1OZAA

Crystal structure of the r103l mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
371
structure length
357
Chain Sequence
MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQALKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALLMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNCTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of substrate-binding groups in the mechanism of aspartate-beta-semialdehyde dehydrogenase.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
molecule keywords Aspartate-semialdehyde dehydrogenase
total genus 115
structure length 357
sequence length 371
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1ozaA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ozaA01
1GCOA 2AEFA 1MP0A 2JD2A 1LLUA 4J0FA 4RVSA 5EMHA 1IPEA 4RPGA 1NFFA 4DWVA 3U0BA 1KY4A 4XGKA 3GVXA 1JLLA 4FN4A 4HV4A 2UVDA 2PD3A 1U2GA 4O63O 1LRKA 1F06A 2GASA 3PPIA 1GQYA 3L6EA 3AFNA 4PLPA 3ROMA 3TZKA 4ALNA 5ENVA 3PP8A 4Y9DA 4WECA 1GUFA 1ZEJA 1SOWA 3A06A 3A4VA 4Q3BA 3ZH2A 5IN5A 3RC1A 3WFIA 3WICA 1P3DA 4RJTA 2X1HA 5KVQA 4MP3A 4RQUA 2DAPA 4J7CA 3I23A 2B5WA 2YFHA 4PRLA 4RO0A 4LW8A 4TMFA 3TZHA 4Y6PA 3PRJA 2EJWA 2FOIA 2GRAA 2QW8A 1Y81A 2BLLA 2H6EA 1AXEA 2X8LA 3NGLA 4IZIA 3E5RA 3G0OA 4FFLA 3GAZA 3JTMA 4FJ1A 5C37A 2QRLA 2VNSA 3F3SA 6ADHA 1WMAA 2DU8A 3HDHA 4PLHA 1HZZA 4CM9D 2GN4A 1UH5A 1ORRA 1J6UA 4MO2A 1TEHA 3VZSA 3PGXA 2DBRA 4HXYA 4NHEA 3GPDG 2OBYA 3I4CA 1DEHA 4XWYA 5G4LA 3RFXA 1KYQA 1G1AA 1YGYA 4OKNA 1NHWA 4I1IA 1X13A 3UF0A 2G82A 5A03A 2F00A 5F1OA 2C20A 4L74A 3ZGYA 5A9SB 4J7XA 1Y7TA 4FFOA 4UVDA 3WWZA 3DQPA 3ABIA 1X7DA 2HMSA 1H9BA 1ULSA 4P4LA 1E5QA 3DL2A 4BS9A 2FZEA 4LRSB 4II3A 5KWEA 4TZKA 1B2LA 3KLPX 4CLDA 1P1IA 2PD6A 4KDEA 5F1KA 1JDJA 1IE3A 1LA2A 3E1KA 1N1EA 2GYYA 3CKYA 4LISA 3WR5A 3IQDB 3WGZA 1K6IA 3K73O 4QX6A 4D46A 1E3WB 4MPDA 4U5QA 1BW9B 1T26A 1WP4A 1TXGA 2EP5A 3ZV4A 1D8AA 2VWGA 5TNXA 2DQ4A 5IAAA 2RAFA 4WNCA 4AJNA 1C0LA 1M66A 4NJOA 2QYSA 2X6TA 3PWSA 1Z7BA 2BF7A 4H15A 1PX0A 2B0JA 5IJZA 4R1UA 1SZJG 1B26A 2D5AA 2Y1OA 4AJKA 2O48X 1W0CA 2XXBA 2AEMA 4L0QA 4XYLA 1U28A 4FFMA 4LK3A 1N8KA 2A35A 3OECA 1IY8A 3ZNNA 2B4TO 4XGIA 3L4SO 2DPHA 3E5MA 1O0SA 1UAYA 1CIVA 3KYBA 3I9NA 3VTFA 2VHWA 2WYWA 4GKVA 3NJ8A 4DVJA 1R0KA 4YR9A 3U3XA 2Q50A 3S8MA 5CDTA 4KTVE 3U62A 5G0UA 1A9ZA 1PL8A 4WOJA 1O89A 4AJOA 3TFQA 1O5IA 3JQ9A 2PGDA 1ISHA 2O3TA 2XXJA 3VH1A 1KOLA 3TQHA 2P4QA 4FJ0A 2C5EA 1N7GA 4EJ6A 1CWUA 5JPIA 3OEYA 1VC2A 1UZLA 4OSPA 2Y0EA 4CUKA 4DQVA 1ZXLA 1T2CA 4XB1A 1H6DA 3PYLA 1XELA 3HN7A 3JQ9C 4RGBA 2PZMA 2H9IA 1VLLA 5ER9A 3WYBA 4J7UA 3S2IA 1CRWG 4BB6A 1B15A 1YJ8A 4IDCA 1IL0A 2O3JA 1F12A 4JJGA 3QSGA 3CTMA 4CLOA 5COQA 2E6UX 2B5VA 3S2EA 1HE3A 3VOSA 3KYCB 4IGFA 4PRKA 4Q3CA 5CEFA 1ARZA 4NQZA 1IHXA 3KEOA 4P38A 5A3JA 3GMDA 4FPXA 1NQAO 1ZKMA 5H83A 1Y1PA 3QV1A 4BO0A 1DJNA 2BGKA 3K9QO 2J8ZA 4URFA 3DFUA 3GR6A 5U1PA 1XKQA 2PR2A 3HFGA 5KJCA 2AMFA 5KJ1A 4D43A 3BHMA 1DPGA 1EVYA 3FR7A 1DLIA 3V1YA 2RHRA 2YQ5A 4XR9A 2ZB8A 4U8GA 4I9UA 3UCXA 3DBRB 1B8VA 4QO8A 2JHGA 4KP7A 3ROQA 4P4NA 3GDGA 3DHNA 2OL4A 4RVFA 2Y66A 3MTJA 2DLDA 1NVGA 2VUTA 2ZQZA 2D5CA 2CUKA 3VAZA 4OXKA 3JQAB 4R01A 1EFKA 4BKQA 5C3MA 2EIHA 4HBGA 1AN9A 1H0KA 2VOJA 1U9JA 3KOUA 3FPLA 5AXBA 3Q2KA 3UGKA 3ASVA 1X7GA 4IJUA 4WKGA 1MG0A 2HK9A 1HDCA 4JBGA 3PDJA 5KVVA 1PTJA 2HJRA 3ZWOA 5KJ6A 5TJHA 1Y8RA 3VKUA 1PJCA 3CXRA 3PZRA 3ORFA 4M49A 4YQYA 1JWAB 4WLFA 3W8FA 2CNBA 5JW6A 4TRMA 3KBOA 4CL3A 1GZ4A 4OXYA 1EVIA 1B7GO 3FNEA 1ADBA 3KSUA 3JYLA 5C7LO 2DBZA 3KYCA 3M1AA 2PY6A 5G4KA 2Q46A 4Q3EA 5G0SA 5JSFA 4ND5A 3AY3A 1M75A 5JS6A 1VSUA 4J1NA 3AOGA 3C24A 4M89A 4DIOA 3ZV3A 1T2AA 2CD9A 1YB1A 4R16A 2VHXA 1ZEMA 5COAA 4RCVA 3D1LA 4BNYA 3OJOA 2W2KB 3HHPA 1AHIA 2HO5A 4PLGA 1EVJA 5B4UA 1GL3A 4YT2A 2SCUA 3RJ5A 5K6AA 3CE6A 1P1JA 3T4EA 2J3JA 3PYXA 2O3RA 3PJFA 5BT9A 5B12A 4D3DA 4QEDA 4XA8A 3UICA 2Q2QA 3MWEB 1YQDA 1SO8A 1AHHA 1GY8A 4MVJP 2BMAA 1UDCA 4GH5A 4II2A 4AJLA 2C7GA 1U1IA 1H6CA 4MP6A 1X15A 4UVHA 3V1UA 4B4OA 3PHGA 1XR3A 2VZ8A 2NACA 3GDOA 1KVUA 3EHEA 4WEOA 2G1UA 2B4QA 4L8VA 2HMUA 3SC6A 1A9YA 1U3TA 3OQ6A 1HSZA 1YVEI 2VRCA 3OICA 3QA9A 3ZWMA 3D3WA 5BSEA 1IYZA 4ZRMA 5F21A 3B1JA 1M76A 2BELA 5FI3A 1BGVA 1LRLA 2X0IA 4Z0TA 1HE4A 3ZNQA 1HEUA 1NR1A 5MDHA 3M1LA 1V35A 5IN4A 3FWNA 4ZQEA 1A5ZA 2A9FA 5KKCA 2CF6A 1D1TA 3ITDA 4ND4A 4PCVA 4ZQHA 3AUAA 4BV9A 1F14A 5A9SA 3H4VA 4YAEA 1PQWA 1ISJA 3EMKA 5CEEA 3FTNA 4YA6A 3LU1A 4FFNA 4YTEA 1SEVA 4WE3A 5T57A 3EC7A 3EYWA 4E5NA 1I3LA 1X1EA 2HMVA 2R00C 5IDXA 1NWCA 3H65A 1GV1A 3BMOA 4RF4A 2H63A 4ZQFA 2ET6A 5ICSA 1PGQA 1XQ1A 3WGYA 3H9JA 1GADO 1TA4A 1W8DA 3K2BA 4Z3DA 2OP1A 4FOOA 1LDEA 1DIBA 3RC7A 2OUIA 2ZYDA 3I5MA 3JYNA 3L4BC 4AFNA 4Z9XA 2W8ZA 5GY7A 4I9HA 4IDDA 1NQ5A 3VHRA 1W4ZA 4B7UA 3RIHA 1PSDA 1LJ8A 4YCAA 3HQ4O 4NK5A 2GPTA 1T1SA 4A10A 3ETEA 4LN1A 2YQ4A 3L4BA 4BNFA 4CR6A 3A28A 4GSLA 3IS3A 3H9QA 3HNPA 3DZKA 1ZK1A 3D3EA 1F8GA 3BMCA 4RV9A 4D3SA 5DP1A 1DRWA 4YAIA 4A5OA 4MVJF 3TJRA 4GQAA 4RQTA 4FGWA 1EQUA 2EXXA 4RVDA 1IHYA 4BL5A 4CM4A 3GNQA 3DAFA 4WLUA 1V3VA 3WIDA 5A5FA 2DTXA 8LDHA 2I3GA 1MC4A 2DBQA 3COSA 1L7EA 4L9RA 3IP3A 3Q6IA 2WWRA 4LVCA 1ENZA 5JY6A 3ADOA 4RDIA 3RQSA 1M6WA 1P31A 3WJAA 4YPOA 2PZJA 2Y1CA 5IDWA 3LF1A 2WYUA 1ISFA 4JGBA 2I5PO 3VH4A 4ZHSA 4LMRA 3LQFA 5JDCC 3ASUA 2Q99A 3O4RA 5JE8A 1E3WA 1V8BA 1ZZEA 1BWSA 2CFCA 4PLVA 1KBZA 3DBLB 4E2WA 4S3MA 3WTBA 4B7XA 4BKPA 5ITVA 3DZFA 2YHIB 4DRYA 4ZQBA 4G5HA 5T8KA 2WD7A 5JO0A 2PKQP 3ONDA 3I3OA 1T2DA 1AGNA 4NU5A 4A26A 1BXZA 4I5DA 4DC1A 2Y68A 1Q7CA 3MWDB 3OIDA 1P1KA 4RF2A 4MKXA 1YH3A 4WCDA 7MDHA 1E1LA 1XLTA 4M1QA 5JAQA 4GX1A 2DTDA 1JQBA 4CMBA 1Q7BA 3QE3A 3FN4A 1QYXA 1T2EA 3QWAA 2GN9A 4B79A 2C07A 5A3VA 4ND2A 3F5SA 1ZMOA 2X5KO 3GG2A 3CSDA 5I8ZA 1WW8A 2GERA 2B35A 1KY5A 4KUHA 5IXSA 3E9MA 4QXMA 1GFSA 2XAAA 3AWDA 3ZWYA 3ZN2A 1LBEA 2PKQO 3PQFA 3ON5A 2CVZA 5CG1A 3ZWXA 5T64A 3A14A 1E6WA 4XZ3A 4IDEA 3U4DA 3WS7A 3ZI0A 3L6OO 2P68A 3LC1O 4PGFA 4J9VA 2CSUA 4TVOA 3RU9A 3RU7A 4WCFA 1Y8QB 2D3TA 2C54A 2HMWA 3AI3A 1LLQA 1EFLA 4BO6A 1DIAA 5BNTA 4RLHA 3CIFA 4M55A 5EQFA 3G17A 4OIMA 1XIVA 4DQXA 4JX8A 3AY6A 2O7QA 1I0ZA 5LDGA 1QV6A 5L4NA 2NVWA 2NTNA 4A7PA 4WOKA 4CPDA 2P5UA 4KOAA 1EUCA 1I8TA 4J4HA 3DBHB 2V6BA 3PLNA 3KLMX 4A0SA 4P22A 2OBNA 1KERA 3VVBA 4BMVA 3RC9A 4N5MA 3ZW8A 1Z6ZA 2ZB3A 4GX0A 3E8XA 1D3AA 1KEUA 1C0PA 4K26A 2NVUA 2OFPA 2G76A 5JMPA 3UW3A 1E6EA 2GN6A 2Y05A 2E37A 1PS0A 3ZWWA 2C82A 1E7YA 2DVMA 5IDQA 4HKTA 3VPFA 3WQRA 2OXIA 4EUHA 3DBHA 4I8XA 1ZBQA 3SJUA 4CLHA 1EEHA 1HF3A 3TWOA 3RASA 5ES3A 1GQQA 4BNMA 3GN1A 1DBVO 4F3YA 3D4PA 3NTQA 1U5CA 5TT1A 1R4NA 1P1HA 2IODA 2VN8A 3E9QA 2PNFA 3OSUA 3DEYX 2NVBA 1Z7EA 4IM7A 4OXNA 1IB6A 4CMHA 4CQLB 3GVIA 4PLTA 1YL7A 4RF3A 4BNNA 1ZK4A 1DC3A 2JFFA 3WGTA 4WLNA 4AJPA 1PZEA 1SEPA 2YV3A 1WWKA 4CMAA 3RFVA 3QWHA 3BTUA 4O59O 4JJIA 4E5PA 1U3WA 3P2OA 4N5LA 4YJDA 4PG6A 1EUZA 1ZCJA 5F1PA 2O7SA 4D3FA 4HFJA 1ML3A 9LDBA 3DOJA 2VWPA 1NVMB 1GTMA 3Q9NA 5BSHA 3KV3O 4WASA 4IMPA 4PN3A 3MZ0A 3WNQA 4CQMD 3X2FA 2VTEA 1R37A 3GVCA 5CDSA 4GWKA 1F8FA 2HJSA 3LT1A 4BO5A 1LDNA 1LLDA 3QVWA 3GQVA 4W4TA 4ZQGA 2C2YA 3OIFA 4ZVVA 4NNJA 3EZLA 4EEZA 3SLGA 3RKUA 4BGUA 2E4AA 5AXCA 2CDBA 3H9EO 1N7HA 1HYGA 4MVJM 2NADA 1BVRA 1U8FO 2W90A 1LUAA 2PGLA 4DLAA 1JN0A 2VYVA 4BQRA 3EK2A 2IEDA 3ITKA 3VVCA 4A03A 1VJTA 2HMTA 3GT0A 2FY8A 5TQVA 3ENNA 1F17A 4W99A 1R16A 4MIYA 3FBGA 2C7VA 3ICCA 4FFRA 4IQ8A 3RD5A 1A4UA 4YJGA 3SEFA 2EV9A 3TF5A 1DHTA 3F1LA 1LQUA 1HLDA 4PZEA 1R66A 4QFCA 1NQTA 4MOWA 3EGOA 4QUKA 1KEPA 2J5RA 2ZCVA 1BSVA 4GWGA 5THKA 1OFGA 1JW9B 1VL6A 5A06A 1JA9A 2AHRA 1RYDA 3PK0A 3N7UA 3C3XA 4BNVA 1ID1A 1MX3A 3GNTA 5I7FA 3RCBA 4XDYA 1E7MA 4MP8A 3WGGA 3DWFA 4WNIA 3GEDA 2AXQA 3PEFA 5I7SA 4R68A 4R5MA 2TMDA 4YB8A 3GRPA 4GGOA 2VRCD 4CV3A 2POQX 1OI7A 1JWBB 2YJZA 4XQEA 4AJHA 4CM4B 3R0IA 1IZ9A 3O8QA 4B3IA 4IJKA 1MLDA 4U0JA 1G0OA 2DFDA 1G6KA 5JAIA 1J0XO 5HM8A 1YL6A 2AW5A 3RWBA 5EJ2A 5GZ1A 4R4JA 1DDOA 2UUOA 4E33A 4RPJA 3NV9A 1LRJA 4HNGA 2WE8A 4XRRA 3WOHA 1PJLA 3WFJA 3I9JA 1PQPA 4DIBA 1EZ4A 4YACA 4W82A 1DFHA 2Q4BA 3NJ4A 2HSDA 2WYVA 1J4AA 3BHJA 2TMGA 3H3FA 3OBBA 7ADHA 4BNJA 4YBZA 1G0NA 2QZZA 4Q3AA 3EDMA 5BNFA 4GSKA 5BNIA 1KIFA 3GFBA 5CEJA 3NUGA 1HDRA 1FDTA 3G1TA 4I9NA 1KVTA 3WBFA 1EE2A 4YAJA 3DBVO 1B3BA 4EI2A 1DFGA 5G4KB 1NR7A 2GF2A 3BXXA 3E82A 4J16A 4CMEA 4EUFA 2EW8A 1UDBA 2GGSA 4D7AA 1ONOA 4WLVA 4BGVA 1L1FA 5DT9A 4TZTA 1V3TA 2X9NA 4NJMB 4PLWA 1TI7A 2ZTLA 1EBUA 1E3EA 3JQAD 2OZPA 3OEWA 1LQTA 3L77A 3DTTA 3F9IA 4JP3A 4RPKA 1CERA 3V1TC 3FWZA 1PJ4A 1EK5A 1GCUA 2C5AA 4JN6B 3CZRA 2JCXA 1X14A 2NSDA 4CL8A 4XRGA 5I9LA 4ITUA 2ZB7A 2P2SA 4YQZA 2I65A 1LTHR 2GD1O 3NDIA 4MKRA 2HU2A 1T4DA 1SC6A 1ZSYA 5ER6A 4FGSA 1M67A 4BQPA 3ETDA 4NFYA 1XQ6A 2IYOA 3MJTA 2QQ5A 2FP4A 4J1SA 5L51A 5KOIA 1GYQA 1NX6A 1AXGA 3QP9A 1GZ6A 2ZTMA 2G17A 3Q0EA 4BB5A 1JAXA 1K6JA 4F6CA 3JQDA 2X5OA 4EDFA 4UVIA 1QV7A 1QR6A 2VWHA 4IDFA 4JCOA 3C1TA 3SC4A 2IE0A 4IIVA 1HDZA 3UVEA 3NYWA 3HB4X 1MV8A 1JKJA 3IJRA 4IJWA 1I2BA 4UVEA 5B1YA 3GN2A 1W73A 3CMCO 2PZKA 1CJCA 1ONNA 1Q0HA 3Q9UA 3EAGA 2JCVA 4BNHA 3I52A 3WYCA 1ENYA 1C0KA 1FF9A 3JYPA 3DZJA 1BDMA 5KIAA 4PG8A 3RKRA 2RHCA 5DOVA 2DUUA 1YDEA 4G65A 3W4JA 5KCZA 1I01A 4PZCA 4IINA 3WLFA 1VKOA 4CM7A 4PLYA 3I1JA 3KSZO 2HKIA 2E49A 3QWFA 1CQJA 2DTEA 3GF4A 4NBWA 3TRIA 4BNGA 3WQSB 4DTIA 4W9NA 1LDGA 3VDQA 4FFPA 4OOEA 3OJLA 1NHGA 4FC6A 5F3RA 2W2KA 2YUTA 4PZDA 5JFOA 3ZV5A 3V2UA 3G3EA 3PXXA 2CDAA 2Y93A 3ZHXA 2QG4A 3NRCA 1CQIA 1QORA 2GN8A 5A04A 1GDHA 2GZ2A 2RCYA 3FR8A 4RVGA 1CYDA 5J23A 2RBEA 4MIEA 2GSDA 4TROA 4OAQA 4F46A 5L53A 3WYEA 1WLYA 4EJMA 3KVOA 3UFXA 5B4TA 3DDNA 1RPNA 4B7CA 4J1QA 3DHYA 5A05A 2BGMA 2F1KA 3AI1A 2AQKA 2XPCA 5F5NA 5L7YA 1NQOA 4YJFB 3D7LA 4AL4A 1PJQA 1DRUA 3PWZA 3OQ1A 1DIGA 4YWJA 1H93A 3ANMA 1E5LA 1JVSA 2JD0A 4CLEA 2PTGA 1T24A 1DLJA 2HLPA 2JFHA 3C1AA 1D4FA 1HE2A 1ISIA 5TSDA 4D44A 3JYQA 3WSVA 1QXSA 3X2EA 1BTOA 1UDAA 3LDHA 2AQ8A 4DL9A 3GPIA 1HT0A 1YONA 2FR1A 3RJ9A 4RVHA 3ZWNA 3JQ7A 2VHYA 1SB8A 4IS3A 4LCJA 3V5NA 5L3ZA 3WTCA 5IZCC 3MOGA 2FPGA 1I3NA 4Z3KA 3G49A 4R3WA 5T67A 3DFZA 3ZHBA 1XWFA 3SBOA 4GMGA 3WMXA 2IYPA 5TIIA 1A4IA 2ZJ1A 5LDHA 5CDGA 3TNLA 1AE1A 3LT0A 1RM4A 1DAOA 1VM6A 3PZBA 2ZKLA 4WCFC 1KVQA 3GZ4A 2CY0A 1JKIA 3JQEA 2D4AA 1UP6A 3QVTA 4CM3A 4W9NC 2WD8A 1VPDA 2YV2A 4Y8VA 1J5PA 2E82A 2CVQA 3PHLA 1EK6A 5JYDA 3JCZA 4E2XA 1U2DA 4YRDA 4BNKA 3NDJA 3QVXA 1MA0A 5EPOA 4ZU3A 2AE2A 1ZVMA 3UOGA 4IS2A 1H2HA 3A1NA 1HKUA 5HA5A 5KKAA 1EDZA 1Z73A 4RPHA 1Y9EA 1BVUA 2I99A 4A2CA 1V3UA 1Y8QA 3D5QA 4KWIA 3W4KA 2W98A 1N92A 1HETA 2ZATA 3K92A 2EHDA 4NBRA 3GGGA 3PFFA 4B8WA 4HP8A 1ZK0A 4R54A 2FSSA 5GMOA 4KUGA 4NBUA 3U4CA 4CMKA 4FB5A 1H2BA 4DGSA 5EN4A 2AEJA 3ZDFA 3NAQA 5KVSA 1E7SA 3I9OA 1HYHA 5EL0A 2WEKA 2X22A 1BRMA 3TOXA 3L0DA 1U5AA 2NU8A 4XJSA 2BH9A 3L9WA 3KXDA 4UEOA 3TL3A 5THQA 5ENDA 2FN7A 2EG9A 3DHEA 4ID9A 1X0VA 4TQGA 4EUEA 4J0EA 5K6AC 5KJFA 4BNXA 5K0ZA 3QJ5A 3DAGA 1P45A 3TSCA 3WQQA 1H94A 4O5OA 3JQFA 4ZD6A 3M2PA 2EKQA 5CDUA 3OQBA 4I5EA 2V6GA 1JKFA 1PR9A 5DN9A 8ADHA 3CEAA 3DZHA 3V2HA 4EW6A 4CLRB 4ONEA 3QW2A 4PLCA 1VI2A 2O3UA 4PVDA 1PJBA 1Y8RB 4XIYA 1I36A 3AY7A 1E0DA 3BTVA 1PQUA 3JQGB 3OIGA 4D42A 1C1DB 2Y99A 2NLOA 4FQ8A 2AG5A 4DC0A 3FI9A 1KEWA 3BIOA 4IUYA 2OOSA 4YJHA 3IDSA 2V65A 4RL6A 3D5TA 3B1KA 1RM3A 1OOEA 4U6QA 1WNTA 1EBFA 5FF9A 1GYRA 1A71A 2E48A 1TT7A 3ANNA 3N74A 3KETA 2P9GA 5AVOA 3HN2A 1UXGA 3PTZA 1HZJA 5JYEA 4O1MA 3GZNA 1R0LA 1P9LA 3Q3CA 1QYCA 4E5MA 3L6DA 4LMPA 3W8EA 4WEQA 4DLBA 4LCEA 4TVBA 2Q1UA 2EKPA 4OH1A 3RUCA 4BNLA 3SX2A 2J5QA 3AM4A 1UXJA 4IZHA 1PL7A 2RH4A 3I6IA 1P0CA 1DIHA 2WD7B 1E1NA 2JD1A 1CETA 4XEHA 5DULA 4AICA 3Q2IA 4NZ9A 3RUDA 3FD8A 3JQ7B 3R3SA 1MFZA 3TN7A 2I67A 5CDYA 3IUSA 4BOYA 3EVNA 2GDZA 3LC2O 1WXDA 4HWKA 1ADGA 1EDOA 1JTVA 2GCGA 3DTYA 4FSHA 2VTDA 2Z95A 1D1SA 2UYYA 5F5LA 1U4SA 2YFQA 4UUMA 2VOEA 3HZZA 1NPDA 1Q1NA 4AJIA 4YRAA 1QLJA 3BMNA 1MC5A 4KTTE 4CLRA 1IOLA 3LLSA 1Y5RA 5IFLA 1YB5A 3ONFA 1ZK2A 2W2LA 3I6QA 2AG8A 4IXWA 4E30A 4BO8A 5BSFA 1S7CA 5CP8A 4LGVA 3JQGA 4XDZA 1GQ2A 1M2WA 4TSKA 4R9SA 4R9RA 1YKFA 1WPQA 4CQLA 4CV0A 5KJEA 4U7WA 3MTGA 1O6ZA 5L4SA 2GUGA 3VPSA 2D2IA 1MFPA 4ROSA 2YW9A 5T8KC 4CM8B 3JQBC 2A4KA 3ST7A 4J9UE 3ETGA 2IEBA 2AA3A 1Q0LA 3T4XA 1ZNQO 1HL3A 1WZEA 3O9ZA 1LLCA 1T2FA 3DAPA 3JD2A 2Z1MA 5L95A 1BW9A 3JD1A 3EY4A 3CZMA 2ZK7A 4QFDA 4ND3A 1U8XX 2ZTVA 3RFTA 4OQYA 3CMMA 4F45A 4W6ZA 3ZHYA 4XCVA 5JDCA 3JQBA 3IIEA 4E13A 4E31A 2P4HX 3OJFA 2ZYGA 3AOEC 4OL9A 4CV1A 3LT2A 3GNSA 4UUPA 3S2GA 1T1RA 4TWRA 1SNYA 3BAZA 1GV0A 3P5SA 4N54A 4WGGA 3B20A 4UULA 3S1LA 2OMEA 3ENKA 2Q45A 1HSOA 3INTA 3H5NA 4I5FA 1OAAA 2X86A 2O50A 1E3SA 1R12A 5L7WA 4K6CA 2GZ1A 2WJPA 5TRTA 1EQ2A 3O03A 1FXSA 4YJGB 2RIRA 2X58A 3JQCA 4UREA 4CUZA 4N5NA 5AYVA 3H6KA 2PKRA 3ZWBA 1ZK3A 4OO3A 1S6YA 1GR0A 2O4UX 1BXKA 1B14A 1Z45A 3BMOB 5I9NA 2WM3A 4EGFA 1HYEA 2VZ0A 3AUUA 3K8ZA 3WWYA 2UDPA 3FNHA 1E3LA 1ZSVA 1GUYA 2FWMX 3HADA 3D3WB 1Y6JA 2Q2VA 4BO9A 3RBXA 5CAEA 3GHHA 4G81A 3PHIA 3Q11A 3K2EA 4BVAA 3QVSA 2D1YA 2FR8A 1K3TA 3N58A 4IMRA 2CDCA 2R00A 3I83A 4E5YA 4BHTA 3EZYA 1UZMA 2C0CA 4OQZA 1X7HA 5TLSA 2R2GA 4MINA 2X0RA 2YZ7A 2WE7A 3F47A 3K6JA 3MJ4A 3GGPA 2P91A 1YS4A 4BNWA 3BYZA 3KZVA 4QT0A 3P2YA 4BNUA 3WGOA 4MVJD 3GMSA 3NEPX 4OGWA 2HRZA 5COBA 5JCJA 1ZW1A 3FCOA 4R1NA 1ZH8A 2PV7A 3WNVA 3U09A 2ZYAA 1DC5A 2BI8A 1FDVA 3TOZA 5AQ1A 4TRJA 2IDZA 3JYOA 3PIIA 5IG2A 3T7CA 1NAIA 1LNQA 4K9DA 1N2SA 4J3FA 4DBVO 4CMGA 3FF4A 2Y0DA 1R0SA 3HUDA 1PL6A 1HE5A 4RF5A 4C7JA 4KWHA 4M87A 4L4RA 4P4GA 1I30A 1YJQA 2DT5A 4RLSA 2PK3A 1A27A 3FPCA 3MEQA 3VPGA 4CQMB 3ZV6A 5JY1A 2D8AA 2B36A 3TFOA 5GZ3A 2O3SA 3IOYA 5I7VA 3L9XA 1UP7A 3P19A 4LSWA 4OOFA 3HDYA 3SXPA 4IQ0A 1VKNA 2NQTA 4BNTA 3BMNB 4YDRA 3W6UA 4ALLA 4GX2A 4B3JA 1Z75A 3FNFA 4BUCA 1XGKA 1PJTA 4PLFA 5FYDA 2BFAA 5A4DA 2JFGA 4H3VA 2X7HA 3GEMA 2BFOA 1NXQA 2NV6A 1WMBA 1T25A 2H1SA 1ADCA 1Y9AA 4HFMA 3OMLA 3G79A 5LCXA 3DOCA 4TKLA 1K6XA 3OA0A 1C1DA 3DR3A 1E7QA 3JQ6A 5KTKA 1Q0QA 2IZZA 4DPMA 1KS9A 3GK3A 4Z9YA 2YHIA 2Q49A 4CR7A 1H9AA 1Z82A 2ZTUA 4Y6SA 4D41A 1I24A 3AW9A 2HK8A 4MDHA 3C7AA 1VL0A 1PR3A 3GOHA 3B6ZA 3KHUA 3WG9A 5DZSA 4J2HA 1HDOA 2OP0A 2NNLD 1GZ3A 1H5QA 1HRDA 1N5DA 3GY0A 4IDAA 2DBVO 4IJVA 1PWZA 1C1XB 4PG5A 1QSGA 3GVPA 5EQDA 4CM1A 3QVOA 2I6TA 4MVJA 4HFNA 5ILGA 4CMEC 1SOVA 1KVRA 4IPTA 2X23A 4J6FA 1WDMA 3OJEA 1OC4A 1LI4A 5BR7A 2AQIA 3ZWVA 1JU9A 1ZJZA 5AXAA 2Q2WA 3IUPA 3IJPA 1XSEA 1DAPA 2PFGA 3JD3A 4KDFA 3KM0A 2Q1TA 2Z5LA 1P44A 2X0NA 3EVTA 4IY1A 1DXYA 4FIZA 4INAA 1GPJA 5DBIA 2DFVA 2UUPA 1KEVA 4ALJA 2O2SA 4JQCA 2Q1SA 4EITA 2VUUA 3MJCA 3RROA 1O9BA 1DB3A 3AOEA 4WPGA 5HS4A 1TLTA 1PS8A 5JNLA 1QP8A 1OZAA 2EGHA 2HDHA 1DHRA 2HK7A 3AI2A 4Y67A 5G0TA 1XG5A 5T6BA 2PWZA 4XJTA 2HQ1A 3LLVA 4JBIA 3UUWA 1MGOA 1XHLA 3TPCA 4Z6KA 1E7WA 1ISGA 3OJ0A 3PJEA 3OF2A 4OJNA 2I3AA 1Q7GA 4NBVA 4ALKA 3PJGA 3GRKA 5DP2A 4K1LA 4LRTB 3RC2A 5JYFA 3DB2A 4KUEA 3ZWCA 1VL8A 1LC0A 2VNAA 3F5QA 2VZ9A 4GPD1 4BGIA 1LU9A 1TB4A 3BHIA 4J1TA 1DRVA 2O4CA 4O0LA 3DOOA 1IULA 4R1SA 4XYEA 1RM0A 3KYDB 3HJAA 4MIOA 4ZA2A 1ZMTA 5G0VA 2P9EA 1B8PA 4CR8A 1PGPA 3U4HA 2DC1A 4MVJI 1UXKA 4IDGA 4NFSA 4KMSA 1K0UA 3UH1A 1NASA 4RZIA 2NWQA 2YY7A 5DBFA 1LSOA 3IC5A 1YWGO 4GVXA 3QHAA 3RUFA 4NBTA 4E32A 3PFWO 4JBHA 3C1OA 1WDLA 5K9ZA 3WDSA 2FR0A 1DO8A 4XKJA 3AU9A 3PHJA 2FRDA 4P8RA 5TT0A 2VT2A 2Y1GA 3RUIA 4BO4A 4GGPA 5AXDA 4HADA 4CV2A 3INRA 1MUUA 1U4OA 2C2XA 1K89A 2NTJA 1PJSA 3P7MA 3HSKA 1LSJA 4YAKA 1MG5A 1HDGO 1NM5A 1SB9A 2R6JA 3OP4A 4NR0A 4R41A 2GLXA 5I8WA 5DBGA 4NI5A 3DBLA 4R51A 3A9WA 3GFGA 1XDWA 4WK6A 4ZRNA 2J5KA 3QIVA 4N18A 5B4VA 3GG9A 4D0RA 2YV1A 1U7HA 4UVGA 4E0BA 4XYBA 2WTBA 4BKOA 1C0IA 5JAMA 1T4BA 3I9KA 2I76A 1A7AA 4FC7A 4CJXA 4B4VA 4LVUA 2PA3A 4XIJA 3BTOA 3UAGA 1RWBA 4CQMA 1FK8A 3HWRA 1YDWA 5CHEA 3PHHA 4J4BA 5DCYA 2VHZA 1MXHA 4YT5A 4C4OA 4XB2A 1PWXA 3NT5A 4RPLA 1BXGA 1HTBA 4ZGWA 3ROKA 1XYGA 1H6BA 1CEQA 1ONPA 4CODB 3WX0A 3K5PA 4ZN6A 1XEAA 1YB4A 5C5IA 3WGIA 1OBFO 3ONEA 2UV8A 3BMQA 4XYGA 1GYPA 1DOHA 3MCVA 3PLRA 2Q1WA 4YEDA 5T5QA 4A73A 1A72A 1ZO8A 2Q3EA 4J4TA 3U49A 1DSSG 4Y6RA 3HDJA 5CG2A 2PZLA 5HTOA 1NBOA 3MOIA 3RBVA 3RVDA 1NVTA 3BA1A 1UUFA 4L4SA 4B3HA 3OA2A 5J9GA 3TZCA 2FMUA 2PH3A 3AUSA 2Y1FA 3H8VA 3LC7O 3ROPA 5B37A 3D64A 1FDUA 1PZHA 5HS6A 1XCBA 3D0OA 5C7IO 2EKLA 2X5JO 1P1FA 4DUPA 6LDHA 1LDMA 1YBAA 2EGGA 1FJHA 2J3HA 1TT5B 4ND1A 3NDRA 4BNIA 4NDNE 1FDSA 1WZIA 2NM0A 1VE9A 2JJYA 1UZNA 1V6AA 4XYMA 4G2NA 4PVCA 1KC3A 4BV8A 2CF5A 5U4QA 3VH2A 1P74A 4NG5A 4Z9FA 5JXWA 2OGUA 2VHVA 3VPXA 1K2WA 3VH3A 1X1TA 4J91A 4DA9A 3DZBA 2HRBA 3E6AA 3JQFC 4E3ZA 3SLKA 1R4NB 3AFMA 1O95A 3FNGA 3W1VA 2QZ9A 4R5HA 3WB9A 4GL4A 3QRWA 4A27A 1YOVB 4HY3A 3FBTA 2ZCUA 1SAYA 3GA0A 3ZU2A 4GAEA 3RAJA 1XA0A 1DC6A 2QX7A 5TGDA 2B83A 2NQ8A 2NU6A 4IQGA 1LSSA 1I32A 1MB4A 1ZJYA 5JLAA 3AM5A 1P77A 3E18A 3PYMA 1GEGA 4TRRA 4AG3A 4L75A 3UN1A 2G5CA 3PJDA 1U7TA 3ICPA 5TJ9A 3ZWPA 2PD4A 1R4MB 2I66A 3QWBA 5A02A 1HXHA 3H7AA 3DZGA 3CINA 3KRTA 4WCFB 4Y98A 4CMIA 4OYRA 3GEGA 3JD0A 3MJSA 3DC2A 4H16A 3ZU4A 3ZZNA 1OMOA 4QSMA 2OORA 4L4XA 4YVFA 4E2YA 1NTOA 3H5AA 3INGA 3TL2A 4FJ2A 3HG7A 3BTSA 2Y0CA 1N9GB 4R3NA 1UJMA 3W8DA 1CDOA 1NFRA 4OKIA 5DNAA 1TVEA 2Q22A 4Z0HO 2OHXA 5M6DA 1NNUA 3S55A 4J90A 4QQRA 3MJEA 1SBYA 5U9CA 3C85A 4E21A 5IZ4A 3NT4A 2QRJA 4EBFA 5JMWA 4EZBA 2VT3A 4K28A 2XF8A 1GAEO 1LSUA 3G1UA 3O38A 4Z0PA 4PG7A 2AE1A 5HWSA 9LDTA 4FBGA 1I2CA 4PLZA 5JAZA 2QIOA 4FS3A 3AM3A 2AQHA 4D0SA 4WLEA 2C59A 5HRUA 2A94A 4GLOA 2Y1EA 4XQCA 3DMTA 3ZW9A 4YT8A 3UCFA 3DO5A 4NU6A 2EF1A 4BKUA 2X0JA 3O8QB 2ZJ0A 5FEUA 1KETA 5ICMA 4IDBA 5DDIP 1QYVA 3WMWA 4CM5A 3LF2A 1QMGA 4M8SA 4NFHA 2WMDA 4NMHA 1QKIA 2G0TA 4CMIB 5A1TA 2NUAA 2BFPA 3WGQA 2GR9A 1U3VA 5H82A 5T73A 3GHYA 2IXAA 2VQ3A 1LC3A 2GNAA 2JL1A 3KEQA 4DYVA 4QECA 1V0JA 1VJ1A 3ZCXA 3B70A 1PJ3A 3VDRA 3FHLA 1NYTA 1B3RA 3NKLA 4WUVA 5HBRA 5GZ6A 2QRKA 3HDQA 4CM6A 4L73A 4RVUA 3IKVA 1J49A 1I10A 4IBOA 1Y5MA 3RBZA 4YJHB 4JP2A 5L45A 3MJVA 2GZ3A 2GO1A 2JHFA 4D45A 1PJ2A 5DCUA 2JAHA 4GBJA 4DYDA 3EW7A 4DLLA 3K96A 4AJJA 4E6PA 1Z74A 4RZHA 4FCCA 2BFMA 4X54A 2J3KA 1QG6A 3GZNB 1SPXA 5JCJD 2IZ0A 4JIGA 2JAPA 1GU7A 5MGBA 3ZU3A 1LEHA 1MXFA 2EJVA 5EESA 2DPGA 1HDYA 2J3IA 3VC7A 2OO5A 3GC6A 4W7HA 2X9GA 4QTZA 4JNKA 1YO6A 4OHUA 4W7IA 3VPHA 1UR5A 4XQ9A 1ENPA 2HUNA 3GDFA 5JO9A 4MJLA 3TDKA 2IRWA 4D79A 4AJ1A 3PQEA 4BMNA 5DCWA 1YOVA 3ZU5A 1RM5A 3SVTA 3I9LA 3QWIA 3UHAA 5KNLA 4GKBA 2EW2A 1C1XA 4XX0A 3E48A 1O94A 3NT2A 2A92A 4EYEA 1XU7A 5CPBA 4DQUA 4E4YA 1E77A 3ANLA 4RDHA 3GAFA 4AJEA 1UP4A 1R6DA 3PIDA 1PZGA 2CMDA 2FZWA 1KC1A 3PGJA 5JC8A 3JD4A 2VRBA 1NAHA 2HAEA 2YDYA 4FOSA 4NJMA 3WIEA 2Z1NA 3OM9A 4YXFA 1VSVA 1IZ0A 4IIUA 4K6FA 1D7OA 5G2OA 5CPFA 1E1KA 3KO8A 3BMQB 3ADPA 4EJ0A 3U4IA 1ADFA 3K30A 3H3JA 1PGOA 1EMDA 4MVJG 3R1IA 4GLLA 2B4RO 4B4UA 2IXBA 2V7PA 4E5KA 4AJ2A 1GD1O 1W6UA 3FRJA 3GH3A 1V9LA 3GLQA 3TZQA 4AJ4A 4DIFA 3AU8A 3PI7A 4BGEA 1EVZA 1NP3A 5JDIC 1E92A 1VJ0A 2I9PA 2CVOA 2UAGA 2PH5A 4UEKA 3ZHZA 3PWKA 3BZUA 3DZIA 3IMFA 1M6HA 4R1TA 3VTZA 4BO1A 4ESOA 4JK3A 4UEJA 2XOXA 5A9RA 2FPPA 2FPIA 4EEXA 2FSVA 3WBBA 3PDUA 1KVSA 3HFSA 3ZNOA 1QYDA 3WSWA 3RUHA 4DXHA 1HDXA 3STHA 1O8CA 1BMDA 1TT5A 2QHXA 1I2ZA 4NK4A 3LYLA 3V2GA 3CPSA 5EERA 1HWYA 2YDXA 1QLHA 3WGHA 1ZSNA 3VZPA 3GGOA 2HCTA 3OHSX 4FR5A 4GI2A 1DC4A 1BHSA 1PZFA 1QRRA 1GEEA 3H9GA 5FFFA 5DOZA 4DPKA 3I4FA 2PGJA 4LSMA 1I3MA 3DBRA 1I33A 4DMLA 2BGLA 2QYTA 3IKTA 5EIOA 4HUJA 2P5YA 3TZ6A 2W2LD 1Q2XA 1NPYA 1JAYA 1QYWA 4ALMA 4ZJUA 5TF4A 4CM8A 1XU9A 3PQDA 3WJ7A 1ZIDA 5BQFA 3LSYA 3DMTC 4DPLA 1LDYA 3R3JA 3IL2A 3LT4A 4GVLA 3V8BA 2NTVA 5AOVA 3C7DB 2JKVA 3JQ8A 1RKXA 1PGJA 3DMYA 1SMKA 1YQXA 3RUAA 3M6IA 4FD3A 3IAHA 1CF2O 2LDXA 1C14A 4Q3NA 5FI5A 4YRBA 2NU7A 1H6AA 4XD2A 1EE9A 4KQWA 3FSRA 1P1RA 3E03A 2Y1DA 1FDWA 1E3IA 2DKNA 1GPDG 2PLAA 3HB5X 2EERA 4JJFA 4Q3DA 5TC4A 3WLEA 5EINA 2YYYA 3RUEA 3LK7A 3H9UA 4BO3A 1ZXBA 2O3QA 1DJQA 4N7RA 3LZ6A 4BKRA 1NWHA 1YE3A 2VYVD 3B1FA 1SCUA 1P33A 1HLPA 2EWMA 2ILTA 3SJ7A 3W6ZA 1ULUA 3GVHA 4TRNA 4HX5A 4QO7A 4U6SA 5TS3A 1YBMA 4J49A 3K31A 3IP1A 2NU9A 4BO2A 1E3JA 3F4BA 3OETA 1YBVA 4M86A 1LDBA 2O23A 4JROA 1A7KA 3NTRA 3VZRA 3I9MA 4CLOB 3F6YA 2YHUA 4IGEA 1UXIA 4E12A 3ULKA 2FHSA 1LX6A 2IZ1A 4ILKA 3AJRA 2O2YA 1JVBA 3H2ZA 1YQGA 4NIMA 3EUWA 3Q1LA 3E9NA 3ZWAA 2JCYA 5A9TA 2ZB4A 4E2ZA 1YL5A 1BDBA 1X0XA 1E6UA 3KYDA 4Q39A 4MVJE 1R4MA 4GMFA 1PEDA 4F6LA 2VCYA 2BKAA 4XGNA 1WVGA 2Q4EA 1PGNA 2D0IA 3OFSA 3T7EA 3F1KA 4I5GA 5L4LA 4KZPA 5IDYA 3FTPA 1UAGA 4UAGA 4KQXA 3CH6A 1B0AA 4CMJA 2LDBA 4H7PA 4JXKA 2DUWA 4BMSA 4XQGA 1YRLA 3JV7A 1EUDA 4BO7A 3F4LA 3DXFA 4WLOA 1RJWA 2CZCA 5I9MA 5H81A 3QLJA 5I7EA 4YJFA 4BIIA 1DFIA 4OMUA 3U9LA 1NPTO 3S2FA 4DMMA 1RYEA 5A5EA 5FWNA 4DBZA 5ITWA 2WSBA 1ENOA 2X4GA 3VZQA 4L76A 4J43A 4HFRA 3ZNPA 4ALIA 3QQPA 2EP7A 4OM8A 4CMCA 1LXCA 5IZCA 2VYNA 1PS9A 3KTDA 4UUNA 4OSOA 3KUXA 2B37A 5ILOA 3BMCB 3UCEA 3LVFO 3QY9A 3RI3A 4TKMA 1PIWA 3D4OA 5JYAA 2BI7A 1OC2A 5L9AA 4BNZA 1I5RA 3NTOA 2Y67A 1C3VA 3UKOA 1DIRA 5KVCA 1BG6A 1B16A 1L7DA 4AVYA 4B4WA 3GUYA 2VUSA 5JDIA 4MKZA 2VWQA 2EEZA 4R69A 1FMCA 4NH4A 3DONA 4CUJA 5L40A 4Q9NA 3CUKA 3RSHA 1ISMA 4C7KA 3F46A 3NX4A 4UUOA 4XR4A 3H2SA 2NVUB 1K5HA 1R15A 2P9CA 4NPCA 3PVZA 4GX5A 1B8UA 4J2OA 2ZQYA 4PFJA 1PU2A 3O26A 4PIVA 1P0FA 4RORA 1VRWA 3GUCA 1AUPA 3JQAA 4WJZA 4JLWA 5CFZA 2C29D 1E7RA 2H5LA 3AUTA 1NFQA 1YXMA 5TX7A 1N1GA 1IPFA 3U5TA 1WDKA 4IXTA 3JSAA 2W4QA 4M54A 3C8MA 1U3UA 1BXGB 4PG4A 4O6VA 5L7TA 2DM6A 4DREA 2B69A 4I08A 4S1VA 5JC1A 5JCXA 5IF3A 3WXBA 2J6IA 3H5RA 1E1MA 3W4IA 1I3KA 3C7CB 3R6DA 3NGXA 4U0KA 2BHLA 3M2TA 3L07A 3UXYA 1WAMA 4FW8A 1F0YA 4YT4A 2V6MA 2VYND 5JBIA 5LC1A 2BD0A 2WDZA 2RH8A 1ZUD1 4CLXA 2X9VA 4B8ZA 1UXHA 3HE3A 3JQ8B 1GUZA 2BRUA 3OH8A 4HNHA 2ZIZA 4YAGA 5IXYA 5BSGA 5C7OO 3KSDO 1IUKA 2V6FA 4MVJH 5DF1A 2D59A 1N9GA 3KB6A 3AK4A 4CM9A 4ZICA 3D4NA 1ZFNA 5G0WA 4FDAA 5ADHA 3VKVA 4YYZA
chains in the Genus database with same CATH superfamily
1STOA 2MSEB 5JU6A 1LLUA 3CTPA 1P61B 5IX8A 5EMHA 4A8JB 1QDUA 4B6JA 2F8TA 4DMHA 2XQGA 4DWVA 1ECBA 4IGAA 3P97A 1QC5A 2FFJA 4JUDX 1G4UR 2KWIA 2UUCB 4O63O 4ACAA 2JK0A 1Y4ZA 1GQYA 3L6EA 3TZKA 3OPXA 4K3VA 3EBPA 1NGSA 3PP8A 4G4GA 5JECA 3E81A 2CXRA 2Z2XA 2Z98A 5CK4A 1P72A 4WFKA 4D6YA 1IHUA 3FCUB 2P6PA 3ILVA 1H1LA 3NJRA 4Q9DA 4RKEA 4RSHA 3HS3A 3ZDRA 4DJAA 2KX7A 4URUR 2EWVA 3DOEA 4FE4A 4CQJA 4RQUA 1WUKS 4P3KA 3REQA 1ZD2P 3CZQA 1GCIA 4OCZA 1LY1A 2D0DA 4S35A 4UMVA 5F23A 1P5JA 1U28C 2DX7A 4NYMQ 4RU1A 4NMMA 1JHDA 3HUEA 1VA4A 2ZBVA 1C9MA 4Y6PA 1IVNA 4EAQA 3F90A 2X1LA 3IALA 1Y81A 2X8LA 5CFQA 3NGLA 4IZIA 1MO3A 1S96A 2WU1A 2OHIA 3H5OA 3E5RA 1G21A 3A9RA 3G0OA 3JTMA 4FKBA 4B71A 4KBFA 5C37A 3RRZA 5JJIA 3ZD8A 4GSYA 3PUXA 1MB2A 2DU8A 4PSAA 3MMXA 1C4XA 2O2JA 2D74A 4PO9A 5GWXA 4YP9A 4CM9D 3UJBA 2XOKD 3RK1A 2Y9MB 4IG9A 4FFBB 1T4CA 1Y3IA 2HNAA 3VZSA 5HJ5A 3UYLA 4YRJA 4HXYA 2AV6A 5CA0B 5DSTA 2OBYA 4XWYA 4HX9A 1H66A 3R7BA 1YGYA 1TF2A 3SM9A 2W70A 1EFUA 1YD7A 3QBJA 5A03A 1NJ6A 2F00A 1TA9A 5F1OA 5EJ7A 3HPQA 1L9XA 4M0MA 3K7EA 4UE3S 5CNIA 5DHUA 2WFZA 4NATA 3KSBC 1JEAA 4W5OA 3HRHA 3ABIA 2HMSA 4P4LA 4DZTA 5JALA 1E5QA 4UHJA 2QW0X 1QO7A 3BF7A 4CKYA 1VKRA 5KWEA 2Z8ZA 4CLDA 2PD6A 4L72A 1JXQA 1JDJA 1JEYA 3V9AA 3N2KA 3VR2A 2WWTA 1LNSA 2HM7A 3RNLA 1N1EA 4BFYA 5JQGF 3SOZA 5KWIA 3FPJA 5E7IA 2FPMA 1B74A 1YKGA 2AMYA 1L7AA 2L17A 3AB3A 4LISA 4LHXA 1MHPA 1TM3E 3IQDB 3SNKA 1G5RA 3Q8LA 2PGAA 2L18A 3U17A 3K73O 5FOUA 3HCRA 1O58A 4YRSA 1PP4A 4ON9A 5I9TA 4O8ZA 2EP5A 3ZV4A 3U5ZB 2CBZA 2VWGA 2GK6A 1EFVB 4N8SA 1E2FA 4NBNA 4BJ6A 4NESA 1LJUA 3A36A 4MUBA 1WVMA 3HM2A 1YHYA 5FTLA 2RAFA 2VNIA 2XUJA 3EPKA 4MQ4A 4CKWA 2ZS9A 3F7MA 3PWSA 3AUKA 2OC9A 4QDOA 1PX0A 3MWYW 2YFYA 2TECE 2Q1YA 5IJZA 2V7UA 4R1UA 1Z06A 2XMBA 2XIJA 1FXWF 5I45A 2C99A 2Y1OA 3FA2A 3SKXA 2O48X 1GNSA 2WIGA 5DGHA 5EJ8A 3IHLA 4S1TA 1W0CA 3SYKA 1U9IA 1SBQA 2GARA 3R4CA 3W04A 2YXLA 1JNXX 4FFMA 1N8KA 2ZIEA 4X6LA 1QQ6A 3ZNNA 2ZRFA 2B4TO 4NZOA 4G4SO 1CY4A 3LQ1A 1GZVA 1PBNA 1RYYA 3DBIA 1E61A 2OAP1 1JGTA 1VIDA 4PO3X 4UOQA 3VTFA 3W3AH 4GKVA 2IS4A 4DVJA 2AXEA 2MIIA 3HVKA 1E6KA 4M8LA 4Z9AA 1Z63A 2Q50A 1I6WA 3OPNA 2NU7B 4QATA 1VE5A 4RM2A 3RNOA 3NM6B 3ZOKA 2DFKB 2AK3A 4NAHA 2QUZA 1E2NA 1WMEA 4DUGD 3HA7A 1O5IA 3JQ9A 5K8TA 3VJRA 3KU1A 2ZRAA 3ORSA 1QRUA 4C0LA 1F8XA 2QRQA 3CVVA 4EI8A 3F97A 1UKAA 3IE0A 1KBQA 1PR6A 5A62A 4GO1A 4B31A 2CFOA 4KPEC 2Y0EA 3B1XA 2VI5A 1ZXLA 4JYBA 2N1MA 3L7AA 1YIDA 2TMYA 1TD9A 4G1FA 2QVYX 5B3KA 3AIMA 4KE7A 1M10A 2W0MA 2H9IA 1VLLA 1VJRA 1QQ5A 2JZNA 1YCDA 4W8HA 2BGNA 1RZ3A 2P67A 5IMSA 1YJ8A 1RJ9A 1K8ZB 4ZCRA 1YFLA 5JNTA 2WM2A 4KO1S 1F12A 1XEWX 3EDYA 4JJGA 4XM1A 5ECWA 1QU2A 4GM1A 5EVCA 4L3OA 5COQA 5HR5A 1HE3A 3GROA 3VOSA 1G17A 2BPOA 3HL0A 3QVGB 2C4WA 5CEFA 1NNSA 1IHXA 2J5BA 5A3JA 1OYYA 3ZQ4A 4ID3A 2GHRA 1QH8A 4MYRA 3E9CA 4JI6B 4MUIA 5HBGA 3M1YA 2V96A 3HSYA 4QPZA 2RHLA 1XZLA 5AJVB 4FD2A 4UJ3A 1EFTA 3Q2OA 2FKAA 4QU5A 2XE4A 5AHKA 1YR8A 5AKLA 2PR2A 1FTSA 5KJCA 3VR2D 3R8XA 2SKEA 1DPGA 1BCRB 3MNFA 4NQRA 1ELOA 2NT4A 1NXSA 2RHRA 4JASB 1F8UA 2YQ5A 4BZWA 1Z5OA 2G88A 2PKEA 4QYWA 2DE0X 3DBRB 1DNPA 4JC5A 4LX8A 1H8EA 3OY7A 4QO8A 5FX2A 3D4IA 1Z2NX 3TM5A 5LBUA 5TF0A 3KJFA 1E66A 3G7SA 2B8WA 1PFUA 2GEBA 2HPZA 3GWGA 2ZQZA 1NUAA 3NH6A 3NUQA 5BQPA 3VAZA 3JVVA 2R1TA 2EKZA 3JQAB 4AWXA 2JJ8A 1EFKA 4TGLA 3QUSA 3IQWA 2NO9A 4BKQA 3L7DA 4CNBA 3DMFA 5FA6A 1AN9A 3CISA 4B7ZA 2OD7A 3FPLA 1S2MA 3GBPA 5AXBA 4P5PA 4DIMA 4MUYA 4MHSA 3H0VB 1R4AA 4KR2A 5BN3B 3ASVA 3GLSA 1I94B 3CG4A 1N2XA 3NNNA 3IEVA 1MG0A 4B6OA 1MTZA 1P2VA 5K0NA 3MXTA 3W9UA 1EA5A 1HQCA 2X7XA 3FPGA 2OQIA 4JBGA 5IUNC 1MZPA 1QZUA 1CQZA 3OHPA 2IV7A 4F46A 4WBSA 1X1CA 3HKCB 3L18A 2RKOA 4ZXFA 3WIOA 5L3SA 4WFJA 2AMVA 2DJIA 4DCUA 5B6IA 1PJCA 3ORFA 1RQPA 3W8FA 1T1JA 2CNBA 1MHTA 3T9DA 2B8TA 1G8AA 2ZRNA 1ODJA 5EJ9A 2YYZA 4U7GA 4PE5B 5CDHA 3RYHB 4B3BA 3FNEA 3RABA 3GB9A 4MS3B 5C7LO 5IYZF 1ORTA 1XMIA 2C97A 2C96A 3DH0A 3HM9A 5D5PA 5JSFA 2CFSA 4V0KA 3O3MB 2N75A 4DZRA 3E7DA 2R4UA 3D81A 1N3BA 3VYRB 3JAKA 4PV7A 3S6JA 1RJEA 5I7RA 3LQKA 3AOGA 2ZRCA 3ZV3A 1T2AA 2CD9A 4R16A 2OCLA 1ZEMA 3E9EA 4LJSA 4RCVA 1OLSA 4QEKA 1AHIA 2XMPA 3QX3A 1Z0DA 4HDKA 3OC0A 4G1EB 3ITEA 1FVOA 2YYAA 3T99A 1P1JA 2F62A 1PAUA 2P3LA 1FTQA 2ZYRA 1GNTA 1T5HX 1AV7A 2WFMA 3HB0A 3PJFA 5BT9A 5B12A 5M7EA 2BM9A 3HYSA 3SVZA 4D3DA 1N6RA 5DRYA 1PDVA 1I1OA 1QONA 3B1ZA 3ROZA 5IFKA 1G6HA 3UICA 2FZ4A 1BOFA 2C3YA 2Q2QA 4FLEA 4BJ1A 2HSGA 5IEJA 1SO8A 3I58A 4CKXA 2C4KA 2AC2A 4ES6A 4MITA 3WAGA 3O31A 4J03A 3IXQA 5JS8A 3G89A 4UVHA 2G28A 4LWZA 1FQJA 3I5XA 2J45A 4MUEA 2F3TA 2Q6OA 1YR1A 4PQEA 3N07A 5DLEA 4AP5A 1QP0A 3DLBA 2IYLD 3EH1A 5JCOA 2J9ZB 4L8VA 4WA8A 2J07A 2YNMD 3B85A 3ZEAA 4MAMA 1YRHA 1KORA 3WK6A 1YVEI 3QA9A 2HFJA 1EB9A 2QLFA 4JEHA 1TCAA 2V7TA 4ZRMA 3QNMA 1H2ZA 2YC2C 1KJJA 1NN3A 3WZLA 3R24A 1AZSC 4QDJA 1XAJA 4FP9A 2XGSA 2FGJA 5BSRA 3SC2A 4DDVA 2H18A 5DX1A 4P32A 3TLKA 3WRYA 1HE4A 3NO4A 2XD9A 3VPDA 4N4AA 2BFEB 4QJ3A 3AB8A 3M1LA 5MDHA 1SU6A 2GBCA 2IYZA 4V38A 4JLBA 1II9A 3A6ZA 3KTAA 3PC6A 2A9FA 2PYZA 4AQDA 1T9KA 4CKBB 5KKCA 1YCFA 2YVLA 3E22B 2OFFA 1MT0A 2DETA 1D1TA 4U9IS 3SXJA 3CFYA 4ND4A 4PCVA 1X39A 3C3PA 1E1RA 3B89A 4QLAA 4Q4CA 1ISJA 3OOEA 1FSGA 1V8ZA 4FYXA 4HN2A 2UU9B 3NOQA 4FI3C 4GL2A 4LZAA 3G8BA 3OFNA 1QOZA 5AJZA 4YA6A 4MQUA 4FFNA 1XD9A 2V59A 3DHVA 4WE3A 1Z4IA 5T57A 2A1IA 4HNAA 3EYWA 3FSJX 5F78A 4XGQA 1X1EA 4MKHA 2R00C 1N5JA 2J32A 2WKQA 1FNCA 3N8HA 3SJAA 3A3YA 5ICSA 3EPAB 1BIFA 1CD5A 2QD5A 4HVTA 1CIPA 4F4UA 3UXHA 3EP3B 2DUMA 3FY4A 3K2BA 1BQEA 3OCZA 4HQKA 4Z3DA 1P2DA 3RC7A 3L4BC 3U7EB 4BMDA 4IF4A 4JLKA 4BTLA 4HVCA 2W8ZA 3V2IA 2PA0A 2AW3A 4ARAA 3KQMA 4IDDA 3SZ3A 1NQ5A 5D3ZA 3IAFA 4B35A 4GMDA 4B7UA 4JQZA 1WUHS 1DV1A 2AXPA 1E9AA 4BBZA 2IWRA 1F4LA 4L5JA 4PXAA 4G4JA 2J6CA 5E0OA 3ETEA 2DECA 5J4YA 3KKNA 3IOEA 1W0KD 4PYNA 4ZO8A 5JRDS 2OT3B 3FB1A 3IS3A 2CLFB 2BOVA 3VMMA 1H1DA 1V7CA 1VGRA 1MO6A 1Z29A 1ZK1A 2ZYHA 3F6BX 3IT3A 2BEWA 4QXAA 1O9GA 4WFIA 2BHSA 5DP1A 2MMCA 5FTNA 2QGFA 1J8MF 1JEOA 4Q05A 1IY0A 4YAIA 1L2TA 2QUJA 1ZX1A 2FK7A 4RQTA 1POWA 4B45A 2OO3A 5I8PA 3DSRA 4NFLA 2A1UA 1W88A 3UUGA 4WADA 4WLUA 1OXTA 1D09A 3DOIA 3WIDA 5JRJA 2YY5A 4UOZA 2I3GA 1MC4A 4C6RA 1CEEA 3KEFA 4B3XA 1YKSA 4UXJA 5LZ5A 4CF4A 1GZUA 2CLEB 2BN4A 2WWRA 5E6SA 2Z5GA 2VSQA 4HPJB 4KE8A 2R7KA 4YPOA 3LF1A 1OHHD 1XU4A 2PWYA 2I5PO 3KPUA 1U98A 4ZHSA 3ASUA 3K6KA 4GM4A 4MV3A 4A8JC 2UZ4A 4CLQA 1ZZEA 1VPEA 2V6IA 4PLVA 1KBZA 4EMUA 5BW5A 2XYQA 3KGDA 3GQBA 4Q1AA 1VCIA 4S3MA 2AN5A 2JAOA 1D9ZA 5LR6A 3DZFA 1KEEB 1HO3A 2OR3A 3ESAA 4GKAA 4KLAA 1ZCAA 3HRKA 4DRYA 2ODAA 4G5HA 4EGCB 2QX8A 2XNDA 2ZI6A 4M6WB 5C8VA 3WLKX 4NNOA 2PKQP 1EGMB 1QQ7A 1RWOA 4LNHA 3A3KA 4NU5A 1H22A 1BXZA 4RIGA 4QXPA 1HC7A 4RABA 1P1KA 3BH0A 4MKXA 1E1LA 1XLTA 2PJUA 2OG2A 5CBPB 1YACA 2NZWA 2VRWA 4I9FA 2GEDA 3QVKA 4KE6A 5C4IA 4KXMA 3QE3A 3QNWA 4ASUD 1QYXA 3QWAA 2B2NA 4BUZA 1T5OA 3QV2A 4ND2A 1AS3A 1IEXA 1T36A 1WZNA 3GG2A 4DABA 5ITZB 3EXG1 2B35A 2CFRA 2GEKA 3IIMA 1KP9A 2XAAA 3AWDA 3ZN2A 2H7VA 2HFKA 4HR7A 4AROA 1VE7A 3EPJA 1AV6A 3V3TA 3KB2A 1Q44A 3AKEA 5ALEA 5CG1A 4AY6A 3AG6A 2DSTA 2FPKA 3EAQA 2GXSA 4IH1A 3KLNA 3UOAB 1X7WA 4QPNA 2C2OA 1U2ZA 4EJSA 3U4DA 4UOEA 1LB1B 5LL6P 3QENA 4ZCIA 3ORHA 3TTTA 3EASA 3LC1O 2WF8A 1ECLA 3A8TA 3ELBA 2QL7A 1Z4NA 1OH8A 3RU7A 2PLRA 1KP3A 2QD4A 2BT4A 4XOIA 3ADKA 4YCMA 3R0QA 1YQEA 1X1QA 3AI3A 4V0OA 4XPZA 4ERXA 1IZ7A 1N2IA 2BJVA 3NBZC 3JQQA 4B3RB 5DMXA 4RHUA 1KO8A 3UAVA 3C5VA 4MR9B 2XUZA 2H2FA 3HO8A 5CNMA 1Z16A 3STUA 3LH5A 4A6PA 2NTYC 1I0ZA 3DG9A 4P3XA 2P6OA 4CKCA 1YRWA 3EA0A 3WI7A 4EVIA 4YIHA 1FMJA 3AFGA 5REQB 4F38A 3BGOS 1JSCA 5LQMA 1X7ZA 1JMYA 4AKTA 2RGEA 3VR3D 4KOAA 1K1EA 4BQIA 1G291 5IC4A 2G07A 4UD6A 3LCMA 2GJ4A 1F2TA 3SDSA 3V7WA 1E2KA 4A0SA 2I2DA 1KERA 4BMVA 3TUTA 3PC8A 2ZB3A 4BX3A 3E8XA 2O2XA 1XTUA 5JWOA 2G76A 2W2NA 4XWKA 1ZC4A 2I7CA 5AJTA 4R84A 5JMPA 1E6EA 2E37A 4ER5A 3BILA 2DVMA 3IQHX 5ARDA 4G1MB 4CNQA 2P5TB 3IMKA 3ZLTA 3PX3A 4EYQA 4EHAA 1DT5A 3EP6B 3T5GA 3RE1A 1U6JA 1WHSB 5ES3A 5ITWA 3KXKA 3L93A 5KYWB 3D4PA 4RJKA 3ZDQA 5TT1A 4OQEA 3ICQB 3E9QA 2VN8A 5KEIA 3GLGA 3OSUA 3OWXA 1M5TA 2NVBA 2BP7A 4GBGA 4IM7A 4XTCS 1YFZA 4OXXA 2MSCB 5AW9A 5CCDA 4CMHA 1C7EA 1THTA 1UL1X 3MQ4A 2ZAIA 1NJ5A 2VUIB 3W6PA 1YL7A 1QIIA 1KJYA 1ZK4A 1DC3A 1SU8A 2JFFA 1JHOA 2PS3A 2QLBA 4HLDA 4KZKA 5CT6A 3IAEA 3D7NA 4KFSA 3BXZA 2YV3A 1THGA 1J99A 1WVIA 2WB4A 3OPQA 3RFVA 4BLOA 4O59O 3U56A 3PBKA 1ZKDA 3P2OA 4WIAA 3R77A 3PNKA 1EUZA 3QYFA 4NOMA 4D3FA 3OX1A 3O83A 3HU1A 5HCNA 4WZAA 1CHDA 5HOQA 4W9MC 1OW3B 4I4TA 1NVMB 5K0TA 5KREA 4N5IX 3VAYA 3MZ0A 3P9KA 4CQMD 2QY9A 3L7NA 2VTEA 2G77B 2Q7XA 1GSHA 5AVQA 5M04A 5AM5A 3Q3JB 5ICFA 1F8FA 3FOFC 3TQOA 2DWCA 1Z0AA 1LLDA 1N5LA 1R7RA 1P73A 2IITA 2CLSA 2GJKA 2ACWA 3L0PA 4ZQGA 4CG2A 2BDTA 1IN1A 2C2YA 3IR7A 5K6AC 4NNJA 4G1VA 4KVAA 5K0FA 4IX9A 4S1OA 2C04A 1T34A 4D6XA 3BKXA 3ECSA 2CZQA 2VDOB 2IGTA 4Q82A 2CDBA 1E8MA 2B98A 3NHJA 1GA4A 2B1JA 4LYAA 4EBBA 3CT4A 4UTRA 1U8FO 3PXDA 1D0IA 2P4UA 3A0UA 3QPVA 3GBSA 3R6WA 4IDHA 4JVLA 4CIYA 3EK2A 4FFDA 4MULA 2ENUA 2IEDA 4BZXA 3AP1A 1AQIA 1XRPA 4EKEA 5EQJB 3DKPA 2HMTA 3DVRX 2ZPAA 3KPWA 5J2TB 5JS1A 5TQVA 1A9QA 1KY3A 2PXHA 4G41A 3EIHA 2QR2A 4Q9AA 5EJ5A 5IAOA 3I73A 1E79D 2HA5A 2GRJA 2C7VA 3LDAA 2SCUB 1H2EA 3RD5A 4UCFA 1OXVA 4QFCA 1LQUA 1HLDA 1I4LD 1R66A 2QVZX 3T7IA 1UPAA 2H9AA 4MOWA 1RE0A 1T9HA 4QUKA 4C7OA 2BFNA 1BSVA 5FTKA 1OFGA 4I50B 3EWIA 1VL6A 4EPYA 2I80A 1OXMA 1RYDA 2CNLA 2R84A 4RDCA 3TNFA 1ID1A 3RCBA 1ESMA 4MP8A 1Z4JA 4HLQB 3RGGA 4CVNA 5JS2A 3GEDA 4U5XA 3C3EA 4M46A 3QYJA 4EB8A 5EHGA 5AK0A 3KG2A 1Z5PA 2G63A 3USES 3GJ3A 4GGOA 4QHYA 5I9BA 3SEZA 4OVKA 1G7CA 3ZE6A 3H04A 5FBRB 4JJKA 2PKXA 1DWOA 3E7FA 1GPLA 3G2LA 1VKHA 1V4BA 1JDTA 1JJBA 1N4AA 3CH4B 3GT3A 1JFFB 1V3QE 3ZKWA 1XQVA 4G5RA 4ENWA 8AT1A 2SECE 5GJWC 4LYJA 3UENA 4PINA 3RKSA 4HNGA 1KTVA 2B7LA 3DTVB 1HR0B 3WOHA 3LHIA 4C87A 2IPMA 3WFJA 4MA0A 4MB0A 4DIBA 1CRLA 1I7NA 3A4MA 1DFHA 3EOBI 1YZTA 3FRIA 4U7FA 4W82A 3HLYA 3HPRA 3QBTA 4NBLA 3HZHA 3BHJA 2ZGVA 1XZJA 1QP7A 3H3FA 3KKMA 7ADHA 4BNJA 5DE3A 2RB5A 4PQYA 4Y0NA 3V55A 4TM7A 5BNFA 1MIOA 3G0DA 4G37A 3PKIA 3TLZA 4GSKA 1QPGA 5BNIA 1P9OA 1KIFA 2OOKA 3E7XA 3N6RA 4BE4A 2Y76A 2E4YA 4H4EA 1E2QA 3A4YA 1JP7A 2AC7A 1HDRA 3KKOA 2I1QA 2NIPA 3CJQA 2RB4A 3RRXA 3BDIA 4W6QA 4LOHA 4L95C 4NPHA 1B3BA 4OYLA 1JJIA 2A9JA 4MEAA 1ZNWA 1NR7A 3BXXA 3OSZA 5G4KB 4EUFA 1SC9A 1TOAA 1UDBA 2H4ZA 1XXHB 4D7AA 4EFDA 5CLLA 1ONOA 1OA0A 3GD7A 5DTJA 4Y9SA 3PL5A 3IEUA 1ABFA 3QPWA 3UTCA 3ESBA 2IPOA 3GDHA 3C6MA 2CUZA 1Z6XA 2JGFA 3NBFA 4TZTA 1D5CA 5GP1A 1VKJA 4NJMB 5K4GA 2ZTLA 5CYOA 1E3EA 2RHDA 4HTFB 1TDJA 1RAIA 2OZPA 1VRVA 4JEUA 2P9JA 4NLLA 4O4IB 1YC2A 4YI5A 3ZXYA 3KCNA 4JP3A 4LJLA 4Q12A 4RPKA 3VU8A 1PO7A 3E7WA 1M83A 2ZJZA 2XV1A 2IVFA 4KLCA 4GQBA 1C3EA 3T95A 2NSDA 1X14A 2XIQA 1QH1A 3AYXB 4PZUA 1FYEA 2ZB7A 2P2SA 3AEXA 1E9VA 1K97A 1QYRA 1KS2A 4ITUA 4M38A 3VSCA 5HZMA 2GD1O 3NDIA 1XBTA 2DP4E 1M9NA 4WESA 4W8GA 2R5WA 4NFYA 2VXYA 3QKRA 4B2YA 1M7HA 3TG2A 1CNEA 2V58A 2HCBA 4F4HA 3MJTA 1RR6A 4J1SA 1NATA 1VYUA 4Q24A 4WJKB 4ZYYA 1AXGA 3TUIC 4MDEA 1GZ6A 2ID7A 3K70C 4WXYB 1GKYA 2WU3A 3DKVA 3COJA 3GGSA 2G17A 1NSFA 3LUBA 1VBFA 4F6CA 2PVSA 3JQDA 1J9ZA 4JJZA 4WNYA 1GZSA 4Y3UA 2F43A 1XQXA 2BBSA 2VHCA 4MGYR 4EDFA 1QR6A 3ILSA 4IDFA 5EE9A 4K6GA 2ZBGA 3ZBTA 2O2GA 1HDZA 2FSVC 1JDZA 4A6DA 1JKJA 4H7IA 4L1KA 1CZKA 4HWRA 4UVEA 1K8YB 3TOCA 2Z6UA 3CMCO 1T0IA 1CJCA 3F4KA 1ONNA 4REQB 4TMXA 1U8YA 4XD7A 2CHGA 2PLWA 3P0RA 1MJGM 1YNSA 1GGNA 3DV0A 1HFWA 4QJIA 1ENYA 4Q1DA 1HTWA 5JRZA 1NMQA 4NKRA 4OLBA 2EFDB 3LNTA 2QEQA 4LBZA 3J81A 3QSYA 3NBMA 3FBWA 5KIAA 4ZOLB 3MCWA 3R20A 3HWWA 4KV9A 4L3WA 2DUUA 4U4AA 3UGTA 4RUKA 2GCOA 1YAJA 5KCZA 1DO0A 1Z4QA 1R0WA 2JVIA 1ONSA 2Q9AA 2HHHB 5K3EA 1ZIPA 2Y77A 3OIUA 4PLYA 1ECCA 5AJWA 4Z7QB 2IHTA 1XEFA 2HKIA 2J9FB 4OQ4A 2AR0A 5HTKA 3TRIA 3VKGA 1OJLA 1FS6A 2BCEA 5C18A 2C83A 1SUPA 2H2GA 4EUSA 2YZ2A 1WE2A 4AZ0A 4I19A 5KQMA 3AMVA 1NZFA 1QHHA 1U8UA 2LD4A 2WOJA 3MRTA 3Q3IA 1TQ2A 3FNRA 4EMSA 5J4HA 1GKLA 2QQ0A 3ZV5A 2NSLA 5JFOA 3KVRA 1Q0TA 2PAAA 1MBZA 3G3EA 4X1KA 4TLLB 5AOBA 1G63A 3T3OA 2CD7A 2I54A 4DCCA 1YE5A 1YVUA 1Z6TA 3AIKA 3NRCA 2JJ1A 4YMWA 3L5OA 2CNWD 2QY6A 2D5BA 3AXTA 2GN8A 5JVDA 2C2ZA 1Y4DE 1S3SA 3FR8A 4Y2TA 2GAFA 5J23A 4G0UA 3F67A 1SM4A 4WSOA 1C7RA 3M70A 1J90A 4B7CA 4J1QA 1DKOA 2DR0A 2F1KA 1FW8A 3AI1A 3CN7A 3CZ5A 5F52A 5F5NA 2FOLA 3OZ7A 3GGJA 4IIFA 4BC1A 2H0AA 5JSYA 1G5PA 3DZ8A 1YK1A 2R48A 4MV1A 3LFTA 4FLFA 1LX7A 2GXUA 4TLBA 5IAEA 4AL4A 2R66A 2EKBA 4OP3A 1DIGA 4IIJB 2ZI5A 4I3FA 5J59A 5FWXB 4ZCPA 1P80A 3ANMA 1E5LA 1JVSA 3RRJA 3A9TA 2NAFA 1C5KA 5EGSA 3ZG6A 4MV8A 2AZXA 4TV9B 3W2EA 2R6R1 1I79B 1AURA 2HH9A 3PGKA 4B4KA 4KPYA 1II0A 4TTVA 2P40A 4ML3A 3M5WA 3ER9A 1U0HC 4NC9A 4PTZA 1GTL1 3PITA 3JWJA 2CCKA 3B5JA 3SE0A 1G8HA 1U7ZA 1WF6A 1C9YA 1PZMA 4LAFA 4UBKA 3ZWNA 2VSFA 2AL7A 2HTEA 3EZNA 3KT6A 1VP9A 1H1LB 1T3TA 2M6RA 4B2IA 1T6NA 4X1IB 5B1EA 1GAWA 5THXA 1Q83A 2RHOA 4IS3A 3AI7A 5D5HA 4I14A 1AQ6A 2P2YA 3V5NA 5IZCC 2FRVA 1Z8DA 4M7OA 1I3NA 2CMGA 2JK1A 2DQYA 1M2FA 1WR8A 3IMEA 4LWPA 3NWPA 3ZHBA 5CBKA 3SBOA 2GYWA 4G5YA 2IYPA 2W2VA 2XUIA 5TIIA 1KQPA 1H0SA 3H2KA 1O5OA 2WIFA 2QVGA 1W87A 3KXIA 4QODA 3MCTA 4RD6A 3NWEA 4O4LA 3SX4A 1JHQA 3PZBA 1YI0A 2ZKLA 3D2CA 4PQGA 2LZ0A 3H3XA 5JVDB 4F11A 1L8LA 2D8MA 1OXUA 4LHEA 1UP6A 3QVTA 1L1EA 3HYTA 1TO2E 1QOPB 2WD8A 4HUQA 4ISCA 5KSYA 2QLNA 1RXUA 4FMDF 1J5PA 1ESDA 2HLHA 2I3DA 4PC3A 4QUIA 1EK6A 5FL7A 1V16A 1ZG3A 2AFIA 3E1GA 3A9UA 3JCZA 3RSLA 3KL2A 1U2DA 4BNKA 1L4YA 1GL9B 1X38A 3NDJA 4NENB 1WB5A 4Z4EA 1MEOA 3WKCA 1KZ7B 1TO1E 3T1NA 1Y4SA 4ZU3A 2WWWA 3DP9A 4WMLA 4Z4GA 2Z5FA 3IERA 4QU8A 5FOXA 3QUAA 3T6KA 1H2HA 2ZUCA 1N5OX 1VP3A 4AYTA 1E6MA 2QJWA 1W0JA 1Z73A 2WPDD 4BX8A 3FNBA 2AOTB 5AVSA 2JLWA 3IWBB 1DBQA 4DY6A 3KDPA 3S1AA 3OPMA 3TIIA 1LFDB 3SN6A 3W4KA 5A5DA 2W98A 1WZUA 4HH3C 1N92A 4NMWA 1NBWB 4PPNA 1VTKA 4NBRA 1CJTC 2Z43A 3GGGA 4M7RA 2JI8A 3G1WA 4R2KA 4B8WA 1NRWA 3TZEA 1KO4A 2GAOA 4R54A 1R6TA 3FCCA 4UATA 5GMOA 1FNDA 2QDXA 3WY9A 1RBZA 1P8JA 2X14A 5HYVA 1BCSA 1ZRSA 4L5IA 5EIFA 5J1SB 4O4JB 1FLAA 2O52A 2XE6A 4RMJA 3RAEC 1EFVA 2R8EA 3WNCA 5BURA 4EVRA 1HE8B 2HZ7A 3ADBA 2WEKA 1W4RA 1UQUA 4MROA 3UAYA 3CG0A 4AKGA 2XUHA 4HSGA 4XJSA 3MT9A 2BH9A 3HYNA 3QQ5A 1OKKA 3UJ7A 4DMGA 1OH7A 2DCMA 1T4GA 1GZDA 2WVAA 5THQA 4CF5A 1M1NA 3FUCA 4KR0A 1ZYUA 4G8BA 1X6VA 4HWOA 3R3ZA 3HDGA 4JNCA 2PS0A 3D8TA 3ZX5A 2PFKA 1FCJA 2E1RA 3DAGA 5EEGA 3OO1A 4X8OA 3TSCA 3PQVA 1XA3A 1CQWA 2AKAB 3L1KA 1H94A 4AZ3A 5KSOA 1T6YA 3JQFA 2XCIA 1OZFA 1XTJA 2E5WA 3EG5A 3KC2A 3ZLVA 2BE7A 4HEQA 1K98A 4MPJA 4MYDA 3DAYA 4C3ZA 4NXNB 4CQLB 1P7ZA 1TEXA 2Z9DA 3P9PA 1XCGB 1JKFA 3P0HA 1PR9A 5IAKA 8ADHA 5SV2A 4C04A 1OV6A 2QR5A 4ZP1A 4CLRB 3QW2A 4PLCA 1NU6A 2O3UA 3SSAA 1TUEA 3T9FA 3NHBA 4F9EA 4EY7A 1MU0A 1EINA 2A5DA 2YWHA 2FZKA 3AY7A 1PLLA 5JQGA 3BTVA 4ETNA 3NVMB 1T0HB 3Q9LA 1ORIA 3A05A 5KYYA 2WR8A 3DV9A 3ZEIA 1SCNE 2Y99A 3MRSA 1Z8FA 4QG3A 2WJAA 3ABSB 3LCVB 4IUYA 2OOSA 1Y48E 2QAJA 1Y3CE 1FFHA 3B1KA 4ZDJA 3UMVA 1SY7A 2GZAA 2OLKA 4M76B 1W94A 5FF9A 1PT7A 1I1HA 3BWEA 3SJZA 1V8FA 1SG0A 4YAFA 1YS1X 1TT7A 2PHZA 3ANNA 4EHHA 1EWTA 5AVOA 3FWPA 3PTZA 3A1SA 4FGJA 1D8TA 3GZNA 5CVEA 5JS7A 4Q7LA 4LMPA 2VNHA 1VZ2A 3WFIA 4P82A 1H2RS 4OH1A 3RUCA 2IX3A 3SX2A 1UXJA 3KTOA 1MEEA 1M33A 1U8EA 1N3YA 1Z6QA 2EYUA 2J0UB 2WD7B 4JWKA 1J1ZA 2E21A 1D6JA 2EAUA 1CETA 3MAAC 4UNNA 3PE3A 3Q2IA 4FHEA 4LX0A 3ZIUA 4B5LA 3R3SA 3D0KA 4DIDA 3RT9A 3TN7A 5H8WA 2QAGC 3EBLA 1LW7A 4OEHA 2E55A 2G1KA 1WXDA 1E1RD 1P2BA 3GAMA 4HWKA 3GJXC 3T1HB 4MS4B 5ERYA 2X3FA 2BZ0A 3L6BA 2VTDA 2UYYA 3VPBA 3DFMA 3EC1A 3MVEA 1OGJA 5C8YB 2NXWA 2VOEA 5ERXA 5AHXA 1YDHA 2QAGA 3AR3A 2NYAA 4AJIA 2V4ZA 2Q4DA 3QM1A 5K03A 2CSXA 1E5VA 5D01A 4CLRA 1IOLA 1Y5RA 2OYCA 2BBOA 1DX9A 2X41A 5AKXA 5TR9A 3I6QA 3CW2A 4IXWA 4E30A 2ETXA 5CB8A 5IT5A 1WDTA 4M7PA 1EFHA 3K8YA 1ULHA 1GQ2A 1NULA 1FIUA 4A0QA 3RIGA 3KQVA 2OGTA 3BE6A 3RRFA 3RYFB 3UWPA 2BBWA 1SBTA 2VDKB 4FSXA 4DSZA 3N05A 1O6ZA 4Q66C 2CBGA 3IA2A 2FNAA 2D2IA 2YNMC 3A1CA 5C1PA 4QREA 5LU8A 2PUGA 2FSHA 1O0CA 2ZRPA 2OB1A 3TXXA 3BRQA 3F6RA 3NV7A 2IEBA 2AA3A 1BD3A 1E5XA 1Z7GA 4J9UE 1XTZA 1WZEA 1W4LA 1MIHA 5AR1A 3MOSA 4AW9A 1T2FA 1NG1A 2WJJA 3JWHA 3RS9A 1X3SA 1KSGA 4U2EA 5LYJB 1CPYA 2CK3A 3TXAA 4P5DA 2FI1A 5IM5A 3EY4A 2P9QA 3AHDA 3CZMA 5LQCA 1U8XX 3FCEA 2IIPA 4JC8A 5GM2A 3CMMA 3TDMA 1LTKA 1Y7HA 3IIEA 2Z9CA 2HX1A 1K7SN 4E31A 5YASA 2E5FA 3N0XA 1WQ3A 3OJFA 3AOEC 2EFGA 3QU9A 1IZYA 1OUMA 2BMDA 3RK0A 4HDKB 1YR9A 4D8UA 1CG6A 4KQGA 2EW1A 4PAMA 5DHAA 3BAZA 3P5SA 3FZGA 5AIAA 5E1MA 1KSFX 1MT3A 1OROA 3VR6A 2Q6IA 1NQUA 5LM3A 3A4TA 2Q45A 2KE5A 3R7WA 3T3EA 2PWAA 2ACKA 4IO0A 4EIWA 4ENSA 5JJBA 2ZXUA 1CZOA 5BSKA 3H5NA 4X71A 4AAYA 4C3VA 4IUCS 1JWLA 2O50A 4E2YA 4N65A 2MINA 2H4JA 4KQ1A 4FI3F 5DYWA 1ZM7A 3EUEA 3PA6A 4YJGB 4HUTA 1SQ5A 3DE0X 3H5WA 4HNAB 1NKSA 2PRZA 4CUZA 3MWKA 4LJRA 3ZWBA 4JYZA 4RMIA 1ZK3A 1S6YA 3Q8XB 4M0EA 3D7MA 1UFVA 2IH5A 3AW8A 1EFPB 1Z0JA 4K6HA 2OFWA 4AYWA 2J0SA 1I14A 1IFXA 1OXBB 1XWIA 3O4HA 2PUDA 1TCVA 1PL0A 3WWYA 3O4IA 5A7GA 1E3LA 2B4YA 5BW4A 1GUYA 1PVDA 1CLUA 1P18A 2PZAA 2R47A 4C03A 3RBXA 5CAEA 4J0GA 3LPDA 4G81A 4DF3A 2RHBA 5AI0A 2FQYA 4B2LA 3PI6A 5CX4A 3QXHA 3VXKA 1VB3A 3DUFA 5CITA 2YN4A 2D1YA 1OLOA 4P9NA 3N58A 2IE8A 5IC6A 2WFLA 3BWCA 3EZYA 2ONKA 1T2NA 2W6OA 4OQZA 5IT0A 3LUDA 2BMVA 2OA0A 2YZ7A 3ETJA 2NUBA 2WE7A 2J4FA 3K6JA 3GGPA 1WD5A 2V5VA 5IKEA 3FZQA 1KH3A 3U19A 2W93A 2FP3A 5K51A 4P92A 1A4XA 1YIAA 4KVZA 1UODA 5HGXA 3PEWA 3MELA 3DWGA 3OPYI 3P2YA 4FQ7A 4E4RA 2O1WA 1YS7A 1A9OA 2DCUA 3GMSA 4AXXA 4TZ0A 2IW3A 1KA9H 5JNUA 4OA8A 1ZGAA 3VKFA 3FCOA 1SR8A 4ZI5A 1CS0B 3S70A 1NMEA 2BTQA 3G5UA 3HDVA 3SYRA 2BI8A 3HL4A 3TOZA 3DQZA 1RPJA 4V1CB 4O25A 3DEIA 4Q4AB 4RY2A 3HA2A 4KBGA 3GA7A 1T36B 1NR5A 2PKYX 1DEKA 5IG2A 4P4TA 1O0BA 5DM2A 3KAKA 3VR3A 5I3CA 2A0WA 2QRGA 2GWRA 3K6SA 1EWRA 1CS0A 1AUVA 1II8B 3HK2A 1PL6A 2DWPA 3G85A 4BJHB 2WV7A 2ZJYA 1EU1A 2JAXA 1S3GA 4M87A 4L4RA 1A5BB 1DI0A 4RLSA 1CFJA 5HJ7A 3AG5A 3L0YA 1M0TA 5JMOA 1FMFA 3DB1A 3HJFA 2XUDA 3KD2A 4PANA 4CQMB 3SIPA 5JY1A 5LNK6 2D8AA 5EIBC 4C6TA 3DZ3B 1WUTA 1B41A 3OLZA 5JEDA 4CT0A 3P19A 1WDWB 4LSWA 3VZBA 4MRNA 5F9MA 3A6KA 1NRXA 2WW8A 1YZQA 2XI4A 2WSIA 3W6UA 4ALLA 3BGDA 4OREX 1QBKC 1XGKA 1SA0A 3HACA 1GU1A 4OMCA 3SFVA 2HRCA 2VHUA 4EX6A 3ED1A 3H16A 2GZMA 4EPWA 3TLGA 2QRPA 2MYPA 4LA4A 4N01A 4MRSA 4TL8A 2Q0HA 2X7HA 1OFVA 1TE2A 1WOMA 2MDTA 4JL8A 3CCCA 1RDFA 2XZOA 3QE9Y 3SFZA 3HI6A 2H1SA 3L05A 5JI3E 1G7SA 4DNFA 4WDQA 4QZVA 1JLLB 2YXBA 1C7ZA 3JZDA 4POAA 2XECA 3NNSA 4GECA 1TZJA 2ZU0C 1BDIA 5LUBA 3A6EA 3T7SA 3EXAA 3QMPA 3NW9A 3QA3E 1TGYA 2VCEA 2AN3A 1E7QA 3JQ6A 3QPCA 5F73A 2RGGA 3QK7A 1KS9A 5LXTA 4BDSA 3GK3A 2FG6C 1CXZA 3I4LA 1S0UA 1V5WA 2ZTUA 1UDXA 1SHLA 3SFTA 5E1DA 2XCUA 1P29A 2N9UA 1I24A 1CQJB 3BB3A 3H8SA 3P5BA 2HK8A 5FOTA 3W2IA 4D41A 1ZIXA 1VL0A 4JYPA 5KSZA 2IXTA 3MGGA 2WHPB 2BBTA 3LA8A 5KTOA 1NF9A 4IZ6A 5KNBH 4UM9D 3T1TA 1CRPA 2W6MA 4J2HA 1QVAA 4QLOA 2Q3DA 2FPPB 2A1TR 1OWOA 2ZT7A 4RLFA 1RWNA 1HLGA 2BC9A 3TSOA 1GNVA 4QOHA 5BV7A 1Q20A 5JZMA 2BJHA 5BW8A 2C2WA 1DAMA 2BGRA 2W5UA 3HKDA 4DYHA 1C1XB 1G2OA 4ZYXA 1QSGA 5EQDA 2VA8A 2ONJA 4CM1A 2QORA 2XMZA 3A6JA 2DMRA 3OZRA 2AJBA 1M1YB 4HH4A 4CMEC 1KVRA 2AOXA 5DXJA 2H4XA 2X23A 3QEMB 4BRUA 4NS4A 5EAIA 1WDMA 5CA1F 3OJEA 1OC4A 2C3PA 1CVIA 2AQIA 5CFMA 2F67A 3H4IA 5HKKD 5JZVA 2BTEA 3M6L