3SFTA 4I1OA 5LYJB 1U28C 4KGZA 2O8DA 1T9KA 1WABA 1DX6A 3QBEA 1ZNQO 3JD2A 4QYMA 1QE0A 5CH8A 2HQ1A 4I1YA 5CVDA 2IFTA 3R7FA 3WWDA 3QOWA 4UHDA 3GH1A 3MDSA 5ITZA 4O4HF 1R27A 1XCOA 3ROMA 3VDXA 2O4UX 1EGHA 3KWLA 1OZGA 1QCCA 4CETA 5JXIA 2Z8YM 3RROA 4LC0A 3HG7A 3FDFA 1N0HA 3HL4A 2C42A 4IGGA 1EP1B 2J4FA 3SBEA 2CLKB 4IDAA 5H5NA 1Y6XA 2FOIA 1GKUB 3TL3A 5HQ3A 4JBLA 2SCUA 3ASUA 1T5DX 3UYKA 1ORWA 1JZSA 4EDHA 2RJOA 4ZGBA 4RHCA 3HYCA 4JBXA 2O8BA 4DFDA 3DE7X 2CF6A 2VJOA 1QPGA 3TCKA 4W1SA 2DE0X 2WTBA 4QA9A 3LH5A 1IZ0A 1RQXA 2VPQA 3AKDA 1QHNA 5KDLA 1I7DA 3MUNA 4CMEC 2Z5UA 2QSYA 1RC8A 5A3RA 4H6WA 1KMMA 1CY4A 4MSQA 1KE1A 3IKLA 4U9HS 4GPZA 4L3WA 1B6QA 1GA4A 1KY2A 5LMUB 5DI3B 4F7WA 4MLZA 3RDPA 1E98A 2H5JA 4UAGA 4ZK2A 1UZLA 1M0SA 1VBFA 2CL5A 4QQ8A 1SCBA 4EPXA 3LZDA 2FE1A 4YAKA 5BN4A 1YJQA 3I73A 2XCRB 3BZUA 2GASA 2P7IA 3FTCA 1I5EA 3O84A 3UG7A 2DPXA 1EGQA 3D6TB 3F71A 4A92A 1UJMA 4PE5B 4UUPA 1GPH1 4NMWA 1HH4A 3S3WA 1GN3A 2A9FA 3AVPA 2EIXA 3GEDA 1I2CA 2ATCA 2XTJA 3BMCB 1YMVA 3OM8A 4QATA 1C41A 3WGOA 2C2WA 4G1VA 3MBOA 4YP5A 1JE0A 3DUFA 4UAVA 2YN0A 4KVGA 4GM1A 4YJ2A 3STZC 1SVOA 2X7XA 4ARVA 1AIPA 5KU7A 3DL2A 3E6AA 4Q6GA 3GVPA 4X3PA 3W2FA 3I5UA 3IV7A 3OOHA 4K88A 4F06A 4OCMB 2WD9A 3E23A 1RWQA 3BA6A 2Z6UA 4FLZA 1ZC3A 3I23A 3OEED 4V38A 2MR5A 3EEIA 4ZEXA 3IE0A 3F47A 1PPJH 5L3GA 2WPDG 1CY6A 4MYTA 1R6TA 4RD6A 5D87A 4AJIA 5JSYA 4DOMA 4LBWA 5IWCA 3D3QA 3D6HA 3VOBA 2OCHA 3I76A 4S2UA 1GN8A 3IODA 2XWJI 4DK1A 2RGNC 2AXPA 1WL8A 2ZWIA 3R5HA 5J1TB 1A32A 2ORED 3U5TA 2I71A 2IGBA 2X8LA 2DBQA 1UM9A 2OK7A 1DJLA 2W4QA 3C24A 3LFTA 3EZ9A 1M1NB 2XIQA 1VA4A 3C3BA 5HR5A 2GT1A 3VKFA 1D4OA 3W7BA 1CDDA 2C5HA 1UMDA 2YVKA 4GE0A 2WQ6A 2O8CA 3HR7A 3HNPA 4BAUA 1P4JA 1G2QA 3HN7A 2YS7A 4OLAA 2H4FA 1T5IA 2YOHA 3ESBA 4BNIA 4E1VA 1OX7A 2NUPA 2V7QA 3GWOA 3GY0A 4BUJA 5I47A 3TLBA 1QGED 4QOHA 1VKOA 4FLVA 3TQFA 3RBVA 3CRVA 10MHA 1OWPA 1RBQA 1CEQA 1KFEB 2PKCA 3B38A 4GGMX 3IEMA 1NG9A 5ICCA 1FFWA 5D3MB 3CZ9A 3EZYA 4EEKA 1FXKB 4BWVA 2VBIA 4AUKA 4I7EA 4PA3A 5HJEA 5E1DA 4RIIA 2JASA 2QQGA 3SR2C 1Y8RA 3G0GA 2PSDA 4G4IA 4P5DA 2ZB4A 1UBEA 4WFJA 4CIXA 2XDQB 5AVKA 3HSYA 3RYTC 3VVCA 1WSBA 1T36A 2DFNA 4DMRA 4MV3A 4ZJZA 4YAOA 1S01A 2CYBA 2OZLB