1OZPA

Crystal structure of rv0819 from mycobacterium tuberculosis mshd-mycothiol synthase acetyl-coenzyme a complex.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
308
structure length
290
Chain Sequence
ALDWRSALTADEQRSVRALVTATTAVDGVAPVGEQVLRELGQQRTEHLLVAGSRPGGPIIGYLNLSPPGGAMAELVVHPQSRRRGIGTAMARAALAKTAGRNQFWAHGTLDPARATASALGLVGVRELIQMRRPLRDIPEPTIPDGVVIRTYAGTSDDAELLRVNNAAFAGHPEQGGWTAVQLAERRGEAWFDPDGLILAFGDGRLLGFHWTKVHPDHPGLGEVYVLGVDPAAQRRGLGQMLTSIGIVSLARRLVEPAVLLYVESDNVAAVRTYQSLGFTTYSVDTAYAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein Rv0819
publication title Crystal structure of mycothiol synthase (Rv0819) from Mycobacterium tuberculosis shows structural homology to the GNAT family of N-acetyltransferases.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 82
structure length 290
sequence length 308
ec nomenclature ec 2.3.1.189: Mycothiol synthase.
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1ozpA00
1RXTA 3H4QA 1QSMA 2P6GA 3G8WA 3TFYA 1YX0A 3C26A 1YVOA 2IL4A 2Z11A 2G3AA 4NEXA 3FXTA 4IF5A 3TCVA 5IX3A 3B8GA 2FE7A 3G3SA 2G0BA 4KVME 1K4JA 4U9YA 2B3UA 2EVNA 2R7HA 4B5OA 4KLVA 1IYLA 4EVYA 1YLEA 2B4DB 3FIXA 3S6HA 4UWJA 3QAHA 1M4GA 1BOBA 3LODA 2B4DA 2P6EA 4CAVA 3R1KA 3K9UA 2Z10A 4MJ8A 3FRMA 1QSNA 2AJ6A 3R9FA 4KOWA 2KCWA 2FIAA 3GYAA 2R8VA 5H84A 1MK4A 2PQ8A 4PSWA 3SXNA 3PZJA 2CNTA 4YFJA 1QSTA 2JEVA 4KOUA 1UFHA 4ZBGA 3SXOA 3F8KA 1IYKA 2HV2A 5H86A 4JJXA 1PUAA 1Z9UA 1CM0A 2PSWA 3CXSA 3WR7A 2P0WA 4QUSA 4XPDB 2OB0A 3TO6A 2Q04A 2QIRA 4KOTA 1YREA 3TT2A 3I3GA 5ISVA 5C82A 2Q4VA 1PU9A 2ZXVA 4OLLA 4E2AA 2PDOA 4NSQA 4XNHB 1VKCA 2CY2A 3P2HA 1Y9KA 4KVOE 4H6UA 3PP9A 1GHEA 2REEA 1B6BA 3F5BA 3D2MA 2R1IA 4KOYA 4KOVA 4FD4A 3ZJ0A 2Q4YA 4NCZA 1S7LA 2VXKA 4KUBA 4UWIA 4CRYB 2DXQA 4PV6A 3W91A 3E0KA 2FIWA 3BJ8A 4KORA 2ZPAA 4J3GA 4R3KA 2CNSA 3CXQA 4NXYA 4JXRA 2EUIA 4PSXA 3VWEA 1U6MA 1ON0A 4RI1A 4HKFA 4II9A 4XNHC 1XEBA 3D2PA 5F49A 2JLMA 1SQHA 2RC4A 5J8CA 3GY9A 2WPWA 1LRZA 5EBVA 4JLYA 5C88A 3UY5A 3DR8A 3JUWA 3BJ7A 5KTDA 2ZW7A 4R57A 3EO4A 2QMLA 3F0AA 2P6FA 4HNYB 1XMTA 4Y49B 4YGOA 1VHSA 3PGPA 2PR1A 4JD6A 3W6SA 1YR0A 4KLWA 4QBJA 4CRZB 3V8IA 3DDDA 2JDDA 2BUEA 2NMTA 2VEZA 4KOXA 3IWGA 1I21A 2ATRA 4ORFA 5DWMA 2GANA 3TOAA 3MGDA 1NSLA 1QSOA 2OH1A 3DNSA 1V0CA 2B58A 4GS4A 1P0HA 3S6GA 4K30A 2J8RA 2OZUA 1YGHA 3T9YA 4KZTA 3TTHA 2I79A 2D4OA 2F5IA 2VZYA 2PR8A 3IGRA 5EC4A 3FYNA 3SHPA 4MY3A 5F47A 1Q2DA 5CNPA 4E0AA 1N71A 1S7KA 2B4BA 4H89A 3TOBA 1P4NA 4I49A 4E8OA 1B87A 2J8NA 1RO5A 2FSRA 1KUXA 1S7NA 1OZPA 4QC6A 4LX9A 4MHDA 4M85A 1L0CA 1Y7RA 2B3VA 4UBRA 1MJ9A 3CXPA 1XF8A 2PC1A 2FT0A 2Y0MA 3W6XA 2VI7A 3OWCA 3DSBA 1I12A 3TO7A 2X7BA 4JWPA 2GIVA 3VWDA 2ARHA 5HMNA 2FCKA 1YVKA 3EY5A 2Z0ZA 3EXNA 4PK3A 4XPDC 2BSWA 2VZZA 1KUVA 3LD2A 4XPLA 2ZW6A 5JQ4A 5JPHA 2OU2A 2R98A 3R9EA 4DNCA 3S6FA 1Q2CA 3FB3A 2OZHA 5GCNA 1WWZA 4CS0B 4MY0A 2JDCA 1Y9WA 4R9MA 4H6ZA 2CNMA 2ZW5A 3NE7A 5KTAA 1QSRA 1BO4A 1IICA 4OAEA 1S3ZA 4YRHA 5J8FA 2FL4A 2K5TA 1NMTA 4CAXA 5IV0A 4CAWA 4X5KA 4KUAA 4RS2A 3ZZIA 3I9SA 4FD5A 3BLNA 4QB9A 4QVTA 3T90A 4U9ZA 1KZFA 3TO9A 2Q0YA 1YK3A 2O28A 1R57A 3JVNA 2I00A 3RYOA 1M44A 1TIQA 4KOSA 4PK2A 4AVAA 2GE3A 4L8AA 4AB7A 4BMHA 1IIDA 4MBUA 3S6KA 5DWNA 4HNXB 1S7FA 1M1DA 5F48A 3R96A 4XPKA 4Y49C 2PRBA 3QB8A 4L89A 2HUZA 2ZW4A 4AVBA 1NE9A 4F6AA 1KUYA 4IUSA 2D4PA 3FBUA 4AG9A 3D8PA 3GKRA 4F0YA 5KTCA 5E96A 1XIXA 4M3SA 4B5PB 2FXFA 1WK4A 3R95A 2WPXA 2HQYA 3D3SA 2Q44A 2B5GB 2OZGA 4B5PA 2C27A 2QECA 2REFA 2VBQA 1MJBA 3KKWA 4UA3A 4R3LA 4U5YA 2B5GA 1FY7A 2G3TA 3DR6A 4AG7A 2BL1A 1CJWA 3R9GA 4AVCA 4NF1A 4ONUA 5I0CA 4LUAA 1S5KA 1M4DA 3P2FA 2A4NA 2VQYA 2FS5A 5F46A 2Q7BA 3TE4A 4MI4A 1J4JA 2AE6A 2H5MA 5HH1A 5FVJA 1IB1E 1Q2YA 1Z4EA 5IB0A 4FD7A 1S60A 1MJAA 1XE4A 4OADA 3N7ZA 1Z4RA 4FD6A 4HNWB 4JXQA 3EC4A 4R87A 2J8MA 1I1DA 1M4IA 4KVXA 3FNCA 3EFAA 2BEIA
chains in the Genus database with same CATH superfamily
1UWYA 1PYTB 1RXTA 3H4QA 1QSMA 3H8FA 3HLPA 5LYIA 1A2ZA 2P6GA 3G8WA 2NYQA 4XNHB 1TKHA 3TFYA 1YX0A 2PVVA 2V8HA 1YVOA 2GU2A 3C26A 3LWUA 2ZENA 4PXCA 2IL4A 4MFLA 4CYPA 2Z11A 1IOIA 2G3AA 5A27A 3H5ZA 4PXDA 4NEXA 3FXTA 2PRQA 1XJOA 3VH9A 4IF5A 4OMEA 3TCVA 2VL1A 3TC8A 4P4IA 5IX3A 4KS9A 3B8GA 2YNEA 2FE7A 3G3SA 2G0BA 1CP7A 3QAYA 4KVME 1K4JA 4U9YA 4OIDA 4P4EA 2PJ5A 2OR4A 4UIAA 1Z5RA 2B3UA 2EVNA 2EWBA 2R7HA 4MFQA 4B5OA 2CF4A 3CPAA 1PCAA 3JRUA 1IYLA 4KLVA 5AG6A 2PJBA 4FWUA 5HXDA 1DE4C 4LQGA 4IK2A 4TNUA 3CT9A 4EVYA 5J1QA 1F2OA 1YLEA 1YMEA 5D29A 2B4DB 3IFEA 2ZEEA 4F9UA 3FIXA 3FEDA 3S6HA 4UWJA 3QAHA 2DPTA 1M4GA 3KHZA 4OC1A 1BOBA 4W9YA 1TF9A 3NE8A 3LODA 4Z65A 2B4DA 2ZEHA 2P6EA 4CAVA 2AFZA 3R1KA 3K9UA 2JBJA 1H8LA 2Z10A 3NA6A 2DEAA 4MJ8A 3FRMA 4UEFA 1QSNA 4ZI6A 2AJ6A 2ZEOA 4KOWA 3R9FA 4BINA 2KCWA 4G1PA 4R8FA 2FIAA 2F8HA 3B3SA 2AFUA 2IJZA 4UCMA 3SI0A 3GYAA 2R8VA 5G20A 4MFPA 5H84A 1MK4A 4MXUA 2PQ8A 4B5PA 4PSWA 2GLFA 3SXNA 3T8WA 3PZJA 3IJ3A 2CNTA 4YFJA 5LYDA 1QSTA 2JEVA 4KOUA 1UFHA 4ZBGA 3SXOA 3D68A 3F8KA 4EWTA 1IYKA 2HV2A 3HUVA 5H86A 3NH5A 2ZEDA 2O4HA 3IWEA 4P4BA 4JJXA 4OC5A 3RAMA 1PUAA 1Z9UA 1CM0A 2PSWA 3CXSA 3WR7A 1CP6A 3RBUA 2P0WA 4QUSA 4XPDB 2OB0A 4RN7A 5D8NA 3FF3A 4M6IA 3FH4A 3TO6A 2Q04A 4EMEA 1XFOA 1ELLP 2QIRA 5JM6A 4KOTA 4A39A 2AFXA 5I4MA 1YREA 3VATA 3TT2A 3I3GA 4P6YA 2JEWA 5ISVA 2C6PA 5C82A 2Q4VA 1PU9A 2ZXVA 4OLLA 4E2AA 2PDOA 1EE3P 3I1UA 3FMCA 1GYTA 3BI0A 1VKCA 2CY2A 3P2HA 1Y9KA 2PJ1A 3PB6X 4R76A 2CIJA 4X8IA 5HVFA 1TXRA 4MRIA 2PJ4A 4H6UA 4KVOE 4UEZA 1LCPA 3PP9A 1GHEA 2NSMA 4WJBA 3WABA 3S9LA 2REEA 1B6BA 1R43A 3F5BA 3D2MA 2R1IA 5G22A 4KOYA 1BAVA 4KOVA 4R6TA 4NGQA 4A37A 4FD4A 4NJQA 1HDUA 1XRYA 3IO1A 3ZJ0A 2Q4YA 4A30A 4NCZA 4PXBA 5LRGA 2PJCA 4UFXA 1S7LA 2VXKA 4KUBA 4UWIA 2C6CA 2DXQA 4PV6A 3W91A 3E0KA 4CRYB 4CYOA 2FIWA 3BJ8A 4DYOA 1CG2A 4NGRA 1VGYA 4KORA 2ZPAA 2ZOFA 4J3GA 4R3KA 2CNSA 3CXQA 2Z3PA 5AG7A 4NXYA 4JXRA 2EUIA 4PSXA 1YW6A 2PVWA 3TX8A 3VWEA 4CGLA 2AFOA 1CPXA 1U6MA 4MFJA 1ON0A 4RI1A 4HKFA 4II9A 4CGPA 3IU2A 4XNHC 1XEBA 3D2PA 5F49A 2JLMA 1SQHA 4MFZA 1FNOA 2RC4A 3RZAA 1YLOA 4CYQA 5J8CA 1Z8XA 2HB6A 5G1ZA 3GY9A 2AFWA 2QJ8A 2CTCA 2QVPA 2WPWA 1BPNA 4NGSA 3SJFA 1LRZA 5EBVA 4JLYA 5C88A 3PB7X 3UY5A 3DR8A 3JUWA 3BJ7A 4GM5A 2ZW7A 4R57A 3EO4A 5KTDA 2QMLA 4BBHA 3F0AA 2P6FA 4HNYB 3PB8X 1XMTA 4Y49B 4YGOA 1VHSA 4OKOA 4C68A 2Q51A 2ZOGA 5AG5A 3PGPA 3FECA 4KSIA 2PR1A 2JBKA 3ISZA 1TKJA 2PJ9A 4A2ZA 4JD6A 5ELYA 1YR0A 3W6SA 5CBMA 2O53A 2ODFA 4Q36A 4UCNA 4WWVA 1VIXA 4O23A 4KLWA 3CDXA 4UEEA 4B6ZA 4NSQA 2Z3KA 3V8IA 4CRZB 1LANA 4QBJA 3DDDA 5CPAA 4B10A 2JDDA 3WC5A 4P10A 3RO0A 2BUEA 2NMTA 1CPSA 2YNCA 2VEZA 4KOXA 2CXAA 1X10A 2GREA 1Z8WA 4R7MA 3IWGA 3B35A 1I21A 2ATRA 3BXMA 4ORFA 2GANA 4MHYA 3MGDA 5DWMA 3B3TA 1NSLA 3TOAA 2YNDA 1QSOA 2I3CA 2OH1A 3DNSA 4CYNA 1V0CA 2B58A 4GS4A 4X2TA 1P0HA 3S6GA 2YGWA 4UCPA 4K30A 3FEEA 3KL9A 2J8RA 3PEIA 1JWQA 2OZUA 1YGHA 2POKA 1YSJA 1BPMA 4KZTA 2FVGA 4ZX8A 3T9YA 3D7HA 5BWAB 2ZEFA 3TTHA 2I79A 2D4OA 2YNCC 2F5IA 2VZYA 2PR8A 3IGRA 5EC4A 3FYNA 3SHPA 4MY3A 4ZYQA 1AYEA 2ZEGA 1LAMA 2WZNA 5F47A 4CGOA 3CPXA 1Q2DA 1VHOA 2XEJA 1ARLA 5CNPA 3WC6A 4H2KA 4ZY2A 4E0AA 4MCQA 4UIBA 5AG4A 3B3CA 4B14A 2PJ6A 1N71A 4OC2A 1S7KA 3MN8A 4F9VA 2Z3NA 1IU8A 2B4BA 4H89A 4B12A 3GLJA 7CPAA 3PB4X 4FAIA 2BOAA 3RNZA 1KWMA 3TOBA 1P4NA 4I49A 4P45A 4A95A 4E8OA 4F0XA 1S7NA 2J8NA 1RO5A 2FSRA 1KUXA 2EK8A 2GFQA 1B87A 5K8PA 1OZPA 2AFSA 2PIYA 4QC6A 4LX9A 4MHDA 3SJGA 4M85A 1L0CA 4Q38A 1X12A 1Y7RA 2B3VA 4UBRA 4AXVA 2ANPA 3PFEA 1MJ9A 3NH4A 4A32A 3CXPA 4OC0A 1XF8A 1ZO0A 2PC1A 2FT0A 3QNVA 4M6HA 2Y0MA 1M4LA 3W6XA 2VI7A 5F09A 3OWCA 2Z3LA 3LACA 3DSBA 1YQEA 3D7DA 4LQ6A 1I12A 4YWYA 3IC1A 3TO7A 2X7BA 4JWPA 2GIVA 4ZGYB 1R3NA 2ARHA 3D66A 3VARA 3VWDA 5LRJA 5HMNA 1NSAA 2FCKA 3WT4A 1YVKA 4DJLA 3PRTA 2RB7A 3EY5A 3V38A 2DF5A 1ZLHA 2Z0ZA 3KASA 1AUGA 3EXNA 4PK3A 3K2KA 4XPDC 2BSWA 2VZZA 1KUVA 3LD2A 4A94A 4XPLA 2ZW6A 2Q7SA 5JQ4A 3K9TA 4TWEA 5IB9A 2HC9A 2BO9A 4OP4A 4F8ZA 5JPHA 1DTDA 4JYWA 2OU2A 5THWA 2R98A 4NGTA 3R9EA 4DNCA 5HVHA 4PQAA 3S6FA 4P4JA 1Q2CA 3BHXA 3FB3A 1ZLIA 2OZHA 2Z3OA 3IWWA 4NFRA 5GCNA 1WWZA 3KGQA 4MY0A 2PCUA 4CS0B 4MCPA 4OIWA 2JDCA 1Y9WA 4R9MA 3BI1A 4FBEA 4H6ZA 2CNMA 2ZW5A 3NE7A 3KI9A 1AMPA 4UFWA 1QSRA 5KTAA 4MMOA 1IY7A 5K8OA 1BO4A 3S9MA 1LFWA 1IICA 4K3NA 4NGNA 4OAEA 3L2NA 1S3ZA 4YRHA 5J8FA 2FL4A 4C2ZA 4GXHA 2K5TA 1NMTA 4EFDA 4MCSA 3KHXA 2V8VA 1OBRA 4CAXA 4BD9A 4CAWA 4UF4A 4X5KA 5IV0A 4KUAA 4RS2A 3NH8A 2WYRA 3ZZIA 3I9SA 4P44A 4FD5A 2DPSA 3BLNA 4QB9A 2QYVA 1Y7EA 4QVTA 1XMBA 2Q43A 3V7ZA 3T90A 3D67A 2EO8A 4U9ZA 1KZFA 3TO9A 2Q0YA 1YK3A 1IGBA 2C6GA 2O28A 5JGFA 3S9NA 4HPSA 5K8NA 5G21A 1R57A 3JVNA 1LOKA 2I00A 3RYOA 1M44A 4B11A 1TIQA 4RUHA 4KOSA 4PK2A 5EMIA 2GE3A 3FVLA 4L8AA 4MCRA 4AB7A 2XEGA 4AVAA 4BMHA 1IIDA 4MHPA 4MBUA 2G9DA 3S6KA 4UFVA 5DWNA 3MRUA 4HNXB 1HEEA 2WSAA 2PJ0A 1S7FA 1M1DA 5F48A 2Q4ZA 3R96A 4MHZA 4XPKA 3SI1A 4Y49C 4PPZA 2Z3MA 2PRBA 4MHNA 2PJAA 2C1CA 3QB8A 3KQZA 4L89A 4M6GA 1YW4A 2HUZA 4YU9A 4OC4A 3CZXA 2ZW4A 3ISXA 4P4FA 4AVBA 1NE9A 5JH9A 2PJ7A 4F6AA 1KUYA 3B3WA 3KR4A 4IUSA 4KSFA 2D4PA 4ONWA 3FBUA 3SI2A 2EK9A 1Z2LA 4AG9A 3D8PA 2V8GA 3GKRA 2BCOA 4IHMA 4PXEA 3H8EA 4F0YA 3IEHA 4ZY1A 5E96A 5KTCA 1RTQA 2WUUA 1XIXA 4M3SA 4B5PB 2FXFA 5LRKA 1QMUA 1WK4A 2IQ6A 3R95A 1Z8TA 2WPXA 2EBJA 2HQYA 3D3SA 3DGVA 2ZEMA 1CX8A 2PJ8A 2XEFA 2GLJA 2Q44A 3A9LA 4P4DA 2B5GB 2CTBA 2OZGA 1ZG7A 3B7IA 3FJUA 2PIZA 2XEIA 3B2YA 2C27A 3PB9X 2QECA 2REFA 3IU1A 4CGMA 5LYFA 1Y0RA 2VBQA 1MJBA 3KKWA 3KZWA 4R3LA 4UA3A 3IIBA 5AGEA 4ZX9A 2IMOA 2B5GA 1FY7A 4U5YA 3H8GA 4B13A 4C7HA 2G3TA 3DR6A 4C7IA 2F7VA 4A33A 5HVGA 2OOTA 4KSAA 3N5FA 4AG7A 5A28A 3D7GA 4C2YA 2BL1A 1CJWA 3R9GA 4X3RA 1XBUA 4AVCA 4CAEA 1TKFA 4NF1A 3WC7A 1F57A 4NGMA 1Y0YA 6CPAA 4ONUA 5I0CA 4LUAA 4FUUA 2ZEPA 1S5KA 1M4DA 1QQ9A 4MFKA 3P2FA 4NJRA 3GB0A 2A4NA 1F2PA 2FS5A 2VQYA 5F46A 3PFOA 1ELMP 1Z8LA 2Q7BA 4Q7AA 4MI4A 3TE4A 1J4JA 2AE6A 4ZY0A 2H5MA 1BLLE 3D4UA 1HDQA 2J9AA 8CPAA 3D7FA 3SJEA 5HH1A 3PBBA 5FVJA 3GIUA 3DLJA 1IB1E 1Q2YA 1Z4EA 4C2XA 3B3VA 4NGPA 5IB0A 4FD7A 1S60A 4CPAA 1MJAA 1XE4A 3FX6A 3PBEA 2V77A 4OADA 4JZ0A 4OC3A 3GUXA 3N7ZA 3JTKA 3KR5A 1VHEA 3SJXA 4CGNA 1Z4RA 1FT7A 1TF8A 2ZELA 4FD6A 1CBXA 2PJ2A 2V8DA 4HNWB 4JXQA 3EC4A 1LAPA 3LMSA 4A38A 3KQXA 1ZG9A 5DS0A 2PJ3A 4R87A 2AFMA 2J8MA 1XOVA 1ZG8A 1I1DA 5K8MA 1M4IA 2ABZA 4DUKA 5LYLA 1JQGA 4CAFA 1IOFA 1Q7LA 4KVXA 3NFZA 4IAVA 4A31A 2PE3A 2RFHA 3FNCA 3EFAA 2BEIA 1ARMA
chains in the Genus database with same CATH topology
1RXTA 3H4QA 1QSMA 2P6GA 3G8WA 3TFYA 1YX0A 3C26A 1YVOA 2IL4A 4MFLA 4CYPA 2Z11A 2G3AA 5A27A 3H5ZA 4NEXA 3FXTA 4IF5A 3TCVA 5IX3A 4KS9A 3B8GA 2YNEA 2FE7A 3G3SA 2G0BA 4KVME 1K4JA 4U9YA 2B3UA 2EVNA 2R7HA 4MFQA 4B5OA 4KLVA 1IYLA 5AG6A 4EVYA 1YLEA 2B4DB 3FIXA 3S6HA 4UWJA 3QAHA 2DPTA 1M4GA 1BOBA 3LODA 2B4DA 2P6EA 4CAVA 3R1KA 3K9UA 2Z10A 4MJ8A 3FRMA 1QSNA 2AJ6A 3R9FA 4KOWA 2KCWA 2FIAA 4UCMA 3GYAA 2R8VA 5G20A 4MFPA 5H84A 1MK4A 2PQ8A 4PSWA 3SXNA 3PZJA 2CNTA 4YFJA 1QSTA 2JEVA 4KOUA 1UFHA 4ZBGA 3SXOA 3F8KA 1IYKA 2HV2A 5H86A 3IWEA 4JJXA 1PUAA 1Z9UA 1CM0A 2PSWA 3CXSA 3WR7A 2P0WA 4QUSA 4XPDB 2OB0A 3TO6A 2Q04A 2QIRA 4KOTA 1YREA 3TT2A 3I3GA 5ISVA 5C82A 2Q4VA 1PU9A 2ZXVA 4OLLA 4E2AA 2PDOA 4NSQA 4XNHB 1VKCA 2CY2A 3P2HA 1Y9KA 4KVOE 4H6UA 3PP9A 1GHEA 2REEA 1B6BA 3F5BA 5G22A 3D2MA 2R1IA 4KOYA 4KOVA 4FD4A 3ZJ0A 2Q4YA 4A30A 4NCZA 4UFXA 1S7LA 2VXKA 4KUBA 4UWIA 4CRYB 2DXQA 4PV6A 3W91A 3E0KA 4CYOA 2FIWA 3BJ8A 4KORA 2ZPAA 4J3GA 4R3KA 2CNSA 3CXQA 2Z3PA 5AG7A 4NXYA 4JXRA 2EUIA 4PSXA 3VWEA 4CGLA 1U6MA 4MFJA 1ON0A 4RI1A 4HKFA 4II9A 4CGPA 3IU2A 4XNHC 1XEBA 3D2PA 5F49A 2JLMA 1SQHA 4MFZA 2RC4A 4CYQA 5J8CA 5G1ZA 3GY9A 2WPWA 1LRZA 5EBVA 4JLYA 5C88A 3UY5A 3DR8A 3JUWA 3BJ7A 5KTDA 2ZW7A 4R57A 3EO4A 2QMLA 4BBHA 3F0AA 2P6FA 4HNYB 1XMTA 4Y49B 4YGOA 1VHSA 4C68A 5AG5A 3PGPA 2PR1A 4A2ZA 4JD6A 3W6SA 1YR0A 4UCNA 4Q36A 4KLWA 4QBJA 4CRZB 2Z3KA 3V8IA 3DDDA 4B10A 2JDDA 2BUEA 2NMTA 2YNCA 2VEZA 4KOXA 2CXAA 3IWGA 1I21A 2ATRA 4ORFA 5DWMA 2GANA 3TOAA 3MGDA 1NSLA 2YNDA 1QSOA 2OH1A 3DNSA 4CYNA 1V0CA 2B58A 4GS4A 1P0HA 3S6GA 2YGWA 4UCPA 4K30A 2J8RA 2OZUA 1YGHA 3T9YA 4KZTA 5BWAB 3TTHA 2I79A 2D4OA 2YNCC 2F5IA 2VZYA 2PR8A 3IGRA 5EC4A 3FYNA 3SHPA 4MY3A 5F47A 4CGOA 1Q2DA 5CNPA 4E0AA 5AG4A 4B14A 1N71A 1S7KA 2Z3NA 2B4BA 4H89A 4B12A 3TOBA 1P4NA 4I49A 4A95A 4F0XA 4E8OA 1B87A 2J8NA 1RO5A 2FSRA 1KUXA 1S7NA 1OZPA 4QC6A 4LX9A 4MHDA 4M85A 1L0CA 4Q38A 1Y7RA 2B3VA 4UBRA 1MJ9A 4A32A 3CXPA 1XF8A 1ZO0A 2PC1A 2FT0A 2Y0MA 3W6XA 2VI7A 3OWCA 2Z3LA 3DSBA 1I12A 3TO7A 2X7BA 4JWPA 2GIVA 4ZGYB 3VWDA 2ARHA 5HMNA 2FCKA 1YVKA 3EY5A 2Z0ZA 3EXNA 4PK3A 4XPDC 2BSWA 2VZZA 1KUVA 3LD2A 4XPLA 2ZW6A 5JQ4A 5JPHA 2OU2A 2R98A 3R9EA 4DNCA 3S6FA 1Q2CA 3FB3A 2OZHA 2Z3OA 5GCNA 1WWZA 4CS0B 4MY0A 2JDCA 1Y9WA 4R9MA 4H6ZA 2CNMA 2ZW5A 3NE7A 4UFWA 1QSRA 5KTAA 1BO4A 1IICA 4OAEA 1S3ZA 4YRHA 5J8FA 2FL4A 4C2ZA 2K5TA 1NMTA 4CAXA 5IV0A 4CAWA 4X5KA 4KUAA 4RS2A 3ZZIA 3I9SA 4FD5A 2DPSA 3BLNA 4QB9A 4QVTA 3T90A 4U9ZA 1KZFA 3TO9A 2Q0YA 1YK3A 2O28A 5G21A 1R57A 3JVNA 2I00A 3RYOA 1M44A 4B11A 1TIQA 4KOSA 4PK2A 4AVAA 2GE3A 4L8AA 4AB7A 4BMHA 1IIDA 4MBUA 3S6KA 4UFVA 5DWNA 4HNXB 2WSAA 1S7FA 1M1DA 5F48A 3R96A 4XPKA 4Y49C 2Z3MA 2PRBA 3QB8A 4L89A 2HUZA 2ZW4A 4AVBA 1NE9A 4F6AA 1KUYA 4IUSA 4KSFA 2D4PA 3FBUA 4AG9A 3D8PA 3GKRA 4F0YA 5KTCA 5E96A 2WUUA 1XIXA 4M3SA 4B5PB 2FXFA 1WK4A 3R95A 2WPXA 2HQYA 3D3SA 3A9LA 2Q44A 2B5GB 2OZGA 4B5PA 2C27A 4CGMA 2QECA 2REFA 3IU1A 2VBQA 1MJBA 3KKWA 4UA3A 4R3LA 5AGEA 4B13A 4U5YA 2B5GA 1FY7A 4C7HA 2G3TA 3DR6A 4C7IA 4A33A 4KSAA 4AG7A 5A28A 4C2YA 2BL1A 1CJWA 3R9GA 4AVCA 4CAEA 4NF1A 4ONUA 5I0CA 4LUAA 1S5KA 1M4DA 4MFKA 3P2FA 2A4NA 2VQYA 2FS5A 5F46A 2Q7BA 3TE4A 4MI4A 1J4JA 2AE6A 2H5MA 5HH1A 5FVJA 1IB1E 1Q2YA 1Z4EA 4C2XA 5IB0A 4FD7A 1S60A 1MJAA 1XE4A 4OADA 3N7ZA 3JTKA 4CGNA 1Z4RA 4FD6A 4HNWB 4JXQA 3EC4A 4R87A 2J8MA 1I1DA 1M4IA 4CAFA 4KVXA 4A31A 3FNCA 3EFAA 2BEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RXT A;  3H4Q A;  1QSM A;  2P6G A;  3G8W A;  3TFY A;  1YX0 A;  3C26 A;  1YVO A;  2IL4 A;  2Z11 A;  2G3A A;  4NEX A;  3FXT A;  4IF5 A;  3TCV A;  5IX3 A;  3B8G A;  2FE7 A;  3G3S A;  2G0B A;  4KVM E;  1K4J A;  4U9Y A;  2B3U A;  2EVN A;  2R7H A;  4B5O A;  4KLV A;  1IYL A;  4EVY A;  1YLE A;  2B4D B;  3FIX A;  3S6H A;  4UWJ A;  3QAH A;  1M4G A;  1BOB A;  3LOD A;  2B4D A;  2P6E A;  4CAV A;  3R1K A;  3K9U A;  2Z10 A;  4MJ8 A;  3FRM A;  1QSN A;  2AJ6 A;  3R9F A;  4KOW A;  2KCW A;  2FIA A;  3GYA A;  2R8V A;  5H84 A;  1MK4 A;  2PQ8 A;  4PSW A;  3SXN A;  3PZJ A;  2CNT A;  4YFJ A;  1QST A;  2JEV A;  4KOU A;  1UFH A;  4ZBG A;  3SXO A;  3F8K A;  1IYK A;  2HV2 A;  5H86 A;  4JJX A;  1PUA A;  1Z9U A;  1CM0 A;  2PSW A;  3CXS A;  3WR7 A;  2P0W A;  4QUS A;  4XPD B;  2OB0 A;  3TO6 A;  2Q04 A;  2QIR A;  4KOT A;  1YRE A;  3TT2 A;  3I3G A;  5ISV A;  5C82 A;  2Q4V A;  1PU9 A;  2ZXV A;  4OLL A;  4E2A A;  2PDO A;  4NSQ A;  4XNH B;  1VKC A;  2CY2 A;  3P2H A;  1Y9K A;  4KVO E;  4H6U A;  3PP9 A;  1GHE A;  2REE A;  1B6B A;  3F5B A;  3D2M A;  2R1I A;  4KOY A;  4KOV A;  4FD4 A;  3ZJ0 A;  2Q4Y A;  4NCZ A;  1S7L A;  2VXK A;  4KUB A;  4UWI A;  4CRY B;  2DXQ A;  4PV6 A;  3W91 A;  3E0K A;  2FIW A;  3BJ8 A;  4KOR A;  2ZPA A;  4J3G A;  4R3K A;  2CNS A;  3CXQ A;  4NXY A;  4JXR A;  2EUI A;  4PSX A;  3VWE A;  1U6M A;  1ON0 A;  4RI1 A;  4HKF A;  4II9 A;  4XNH C;  1XEB A;  3D2P A;  5F49 A;  2JLM A;  1SQH A;  2RC4 A;  5J8C A;  3GY9 A;  2WPW A;  1LRZ A;  5EBV A;  4JLY A;  5C88 A;  3UY5 A;  3DR8 A;  3JUW A;  3BJ7 A;  5KTD A;  2ZW7 A;  4R57 A;  3EO4 A;  2QML A;  3F0A A;  2P6F A;  4HNY B;  1XMT A;  4Y49 B;  4YGO A;  1VHS A;  3PGP A;  2PR1 A;  4JD6 A;  3W6S A;  1YR0 A;  4KLW A;  4QBJ A;  4CRZ B;  3V8I A;  3DDD A;  2JDD A;  2BUE A;  2NMT A;  2VEZ A;  4KOX A;  3IWG A;  1I21 A;  2ATR A;  4ORF A;  5DWM A;  2GAN A;  3TOA A;  3MGD A;  1NSL A;  1QSO A;  2OH1 A;  3DNS A;  1V0C A;  2B58 A;  4GS4 A;  1P0H A;  3S6G A;  4K30 A;  2J8R A;  2OZU A;  1YGH A;  3T9Y A;  4KZT A;  3TTH A;  2I79 A;  2D4O A;  2F5I A;  2VZY A;  2PR8 A;  3IGR A;  5EC4 A;  3FYN A;  3SHP A;  4MY3 A;  5F47 A;  1Q2D A;  5CNP A;  4E0A A;  1N71 A;  1S7K A;  2B4B A;  4H89 A;  3TOB A;  1P4N A;  4I49 A;  4E8O A;  1B87 A;  2J8N A;  1RO5 A;  2FSR A;  1KUX A;  1S7N A;  1OZP A;  4QC6 A;  4LX9 A;  4MHD A;  4M85 A;  1L0C A;  1Y7R A;  2B3V A;  4UBR A;  1MJ9 A;  3CXP A;  1XF8 A;  2PC1 A;  2FT0 A;  2Y0M A;  3W6X A;  2VI7 A;  3OWC A;  3DSB A;  1I12 A;  3TO7 A;  2X7B A;  4JWP A;  2GIV A;  3VWD A;  2ARH A;  5HMN A;  2FCK A;  1YVK A;  3EY5 A;  2Z0Z A;  3EXN A;  4PK3 A;  4XPD C;  2BSW A;  2VZZ A;  1KUV A;  3LD2 A;  4XPL A;  2ZW6 A;  5JQ4 A;  5JPH A;  2OU2 A;  2R98 A;  3R9E A;  4DNC A;  3S6F A;  1Q2C A;  3FB3 A;  2OZH A;  5GCN A;  1WWZ A;  4CS0 B;  4MY0 A;  2JDC A;  1Y9W A;  4R9M A;  4H6Z A;  2CNM A;  2ZW5 A;  3NE7 A;  5KTA A;  1QSR A;  1BO4 A;  1IIC A;  4OAE A;  1S3Z A;  4YRH A;  5J8F A;  2FL4 A;  2K5T A;  1NMT A;  4CAX A;  5IV0 A;  4CAW A;  4X5K A;  4KUA A;  4RS2 A;  3ZZI A;  3I9S A;  4FD5 A;  3BLN A;  4QB9 A;  4QVT A;  3T90 A;  4U9Z A;  1KZF A;  3TO9 A;  2Q0Y A;  1YK3 A;  2O28 A;  1R57 A;  3JVN A;  2I00 A;  3RYO A;  1M44 A;  1TIQ A;  4KOS A;  4PK2 A;  4AVA A;  2GE3 A;  4L8A A;  4AB7 A;  4BMH A;  1IID A;  4MBU A;  3S6K A;  5DWN A;  4HNX B;  1S7F A;  1M1D A;  5F48 A;  3R96 A;  4XPK A;  4Y49 C;  2PRB A;  3QB8 A;  4L89 A;  2HUZ A;  2ZW4 A;  4AVB A;  1NE9 A;  4F6A A;  1KUY A;  4IUS A;  2D4P A;  3FBU A;  4AG9 A;  3D8P A;  3GKR A;  4F0Y A;  5KTC A;  5E96 A;  1XIX A;  4M3S A;  4B5P B;  2FXF A;  1WK4 A;  3R95 A;  2WPX A;  2HQY A;  3D3S A;  2Q44 A;  2B5G B;  2OZG A;  4B5P A;  2C27 A;  2QEC A;  2REF A;  2VBQ A;  1MJB A;  3KKW A;  4UA3 A;  4R3L A;  4U5Y A;  2B5G A;  1FY7 A;  2G3T A;  3DR6 A;  4AG7 A;  2BL1 A;  1CJW A;  3R9G A;  4AVC A;  4NF1 A;  4ONU A;  5I0C A;  4LUA A;  1S5K A;  1M4D A;  3P2F A;  2A4N A;  2VQY A;  2FS5 A;  5F46 A;  2Q7B A;  3TE4 A;  4MI4 A;  1J4J A;  2AE6 A;  2H5M A;  5HH1 A;  5FVJ A;  1IB1 E;  1Q2Y A;  1Z4E A;  5IB0 A;  4FD7 A;  1S60 A;  1MJA A;  1XE4 A;  4OAD A;  3N7Z A;  1Z4R A;  4FD6 A;  4HNW B;  4JXQ A;  3EC4 A;  4R87 A;  2J8M A;  1I1D A;  1M4I A;  4KVX A;  3FNC A;  3EFA A;  2BEI A; 
#chains in the Genus database with same CATH topology
 1UWY A;  1PYT B;  1RXT A;  3H4Q A;  1QSM A;  3H8F A;  3HLP A;  5LYI A;  1A2Z A;  2P6G A;  3G8W A;  2NYQ A;  4XNH B;  1TKH A;  3TFY A;  1YX0 A;  2PVV A;  2V8H A;  1YVO A;  2GU2 A;  3C26 A;  3LWU A;  2ZEN A;  4PXC A;  2IL4 A;  4MFL A;  4CYP A;  2Z11 A;  1IOI A;  2G3A A;  5A27 A;  3H5Z A;  4PXD A;  4NEX A;  3FXT A;  2PRQ A;  1XJO A;  3VH9 A;  4IF5 A;  4OME A;  3TCV A;  2VL1 A;  3TC8 A;  4P4I A;  5IX3 A;  4KS9 A;  3B8G A;  2YNE A;  2FE7 A;  3G3S A;  2G0B A;  1CP7 A;  3QAY A;  4KVM E;  1K4J A;  4U9Y A;  4OID A;  4P4E A;  2PJ5 A;  2OR4 A;  4UIA A;  1Z5R A;  2B3U A;  2EVN A;  2EWB A;  2R7H A;  4MFQ A;  4B5O A;  2CF4 A;  3CPA A;  1PCA A;  3JRU A;  1IYL A;  4KLV A;  5AG6 A;  2PJB A;  4FWU A;  5HXD A;  1DE4 C;  4LQG A;  4IK2 A;  4TNU A;  3CT9 A;  4EVY A;  5J1Q A;  1F2O A;  1YLE A;  1YME A;  5D29 A;  2B4D B;  3IFE A;  2ZEE A;  4F9U A;  3FIX A;  3FED A;  3S6H A;  4UWJ A;  3QAH A;  2DPT A;  1M4G A;  3KHZ A;  4OC1 A;  1BOB A;  4W9Y A;  1TF9 A;  3NE8 A;  3LOD A;  4Z65 A;  2B4D A;  2ZEH A;  2P6E A;  4CAV A;  2AFZ A;  3R1K A;  3K9U A;  2JBJ A;  1H8L A;  2Z10 A;  3NA6 A;  2DEA A;  4MJ8 A;  3FRM A;  4UEF A;  1QSN A;  4ZI6 A;  2AJ6 A;  2ZEO A;  4KOW A;  3R9F A;  4BIN A;  2KCW A;  4G1P A;  4R8F A;  2FIA A;  2F8H A;  3B3S A;  2AFU A;  2IJZ A;  4UCM A;  3SI0 A;  3GYA A;  2R8V A;  5G20 A;  4MFP A;  5H84 A;  1MK4 A;  4MXU A;  2PQ8 A;  4B5P A;  4PSW A;  2GLF A;  3SXN A;  3T8W A;  3PZJ A;  3IJ3 A;  2CNT A;  4YFJ A;  5LYD A;  1QST A;  2JEV A;  4KOU A;  1UFH A;  4ZBG A;  3SXO A;  3D68 A;  3F8K A;  4EWT A;  1IYK A;  2HV2 A;  3HUV A;  5H86 A;  3NH5 A;  2ZED A;  2O4H A;  3IWE A;  4P4B A;  4JJX A;  4OC5 A;  3RAM A;  1PUA A;  1Z9U A;  1CM0 A;  2PSW A;  3CXS A;  3WR7 A;  1CP6 A;  3RBU A;  2P0W A;  4QUS A;  4XPD B;  2OB0 A;  4RN7 A;  5D8N A;  3FF3 A;  4M6I A;  3FH4 A;  3TO6 A;  2Q04 A;  4EME A;  1XFO A;  1ELL P;  2QIR A;  5JM6 A;  4KOT A;  4A39 A;  2AFX A;  5I4M A;  1YRE A;  3VAT A;  3TT2 A;  3I3G A;  4P6Y A;  2JEW A;  5ISV A;  2C6P A;  5C82 A;  2Q4V A;  1PU9 A;  2ZXV A;  4OLL A;  4E2A A;  2PDO A;  1EE3 P;  3I1U A;  3FMC A;  1GYT A;  3BI0 A;  1VKC A;  2CY2 A;  3P2H A;  1Y9K A;  2PJ1 A;  3PB6 X;  4R76 A;  2CIJ A;  4X8I A;  5HVF A;  1TXR A;  4MRI A;  2PJ4 A;  4H6U A;  4KVO E;  4UEZ A;  1LCP A;  3PP9 A;  1GHE A;  2NSM A;  4WJB A;  3WAB A;  3S9L A;  2REE A;  1B6B A;  1R43 A;  3F5B A;  3D2M A;  2R1I A;  5G22 A;  4KOY A;  1BAV A;  4KOV A;  4R6T A;  4NGQ A;  4A37 A;  4FD4 A;  4NJQ A;  1HDU A;  1XRY A;  3IO1 A;  3ZJ0 A;  2Q4Y A;  4A30 A;  4NCZ A;  4PXB A;  5LRG A;  2PJC A;  4UFX A;  1S7L A;  2VXK A;  4KUB A;  4UWI A;  2C6C A;  2DXQ A;  4PV6 A;  3W91 A;  3E0K A;  4CRY B;  4CYO A;  2FIW A;  3BJ8 A;  4DYO A;  1CG2 A;  4NGR A;  1VGY A;  4KOR A;  2ZPA A;  2ZOF A;  4J3G A;  4R3K A;  2CNS A;  3CXQ A;  2Z3P A;  5AG7 A;  4NXY A;  4JXR A;  2EUI A;  4PSX A;  1YW6 A;  2PVW A;  3TX8 A;  3VWE A;  4CGL A;  2AFO A;  1CPX A;  1U6M A;  4MFJ A;  1ON0 A;  4RI1 A;  4HKF A;  4II9 A;  4CGP A;  3IU2 A;  4XNH C;  1XEB A;  3D2P A;  5F49 A;  2JLM A;  1SQH A;  4MFZ A;  1FNO A;  2RC4 A;  3RZA A;  1YLO A;  4CYQ A;  5J8C A;  1Z8X A;  2HB6 A;  5G1Z A;  3GY9 A;  2AFW A;  2QJ8 A;  2CTC A;  2QVP A;  2WPW A;  1BPN A;  4NGS A;  3SJF A;  1LRZ A;  5EBV A;  4JLY A;  5C88 A;  3PB7 X;  3UY5 A;  3DR8 A;  3JUW A;  3BJ7 A;  4GM5 A;  2ZW7 A;  4R57 A;  3EO4 A;  5KTD A;  2QML A;  4BBH A;  3F0A A;  2P6F A;  4HNY B;  3PB8 X;  1XMT A;  4Y49 B;  4YGO A;  1VHS A;  4OKO A;  4C68 A;  2Q51 A;  2ZOG A;  5AG5 A;  3PGP A;  3FEC A;  4KSI A;  2PR1 A;  2JBK A;  3ISZ A;  1TKJ A;  2PJ9 A;  4A2Z A;  4JD6 A;  5ELY A;  1YR0 A;  3W6S A;  5CBM A;  2O53 A;  2ODF A;  4Q36 A;  4UCN A;  4WWV A;  1VIX A;  4O23 A;  4KLW A;  3CDX A;  4UEE A;  4B6Z A;  4NSQ A;  2Z3K A;  3V8I A;  4CRZ B;  1LAN A;  4QBJ A;  3DDD A;  5CPA A;  4B10 A;  2JDD A;  3WC5 A;  4P10 A;  3RO0 A;  2BUE A;  2NMT A;  1CPS A;  2YNC A;  2VEZ A;  4KOX A;  2CXA A;  1X10 A;  2GRE A;  1Z8W A;  4R7M A;  3IWG A;  3B35 A;  1I21 A;  2ATR A;  3BXM A;  4ORF A;  2GAN A;  4MHY A;  3MGD A;  5DWM A;  3B3T A;  1NSL A;  3TOA A;  2YND A;  1QSO A;  2I3C A;  2OH1 A;  3DNS A;  4CYN A;  1V0C A;  2B58 A;  4GS4 A;  4X2T A;  1P0H A;  3S6G A;  2YGW A;  4UCP A;  4K30 A;  3FEE A;  3KL9 A;  2J8R A;  3PEI A;  1JWQ A;  2OZU A;  1YGH A;  2POK A;  1YSJ A;  1BPM A;  4KZT A;  2FVG A;  4ZX8 A;  3T9Y A;  3D7H A;  5BWA B;  2ZEF A;  3TTH A;  2I79 A;  2D4O A;  2YNC C;  2F5I A;  2VZY A;  2PR8 A;  3IGR A;  5EC4 A;  3FYN A;  3SHP A;  4MY3 A;  4ZYQ A;  1AYE A;  2ZEG A;  1LAM A;  2WZN A;  5F47 A;  4CGO A;  3CPX A;  1Q2D A;  1VHO A;  2XEJ A;  1ARL A;  5CNP A;  3WC6 A;  4H2K A;  4ZY2 A;  4E0A A;  4MCQ A;  4UIB A;  5AG4 A;  3B3C A;  4B14 A;  2PJ6 A;  1N71 A;  4OC2 A;  1S7K A;  3MN8 A;  4F9V A;  2Z3N A;  1IU8 A;  2B4B A;  4H89 A;  4B12 A;  3GLJ A;  7CPA A;  3PB4 X;  4FAI A;  2BOA A;  3RNZ A;  1KWM A;  3TOB A;  1P4N A;  4I49 A;  4P45 A;  4A95 A;  4E8O A;  4F0X A;  1S7N A;  2J8N A;  1RO5 A;  2FSR A;  1KUX A;  2EK8 A;  2GFQ A;  1B87 A;  5K8P A;  1OZP A;  2AFS A;  2PIY A;  4QC6 A;  4LX9 A;  4MHD A;  3SJG A;  4M85 A;  1L0C A;  4Q38 A;  1X12 A;  1Y7R A;  2B3V A;  4UBR A;  4AXV A;  2ANP A;  3PFE A;  1MJ9 A;  3NH4 A;  4A32 A;  3CXP A;  4OC0 A;  1XF8 A;  1ZO0 A;  2PC1 A;  2FT0 A;  3QNV A;  4M6H A;  2Y0M A;  1M4L A;  3W6X A;  2VI7 A;  5F09 A;  3OWC A;  2Z3L A;  3LAC A;  3DSB A;  1YQE A;  3D7D A;  4LQ6 A;  1I12 A;  4YWY A;  3IC1 A;  3TO7 A;  2X7B A;  4JWP A;  2GIV A;  4ZGY B;  1R3N A;  2ARH A;  3D66 A;  3VAR A;  3VWD A;  5LRJ A;  5HMN A;  1NSA A;  2FCK A;  3WT4 A;  1YVK A;  4DJL A;  3PRT A;  2RB7 A;  3EY5 A;  3V38 A;  2DF5 A;  1ZLH A;  2Z0Z A;  3KAS A;  1AUG A;  3EXN A;  4PK3 A;  3K2K A;  4XPD C;  2BSW A;  2VZZ A;  1KUV A;  3LD2 A;  4A94 A;  4XPL A;  2ZW6 A;  2Q7S A;  5JQ4 A;  3K9T A;  4TWE A;  5IB9 A;  2HC9 A;  2BO9 A;  4OP4 A;  4F8Z A;  5JPH A;  1DTD A;  4JYW A;  2OU2 A;  5THW A;  2R98 A;  4NGT A;  3R9E A;  4DNC A;  5HVH A;  4PQA A;  3S6F A;  4P4J A;  1Q2C A;  3BHX A;  3FB3 A;  1ZLI A;  2OZH A;  2Z3O A;  3IWW A;  4NFR A;  5GCN A;  1WWZ A;  3KGQ A;  4MY0 A;  2PCU A;  4CS0 B;  4MCP A;  4OIW A;  2JDC A;  1Y9W A;  4R9M A;  3BI1 A;  4FBE A;  4H6Z A;  2CNM A;  2ZW5 A;  3NE7 A;  3KI9 A;  1AMP A;  4UFW A;  1QSR A;  5KTA A;  4MMO A;  1IY7 A;  5K8O A;  1BO4 A;  3S9M A;  1LFW A;  1IIC A;  4K3N A;  4NGN A;  4OAE A;  3L2N A;  1S3Z A;  4YRH A;  5J8F A;  2FL4 A;  4C2Z A;  4GXH A;  2K5T A;  1NMT A;  4EFD A;  4MCS A;  3KHX A;  2V8V A;  1OBR A;  4CAX A;  4BD9 A;  4CAW A;  4UF4 A;  4X5K A;  5IV0 A;  4KUA A;  4RS2 A;  3NH8 A;  2WYR A;  3ZZI A;  3I9S A;  4P44 A;  4FD5 A;  2DPS A;  3BLN A;  4QB9 A;  2QYV A;  1Y7E A;  4QVT A;  1XMB A;  2Q43 A;  3V7Z A;  3T90 A;  3D67 A;  2EO8 A;  4U9Z A;  1KZF A;  3TO9 A;  2Q0Y A;  1YK3 A;  1IGB A;  2C6G A;  2O28 A;  5JGF A;  3S9N A;  4HPS A;  5K8N A;  5G21 A;  1R57 A;  3JVN A;  1LOK A;  2I00 A;  3RYO A;  1M44 A;  4B11 A;  1TIQ A;  4RUH A;  4KOS A;  4PK2 A;  5EMI A;  2GE3 A;  3FVL A;  4L8A A;  4MCR A;  4AB7 A;  2XEG A;  4AVA A;  4BMH A;  1IID A;  4MHP A;  4MBU A;  2G9D A;  3S6K A;  4UFV A;  5DWN A;  3MRU A;  4HNX B;  1HEE A;  2WSA A;  2PJ0 A;  1S7F A;  1M1D A;  5F48 A;  2Q4Z A;  3R96 A;  4MHZ A;  4XPK A;  3SI1 A;  4Y49 C;  4PPZ A;  2Z3M A;  2PRB A;  4MHN A;  2PJA A;  2C1C A;  3QB8 A;  3KQZ A;  4L89 A;  4M6G A;  1YW4 A;  2HUZ A;  4YU9 A;  4OC4 A;  3CZX A;  2ZW4 A;  3ISX A;  4P4F A;  4AVB A;  1NE9 A;  5JH9 A;  2PJ7 A;  4F6A A;  1KUY A;  3B3W A;  3KR4 A;  4IUS A;  4KSF A;  2D4P A;  4ONW A;  3FBU A;  3SI2 A;  2EK9 A;  1Z2L A;  4AG9 A;  3D8P A;  2V8G A;  3GKR A;  2BCO A;  4IHM A;  4PXE A;  3H8E A;  4F0Y A;  3IEH A;  4ZY1 A;  5E96 A;  5KTC A;  1RTQ A;  2WUU A;  1XIX A;  4M3S A;  4B5P B;  2FXF A;  5LRK A;  1QMU A;  1WK4 A;  2IQ6 A;  3R95 A;  1Z8T A;  2WPX A;  2EBJ A;  2HQY A;  3D3S A;  3DGV A;  2ZEM A;  1CX8 A;  2PJ8 A;  2XEF A;  2GLJ A;  2Q44 A;  3A9L A;  4P4D A;  2B5G B;  2CTB A;  2OZG A;  1ZG7 A;  3B7I A;  3FJU A;  2PIZ A;  2XEI A;  3B2Y A;  2C27 A;  3PB9 X;  2QEC A;  2REF A;  3IU1 A;  4CGM A;  5LYF A;  1Y0R A;  2VBQ A;  1MJB A;  3KKW A;  3KZW A;  4R3L A;  4UA3 A;  3IIB A;  5AGE A;  4ZX9 A;  2IMO A;  2B5G A;  1FY7 A;  4U5Y A;  3H8G A;  4B13 A;  4C7H A;  2G3T A;  3DR6 A;  4C7I A;  2F7V A;  4A33 A;  5HVG A;  2OOT A;  4KSA A;  3N5F A;  4AG7 A;  5A28 A;  3D7G A;  4C2Y A;  2BL1 A;  1CJW A;  3R9G A;  4X3R A;  1XBU A;  4AVC A;  4CAE A;  1TKF A;  4NF1 A;  3WC7 A;  1F57 A;  4NGM A;  1Y0Y A;  6CPA A;  4ONU A;  5I0C A;  4LUA A;  4FUU A;  2ZEP A;  1S5K A;  1M4D A;  1QQ9 A;  4MFK A;  3P2F A;  4NJR A;  3GB0 A;  2A4N A;  1F2P A;  2FS5 A;  2VQY A;  5F46 A;  3PFO A;  1ELM P;  1Z8L A;  2Q7B A;  4Q7A A;  4MI4 A;  3TE4 A;  1J4J A;  2AE6 A;  4ZY0 A;  2H5M A;  1BLL E;  3D4U A;  1HDQ A;  2J9A A;  8CPA A;  3D7F A;  3SJE A;  5HH1 A;  3PBB A;  5FVJ A;  3GIU A;  3DLJ A;  1IB1 E;  1Q2Y A;  1Z4E A;  4C2X A;  3B3V A;  4NGP A;  5IB0 A;  4FD7 A;  1S60 A;  4CPA A;  1MJA A;  1XE4 A;  3FX6 A;  3PBE A;  2V77 A;  4OAD A;  4JZ0 A;  4OC3 A;  3GUX A;  3N7Z A;  3JTK A;  3KR5 A;  1VHE A;  3SJX A;  4CGN A;  1Z4R A;  1FT7 A;  1TF8 A;  2ZEL A;  4FD6 A;  1CBX A;  2PJ2 A;  2V8D A;  4HNW B;  4JXQ A;  3EC4 A;  1LAP A;  3LMS A;  4A38 A;  3KQX A;  1ZG9 A;  5DS0 A;  2PJ3 A;  4R87 A;  2AFM A;  2J8M A;  1XOV A;  1ZG8 A;  1I1D A;  5K8M A;  1M4I A;  2ABZ A;  4DUK A;  5LYL A;  1JQG A;  4CAF A;  1IOF A;  1Q7L A;  4KVX A;  3NFZ A;  4IAV A;  4A31 A;  2PE3 A;  2RFH A;  3FNC A;  3EFA A;  2BEI A;  1ARM A; 
#chains in the Genus database with same CATH homology
 1RXT A;  3H4Q A;  1QSM A;  2P6G A;  3G8W A;  3TFY A;  1YX0 A;  3C26 A;  1YVO A;  2IL4 A;  4MFL A;  4CYP A;  2Z11 A;  2G3A A;  5A27 A;  3H5Z A;  4NEX A;  3FXT A;  4IF5 A;  3TCV A;  5IX3 A;  4KS9 A;  3B8G A;  2YNE A;  2FE7 A;  3G3S A;  2G0B A;  4KVM E;  1K4J A;  4U9Y A;  2B3U A;  2EVN A;  2R7H A;  4MFQ A;  4B5O A;  4KLV A;  1IYL A;  5AG6 A;  4EVY A;  1YLE A;  2B4D B;  3FIX A;  3S6H A;  4UWJ A;  3QAH A;  2DPT A;  1M4G A;  1BOB A;  3LOD A;  2B4D A;  2P6E A;  4CAV A;  3R1K A;  3K9U A;  2Z10 A;  4MJ8 A;  3FRM A;  1QSN A;  2AJ6 A;  3R9F A;  4KOW A;  2KCW A;  2FIA A;  4UCM A;  3GYA A;  2R8V A;  5G20 A;  4MFP A;  5H84 A;  1MK4 A;  2PQ8 A;  4PSW A;  3SXN A;  3PZJ A;  2CNT A;  4YFJ A;  1QST A;  2JEV A;  4KOU A;  1UFH A;  4ZBG A;  3SXO A;  3F8K A;  1IYK A;  2HV2 A;  5H86 A;  3IWE A;  4JJX A;  1PUA A;  1Z9U A;  1CM0 A;  2PSW A;  3CXS A;  3WR7 A;  2P0W A;  4QUS A;  4XPD B;  2OB0 A;  3TO6 A;  2Q04 A;  2QIR A;  4KOT A;  1YRE A;  3TT2 A;  3I3G A;  5ISV A;  5C82 A;  2Q4V A;  1PU9 A;  2ZXV A;  4OLL A;  4E2A A;  2PDO A;  4NSQ A;  4XNH B;  1VKC A;  2CY2 A;  3P2H A;  1Y9K A;  4KVO E;  4H6U A;  3PP9 A;  1GHE A;  2REE A;  1B6B A;  3F5B A;  5G22 A;  3D2M A;  2R1I A;  4KOY A;  4KOV A;  4FD4 A;  3ZJ0 A;  2Q4Y A;  4A30 A;  4NCZ A;  4UFX A;  1S7L A;  2VXK A;  4KUB A;  4UWI A;  4CRY B;  2DXQ A;  4PV6 A;  3W91 A;  3E0K A;  4CYO A;  2FIW A;  3BJ8 A;  4KOR A;  2ZPA A;  4J3G A;  4R3K A;  2CNS A;  3CXQ A;  2Z3P A;  5AG7 A;  4NXY A;  4JXR A;  2EUI A;  4PSX A;  3VWE A;  4CGL A;  1U6M A;  4MFJ A;  1ON0 A;  4RI1 A;  4HKF A;  4II9 A;  4CGP A;  3IU2 A;  4XNH C;  1XEB A;  3D2P A;  5F49 A;  2JLM A;  1SQH A;  4MFZ A;  2RC4 A;  4CYQ A;  5J8C A;  5G1Z A;  3GY9 A;  2WPW A;  1LRZ A;  5EBV A;  4JLY A;  5C88 A;  3UY5 A;  3DR8 A;  3JUW A;  3BJ7 A;  5KTD A;  2ZW7 A;  4R57 A;  3EO4 A;  2QML A;  4BBH A;  3F0A A;  2P6F A;  4HNY B;  1XMT A;  4Y49 B;  4YGO A;  1VHS A;  4C68 A;  5AG5 A;  3PGP A;  2PR1 A;  4A2Z A;  4JD6 A;  3W6S A;  1YR0 A;  4UCN A;  4Q36 A;  4KLW A;  4QBJ A;  4CRZ B;  2Z3K A;  3V8I A;  3DDD A;  4B10 A;  2JDD A;  2BUE A;  2NMT A;  2YNC A;  2VEZ A;  4KOX A;  2CXA A;  3IWG A;  1I21 A;  2ATR A;  4ORF A;  5DWM A;  2GAN A;  3TOA A;  3MGD A;  1NSL A;  2YND A;  1QSO A;  2OH1 A;  3DNS A;  4CYN A;  1V0C A;  2B58 A;  4GS4 A;  1P0H A;  3S6G A;  2YGW A;  4UCP A;  4K30 A;  2J8R A;  2OZU A;  1YGH A;  3T9Y A;  4KZT A;  5BWA B;  3TTH A;  2I79 A;  2D4O A;  2YNC C;  2F5I A;  2VZY A;  2PR8 A;  3IGR A;  5EC4 A;  3FYN A;  3SHP A;  4MY3 A;  5F47 A;  4CGO A;  1Q2D A;  5CNP A;  4E0A A;  5AG4 A;  4B14 A;  1N71 A;  1S7K A;  2Z3N A;  2B4B A;  4H89 A;  4B12 A;  3TOB A;  1P4N A;  4I49 A;  4A95 A;  4F0X A;  4E8O A;  1B87 A;  2J8N A;  1RO5 A;  2FSR A;  1KUX A;  1S7N A;  1OZP A;  4QC6 A;  4LX9 A;  4MHD A;  4M85 A;  1L0C A;  4Q38 A;  1Y7R A;  2B3V A;  4UBR A;  1MJ9 A;  4A32 A;  3CXP A;  1XF8 A;  1ZO0 A;  2PC1 A;  2FT0 A;  2Y0M A;  3W6X A;  2VI7 A;  3OWC A;  2Z3L A;  3DSB A;  1I12 A;  3TO7 A;  2X7B A;  4JWP A;  2GIV A;  4ZGY B;  3VWD A;  2ARH A;  5HMN A;  2FCK A;  1YVK A;  3EY5 A;  2Z0Z A;  3EXN A;  4PK3 A;  4XPD C;  2BSW A;  2VZZ A;  1KUV A;  3LD2 A;  4XPL A;  2ZW6 A;  5JQ4 A;  5JPH A;  2OU2 A;  2R98 A;  3R9E A;  4DNC A;  3S6F A;  1Q2C A;  3FB3 A;  2OZH A;  2Z3O A;  5GCN A;  1WWZ A;  4CS0 B;  4MY0 A;  2JDC A;  1Y9W A;  4R9M A;  4H6Z A;  2CNM A;  2ZW5 A;  3NE7 A;  4UFW A;  1QSR A;  5KTA A;  1BO4 A;  1IIC A;  4OAE A;  1S3Z A;  4YRH A;  5J8F A;  2FL4 A;  4C2Z A;  2K5T A;  1NMT A;  4CAX A;  5IV0 A;  4CAW A;  4X5K A;  4KUA A;  4RS2 A;  3ZZI A;  3I9S A;  4FD5 A;  2DPS A;  3BLN A;  4QB9 A;  4QVT A;  3T90 A;  4U9Z A;  1KZF A;  3TO9 A;  2Q0Y A;  1YK3 A;  2O28 A;  5G21 A;  1R57 A;  3JVN A;  2I00 A;  3RYO A;  1M44 A;  4B11 A;  1TIQ A;  4KOS A;  4PK2 A;  4AVA A;  2GE3 A;  4L8A A;  4AB7 A;  4BMH A;  1IID A;  4MBU A;  3S6K A;  4UFV A;  5DWN A;  4HNX B;  2WSA A;  1S7F A;  1M1D A;  5F48 A;  3R96 A;  4XPK A;  4Y49 C;  2Z3M A;  2PRB A;  3QB8 A;  4L89 A;  2HUZ A;  2ZW4 A;  4AVB A;  1NE9 A;  4F6A A;  1KUY A;  4IUS A;  4KSF A;  2D4P A;  3FBU A;  4AG9 A;  3D8P A;  3GKR A;  4F0Y A;  5KTC A;  5E96 A;  2WUU A;  1XIX A;  4M3S A;  4B5P B;  2FXF A;  1WK4 A;  3R95 A;  2WPX A;  2HQY A;  3D3S A;  3A9L A;  2Q44 A;  2B5G B;  2OZG A;  4B5P A;  2C27 A;  4CGM A;  2QEC A;  2REF A;  3IU1 A;  2VBQ A;  1MJB A;  3KKW A;  4UA3 A;  4R3L A;  5AGE A;  4B13 A;  4U5Y A;  2B5G A;  1FY7 A;  4C7H A;  2G3T A;  3DR6 A;  4C7I A;  4A33 A;  4KSA A;  4AG7 A;  5A28 A;  4C2Y A;  2BL1 A;  1CJW A;  3R9G A;  4AVC A;  4CAE A;  4NF1 A;  4ONU A;  5I0C A;  4LUA A;  1S5K A;  1M4D A;  4MFK A;  3P2F A;  2A4N A;  2VQY A;  2FS5 A;  5F46 A;  2Q7B A;  3TE4 A;  4MI4 A;  1J4J A;  2AE6 A;  2H5M A;  5HH1 A;  5FVJ A;  1IB1 E;  1Q2Y A;  1Z4E A;  4C2X A;  5IB0 A;  4FD7 A;  1S60 A;  1MJA A;  1XE4 A;  4OAD A;  3N7Z A;  3JTK A;  4CGN A;  1Z4R A;  4FD6 A;  4HNW B;  4JXQ A;  3EC4 A;  4R87 A;  2J8M A;  1I1D A;  1M4I A;  4CAF A;  4KVX A;  4A31 A;  3FNC A;  3EFA A;  2BEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...