1OZ0A

Crystal structure of the homodimeric bifunctional transformylase and cyclohydrolase enzyme avian atic in complex with a multisubstrate adduct inhibitor beta-dadf.
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Avian AICAR Transformylase with a Multisubstrate Adduct Inhibitor beta-DADF Identifies the Folate Binding Site.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
molecule keywords Bifunctional purine biosynthesis protein PURH
total genus 201
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2003-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1oz0A01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1oz0A04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1oz0A03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1oz0A02
4EHIA 1VMDA 1B93A 2X8WA 1PL0A 1S89A 1C30A 1OZ0A 1KEEA 1ZCZA 2IU0A 1G8MA 1THZA 1JDBB 1WO8A 1PKXA 1EGHA 4A1OA 1CE8A 1IK4A 1C3OA 1CS0A 2B1IA 2XW6A 2YVQA 2IU3A 1BXRA 1S8AA 5H3LA 1A9XA 2B1GA 3ZZMA 1P4RA 1M6VA 1T36A 1M9NA
chains in the Genus database with same CATH superfamily
1U8EA 2JIMA 4Q9NA 3AG1B 1ADBA 1EAYA 1U2GA 3QH4A 1SXJE 4BP1A 1UMCB 1NU8A 2FW6A 5KOIA 1UXKA 2PCLA 3JALA 4PSKA 4Z6KA 4HGQA 2OO7A 1C9KA 2ZUCA 3GJ4A 5CIQA 5JATA 1TT5A 3IVMA 4TXLA 4LOAA 1U4NA 4WADA 1TYDE 3D31A 2D1YA 3UOWA 2VNHA 1OBHA 5F9MA 3IA7A 4CL3A 5L3FA 4QDZA 4KL8S 2BF7A 2Y99A 3GGJA 3WNVA 3H0CA 1IU9A 3AYZB 1VJ1A 5H1YA 1KY2A 1UFOA 3JR3A 3WK7A 1DQSA 3VSBA 4BGEA 2Q1XA 2PLFA 3IJRA 3WDMA 1L3IA 5BRAA 3R9IA 4DV4O 4HLQB 4QYIA 1N32O 5KYYB 1FJGO 1DCKA 1U6KA 4I9FA 3ZE1B 4CVNA 1VGQA 2IWHA 4MWSA 4J41A 1I6LA 1NBAA 1U2EA 2W0FC 4IH1A 4KVAA 2XCIA 1QQBA 1EPUA 1C9JA 1QGOA 3BREA 1IRXA 2PZAA 4R71A 5EQTA 1TRKA 2XYVA 3ZWMA 3DL7A 2XAGA 4AKGA 1JU4A 1DKNA 4FDVA 3SYLA 1DPFA 1B0PA 1YBMA 4H7IA 1VBMA 2C5LA 3HA2A 3Q7PA 3OBIA 4CFYA 1O57A 3GEEA 2G1PA 3D4NA 3HE3A 1IBKB 2CNLA 3ELWA 1HT1E 2M6LA 1S8FA 4Z5XA 3AHJA 4MCAA 3JYPA 3I3SR 4JROA 4KSYA 3SHQA 3KAQA 1Q86W 2I55A 1N36B 3GLUA 3H7IA 2CLKB 1RQ2A 1GSAA 1NUAA 2P4QA 2VNAA 2Z3ZA 3SXUA 2C9CA 2HSWA 1T5BA 6REQA 3PWZA 4I3HA 3RYFA 3ZHYA 2OQIA 1UKEA 3PNBA 3GK3A 4J0DA 4OBWA 1KP2A 4J11A 1F38A 1RHMA 2QNRA 3STTA 4HK4A 1AQLA 3HWRA 5A3VA 1NBHA 1TF5A 5D7NA 2X19A 3KR0A 4CIDA 5A4FS 3CWQA 4EGCB 1DX9A 3ANMA 5AM5A 4ZANA 4HWOA 4C6RA 4AJHA 2AG6A 3ZI0A 4IQ4A 2XSZD 2IUFA 2Y67A 1HFKA 2QS9A 1F0KA 3EFHA 3ESRA 2CKMA 4LKOA 1A32A 1SZTA 2F7SA 4PA7A 4Q47A 1AVMA 1EBBA 4PGMA 3ABKC 2FTKE 2YUTA 1GPUA 3EVBA 2WLTA 1XHLA 4JOQA 4I4TB 3K2EA 4KWHA 5EMLA 4IP0A 4D57A 4CL2A 2M6YA 1GTVA 2IIBA 3VOAA 4CEHB 1TQ8A 1QORA 2CNNA 2K2QB 4M8IA 3E8XA 4B83A 5U9CA 1OPXA 4DR7B 4CC6A 2J3LA 3AUKA 3EVAA 1HWYA 4M55A 5JMPA 4L4YA 4C6TB 5LZ7A 3QVLA 1B06A 4WKOA 4TOIA 2BVNA 2HRQA 4HF7A 1I4TD 2I3ZA 2W22A 2EWWA 4BL5A 3W5VA 3ICQB 4BN5A 2OV6A 3F7NA 4IUDS 2ZNIA 2P68A 1M66A 1PEAA 2B3ZA 1XEXA 1V1JA 2EX0A 2C2AA 1ZNQO 1Z0ZA 1AUOA 2YWEA 2ZG6A 1Z39A 4LGYA 4EO4A 3L7NA 1GNVA 5BV1A 3KCQA 2E3CA 3TAHA 2O5RA 4LHEA 1XDCA 4Y6QA 4QBFA 3KVOA 5BYAA 1EVZA 1DSSG 1VLVA 4U7GA 1SQFA 4GX1A 2R7NA 2WIGA 3GVCA 4KQCA 2ZJFA 1YJXA 5J63A 2AZDA 3TZKA 1S02A 1EX1A 1HQYE 2GH1A 2NZVG 3GGGA 3KB2A 1H4TA 1MRZA 4YGXB 5FP0A 2MR5A 2XMQA 5UKDA 4DIDA 4F6CA 2YV3A 4BRZA 1RACA 3B12A 2DQ3A 3IAHA 4IOMA 5F51A 5EMMA 4ZCSA 3T5BA 3NIGB 4BTLA 2BV3A 4FMDB 4F6RB 4QLAA 1ZJ5A 3WSWA 4NAHA 5DNDA 3RIEA 3SYRA 4RMIA 1S89A 3K8OE 1TZKA 1SVKA 5GONA 3PTZA 1EVLA 4GOKA 2NAFA 3RV4A 2X0FA 3JR7A 4A2QA 2C77A 2JRCA 4DMHA 1Q3TA 4B4KA 1JQ3A 2PHZA 2WJZB 2BFNA 2J5XA 4QODA 5D6OA 1CCWA 2C3MA 4PSAA 3PCXA 3VA7A 1FDVA 4NQLA 3CRRA 1BDBA 4UCVA 4N7MA 5BOSB 5IZ4A 3B51X 2EJ7A 4KE7A 5KDLA 4CH5A 1DV1A 4RQFA 4E0BA 2W4MA 2CD9A 1KMIZ 2ZPUA 2DHDA 4WERA 3AINA 3KC2A 3O4VA 1OCZC 4JENA 3B1XA 4XVHA 4YJ2B 3TLCA 2VHVA 4BW9A 3CW8X 2VQFB 1S6YA 2FY8A 1XNGA 3OJFA 3CWCA 5E2IA 2JHFA 3Q5EA 4W1RA 5G4LA 3R9KA 1Y3FE 4Y1EA 1U98A 4E13A 4X62B 1R12A 3PFIA 1V7CA 1GFSA 3IURA 3TLGB 1FRNA 1N1GA 5FWDA 4DSOA 1X7WA 5GGXA 3KE9A 2XDWA 4WESB 5L40A 2XV1A 4NE7A 1AF2A 1LS1A 1GTJ1 1DIBA 3DLPX 1HL7A 3SHTA 3KQMA 2NACA 1RHUA 1YC5A 3QQPA 3TLJA 2E49A 1ETHA 2Q4DA 3IMCA 1IXMA 4TV8A 2COKA 5FPOA 5JQWA 1ZKDA 2NN3C 5KUMA 3SZUA 4TUYA 1SO8A 1K4YA 3FDZB 4ENSA 2ATEA 2JAXA 3BL6A 3RH0A 2KG7B 3RVYA 1E4VA 2X9QA 3BMNA 3M81A 4AUEA 4N5LA 1E3WB 2AC4A 4HUJA 3THXB 1XDBA 3QTBA 1WTAA 4IV8A 1V1RA 4WUTA 4B82A 1UKVY 4XPIA 4TVKA 1E0KA 2XQFA 2WF8A 1UAGA 3RS4A 5D00A 1H8HD 3CGWA 3WWDA 4CF5A 1XRMA 5DN6D 1T5OA 1Z2CA 2PNFA 2MSKA 2VPQA 3AESA 4LK2A 4OX9O 2O50A 2SICE 4X5OA 4TT3G 4MKXA 4CKXA 3S2FA 3UAYA 3DAFA 4BQNA 3U10A 3UFBA 4ZZ1A 3GRKA 3QO5A 2EYUA 3A31A 3LDHA 4O0MA 1YRHA 2HXVA 2R9IA 1EFKA 2A57A 2IUEA 2WA1A 5ITZA 2WHPA 3AMVA 2EILB 4J1QA 2GRJA 1QG6A 2X7JA 4ZK2A 5K0TA 3EGOA 3VR1A 1DARA 1YS6A 1VQKV 2ECPA 1IM8A 4JC0A 5HFJA 2ZITA 1O6FA 3N1UA 4CLOA 2HIAA 3VHXA 2B2CA 2GV9A 2QTVA 1DTSA 2NNLD 4JKIA 4ER6A 1NW7A 4I8DA 2WTXA 3DNPA 1RLJA 1QR9A 1RBQA 4V38A 4DAEA 4LJSA 3UAZA 3LXMA 1M7GA 1BEEA 1IOVA 4BX9A 4CIYA 5MDHA 2HF2A 4L4SA 4L75A 1T8PA 1G59A 2AJDA 1VE9A 3BKXA 4GRDA 5MN5A 2J7PA 2YIVX 3DQQA 5JZOA 1CUHA 4H1VA 1A2OA 4JD5A 2XNDG 4RFVA 2GT1A 3EN0A 1K7EB 4C6TA 1S2IA 1U11A 2NN4A 1MX1A 4DLKA 5C4GB 2HMAA 2HOQA 3Q0EA 3QVWA 2Z0AA 1KKUA 1U0OC 1ZUD1 5A2GA 4IJUA 4KFMA 1B0ZA 5JJIA 1WETA 2JHCA 2VBGA 2VSYA 2BMAA 3S3XA 2YJZA 3BH6A 3K57A 3HV2A 4H7FA 3N0VA 4GF5A 3HTXA 1R0LA 1CTUA 1D1PA 3HLTA 4FBMA 1L4BA 3CHXA 4IXNA 3VH4A 1CFJA 5KTKA 1XILA 2ZTVA 4UUJC 2ZAMA 3A1FA 3AJRA 3CEAA 2EERA 1NQAO 2O5VA 3OPVA 2WICA 3KQHA 4HYOA 2QUIA 3F2VA 2F1JA 4XGRA 1XMOB 1GKKA 3X1KA 4P5DA 5B3LA 4UNIA 4AQDA 4NXNO 2XMSA 1H6CA 1E1CB 3RYFB 2PX4A 4JC5A 4UNSA 4EI2A 2XAHA 3OE7D 3UH1A 4E4YA 3HZZA 2Z8YM 1P91A 3L0CA 2UUBB 4N76A 1JT2A 3DDCA 3L0IB 1SC6A 4ED9A 4XYBA 2R751 5EXDA 1X70A 3H05A 4Z2WA 1C7EA 2OECA 3HK2A 4LWPA 4AX8A 4XRGA 1JE1A 3Q5DA 1TKCA 5JXIA 3UHFA 3ASVA 3FOZA 2GNOA 1HEIA 3E9DA 4ETWA 2SCUA 121PA 5CXSA 5IAEA 3OFSA 3T9FA 4BMNA 3IDQA 4NV1A 3H1LH 5HMLA 2ISQA 1WWKA 4GBGA 2V6FA 5B7PA 2V1DA 1ZWLA 2Q3MA 2WWXA 4WBSA 1I5OA 3I30X 1U02A 4REOA 1TAHA 5LWQA 1IK4A 1X94A 5FHQA 5AVQA 2YMQA 1DQNA 2G8NA 4KQ9A 4HZ3A 2ZRQA 3ZDAA 2OAEA 5LOVF 1DQYA 1TMYA 2YJTD 3PX2A 4ZI5A 3EDRA 2VJPA 4B32A 2Z08A 3K9SA 4UCTA 2XQGA 2RCNA 3GU3A 1N2CE 3MTEA 5L3RA 3WLRA 1VQPV 1RHRA 1T36B 1YE3A 2XEXA 2OCDA 4EX6A 2IS4A 2IU4A 1N5JA 2YVAA 3OQNA 3GLKA 3CD6V 2NU9A 1LI7A 4O2BA 3GG2A 3GRYA 4RPJA 5CM2Z 4CPDA 4LNUB 1DBIA 4H7JA 2VT6A 4LH7A 1BHBA 4KIGA 5IKPA 1R50A 3EBLA 4JVLA 4MTOA 2O8EB 1H8EA 4NWIA 4N8DA 5J3JA 3NHFA 1R0BA 3V1UA 1J0EA 2NYAA 3FY4A 3M8AA 1EGQA 3H8VA 4FSDA 2ILVA 1V5FA 4MB0A 4KMSA 3LGSA 4WXHA 4DCTA 1L9XA 1Q19A 4L5IA 1SXJC 2DKFA 1U8TA 2OXIA 3VI3B 5IFKA 2H06A 2AWNA 3QMMA 1G2OA 3E4DA 4W5HA 1D8AA 4KJZA 5C4MA 1RPZA 4UCFA 3STLC 2B98A 2H0AA 4BGIA 1CEZA 1I8TA 1ABFA 2PGXA 2FWMX 2GN6A 3KM0A 4YPOA 1K7FB 3K20A 4G4SP 4UHJA 5IMBA 1TVKB 5DN6G 3UUEA 2OC4A 1ESMA 2AUTA 1INLA 1NKSA 4LDJA 2GM5A 4OBBA 1NKDA 1Z5NA 1HOTA 3FFTA 3CCMV 3WIOA 4YYEA 1T9BA 1XAGA 1UXJA 3MHPA 3QXGA 1SD1A 4AROA 3A1CA 3K30A 2K87A 4RM3A 5I5EA 3MAQA 2ZYUX 4C89A 3CPWU 2H17A 1O4WA 2IYVA 3RUAA 1TVKA 4M1SA 3ZCVA 4M53A 4YQZA 2PGLA 1OIXA 4G25A 3Q4GA 4FXOA 1C1YA 3T4DA 2BELA 3FX2A 4ONEA 3T7DA 4OSOA 3CNEA 1TCUA 1GN3A 3GCDA 2H1RA 2I7CA 4FILA 4G1FA 5TQ0B 3VYWA 3WX0A 4CRWB 4BY9E 1P9WA 1PJ3A 2V1XA 5B58T 2I65A 4RTKA 1G6Q1 5CFZA 2HLHA 2EKDA 3HU5A 1AHIA 1Y6XA 2J08A 4K9RA 5E6SA 3OF3A 4C5AA 4FB5A 4OEHA 4P4TA 5JZ9A 5DM2A 5P8WA 1CJCA 1TZ2A 4Q1DA 2J33A 3CISA 2DOKA 3QFHA 5FR2A 4GMGA 4AZ3A 4Y1GA 4B46A 4EMTA 1MEEA 1N1EA 3DE4X 1XHFA 2BGNA 3C2QA 4UD2A 5FOSA 2Y4UA 3DULA 1SD5A 2IHVA 2EX1A 2F3PA 2KB0A 3SOZA 1GPKA 1Q7RA 2W98A 4U63A 4UVEA 3TXYA 4AYTA 1OI3A 4UM8B 4ZYXA 3ADDA 1Y3CE 4J1SA 2Y0EA 3DAOA 4MW2A 5LLDA 4ZV7A 4IHJA 3NAQA 4OQNA 3RVPA 1Z74A 3D54D 4K8RB 3W5IA 3STHA 3L74H 2BFCB 3KXIA 1DOAA 5K3OA 4Q0MA 4MR7B 5IE9A 1KO5A 1LLDA 3RYCA 1DLJA 4TV8B 2P2ZA 2Z9CA 5LYJB 2LXNA 3BE8A 3HCFA 2R8OA 5FBVB 3P97A 3C0KA 5A5FA 4BNNA 1V2HE 3BD7A 3PYLA 2C2OA 4DRXA 1GT6A 3SYCA 2EWVA 5BV0A 3IERA 3FFXA 3TZCA 1PS9A 4ZXPA 1N9GA 3C7DB 2JS7A 4GQIA 2IJHA 2PTGA 3R7NA 1E3SA 5CAEA 2X8JA 4CLEA 3FIUA 4KC0A 4ZT4A 4XWKA 1M7HA 2WLIB 8GPBA 1VQ7V 4ZHQB 1KDOA 4BQPA 1A1VA 2M6SA 2DPYA 2XRMA 2YHSA 1W44A 3F5SA 3H01A 1GU0A 2GUWA 2ZJ3A 3D02A 3TCUA 4FNOA 3QXJA 2WG2A 5DULA 5I8PA 5JJLA 3QE4A 2FPPA 2Y71A 3PEUA 2OEPA 3CO0S 5M2QA 3IP1A 1AMUA 2ON6A 3GJ6A 2REOA 3I6QA 2RDMA 5BOSA 1TUBA 2D8MA 5K3FB 2OR3A 1KC1A 2ZUTA 4A8TA 1GQ2A 3HPRA 2D4AA 3G6KA 4BLPA 4HRQA 4LD4A 3L8CA 4R2WA 4EKWA 1P7CA 1Q1NA 1GGMA 5DM70 3H1HH 3TL3A 1SD2A 5FL7D 4BE7B 4GEKA 5AT1A 2MYTA 1XU4A 1JOYA 2VJCA 3E53A 3GZTB 4YX9A 1RRPA 4TKMA 4X3CA 4JEMA 4M21A 5KX5B 5TF0A 4EJ0A 4BECA 1G9XA 2PZ8A 4KXRA 3GGPA 3KPWA 3KQSA 4MVJG 4PSVA 2B6HA 4RVOA 3SJBA 5B6IA 3GAZA 4DEYA 1WS6A 2C54A 4QUBA 4IQFA 4ZYVA 2OUIA 3IHLA 1IBMB 1QNMA 3AM3A 3DEYX 3L49A 4RMGA 2DUJA 2CK3A 3BK2A 1LGYA 4G0MA 4BO7A 3QZUA 4MS2A 1Y6FA 1VGRA 1OVGA 2C7GA 1WSWA 3OVMA 5FTJA 1CUUA 1KKLA 3AYXB 3UIEA 3RB8A 1NW5A 3HLYA 3R5FA 5F76A 3S8MA 3H4TA 3ZV5A 3D5TA 3L0OA 4D8YA 3G8DA 4EPXA 5LYJF 3D9QX 1HQKA 4PGFA 1PNQA 2Z30A 1OBCA 2R6ZA 3BCCH 4R8MA 3RFVA 4BNFA 1JHPA 3DT6A 4WKGA 3OMNB 1E3TA 1UBLS 1VMAA 3HRIA 4PGAA 5EQJB 1JJAA 3U48A 2Q5OA 4OYRA 3BQNB 4QGGA 1LFAA 4D7SA 5JDIC 2XA2A 4MUYA 4XW2A 3TDNA 1WF6A 3MJ4A 4I0XB 1YITV 4O59O 3W8DA 1JKMA 3OR6C 2E2WA 1XMXA 4DPLA 2V7TA 2FTKA 5F7ZA 1CB7A 1G8SA 2WU8A 2YWDA 3A04A 3AESB 4PY2A 4DQKA 3G85A 4U6SA 1I7NA 3M4NA 1U1DA 3N8HA 3DG9A 1VI6A 1FPMA 1SC9A 3CH6A 1YA6A 1WN7A 2BHTA 1OCCC 3UHAA 3ESXA 1NONA 1SQQH 2H1WA 5FUWA 2PG3A 3R0IA 3ZE6A 1S3SA 2PTHA 4R6XA 3T9EA 2ZZKA 1HE1C 1CE8A 3BWXA 4G84A 2O2ZA 4G09A 1VE1A 5JD4A 3FWNA 2WSMA 1L8OA 4NR1A 1ZIOA 4BE4A 2D3WA 4C7JA 4F86A 2O2DA 3L4BC 3SC2A 1GA6A 3KNZA 1O6GA 2DPXA 3AEQA 4ZTUB 3SZRA 5FFFA 2CY0A 4GDMA 1C29B 2PU5A 1YJ9V 4ITRC 4AP9A 2Q0OC 4FFWA 5AVRA 3GDHA 2BH2A 2NADA 2QX7A 2W71A 1R8QA 3MS7A 3QLUC 4LRYA 4AURA 4AL4A 1SIOA 1QX3A 4JUIA 4HBGA 5IK2A 5B4UA 3TGPA 2WSBA 1P1RA 3K09C 3ABUA 2IPOA 1UKCA 2GA9A 2GSDA 2JBHA 3LLMA 1XDGA 2CH7B 2GBOA 5K0SA 5JWPA 3TLKA 1YB1A 2AYXA 4AF6A 1NVXQ 1BVHA 3HCDA 3V5NA 4LK3A 3NHRA 1KYZA 3NIDB 1DWQA 4ALIA 3AZOA 2QWNB 4TM7A 4WFKA 1EN6A 2YRXA 5HIIA 2EG9A 4OCLA 5T4HA 4M22A 2B94A 4CDRA 1X7HA 2LJ2A 1OU0A 3EW9A 3I83A 2HNBA 3TLAA 5AM0A 2D5LA 4W5TA 2RHDA 2O20A 3HG7A 1A5BB 3M4XA 3KKZA 4WNAB 5DIFA 1OCRB 2ACVA 2QPLA 3SPXA 1AD2A 3H99A 3MMNA 2ZBEA 5K2MA 3AK4A 1CXZA 4EG2A 3K8QA 3LBFA 4EABA 4TT8A 3B9RA 2B9EA 1BQEA 2VDNB 4PG6A 4WNCA 4AMGA 3K59A 2UDPA 2V8OA 4K8XA 3THRA 2YXDA 3BE4A 3IEMA 5JSZB 2QG4A 3BEOA 1VHQA 2VI5A 3O38A 1ZABA 5IYDO 3TSYA 3OIDA 3MUNA 1UQRA 4NLLA 4YLEA 4D3YA 4H31A 4YJHA 2ICAA 4KO1S 3STWA 2OCGA 1Y34E 4DKJA 3IQZA 1R9JA 2NUPA 2FUKA 2JLAA 4JZGA 3MA0A 4OP1A 4RQTA 2QQEA 3UV3A 4MWOA 4F3YA 5CFOA 1YULA 4E30A 1DEOA 4NOMA 4X71A 1L5ZA 3ZYCA 1XOUA 2KWIA 7GPBA 2CEKA 5AXAA 5KNDH 3P52A 4PPQA 4BJ6A 1PJ8A 2P30A 1KDTA 3UXHA 3GLFB 1G8FA 1PR5A 4GMKA 4TYQA 4AG5A 4EL0A 3ZVNA 1L5SA 2J3EA 5AXCA 2P06A 1EEHA 2NO6A 2HU7A 3K2BA 3TEMA 4UTNA 5JSQA 1ZVMA 4W9NC 2GBLC 3X2QB 2Q2VA 4FLUA 4PLZA 5EC8A 3WL6A 4B4WA 2WZBA 4EHAA 2G67A 1VPLA 3FZNA 4F85A 2ET6A 1OXVA 2GMWA 2YMMA 3CCCA 3KHKA 5H68A 3WLLA 5JNWA 1BVYF 3K58A 2F3RA 1SXGA 5U4XA 1W6UA 1K0FA 1SN7A 1QPGA 2HMTA 4AO8A 1CF4A 4FLVA 1T0UA 4JH0A 4FW9A 2I29A 2YNMC 1XDWA 2PGOA 3TZ6A 3X2EA 1Y1LA 1MO3A 3TFWA 2VPWA 2G0AA 1LI5A 4G0NA 4OB6A 3U3XA 3CCEV 1SVSA 1T1GA 3NTRA 5LBUA 2Z4RA 2ZBVA 1IY1A 4LR3A 1V45E 3ZCRA 2X5XA 3WU2Z 3WBKA 4AYXA 1GU7A 1TYEB 2QV7A 3IEUA 4BLQA 4DNXA 1NE7A 5CXQA 1ZK3A 2VJNA 3HDYA 1JG6A 3TINA 3TJZA 1A77A 4QVIA 3NTLA 4HDOB 2ATXA 3TM4A 1A8IA 4KNYA 4ZOLA 2OG4A 1S2OA 2UXBO 4EB6B 4I9QA 3CUVA 3DVRX 1G8JA 1UFRA 1OZHA 1T9HA 1T8WA 4GE3A 5GY7A 4BX0A 2Y48A 1K8XB 5HOQA 4N3BA 1EU1A 2XEDA 3L93A 4EG5A 3O3CA 4KYIB 1YKSA 3HCBA 4JNKA 4P83A 2HBRA 1GCUA 4ZO8A 4GOND 2PT5A 1HUQA 3L7OA 1CD5A 4ITVA 1GA4A 2IF2A 1S96A 4J7AA 4OM8A 4Q7EA 3G0BA 5IKOA 2BGUA 1L7QA 2ASEA 3S28A 2WT4A 5KTRA 1DQZA 1N4DA 5D1HA 4AC9A 3MGBA 4FCCA 2B5OA 2D59A 1V43A 5FF9A 3WGHA 4ZDIA 1UPBA 2CNOA 1SXHA 2IPLA 3N2GB 1OD6A 1DB3A 3OAAG 3B85A 3A9WA 3DCYA 4DIEA 2C2BA 4TTSA 4KXUA 1PNKA 4QPCA 4RF5A 4HQ0A 5JWHA 4INZA 4N21A 1EFVB 1YZ3A 1THMA 1BHAA 1OSNA 2FMKA 4NAUA 4RK6A 3T5GA 2PZMA 4Q4DA 3TBHA 1QLNA 2HEIA 4EB8A 2XXJA 3WAKA 2QW0X 2QSYA 2OFOA 2XBUA 1FXVA 5I4KA 4CIAA 3RYCB 3G2HA 8OHMA 3L7MA 1K33A 4N5MA 4C05A 1A04A 1DNPA 4BMSA 1BKSB 4WK0B 1SB9A 4F9GA 2B9ZA 2QTNA 3ONFA 1R1BA 1KGSA 4MXDA 3ZTWA 5HQ3B 5K0FA 1CVIA 2JEOA 4P4UA 3VYUB 2A9QA 2ZWPA 1CIJA 2O3RA 3WLAA 3ZBQA 3OC6A 1ZIDA 2O14A 2G9QA 2JDIG 3AQ4A 5JPCA 3KEMA 2BI8A 4HZGA 1O7JA 2BGRA 1D2CA 1V8OA 4AZSA 4B48A 1MABG 3R8FA 2D6FA 4LC1A 4M36A 1P4JA 1M1NB 2P6NA 3H1GA 4ZDWA 4NCIA 1PR9A 3P3NA 4O4HB 2ZRBA 4L4XA 4OF4A 4IEIA 5BNWA 1GTSA 3QTTA 3S7TA 2I80A 3TAUA 3OCWA 3DGEA 1IEXA 4DNPA 1QIEA 1RBZA 1LBQA 1T1RA 4K9SA 2EKZA 1ISRA 1PG0A 1P29A 2BMEA 3CLSD 3IHKA 2HCTA 7ADHA 2CN1A 3S3WA 1RIIA 3U3JA 1XNRO 4U9HS 3PRYA 4KWCA 4IRXA 1E1QG 4JEUA 4LC9A 3CR8A 1CB0A 3NIBA 4CCSA 3K96A 2NZJA 1U0BB 1L8AA 1Y98A 3OSZA 2G1KA 3FPSA 3KPUA 1CETA 3C1AA 1G21E 3RJ5A 4DE5A 5F73A 4I1VA 1EHYA 3DM9B 1NBMD 1YTFD 4N39A 3OUZA 4K2AA 3OKFA 2VRCA 2I4MA 2AFIB 4Q12A 5I7VA 3OP4A 2QLTA 2H2AA 4N54A 3VBBA 5A6SB 2QZPA 4BMCA 2Y1CA 1WABA 1KFJB 1Y1SA 4PLYA 4C4AA 4PYLA 2JIOA 3TGUH 1HTBA 2R96A 3CVWA 5TX7A 3DL0A 3U16A 5CBGA 3S4YA 1GADO 3L41A 4XSHA 4LEIA 3QPBA 5EJAA 1T9CA 4YP7A 3DXFA 2C82A 1JLLA 2EQBA 1J7JA 1PS8A 2J67A 3IUMA 4RS3A 5KVVA 2QOEA 3V4LA 2C0CA 1CVRA 3G49A 3HSKA 3QXSA 5KTTA 1EG7A 2CTWA 3RIYA 2UV8A 5A0FA 5IJZA 2FPIB 2ZI3A 4DA8A 2FWRA 3E7DA 5BMVB 1L5RA 1OX4B 1PZFA 1S3FA 2ZYAA 2J5QA 4YP0A 3ZU4A 3LT5A 1NBMG 2H85A 2IIVA 3ZHVA 1MSWD 4QNMA 2ZCUA 2XVXA 4ZICA 3TBFA 1TVMA 2CFSA 3Q7RA 1BXRA 5AP9A 3NTOA 5DT2A 3ITKA 2JFPA 1UBRS 1WZCA 1QGUA 2WYHA 4U4AA 4DF3A 5EP4A 4YRFA 5C80A 3BXHA 5LYYA 2FSVC 1TEXA 2RFLA 1BNCA 2WKRA 1PKEA 2D1QA 3BM5A 2P5YA 2J0SA 4NCBA 1QZZA 5DU2A 2IFTA 3BFKA 4G4IA 4BP8A 4GICA 5A5EA 2FOLA 2QG6A 3PWSA 4BE9A 1XZGA 2I1QA 3A6FA 4EENA 4MVJA 5ILGA 2JLQA 3CCSV 2DYSC 4ZBMA 1GTMA 1KZ4A 5AXDA 2PUEA 2B4RO 3W90A 1IUOA 2UUAO 4CF6A 1JEEA 1N75A 2ZK7A 4P3YA 1FXHA 1PEDA 4JAUA 3ACCA 3QFSA 1EDEA 4WX2B 3VJKA 3PXGA 1BE3H 1SXJA 3NU1A 4MKHA 1E5LA 3AP2A 4OMUA 1I5XA 3QKTA 4PPGA 5HRAA 4INJA 5DJ5A 1SOWA 4ALNA 1CUXA 1P4AA 3AEQB 4UBOA 4ZOEA 5L3QB 2WOOA 4EY6A 4DADA 2Q2WA 1OTHA 3G17A 2DUUA 4A6PA 5ARDA 1Q91A 2WMDA 4C08A 1MOQA 4N7RA 3RT1A 3IJ5A 1BVUA 3BL8A 4QWMA 4XARA 1PJAA 3R3VA 3TW8A 1HYQA 2C58A 4O5AA 4KSCA 3C3DA 3TR0A 4A0RA 2QW8A 1KIFA 4RVCA 9LDTA 4QYTA 4O4LF 4ZQFA 3DEIA 2D2VA 3L9DA 4R1SA 1WZ2A 4DKXA 1HXHA 5LZ5A 4HS4A 5L6MB 3HJTA 3RG8A 4DV1B 4LF8B 3R0QA 1O87A 2D5IA 1P2SA 3DAYA 3LVBA 4CR6A 2ZS8A 5BV8A 3S7ZA 4ETNA 4RXUA 1PNRA 1BQ0A 4J0KA 4RA6B 2B8JA 4AICA 2H1IA 3DWIA 4J1TA 2UUPA 1SH7A 4QDXA 4XUGB 3GW8A 5JQGB 1UWCA 2IQIA 2ZXFA 3PX3A 1GVHA 1F8UA 3K04A 4FMDF 3AEXA 3ZHBA 1RKUA 4PN7A 4P86A 5JAPA 5LWHA 2JGLA 2ZPAA 2ABWA 1L7XA 4JI6B 2DH5A 2YFHA 3IOBA 3WRXC 1EA5A 2D8AA 2WYWA 3LA8A 4WXYB 2HMUA 3DDNA 4HNQA 3UMFA 3VU1A 1V4NA 4ALLA 4QGSA 5KSOA 4Q1EA 5EHGA 1K92A 3D8HA 3JCUZ 1XRQA 2YY5A 1G5QA 4JC4A 1BWPA 5FFNA 3MPOA 3CEHA 5FR1A 3SIWA 4XR9A 1YJNV 3IJFX 1F8XA 3AVOA 4TV9F 1LB1B 3AY6A 5GJWC 2EZ4A 3WJ1A 4EGJA 2K4MA 5J2UF 1JPXA 5HZKA 5AHXA 5D3MA 2Q9BA 5ECYA 3GJ7A 1ONOA 5H3HA 1ZUHA 3F9RA 1H6DA 4DPKA 4E5PA 2OBCA 4WXRA 2DHEA 3T7JA 2ZB8A 1Z2NX 1RI3A 5ITZB 1ISSA 1RM5A 2RH8A 4IY1A 3DMFA 4B43A 4PYNA 4J9ZB 2WLJA 1EGVB 1BGYH 1OV9A 1B43A 2QKAA 4ZYLA 5AH0A 2P4VA 5AI0A 1XZNA 4GP6A 3UB4A 1I2DA 1E69A 3KKKA 1J95A 1KK0A 2RK4A 1KI3A 2J0VA 2Q3EA 3BX1A 3LIIA 4LNHA 4TKZA 3FN4A 2XB2A 3QU4A 1M1YE 2ECKA 4EVQA 2OXFA 1UFKA 4OHRA 2FUNB 3ROTA 2AQ8A 5CNKA 1V6CA 5A9SA 4IJVA 2NO9A 1B1CA 2O23A 1XA3A 5DHFA 3NV9A 4NICA 4IF4A 1KP3A 2WHRA 1GN2A 3OZVA 3ZQUA 4D99A 1BRTA 2ZGVA 3BMNB 3PYMA 4K7JA 3STUA 4ND6A 1XO1A 1BEUB 1N92A 4D96A 3DBLA 5KQRA 1J5PA 4NB5A 2YXEA 2EGGA 4NARA 4YRRA 3AXSA 3OX3A 4CM4A 4TQUS 4DG5A 1CIVA 2YIBA 3B5JA 1IPEA 1TJ3A 2Z95A 4NULA 1L5LA 2IYQA 4IIFA 4BFUA 5BWMA 1AHPA 1OHHA 5CJJA 2HCRA 4ND7A 4BJ3A 4YAIA 5DMXA 3W04A 2LPMA 2ZU6A 2HX1A 3CLTD 3B09A 5LP6B 4NNOA 5HIJA 2DFPA 5B2FA 1YJWV 3FB8C 5LDHA 4PNZA 3DR5A 2GPBA 3LVRE 1L0NH 1I0LA 3F8SA 3CXHF 3QVOA 4N0MA 1YR2A 1T6YA 1G5IA 2NM0A 2ZRCA 4WZBB 5F2EA 4D1YA 3I5XA 5IASA 1PD3A 1E3LA 4B7KA 1M56B 3C90A 4ML3A 2JVDA 3ZCCA 1XWWA 2N47A 3M49A 1NC1A 1RC8A 1IIBA 1RDFA 2VDQB 3VJMA 3EEOA 1IXBA 4YRMA 3TEJA 1PZGA 1S9DA 2NVUA 4BFTA 4X94A 2BONA 5DISB 4FMTA 1JLMA 4F56A 2YEVA 3ZXIA 3SWWA 5CBKA 1MC4A 5CLJA 4YP5A 3TPCA 2IYZA 5TT1A 2YIMA 4RY9A 5JOQA 1OWOA 1Z6PA 4XSGA 1N2HA 3KSRA 4JEIA 4WKBA 3ZD9A 4I1PA 4AKTA 5BQXA 4UFOA 4PX5A 1N33O 1L7AA 2Q0HA 5EIOA 2IELA 2WLSA 4PPYA 4O4HF 4EO9A 1HETA 4U3JA 5IUNC 4ISCA 4EUHA 5I51A 1K9SA 4I4IA 4MS4B 2W2LD 1ZY2A 3OR7C 3CZ5A 3EZ2A 1RCTE 2EAUA 3ABZA 1GRQA 2HJRA 2JLSA 3N6VA 3ZDDA 3MUFA 2MSWA 2FFQA 3FYUC 3J81k 5F2VO 2GDJA 2J46A 4N01A 2CJWA 1U8AA 2ZYRA 2PKQP 3QVTA 2EEPA 2B25A 1R73A 3KKOA 3KQWA 3NAMA 3OEHD 4ZAXA 4KQIA 4AJPA 1DXHA 3OHSX 4OUDB 4JP3A 4LYJA 4UU7A 1SCUA 3ZJYA 4KAJA 2QN9A 3UJCA 3GJ0A 3R7LA 1FDTA 1I5YA 1E9BA 3F5WC 1CUDA 4HAYA 2CLLB 4NBVA 4WASA 1N2BA 4PNPA 5E4TA 1QE5A 4ZVUA 1Y3HA 2F00A 3KUKA 4JX8A 4AQYO 4G85A 4RCZA 3IBGA 4R1MA 2V7UA 1ZI6A 3JTMA 1UT8A 1EZ1A 2XD4A 2GZ1A 3LX4A 2PYJA 1FFSA 2OILA 2VHEA 4XFDA 4B3GA 4A27A 1RAEA 1SVIA 5DE3A 3H5LA 1GGVA 2SECE 4F2GA 2AC2A 4INPA 1Y1RA 4F3CA 3EISA 1JDZA 2ZKIA 3DAHA 4RL4A 4XWGA 1X74A 1S2LA 2DLDA 3S55A 4BNDA 2WA3A 4GX0A 3I6BA 3MVEA 1MC1A 5EPEA 1NQOA 1DS6A 4A5OA 4B9AA 4BIUA 1K5DA 3GFQA 2ZEJA 5HK9A 2R7KA 5H5NA 3NM5A 3FLAA 1R6TA 4M98A 5ALWA 2DULA 4A3SA 3GYBA 1T2DA 5JS1A 2ZKOA 2QI9F 1J2YA 3OTWA 3JQAA 5EXSA 3RLIA 2TMYA 2CV0A 2G36A 2P0EA 4C2TA 2X1VA 2L35A 1QX4A 3QFFA 1RBYA 4QXRA 2RGAA 5TMDA 3TSCA 1S1MA 3B1KA 3QLVA 3WLNA 2NU7B 1KERA 4MR8A 4X61A 4ZAYA 5KOJB 3II6X 1Z2DA 1CR4A 4I08A 1T36A 4BIZA 2A9JA 3U4CA 4YCLA 3THWB 5LUAA 2A92A 2ZIGA 3X43A 2C97A 2CH7A 4E2FA 1A88A 3D1LA 3CX6A 1N2JA 2FFJA 2EEZA 4CIVA 3FPAA 4FJCC 3WKAA 3X1XA 1DHRA 4CTOA 4RHFA 4QYWA 2P9HA 1GZ3A 4GYYA 1NYLA 4GC9A 3EY9A 4QPDA 4ZRNA 3OEEG 2BEKA 3ILYA 2C4WA 1SQGA 2I6QA 1IK6A 1XTKA 4AAYA 2IOFK 2RGNC 1PD0A 1YVDA 4X62O 2PEZA 2HQRA 3C8UA 3FFWA 3HFJA 4HGOA 4PG5A 4ZO6A 4EKGA 4ZIRB 5GIOE 1RR6A 3EHDA 3EA5A 3GEIA 1WXIA 4XRRA 2DBZA 1AA9A 4MLPA 5P21A 3GA7A 3JY6A 2ZULA 1E7QA 3IVXA 4F2WA 4PD4F 3CCJV 3E7XA 5AVZA 4D6TH 4FM2A 2PT6A 1TQHA 1PGNA 1QV6A 4EFEA 3GB7C 1VL6A 1TI7A 2B99A 2HREA 3DQPA 2ANBA 3IGAC 1QQ7A 3D2BA 4URWR 4WXEA 3SR4A 2O3SA 4FWIB 3HUEA 2FUG6 3I04M 4YBZA 3RTAA 4YI3A 1GCGA 1RRFA 5EKTA 5L8VA 3S8YA 1RP7A 2AC7A 3H42B 4LF7O 1JSXA 2IA5A 4KFUA 5LMNB 2G5CA 1D07A 1PYGA 1VSUA 1OBOA 1Y6ZA 3IAUA 1C4OA 4K03A 3B77A 4FPPA 4W4TA 4BJ5A 1IEQA 3LXXA 1EESA 2Q8NA 1XRRA 4EQZA 1SQPH 1E32A 2X7RB 4F2PA 1RABA 2QKSA 2JJYA 4NU8X 4LYFA 1DFIA 4KX5A 5A2QN 5KC9A 3PUVA 4FK8A 4PX2A 4OX9B 2BR5A 1VMGA 1IY0A 1O6BA 3SQNA 4HN4B 4ZEVA 4QXPA 1UQTA 2NU6B 1PSWA 2XGSA 2ZI5A 2XR1A 2H3EA 1QH1B 2Q5CA 2OK7A 3EH1A 4IAOA 3HYCA 1FTWA 3QXXA 3GA0A 4FYVA 4TUYF 3KLMX 1QK5A 3B1WA 4CMCA 1XK6A 1CQPA 3CF2A 1NPDA 2EFYA 4YAEA 3T7TA 1OGYA 4GE0A 3VPCA 3NBZC 2AMVA 3WK9A 1BX0A 1YBVA 3E23A 2UYGA 3CNNA 4GZRB 2BSXA 3GCXA 4KAAA 1Q7YW 2I76A 2IW3A 1V16B 2ZR3A 1Q5PA 3RU7A 2BFAA 2ZE5A 3ZIAA 5J2UB 2JFGA 5IZCC 4S2EA 4FGWA 4WFFA 1LCIA 2H51A 2QUJA 3G8QA 3L9XA 4C7KA 3LNCA 3QVNA 1L7MA 2C94A 3LT4A 3Q87B 1M34A 2ALJA 3LL4A 2BPOA 2E5LO 4Z0HO 1SULA 1MFPA 2X8BA 1KNQA 3CR3C 2ZIMA 3H3XA 5DO9A 4WLVA 1B3BA 4WOBA 4J90A 3A0UA 5DTIA 3SX4A 4IDNA 3IQGX 4Z4QA 4BFSA 1H8EG 2OT3B 4GKAA 4LCBA 3SEFA 2DCUA 4MVZA 4J3FA 1IBCA 2G71A 4BKQA 4CM9D 4IXDA 3ZK8A 4YP9A 1MDFA 1YD7A 1IY2A 3RJ9A 2QBYA 2KHZA 2QL9A 4CLXA 2LW1A 1ZP6A 5ICFA 1PV2A 2RSLA 1Q1QA 1C3OA 4JTAB 3AERB 2PS0A 4HSEA 5F1PA 3UAVA 3VO9A 5LD2C 3R0XA 4RTRA 4MW4A 1H9CA 3PC6A 5KWVA 2O8CA 1XD2A 2P0AA 2Z2ZA 1OIWA 4KIFA 4NIMA 4KRGA 1R4NB 3KE8A 3PJGA 1S3GA 4L3VA 1MA0A 5DN6A 5IULC 1ANKA 9LDBA 2C96A 3U4IA 3PUXA 1KOFA 1DIRA 1JS1X 1SHTX 2FPOA 2SNIE 4I3FA 1H8ED 3D8TA 2UUBO 4X1KA 1YVUA 3AKYA 4OJNA 1A8QA 4XQGA 5BN4B 3W9UA 3A0BZ 3SM3A 1UJWB 3OHMA 3NASA 5CNMA 2VTBB 1FFDA 4XD7D 1LRLA 3WL7A 1TW3A 1AB3A 3JSNA 4RYDA 1EM1A 2BGKA 3HJCA 5ALKA 3TLGA 1ZNXA 2JPDA 5DTQA 5GZ1A 1RBMA 2I2XB 3ZV7A 3WADA 3L7BA 3E3LA 3LX8A 3SDLA 4NENA 5T3YA 3U80A 5LNK1 1JCHA 2A5DA 2B9VA 1TF2A 4I2VA 4EJFA 3EZNA 2HFJA 4N65A 4M46A 4NMXB 2VZ8A 2QYHA 3I42A 1Z4NA 1PSDA 1O2DA 1RWBA 2LE0A 3N8KA 3P5SA 4LZLA 5C5CA 2FEKA 2HYIC 2KPOA 2WNHA 4J42A 1R1DA 1KBOA 2FSGA 4FLEA 4PS1A 1BXRB 2VRZA 1J2JA 4HN9A 3DZFA 4IJQA 4KP4A 2CLSA 4C3ZA 5B1BC 2WWFA 4WFAV 1AT1A 2ZRGA 4BAYA 2C61A 2EF0A 2UYOA 3AU9A 3MUEA 3IV9A 1YE5A 3NW9A 4DDVA 3VR6A 4HB2A 3VDQA 5LOVB 3WBFA 3I04A 3MJRA 3X1YA 3E7WA 1WLYA 4D3DA 3ZNOA 1KYQA 4UCOA 1Q77A 4Q7KA 5ABPA 5LQUA 2C2WA 2JFXA 4J4BA 2WT9A 3PFNA 5HSGA 2AFRA 3S6JA 5J23A 1QS0B 1DK1A 2D1TA 2C98A 1E2JA 3KZIZ 2GUGA 4NI5A 1M2JA 4K28A 1HP8A 3AR7A 2FE4A 5TQ2A 1H3NA 3H4MA 3PDCA 3SC3A 2A0YA 3W3AD 3RUEA 5L53A 4R7TA 1C80A 1L0BA 1XMQO 3CNBA 4HUQB 5K51A 1L5KA 1P74A 3WMEA 4IS3A 4I0XA 4Z86A 4X6LA 4I0WB 4JGSA 2JASA 1I3KA 2XIQA 1WXFA 3LBHA 4JVOA 5DM4A 4G1VA 2A8YA 3RSQA 3TSOA 4B3FX 4FP9A 3EQ6A 4QQKA 3I73A 2O0LA 3TYXA 2H16A 5B4VA 1QDLB 1FLDA 3ZD8A 4LFAB 1YSBA 1JEQA 3UJ8A 1Z8FA 3PDUA 4FDAA 4WY5A 1KSFX 5ELLA 2IYLD 1JVSA 3EASA 4M89A 3WGVA 4E1VA 2QZ4A 4I55F 5J9PC 2P2NA 3CGGA 2DMXA 4ARIA 1QTIA 4MPRA 4MJXA 2CVHA 1QAOA 2YDXA 2E9SA 2HY7A 3Q12A 3ZOKA 4CV2A 4DN6A 7REQA 4MQ6A 2PD6A 3E0XA 1HR0O 4FJ0A 1KU9A 1P60A 3EEFA 1WY7A 3CMCO 5LA6F 3BE6A 2HDOA 3LKDA 3A4IA 4PZPA 4FQ8A 2B37A 1N6RA 1OXBB 3QNEA 1QO9A 4HDKB 4YMUA 3DMYA 4FLFA 2Q2QA 1HZZC 1XRSB 2QN8A 1QU2A 4WN9B 2ZWAA 1E7RA 1PL6A 2WW8A 3P4XA 3CVYA 1KMIY 4U7DA 2OHVA 5E1MA 1HDYA 1HM5A 2Y4NA 1JG1A 5CH5A 4E5KA 1Q22A 2ODTX 2QD4A 2WHXA 1NJGA 2AHOA 4Q9HA 1XLWA 1A1SA 1OT3A 4LC5A 3C5WP 4RZUA 2R4TA 2J3QA 3H65A 3EPHA 1H4VB 1UK9A 2FJUA 2A0XA 2K7ZA 2O07A 1QO0D 1GN9A 2L82A 2PPLA 3ENNA 2YWJA 2NO0A 4EPVA 1G291 4KNVA 1SERA 3ZY5A 4CV3A 2Z2IA 3EXHB 3KQPA 3TD9A 3M6IA 1XL6A 3SS7X 1NJ5A 4JU8A 3SDBA 3U7EB 1VPWA 3UGTA 1PNVA 4C4SA 5JAIA 2IT1A 2QJFA 4R2JA 2X7XA 2JJMA 4U0KA 4DLLA 1UOQA 3OTGA 4TS4A 2A0KA 1NVPD 1JMYA 2WD9A 2XTAA 1TOAA 4DTIA 5BY2A 2WQ6A 3ZHTA 1PIWA 1PUJA 1QCCA 2FGKA 4W82A 3ZKAA 5KSYA 4B2IA 3SHFA 3TKAA 4ZHQA 1XLTA 1YQ9A 4QUDA 4HRVA 3P7MA 1LRKA 3ABTA 1O94A 3DQZA 5TJHA 1CS0A 4RD4A 3EIUA 3EXEA 2HHHB 1T10A 4OHBA 1WAMA 4INAA 3P27A 4WGGA 1A2KC 1UT5A 1TC1A 3IEXA 3MXTA 3PI7A 3ZDQA 2O59A 2DR2A 3R5HA 1SUIA 1TXGA 3ZHUA 5E4FA 1XPJA 2DC1A 3DWEX 4YV7A 1B6QA 4K05A 1N0HA 1WMAA 1SXJD 2QL7A 2KYRA 3D6TB 3FYDA 4PFKA 3VR3D 2HA4A 2C7RA 3M8KA 1GV0A 2VHCA 3UMMA 4X6UA 2CVQA 3FLBA 2JVKA 3JQ8A 5EXPA 1NXXA 2H4JA 1UDCA 3EB9A 3D0OA 4TL9A 2Z2XA 1RM0A 2MR6A 3E84A 1LJUA 1ULAA 2X0JA 4H17A 3TW6A 4H59A 1CF9A 1E6WA 1JX9A 4TLMB 4DW0A 1C0LA 3MOIA 1EZVH 3PHBE 4OYLA 4BTEA 4BX3A 4M9XA 4W7SA 2BHNA 3PBKA 4WI1A 1AZSC 5H70A 3DKPA 1AV7A 4Q3AA 2CCJA 3FYHA 1NZFA 3KEOA 2YXHA 3DV2A 4YJDA 2P6OA 3BGOS 1WNSA 4K87A 3GN1A 3FMGA 5SY6A 3GJ8A 3AL2A 1S5PA 1X0VA 1N6OA 2VKQA 1CUJA 3I8SA 4WDQA 3M1AA 3GFGA 2ZBGA 4FJ2A 1C4XA 3E22A 4JI8O 1CY1A 4AG6A 2FG6C 1UWLA 1OIVA 4NK4A 1D0IA 3B3FA 4RLHA 4UUBA 3COPA 4Q7JB 1A2QA 1XMQB 1JWBB 3SGLA 4DYHA 1G0NA 1E2HA 3FFAA 2VP6A 2HJDA 1F4VA 4JB0A 2Q8VA 4A8JA 2YWGA 4QYMA 4JP2A 4ZKEA 2ZTUA 5THXA 5CYGA 1VB3A 3MTJA 3ER8A 1IDSA 5CA1A 3V4ZA 1H38A 2GAFA 3GMTA 3R6TA 3RF7A 1IUPA 1DEAA 2O8VA 3U4HA 1YZNA 4CQJA 4DWVA 1W1UA 1P6UA 3QJYA 4UZSA 5AJZA 2IHNA 3OCZA 4QOHA 4ZCIA 5JAMA 5KCMA 2O3JA 1Q0QA 2VLBA 3IAM6 4RYLA 2JANA 2XLBA 3KUUA 4BV2A 4EZEA 1XZQA 5JSZA 4A2CA 4D4HA 4QFCA 1RI1A 2H1LA 5CBHA 4D8UA 4MV3A 5LMUB 1HE2A 2ZIUB 3ISTA 5BMVF 3ORSA 1WPGA 2CNBA 2W2MA 3PGKA 1V2GA 2V4MA 4I9UA 4XB1A 1Z5WA 4RHCA 2JLBA 2G04A 4O2BB 2ZJ2A 3P9YA 5CH8A 5DX1A 5CDYA 3D0RA 1I1NA 4FC6A 4EGQA 2G9VA 4Q00A 1GTG1 2QPAA 1VL2A 3TQQA 1REQB 3EHBB 1KH1A 4O02B 3RVSA 3VZPA 3LDDA 4QGPA 2IYUA 3DTNA 5FPKA 4BNTA 1BROA 4XH9B 5ILOA 5A0VA 1C30B 1V47A 3D43A 2LGQA 3RK4A 1XWIA 2ODEA 5HUJA 1JIJA 1PYOA 5EYPA 3K1ZA 2J4CA 4YT4A 1AH2A 3DXYA 3L4EA 4R5MA 5G3ZA 3DFKA 3GDOA 4IQGA 3RIXA 3KSAC 4DR6B 1U2RA 3FCCA 1N6HA 4HADA 1YRYE 4DZZA 3FNEA 3QK7A 5CFMA 1SOUA 4O4LA 4IDCA 4J29A 4P6VF 1R9GA 1XMIA 1T2EA 4M88A 4O8ZA 2JLWA 1CY2A 3UICA 4Y2UA 4AY3A 2O2EA 4URXR 1Y6QA 1GEEA 3DTVD 3RVNA 5J4KA 3CUEF 1BQZA 1KY3A 3UY4A 4FM9A 1KMNA 3NUZA 1E6UA 4YROA 1RB7A 5AIBA 4LV8B 4XWYA 4IGIA 4JIGA 2W2VA 4N40A 2YJNA 3O4JA 4LCOA 2WLLB 5LSAA 3JSAA 2H59A 4S0XA 4BBZA 5I4CA 4OQPA 3SYKA 3RHTA 1UPFA 4A5SA 3LHKA 3A6PC 1P33A 1QLWA 1XQ1A 4PA9A 1ZVJA 3ZWKA 1V0JA 2Q1UA 5JYCA 4R69A 3HB9A 2WNIA 1UAYA 3JQDA 2XUMA 5LLTA 5J59A 4HNUA 3GQBA 3QX7A 2ORWA 1Q15A 5K8CA 3OT1B 2PKQO 1QLJA 2VAMA 4LMAA 1P62B 1VOTA 5EKSA 1PJ2A 3T7KA 1AGXA 4L22A 2P8JA 2VS0A 3KWJA 2WM2A 3QU2A 4WKPA 4R0MA 4MP8A 5DCAJ 3JAKB 4MDYA 4MVJP 3T5DA 2DT8A 4GT1A 1E64A 1ULTA 3K6KA 3C1TA 2DPLA 2PUBA 2CWWA 2Q8PA 2AVDA 4XFKA 1RXWA 1R5NA 1RFLA 3H9GA 3Q9SA 4HC4A 4QPJC 5BW6B 3KZXA 4H7PA 5AVXA 2WIAA 2Q46A 1KRHA 3AI7A 3KYDA 4KKXB 5CB4F 3WYBA 3OFND 1N34B 3PR3A 1ECBA 3GRZA 3KTDA 2ACKA 1FTNA 4KGZA 1K8RA 4HNAA 3ZZMA 5AVSA 2LGJA 3K1JA 1QH8B 3ZR4B 1QRSA 4CQLA 2W00A 2PUSA 3QO8A 1N36O 1P18A 3D3KA 2OGSA 4OHYA 1K4MA 3WWCA 3K6RA 3QLEA 4CEJB 1GG8A 2FRVA 1U8XX 3FYUB 4QO8A 4GKJB 3V1TC 3ONVA 3VYSB 4FE3A 4X65O 2VK1A 2YZGA 2BI4A 5CW1A 4AS2A 1G6KA 5ICSA 1Q84A 2HHAA 4R98A 2EFHB 2Z04A 1Z3IX 3AEIA 3H11B 3MRSA 4U8GA 1WZUA 2CMKA 3KJEA 2ITCC 4IIYA 4HS9A 5CDFA 5ALHA 1VCNA 2JDID 3CIOA 4KDFA 1KWKA 2XT0A 2FG5A 4MDEA 2DYRC 1RMQA 5LP1A 1X1AA 4JI8B 1NM5A 2RGWA 2VT3A 1IPHA 2WT8A 3VPGA 2P8SA 5C1BA 3T1HO 4ZA2A 2RMKA 2WJWA 4EHBA 5LIPA 5MFZA 1IHDA 2FN4A 2P5OA 1FXWA 2J48A 1I4DD 3WYGA 1V6AA 2FN8A 1R0XA 4WJKB 3SJCA 1G2PA 4LCNA 1U8ZA 1LQ2A 2JGNA 3RSCA 2QDKA 4GOMD 1IOZA 4KEAA 3L0PA 4GZMA 1TIKA 2GARA 3HY6A 3QRWA 4CM8A 2A9OA 1N6IA 4XYGA 4UAUA 3BAFA 1R7RA 1W87A 5TRTA 1XCOA 3GFVA 3BB4A 3KIPA 5AW2A 5L45A 2LWIA 2O6LA 3GUYA 4PEVA 2ZIAA 1G4YB 2FN9A 4DAOA 1KQFA 4RMHA 4PXAA 4XZ3A 4K26A 3I5MA 3SGIA 1AILA 1GN4A 3JYLA 1VQ1A 1TUBB 3PUZA 1SKAA 3OM0A 3FNRA 4I4CA 4MA0A 4V1CB 1ZUIA 2ATIA 1XZCA 4B40A 1MP0A 3HN6A 3UUWA 3JQPA 3K3WA 3DEHA 3GCWA 3GQBB 3LZCA 4MYRA 2UYYA 4RY2A 4AN0A 4BEBA 5JANA 5IJ9A 1JR4A 1JAIA 4OAQA 5KX5F 1X87A 2KBEA 4BZXA 3EPLA 2G0TA 1QHYA 2W6IG 2DR0A 3DC7A 3FLEA 3LLSA 1RLUA 4LY3A 3KR2A 3K72B 4RK4A 1RRVA 5SZJA 3TRJA 4QUKA 4JI0O 4JI2O 4B44A 3ND9A 4EUSA 3EDQA 1P5FA 1ZCJA 2BWJA 4JJ8A 4QOJA 5DWDA 2YIDA 2OSVA 3H84A 5ETJA 2CE7A 2JGDA 5AHOA 1E8MA 5CG1A 3KB8A 1I7LA 1R6AA 4X92A 3TJTA 4WESA 3AL0C 1WPQA 1GH6A 2RI6A 1VMKA 1IN4A 2TMGA 4JP8A 4X44A 1PFKA 1SUBA 3QV1A 4DLRA 1EFPA 3B3AA 3GOHA 2ZDIC 1CR2A 1H2MA 4Q02A 3H9BA 1HPLA 3L6BA 1V39A 4C30A 1OCZB 3PCTA 2GR9A 1OH7A 3OAAA 1CJSA 1XQWA 5B1EA 5FADA 3NYWA 2HADA 4IIJA 3O84A 5BUSA 2QY6A 2C9YA 1XD2B 2PRIA 5A3JA 2Y66A 3P26A 3DE5X 4NABA 5ICMA 3U19A 2BM8A 3H16A 4PDLA 2QRGA 5EBWC 2VP5A 4V0ME 5ALNA 3BS4A 2NO7A 5JSKA 1NXPA 3QNMA 2H2WA 3H1TA 5EMHA 3JALB 4PQTA 1HLPA 4GAEA 2QP3A 2R1UA 4B6GA 1DMRA 1E9RA 3VPAA 5JXGA 5D5HA 1TNDA 3K0FA 1U3FA 4GMXA 4Z3DA 3RNLA 5M5BA 3GFBA 1XNQO 5F9FA 4LJRA 4BWGA 3W7UA 4FM0A 1DXYA 1SVMA 2OHHA 3A58B 5J5VA 1C0PA 2ZJ1A 3A2LA 4PZUA 4RDXA 5GJBA 4JR1A 3NUGA 1COWG 3LJKA 5GOZA 1H66A 1WHTB 3F6RA 1GEGA 4P31A 4R8LA 3GLHE 1Y0BA 5JSYA 1XA0A 2VN8A 2POQX 2VO1A 3MWFA 4YREA 2HWWA 2IKQA 2P5UA 4G2NA 4LZNA 4EHIA 3O92A 4FOLA 3T4XA 2Q8QA 4RTLA 2PRZA 1QHTA 4MDHA 2VPZA 1PJZA 2BE9A 2J0QA 3QPVA 2P2YA 2XASA 2GEFA 4U2EA 2TMKA 2R7AA 1P7BA 1JB9A 3LS2A 3P2YA 4IJKA 5DBOA 1MQ8B 1ZN2A 5FNVB 3TPZA 3EGVA 4IMJB 4JZYA 3QEMB 5KB3A 3HJFA 1XVVA 1MJNA 2PWBA 2Y1XA 4C7BA 1W36C 1F2UA 2DB3A 4LP8A 2NO1A 2PMBA 8AT1A 2D74A 2BKAA 3FAVA 4PZ0A 4RDHA 4RY0A 4JLOA 1W85B 2DUMA 3W79A 3IC5A 3F71A 3RRFA 3NFRA 2NZUG 1UDXA 2V7PA 4I5GA 2FPRA 5C0OE 5BW5A 5CB0A 5E4JA 5A3RA 2E4WA 1VQ5V 1TA9A 2JLYA 5J5CA 4DR5B 2NAPA 3QA9A 5JNTA 2ZKLA 5IG2A 2HT6A 2OCAA 4UARA 3SEAA 2CZGA 4NBWA 1SRYA 1O95D 2QWXA 4LHXA 3JYOA 5TY0A 3KQLA 1DI0A 5KU7A 1TM5E 5LUBA 4LSWA 4X64B 1PR2A 2QLBA 2JK0A 3JV7A 5YASA 5EC2C 1RTTA 4KVGA 5AK6A 3LRTA 5T4EA 2TECE 3NHYA 3OF5A 4D46A 2XCTB 1ESDA 4Q6GA 1ECLA 1R3UA 3L1VA 1SZPA 4NYJR 1ZOPA 2EX4A 3BMCB 4WZBA 2EZ9A 4V2UA 1MB3A 3PUIA 2Q6VA 1L3BA 2ZSHA 4C7XA 1CRLA 1RHJA 2ZUDA 5I9TA 3CLRC 4DV7O 1DRUA 1EFTA 3NDJA 4P7KA 4Y2XA 1T6NA 3M3DA 2O95A 4FFBA 1Q7GA 3B1YA 2WJPA 1C14A 2PEYA 1K6JA 2V96A 3EMKA 3EXEB 3MLBA 1IAVA 3DKRA 1OXUA 2XUJA 4FQ5A 4FYKA 1CDEA 4QUJA 4RGVA 5GV8A 5J2TF 5JNVA 1LZLA 2E21A 4L8LA 1QZ3A 2VRBA 3CMEV 4OQYA 3O4GA 3ROEA 2EFEB 3C3PA 1JEAA 3AG4B 4I99A 4L3OA 1SBIA 4HH3C 4EECA 3DFFA 4PGGA 1D6JA 2EHDA 3EOBI 4HFNA 3IP5A 2YC0A 1BHSA 2Q50A 3I0MA 3PWKA 4AO6A 3EZGA 4A82A 2DGDA 3A4MA 1WIWA 1MZEA 3KO8A 5CUQA 4G8DA 5DYNA 5C3UA 4EPYA 5KYYA 2CBGA 4FHEA 7MHTA 2Q2OA 2H4ZA 1RPTA 3TZQA 5G02A 5J47A 2FUG1 2Z3WA 2FQWA 3WSTA 5IK2D 2CUGA 2FV8A 2IXGA 3G2MA 3Q6NA 4IGFA 4RGBA 1YNOA 3OOWA 3KZVA 4AJ4A 3AFOA 2ZRHA 3K9BA 5EYPB 2YFQA 1QONA 3GVXA 3UJBA 1MT0A 3O3OB 4PR3A 3G79A 4YB8A 1KHTA 2IUUA 4A6EA 4BWYA 2QSAA 2XMPA 4R84A 3DLHA 3D2CA 4ZREA 4PLFA 3FH0A 2WFAA 2A06H 1A2BA 1FP1D 2D1FA 4Y2RA 4S1NA 3TTTA 4BNGA 4ZEMA 1XQ9A 2KSQA 3P2JA 2IDKA 2AOTA 1FJGB 4L8WB 4XB2A 4X3OA 1UAQA 1BHJA 2IH4A 5CB4B 2WTEA 5DGXA 3GFFA 5KQMA 2XA1A 1NYRA 5B1HA 1NDUA 3M7IA 2A3QA 2RJZA 3E9YA 3KOMA 5D84A 2E89A 2HQBA 2RHCA 3I2FA 1Q50A 3E48A 4CF3A 1QKKA 4ZGBA 1PZEA 3U49A 3QBTA 5DOVA 5LQKA 4E33A 1J07A 4QUAA 4FB4A 1EJBA 1W2BU 1IBKO 3EXIA 3H4IA 4OATA 1G1XB 2DYSB 1TCCA 3HKCA 2A78A 4XAQA 4IQ8A 2OGWA 3ETEA 1W4AA 2PAFA 2IX3A 3OM1A 5JS6A 3TQFA 3N5CA 3QMWA 4HZUA 3AX6A 4UPVA 4G26A 1US8B 2JLXA 4RY8A 4X1IB 1IWBB 3EEIA 3T52A 3UBMA 4F7DA 1EM6A 1VBNA 2XCSB 4REQA 3GAMA 3IULA 4KAFA 5A7GA 3MS2A 3TI9A 2AJ8A 5KA5A 1TF7A 3KDSE 1RKXA 3VHXB 1VPVA 2QKYA 3QPCA 4A5UB 3EPKA 3A2NA 1K68A 4R9VA 1B1AA 3IMGA 3BJZA 1VJCA 3NGMA 4Z0NA 1K8AW 1RRMA 1ZSYA 2Q1SA 3TEFA 3O9MA 3APQA 3WY9A 2WD7B 1CJTC 4WLOA 3UFXB 3W5HA 4LBYA 5H4GA 2EU8A 3K9GA 4QL3A 1HQCA 5AOCA 2LVBA 5BNTA 4LD2A 4PZCA 4V03A 1B26A 2WINI 3L8HA 3ADOA 4KVFA 4P30A 5IH7A 3AH8A 3MTDA 2H31A 3GT4A 4HY3A 2XT6A 1GN8A 3DB2A 2JIDA 4S1PA 3DNMA 1JU9A 2AKAB 3N07A 1E1LA 2ZRIA 1UM8A 2QM7A 2C59A 3IA2A 3M4YA 1Y5MA 4O29A 1V4BA 3O82A 1SRQA 1WZIA 1RSZA 2H0QA 3AF5A 1VLZA 4U7NA 2RK6A 2YXPX 4M83A 1VHDA 5EMKA 4DSUA 4E08A 1IZYA 3DZGA 2PSSA 2GFQA 4BEWA 3MCTA 4WK4B 1SCNE 3GRRA 3P9SA 4R2KA 2VSOA 1JX6A 2BFBB 1VIVA 4B7UA 3N8GA 4BFLA 5TNXA 1XI1A 1DT3A 4LF6O 1XQXA 3HDTA 1P2BA 4TYMA 3W5JA 3MLEA 4K9PA 3PVZA 2PGDA 4NEHB 5A2QA 4MS3B 4N0EA 1T3LA 4Q1CA 4U7TB 1WQ3A 3FKQA 1XNHA 4IVQA 3V80A 2WR8A 3ZGVA 1PWXA 3MS4A 3JWHA 3I2GA 4K86A 4MV6A 2PXHA 4MQBA 4ZC8A 5JI2E 2YXYA 2V3CC 4NOJA 5ALIA 4IUBS 2FJ0A 5FOVA 3IP9A 4BKPA 5LP6A 3LO8A 2NG1A 1FUUA 2OZKA 1LTKA 4H77A 4KO4S 2WFLA 4MS3A 4R6WA 2YS8A 4X8LA 1C1XB 1AGYA 4KNWA 4ZCQA 4J6EA 1FFGA 2P2SA 1UCFA 2E1PA 3PPYA 4U5QA 3ABMB 4IW3B 5TARA 4F9TA 3AVPA 5JO0A 2E4AA 1E6CA 1UMBA 3IAYA 1L8DA 3DC5A 4JFRA 5IEBA 1WG8A 4XUEA 2AVNA 2PZKA 3UKJA 3QVKA 4DWWA 5A02A 5JAZA 4Y7DA 4GR5A 2GPSA 3RWMB 2QRHA 1U2DC 4NFSA 2Y0PA 5L3ZA 3U9TA 1DFHA 1RWKA 2PKRA 3SKVA 3T8YA 4AZ0A 2V5UA 1BMFA 5LL6P 3BRWA 2PL3A 2V5AA 3PTAA 1JA8A 3KKEA 1UJMA 1WVMA 1CJBA 3DM5A 2WLNA 4BW5A 3NWJA 4J0FA 5G0TA 1T8TA 3KELA 2JGMA 2GUZA 4JYCA 2RHTA 2ZUUA 1N7IA 2FWJA 3BB1A 4M1MA 3VPFA 1E0AA 4MHOA 4P0PB 3NYQA 5LMCA 1CIPA 2V97A 5H6RA 4BMPB 2AXTZ 3NXSA 4MVJI 4CDNA 4RZ2A 4LF9B 3VR0A 2Y2UA 1PGPA 3H1IH 1A27A 2P9TA 2PLNA 2G5TA 4LBWA 4ZVLA 3D0KA 4F6RA 3BXPA 3MC1A 4C06A 4F4IA 1A5ZA 1NP6A 1T6BY 1V3UA 5FPPA 4J43A 4RLFA 1OYOA 2Q6OA 3B38A 3RS5A 1N33B 3JTEA 3R3HA 3OY2A 4X89A 1XZLA 3GELA 1CZOA 2Z6VA 4RU1A 4PO9A 3ZK9A 1K73W 1F4NA 4RH1A 4E3WA 3KOWA 2B3JA 3LUGA 4P7BA 3IE1A 4G1UC 2VH1A 1KUQA 3C4JA 3R5JA 4WLUA 1XRNA 5J40A 2C0QA 1XPOA 3ECCA 1UM9A 1IQRA 1YS2X 4YDRA 3VTZA 3TXQA 3K5MA 1RJ9A 2LP4Y 2RG1A 3OURA 5DYYA 4F06A 1NR1A 4MB2A 3NBMA 4XE5A 2Q07A 1Z6TA 3D6VA 2JH9A 3I4CA 2KKSA 1UWZA 3MINA 2HHCA 3SDSA 2YOFA 2DTXA 4N41A 3K5NA 1G5TA 1FP7A 3FKJA 5D85A 1N77A 3V3KA 3ML0A 2B1JA 3C3YA 3NM6B 4O1IA 2XAJA 1I7SB 3SJZA 3QE2A 3H2HA 3NLLA 1WRBA 4OSPA 4RZXA 4C29A 4ENVA 4Q7QA 1GUDA 4FYIA 1VIAA 2C5SA 3IJ4A 1MH1A 3WDLA 1IBMO 4AQYB 2POCA 1SC1A 4RLQA 4RZQA 1SIUA 4A0FA 1DX4A 3CKLA 4JDPA 3A2FA 2R1VA 1LY1A 1TUEA 3SQLA 3WKBA 4AZ0B 5BSFA 1T35A 3AHIA 3BMQB 3QE3A 5KYGA 3TW4A 4EKYA 5KX5A 2MTBA 4OQ4A 3Q7EA 2K6GA 1A9OA 4RKFA 4RQAA 4D10F 1W29A 2HNAA 1IRIA 2WEKA 3AI3A 4G5XA 2C84A 4RPCA 2GWRA 4B3TO 2IOFA 1O03A 2AD5A 1UBCA 5FBKA 2IP4A 2WSSD 3G89A 3W8RA 4C7UA 1N4CA 5B1NA 2C8JA 3AUUA 2B34A 1GU1A 4H6PA 1E3WA 1GCIA 2NLJC 4X8AA 1YZKA 2H00A 4GKVA 4HDQB 2QMOA 4IGEA 2H57A 4JSYA 1C7QA 1ZAKA 4OXRA 3ZHSA 1GTL1 1QCEA 3LUCA 2RAUA 3MMSA 3PEVA 1A96A 4FFSA 4XYLA 4MTFA 1C3VA 1TU0A 2OCBA 4YV2A 2C4VA 4BVLA 1PGJA 2CLCX 2F8LA 1S0VA 1PK7A 1Y1TA 3JZDA 4Y9DA 4FSXA 1GVNB 3MCVA 4HDCA 3ICVA 3O47A 4D9NA 2FZ4A 2JFYA 4G86A 4OREX 2VHTA 1K6MA 4TMZA 4YP6A 3VQTA 4BAZA 2AOXA 3PENA 1KDRA 4RIIA 1ZD1A 3HU1A 4FZJA 2HA6A 5HTKA 1N9GB 1EI9A 1H0RA 4OMCA 4YJGA 2HR1A 3K05A 7AT1A 1FYFA 2IYTA 3H1AA 5KJ1A 3BC1A 1FJXA 2VOJA 4L76A 3ZWVA 5JRJA 1EM8B 3P30A 3QEBZ 4MKIA 3LBAA 3IGFA 5AW5A 4CEIB 1Z3CA 4FNGA 2FAXA 3N6XA 4LCJA 4UBMA 3K1TA 2PSEA 1J49A 4FMCF 1A50B 4UZEA 5IHPA 3OJEA 4NXNB 1C3OB 3AERA 3K16A 1C9EA 2MOKA 2NTJA 4LVNA 1ZLYA 2J9FA 3I2KA 4I5FA 1QRTA 1G38A 1EFAA 4F1KA 2J5BA 3DHEA 4I6GA 3UUFA 2QEQA 4YQEA 2YS6A 3ICPA 3PIIA 3O3NB 1HW7A 1TT5B 2AV6A 4L8JA 2PL5A 5CRIA 2DX7A 2X41A 3NP9A 4MIOA 3UJ9A 3X3HA 3E1UA 5HQJA 4RE5A 2VJAA 3W9BA 2WD7A 3WO1A 1GQRA 1X9HA 5AVVA 4ZVQA 3HQ4O 5HE9A 5A06A 4X6YA 3EA0A 5DYTA 5LMNO 3IEVA 2HZ7A 4KI7A 5E6SB 3U61B 4TL8A 1NM5C 4YMGA 1D4ZA 3BDVA 1EDBA 2FKAA 4IVRA 5AVWA 1J56A 2QWRB 1PQ4A 3EIEA 1IONA 3KOUA 5L3SB 2EW2A 2CBZA 4S2UA 1JQBA 2PMWB 2VCEA 1Z5ZA 2ZATA 3DBHA 3IP6A 1ORTA 1XROA 2WPDA 3PF8A 5K4AA 4FI3F 1HTTA 4LAFA 1DKUA 2CWDA 4TGLA 3G7SA 3RODA 3CZ4A 3F1KA 3WIVA 4DLSA 1NG9A 3NP7A 1WA5A 2PPVA 3AO0B 2OLKA 3ILHA 3AQIA 4P3KA 2QL6A 2OXEA 4JLPA 3RKUA 3DKIA 1RYNA 2Q21A 3CXUA 1QYXA 4K46A 4PO3X 1UBTS 2JBAB 4LWZA 2PY5A 2NZ2A 4JPRA 2R1ZA 2W11A 4TWBA 3LQRA 4E5MA 1XEXB 4GXTA 3NX4A 1O0BA 3EVNA 2P6MA 4YXWG 4ABYA 5GINE 3E8SA 1KA9H 2LIVA 3MJEA 2AR0A 1ZGAA 4Q3NA 3V8QA 4X91A 2OMEA 2VF4X 5J4LA 2PBFA 4LXTA 3GLHB 3EIWA 4YACA 2EBHX 1XI2A 2Y4OA 3GP5A 4UUPA 2OPBA 3HVHA 3OWXA 4FBGA 2G6BA 3PS9A 2WM3A 3QHQA 3F9CA 3EY4A 3QYPA 4PRZA 1E2UA 4JWKA 4EI9A 2ZIFA 4X7RA 4KWEA 1E77A 5AOAA 4LECA 5D3QA 3M2PA 2LO1A 3KZNA 2W2PA 4FTWA 3ETGA 1L8QA 1NPTO 4EFMA 3GP8A 1POWA 3CVVA 3AHDA 4MHTA 3E8BA 1NA5A 2C2YA 3MXOA 4MV7A 5JCXA 3JASB 3U4GA 5JY6A 1FB5A 4EMSA 2CMGA 3FTFA 4H7EA 4D8TA 1PFWA 2YZNA 2E4ZA 4UBJA 5G41A 3GROA 3ZJTA 3E1GA 3SR2C 3IQFA 1DUSA 4E11A 1CNFA 2J6HA 1H1LA 4YV1A 4QKQA 3LHDA 4UFPA 1KY4A 4RE6A 1E6LA 5AW9A 3SHVA 1YWGO 4YONB 2JATA 3ONDA 2B35A 4PIMA 5DCYA 5C8ZA 3WLKX 4MSJA 4DA7A 3LT2A 4DQDA 2B5VA 3BCRA 4LRSB 4ZT7A 3RSGA 1ZUWA 1M8JA 3LQQA 2XHEA 3OF2A 5D1NA 3H19A 4OK3A 3JAWB 3R7BA 1IN1A 2XE7A 3K0AB 1Q6UA 3NBQA 2V7QA 1XWFA 2VZEA 3PSAA 4G5YA 3DV9A 2OE2A 1WR8A 4H0FA 4DM7A 3DBLB 1ZJ4A 3AVXA 1MVOA 2BL4A 3D8BA 4DLXA 3DZJA 3CR7A 1KZ1A 4HB3A 2GZ3A 3RS2A 3I61A 2DYRB 2IM9A 1ZNZA 2VL7A 3C14C 4OK6A 4WOCA 5FOXA 4AKHA 4M1TA 2FHSA 1ZINA 2EDCA 4BFVA 4Q3BA 1AQIA 3PCRB 1J99A 2UXBB 4BMZA 4CQNA 2M2IA 4WZZA 3ZG6A 2CXUA 1FYWA 5HFLA 3JD1A 1E92A 1VKOA 2FSUA 4I7EA 1SBHA 3IUPA 3NRCA 4CCWA 3RI3A 1SUWA 4X85A 1V55C 1RJEA 1JVNA 1T5LA 3LBNA 4QNNA 2F59A 3JS5A 4N49A 1W49A 4J2HA 2VXCA 4AK9A 4MWEA 5K2OA 4TYYA 1BFKA 1W52X 2OHOA 1E7YA 1SHZA 2BLNA 3W2FA 3WAJA 3KG2A 5F7XA 3FPBA 3RTBA 2ZYGA 3K08A 1EHIA 3CXCU 4GI5A 5G1NA 4CG3A 3LF1A 4QGFA 4KYTA 1N6KA 4JU9A 4C5BA 1THZA 3OLXA 3PKIA 4PA6A 4KN9S 5KNLA 3A32A 1S76D 2CLIB 1ZRMA 3W6UA 4F5DA 2XUKA 2IHKA 1IC6A 4DCGA 2LQTA 3LZDA 4KWIA 5LJIA 5CURA 5CBPB 5KYUB 2PGGA 2H5LA 3I6ZA 4GXRA 3DBHB 1IQUA 1M72A 3O75A 1V1MB 3DJFA 5BO5A 3F6YA 1TL7C 1LVGA 3DFIA 3CVOA 3CPJB 1MG0A 2I33A 3GZ4A 3M4JA 3O7MA 5GM2A 5CFRA 2CW5A 5B7NA 3R2NA 2X6CA 1P31A 4CTNA 4PW0A 4PYQA 3WRYA 5KQGA 1NXOA 3BQ9A 4ARZB 2RH9B 1ZUNA 5LOVA 1RSOA 1NNSA 3MYYA 3OZFA 4Q3DA 4R51A 1VE7A 5AI8A 3TW8B 1RCUA 2B8WA 3PNYA 3ABLB 1M54A 2CEAA 3FZEA 1F1JA 4LYHA 4R4JA 5FX2A 3HBLA 2XCUA 4G0VA 2O96A 2NV0A 3AR2A 4M7OA 2O3KA 1KVTA 2ZW9A 1RQNA 3BORA 3HJRA 4ZAVA 5KVSA 1XLUA 5KYKA 1PO7A 3ETNA 1QZXA 1DBVO 1ODSA 2WAXA 3CLRD 4YAUA 1J9EA 4NV0A 2LKCA 4JOCA 3WXMA 4ETIA 1FQKA 4G67A 3TQCA 3QE9Y 1FUKA 1U94A 1IUNA 5DSZA 4LHVA 4QO7A 5AW1A 1OI0A 1YDFA 2CXNA 2IX9A 3SBXA 3F6CA 1ORQC 2IYPA 2IHYA 1K2VN 3W7XA 1EUDB 2GO1A 4OHVA 4YCMA 2SKEA 2HA3A 4AMBA 3L7LA 3Q3VA 4C5CA 1KTIA 1P4RA 1MBZA 3OA0A 3HKDB 4GLLA 5AJYA 5EJ8A 1PV0A 2PRSA 2GGSA 4LWSB 4QBHA 1D2HA 3SE7A 5JRDS 3N6RA 3HM9A 5E8RA 3WL8A 1QP4A 1E1NA 4PTYA 3AFHA 4J2OA 3VR5D 4P38A 1NBWB 1DAEA 1R4AA 1WNTA 1YK1A 5JMTA 2QRLA 3A3NA 2F4VO 4K0KO 4HUTA 4FHZA 1W4CA 3ZE7A 5CD1A 1L5HB 1ZJJA 2Q4PA 4LWSA 2BCCH 3VQYA 1J25A 1U90A 5FI0B 1P3JA 1OE0A 4JJKA 1NASA 2PL1A 2WFMA 3DB1A 3NHWA 1H94A 3WGNA 4DUGA 1DWPA 4EHNA 4OHZA 2B30A 1R0SA 1NBIA 2WILA 3NKFA 4EFKA 1AF4A 4OI1A 3ELYA 1N8RW 3LHSA 1VBKA 3R3ZA 4XOUA 5HZHA 2CBXA 1ZR2A 2VCHA 2PUWA 3QY9A 4JZ2A 1IDN1 4LGMA 1YR7A 4JXJA 2EIMC 2D0DA 3TTXA 3V6LA 3ZQKA 3BJIC 5EWJA 1H22A 2Z3GA 4IPTA 3BH1A 1P1IA 4DV4B 2JIQA 1JYFA 1XVLA 1HZZA 4KR2A 2GF9A 1COWD 5LXTB 3NOVA 3UT5A 3EAFA 4E5YA 4XTCS 1CZRA 3LC7O 3WA7A 4GZ5A 1VJ5A 4BC0A 1ZHHA 4A10A 1G7CA 1I3OA 2JFBA 4BNYA 1WLEA 3N7TA 5KQPA 4FYYA 1TAUA 1JALA 3KSZO 4EP1A 3GD7A 1M34B 1GNSA 1JSLA 2C2XA 2P65A 3AC0A 1R5OA 3EZ7A 3KALA 4OJTA 5LZ8A 2PUAA 3LT0A 1EVYA 1V5IA 4FMPA 1YNSA 3ROMA 3QSGA 1F8FA 3AEUA 3BG5A 1K98A 4V0SA 5JWRA 2VJYA 4OFZA 1NIPA 1J2RA 1BS3A 4PA3A 1XFDA 2QMUA 3EVTA 3QOWA 3ZY3A 2P4HX 5BVGB 1JECA 2CFOA 4WD3A 2VATA 4DR3O 2GDSA 1C8BA 5AVJA 4CU2A 5JFTA 4OUKX 1GM8A 1WXWA 3WG7C 2QR5A 2WU4A 4OK5A 2QK4A 3SEQA 4UDNA 4EUFA 5CT8A 3ON5A 4L0QA 4L0DA 1AOXA 5JJBA 1U2SA 3OWOA 1X42A 5EEGA 3HEAA 1Q1BA 2DBRA 3P0IA 2XECA 4MRVA 1W59A 1HDZA 2NU6A 5EERA 4A8JC 4B0OA 4LOLA 4X1IA 1B3RA 1QMPA 4HBZA 4M7PA 4OG2A 4MYSA 5B58C 1IAQA 2D5NA 1PWEA 1T9ZA 3N70A 3GC6A 3WHKA 2A1TR 2PUHA 4D3ZA 1H2FA 2JGEA 4J3JA 1NF8A 5KTPA 2XUQA 3KHTA 4XUDA 1OJ7A 2PX6A 3PGA1 4P54A 4WCFC 4OHCA 1K63A 1WTCA 1MC5A 2QUAA 2X5KO 3STXA 3BWCA 1UJBA 3AVYA 621PA 2P1RA 3AM1A 3EF1A 3B8NA 2J4DA 1RYHA 4L08A 4UHBA 5THQA 3C5EA 4CIBA 5KSZA 1EX6A 1FDOA 1Q0LA 3W1EA 4EKEA 4P0QB 5EN4A 3PFFA 6GPBA 3D3JA 5LU8A 3A4NA 5ADHA 2B1QA 1U4OA 2JA1A 1P49A 4N18A 5IAKA 1GNPA 1M2GA 2AOTB 4MQUA 3FYEB 1NW9B 3P0JA 1AI6A 2IW1A 1L8XA 3TRIA 3R6DA 3BD6A 3IO5A 4BPRA 2VHQA 1LLUA 2QGFA 2ZQZA 2V4ZA 5LMUO 1WE2A 3NCTA 3WTBA 5C1OA 5F9HA 4P2ZA 3D7SA 4IFIA 3FCXA 2XVYA 4MJLA 2RAPA 4NCXA 4KBFA 4XQCA 4ZD6A 1D2NA 4UASA 4CKEA 2PT9A 2GAOA 3KHUA 3VNAA 5JO9A 5BR7A 5JAHA 3K0AA 3L8DA 4DFDA 2AEJA 2HIHA 3OZIA 1IPFA 2H8KA 4IZ6A 4RL6A 3TLEA 9ATCA 2V55B 1R8XA 5DHUA 2ZIEA 4C78A 3PC7A 5CITA 4D79A 2CK3D 4ZDKA 2HA7A 1MO2A 1PV1A 2P3SA 3FZGA 4FDUA 4K5QA 4JJGA 4QJ4A 3SYTA 2DQ0A 1EXWA 3PFWO 5I8ZA 1X1DA 1D7AA 2Z58A 3QYAA 4HAUA 1FTYA 1ESNA 2F9MA 2PMKA 1R0WA 3QVVA 3LC0A 3RVRA 1E3QA 2VHZA 3PC3A 2QN3A 221PA 2O3QA 5AKLA 3P19A 2QR4A 3KBBA 1C3LA 4QHTA 3L8MA 4BRWA 1WN5A 1NVFA 5ERYA 3O8OB 2BGTA 2MHCA 3VUEA 4BO5A 4EB6A 3NZEA 1KIMA 1L0LH 5HF8A 2FRDA 2P7TC 1KRXA 1H8HG 2OCHA 1YJ5A 3C7AA 5CB6A 3FHCB 2JA2A 4PZAA 1XN1A 2EIXA 1B8NA 1JB1A 5CD9A 2EKLA 2FKNA 2HTEA 1SMKA 2DT5A 2HXSA 5FA6A 1DMSA 2CTQA 1ORVA 4MPPA 1OFUA 1T25A 3AETA 5DHTA 4HDNA 4BVKA 3L5KA 2VUUA 2OM6A 4G5SA 1REQA 4HDKA 4DQ0A 5GZ3A 2FMLA 1R00A 2GZDA 3BSWA 3RJZA 4E4RA 1OT5A 2I54A 2R6FA 2WE8A 4W5NA 3EXFB 3LZ6A 3KQNA 3M6MD 4DW1A 1BFUA 3W34A 4CXMA 3KUXA 3JSLA 2JI6A 1WUTA 1HDCA 3FBTA 2ZJOA 3Q2KA 5KAFZ 4Y2VA 2IJIA 3O8QB 4XIIA 1WCV1 4X6XA 3PL5A 4A2PA 2IV3A 5M59B 3ETJA 4MYTA 5LQCA 4O08A 1DO0A 2O05A 1MOZA 4BLTA 1R0ZA 2O0HA 4DMCA 4PG8A 4HQOA 1OFIA 1TUIA 2W6IA 4DJDC 4FGKA 4HWRA 4O5OA 3T12A 3ZOZA 3GEGA 5K6AC 4H7HA 1SCUB 3LX6A 3LH5A 4DLBA 3Q3JB 3ABIA 3SJ7A 2PLWA 3KZCA 2CT8A 2AMJA 4HO1X 4DLVA 4TZKA 5ALQA 1FYVA 3D7NA 2QRVB 3L02A 4BO1A 3PEYA 1H93A 3SY8A 5C51B 4XDGA 2NYUA 3QYJA 1W5EA 4GKJO 4CS2A 1IN7A 3UEOA 1B8OA 4R40A 3X1WA 2IGBA 4K9NA 5DLQC 4UV8A 1T1IA 3BAZA 4X1YB 2JRIA 2NPOA 4FLXA 2AJLI 4MWZA 1U3WA 1ZG3A 2BBOA 2NOAA 2RHGB 2WHPB 4NPHA 1OC2A 4IIUA 4QGAA 3TKYA 1T1EA 4YIHA 3V4RA 1DQPA 4YASA 1IN5A 4C4TA 5KJFA 3PFGA 4YCNA 3EXIB 4RSMA 3KSBC 5C31A 3TUZC 1UF9A 5EGSA 3T0IA 4QRIA 4TWIA 3LIPA 5GTHZ 3FJYA 4NMWA 1QBZA 3OE7G 1ID1A 3A1UA 3VI4B 4FCVA 4YJHB 1ZXBA 1EBFA 3DWGA 2JEUA 4XWAA 4GR4A 2ADOA 2CDCA 2RGNA 1G0OA 3LY5A 3PXXA 4ZRMA 3I45A 3LCCA 3BZUA 1E1RG 1Q2XA 3EWAA 2R62A 3OD5A 3AHFA 4HGRA 3VO1A 5M34A 4KO3S 3EPJA 3BH0A 1NVMB 1UK8A 4D8XA 4AP6A 1ZICA 4MDFA 3B36A 1P17A 4WFGA 1JFTA 2AJTA 4P35A 3V7FA 4TUYB 1SBNE 5KNDA 2FMXA 4ZXFA 2IPMA 3Q7QA 1SCKA 3H1BA 3EIXA 2ZM5A 1NKVA 2O8BB 1A8UA 4ZO4A 4CKZA 1QFZA 5H3CA 2LDBA 3SJAA 2V6GA 2YYSA 4J0CA 1IQPA 1LF0A 4LG1A 4Q9JA 4YLYA 2FKXA 1U8FO 1R64A 3LFUA 3WNQA 5CLLA 2IZZA 1IHPA 3N3BC 4QG7A 3WKEA 1AVTA 3CNLA 4TXMA 2NSLA 3AFMA 3ROPA 3IV7A 3AHEA 2QX8A 3GLRA 3SF0A 5I01A 2JZOA 4LJAA 5ALTA 3QFCA 1OFGA 5TQ0A 3PR1A 3FA2A 3QELA 3AUFA 3VHQA 4P9CA 2A8NA 4RACA 4MPDA 4DC9A 3O1IC 3ORQA 3RRBA 1X2BA 3PQ8A 4HNVA 1IMJA 4OCMB