1OZUA

Crystal structure of familial als mutant s134n of human cu,zn superoxide dismutase (cuznsod) to 1.3a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
153
structure length
149
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHIIGRTLVVHEKADDLGKGGNTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Amyloid-like Filaments and Water-filled Nanotubes Formed by SOD1 Mutant Proteins Linked to Familial ALS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 35
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 1ozuA00
1XSOA 1OEZW 2V0AA 1Z9NA 2WZ6A 4FF9A 1BA9A 3KH4A 1F1DA 4OH2A 3KBFA 3L9YA 1E9OA 1RK7A 3ECWA 2Z7WA 1FUNA 1P1VA 1SDAB 2WYTA 3HFFA 3SODB 1IB5A 3F7KA 2AQTA 3GQFA 2ZKXA 1BZOA 1EQWA 4L05A 3CQQA 4U4IA 1B4LA 1PU0A 1OAJA 3LTVA 2C9UA 1OZUA 2AF2A 1U3NA 2AQRA 2K4WA 3KH3A 2ZKWA 1TO4A 1SRDA 1SDYA 1SXNA 2Z7ZA 2GBTA 1SXZA 2C9SA 3GTVA 4A7SA 2E46A 1L3NA 4MCMA 1IBFA 4A7VA 1IBHA 3GZQA 2AEOA 3QQDA 1EJ8A 3F7LA 1SXSA 5CU9A 1AZVA 2WWOA 2C9VA 3QQDB 3T5WA 2AQQA 1OALA 1JCVA 1SXCA 5KBMA 2ZKYA 3H2QA 3HOGA 4A7GA 1SXBA 1KMGA 1N19A 2XJLA 3S0PA 4B3EA 1MFMA 2R27A 3MKGA 2APSA 3KM1A 4MCNA 2E47A 2VR8A 4A7GF 4BCZA 2SODB 1QUPA 4BD4A 1SOSA 5KBKA 2LU5A 2ZOWA 3L9EA 1Q0EA 4OJAA 3KM2A 1PTZA 1YAZA 1ESOA 2XJKA 2Z7UA 3PU7A 4A7UA 1SPDA 3GZPA 1F1AA 3HW7A 1F1GA 1XTLA 1UXMA 1TO5A 2AQPA 4BCYA 1YSOA 2JLPA 3K91A 4A7QA 1IBBA 1HL5A 3CE1A 1F18A 1XTMA 5KBLA 1DO5A 2Q2LA 2AQNA 3MNDA 1CBJA 2Z7YA 1HL4A 2WZ0A 2WKOA 3ECUA 1CB4A 1S4IA 3GZOA 3KBEA 2WWNA 2NNXA 1DSWA 3GTTA 3H2PA 2WZ5A 1COBA 2WYZA 1E9OB 1JK9A 1UXLA 2GBVA 1Z9PA 2WKOF 4N3UA 1E9QA 2JCWA 2GBUA 1E9PA 4N3TA 1JK9B 3RE0A 4A7TA 1B4TA 1OZTG 1E9QB 1IBDA 1SXAA 1N18A 3CQPA 1PZSA 3ECVA 2VR6A 1E9PB 1YAIA 2AQSA 2VR7A
chains in the Genus database with same CATH superfamily
4HFUH 2Q87A 3WFBH 5E8OB 2VRAA 4Y1TA 4HXAL 3I75A 5I74C 4D7PA 4XRCB 4J39A 3EBGA 1KTLA 3EFFA 4JPWL 2WYTA 3RAJH 1TJMA 3MRDA 3ZQWA 5KN5B 3D85D 4R97B 2IALA 4BK4A 1O9ZA 1RJLB 3QDAA 1XL4A 4ZMWA 2P28B 2XC8A 2JK5B 1CLZH 2NY4D 3K6SB 3OR6A 5DD5H 5C08B 2EVFA 4KKQA 1GOGA 4OT1L 3WFZA 4FQIH 4GAYB 4OCRL 4E36A 1II4E 3IJYB 5H2BB 2GJ6B 4TVUA 3WJLA 1ZANL 5KVGL 5FO2A 3IS1X 3C8KA 4KXBA 1AAJA 3KLAA 2K6ZA 4H8WC 3F00A 4I77H 2CNYA 3RWIB 1NLBH 4FFYH 4JE4B 1AD9A 2DTSA 2GT9B 2BS9A 5D55A 3FCBA 3FQUB 2BDNH 4H8UA 5H37H 2NNAB 5LQBL 4KZEL 4JKWA 4P2RE 3BH9A 2R1YA 2XA8H 1N59A 3AY4A 2QADC 3BAWA 3IDXL 3HZ3A 5C0EB 2I85A 3FN9A 2P49B 3EZJB 5D72H 5IB4A 5I71C 2ZKYA 3RJQB 3DX7A 1M6UA 4Y5VA 4L4TB 4Y19E 3VYOA 5LVEA 3ARPA 3IDIB 4B41A 2Y2TA 1YMME 1WA0X 3ZHKA 2HKAA 3R8QA 3ULUL 5FEBA 4JAMB 4AQAB 4MMXC 1GKOA 3MRFB 2TSAA 4I0KA 4U6TA 5J57B 5IT2L 4WJG3 1KACB 3KYNB 1K8IB 1JNLL 5L4FA 4XCCL 4LEOA 3NFNB 2B2XH 3MLSH 4L9LA 2IAMC 1KCWA 2BVYA 3S2CA 2NY3B 1IC7L 3TFKC 1W6WA 2OCJA 2WIIA 4YR6A 3HG4A 2OZ4A 1ZOXA 4PEEA 3QP3A 3F65A 1J8RA 3P69A 1J0IA 3WL9B 2AQNA 2YPKB 1BDYA 1BFVH 4UM9D 2Z7YA 1IC5H 1MN4A 3I02A 3QPQC 4ODWA 4PVMA 3VXME 5KSBE 1REIA 1BZ8A 1UD5A 5BS0E 4ACTA 2FDBP 3WD5L 3E9UA 4UTCA 1JVKA 2OX5B 1E27A 3ZUNC 4OLWL 4PGJA 3ZZ1A 3PDOA 3FQ2A 5D7JC 3O45B 4C56A 2QPSA 5CEZL 4UTBL 1TCRA 4XP6H 4WW2B 1X7TA 3L3JB 1KBGH 5JTWA 3F58L 4JLRB 2R0LL 3QARA 4XOCA 1MLCB 5TQ0H 5G4NA 5BQ7B 4KJQC 5CZRA 3RNKB 3WYRA 3G5XB 5HI4D 4B9IA 1XZ0B 3DX8A 5F6IC 4PAZA 1S7XA 3UDWA 5E8DH 1ODUA 1DUZA 2LLGA 4HAGA 5T1LD 2EAEA 4K5OA 5BRZD 1BZ9B 3TF7C 4HIPA 2IDTA 3NCJH 3APNA 2ADGA 1G84A 2WQ8A 2WXMA 4PJIE 3CBRA 4N9GB 1DR9A 3RDJA 5GGVY 3T2OA 3ZTNL 3S8GB 4LBEB 1CFBA 4PG9B 1QSED 2VIRB 2Q86A 3DUHA 3I6GA 3L5XL 1I85A 5IFAH 2J6WA 1L9OA 1S9VB 3DPDA 4PTUB 2RFXA 3R7RA 3HBZA 5LG6A 25C8H 2C9SA 4U1KB 3W5NA 1NBZA 4Z7UF 4E0RA 3BSZH 4XE5B 3V6ZB 4WV1A 2MHAA 2P42B 5C0JA 4Z7NB 5ENWA 4QRUA 4GSUA 4F7EB 5DK0A 1JZJA 4KQ3H 2WUBH 4OM1H 3F3HA 4AZ8A 3RY6A 3LOWA 5A2CA 3LSOA 5IEHA 3PWPE 3QB7C 2XT1B 4NPYA 5A16A 1JXFA 3GSRB 4KHTH 1GGIL 3CIQA 2BIIA 1XB8A 2GVYA 3D33A 2BY2A 1DEEA 3W38A 1ZKAA 2OJEB 3N50A 4ZMNA 2W9EL 3WNJA 3GKWL 3MV7E 3RQ3A 4YHKL 2K7PA 4M6AA 2LQRA 4QWWD 4XGZB 5BXFB 2OI9B 5M94B 1DLHA 1Q0YL 5H35A 4MYWB 4WFFD 3P77B 4N2AA 4ALAL 3ULVH 4JCWA 3NIGF 4PJCF 2H41A 4GQRA 4JZNA 3PV6B 2AEQH 3QZLA 1DVZA 4F3FA 2FL5B 1BECA 3QQ4B 1AJ7H 5DF0A 4LU5H 3SPVB 3EO1B 4N2GA 3PY9A 4X5LA 5JOPD 4YX2L 2LAGB 3C87A 1R1CA 4J4PD 5I1CH 4LLYA 1BF8A 3D0LB 1JYWA 2V17H 4DGIL 1IGIL 4B7IA 4H7VA 5GJSH 3PWJB 4P46C 4XCNB 1TZGL 3EYFB 3LKRA 4OZHB 5IB2B 2BFVL 4Y4HB 4AG4L 2WUCL 4RDQG 1NMCB 1T1ZB 5C08D 2K70A 5E00B 1YNTB 4E5XA 3MRRA 3BZFB 1CC3A 2H45A 3LN5B 1VEPA 1IAIM 2CO1A 4MCZB 3G5YA 4PJ8C 5FYJU 1UTDA 4UQCA 3IMTA 4AIXA 5ID1B 1CLYL 3F62A 4OCSH 4HJJL 4QKXB 1CXLA 4ESKA 4FFWD 2YUXA 5GSVB 2PR4L 2R4SH 3DBXB 3MLUH 3WJJC 1MQ8A 4KJWD 2Z7WA 4Y4KA 1BEXA 1B0IA 2QR0B 5C3LD 4AVIA 4HXBH 1TZHB 4G9DA 3IDNB 3NUKA 1IIIA 2VNCA 4MRBA 4XO4A 3UC0H 4U4IA 5KYUA 3X1NA 4ZNEA 3LTVA 2R15A 1AVAA 4UOJA 4OZ4B 2WNKA 1MEXL 1WFUA 4MD0A 1DANT 4RRPA 4NQVB 3F7VA 3QISA 4LT7A 3NESA 4FLSA 2ZUTA 3ZLQC 3KXFE 3N1QC 2R39A 4KJYA 5HGDB 3T65A 3UZEC 3FH5A 2Q6WA 2Y2WA 3FTSA 1MNNA 3BSHA 5J5EA 4HGMA 2UWEF 2E9BA 5CU5A 5AUMA 3BUBA 3D9AH 4Y2DB 2EC9U 4FABL 2JKJA 3NIDF 1QSFB 1ND0B 4JO1H 3VI4E 4UQAA 1U93B 1KGUA 1MCNA 4GKZB 4XPHL 4BXSV 4LEEA 3BWSA 5CJ8A 1V5JA 2NY3D 1I7TA 2OSLB 4NNXA 3RX9A 5FM5O 5C3TA 4M43L 3PL6A 4GIPD 3CBKB 1R3KA 4ZO8A 4YH6A 4RMRA 5HXMA 3TJPA 4BSWB 1SM3L 5DT1L 1J9QA 2ZCKH 5KYXB 4HP5A 4K8RH 4L4VB 5E56A 3F01A 2GQHA 2Q20A 4UWQB 4XO5A 4AI7A 4BZ1H 5F7HA 2PUQT 1KXQA 2XLLA 3PABB 4AW4A 3IJ9A 3IT8D 4X4YA 1UFGA 2D7NA 2DL9A 2IMNA 1YPZA 3HKFA 1J1OL 4PJXE 3KVPA 3AUVA 4YXLH 3OF6D 5C0DA 3MOAL 3MA7A 4JEGB 3QIBC 2JKIS 2OYMA 3TBBA 5IV2A 1N3NA 2FATL 4GT0A 3CMOL 2MCAA 1DO5A 1CTOA 4R9HA 4E9VA 4OZIF 3QAQA 3H56A 3O6ML 1TJIL 3UAJC 3DO7A 4X2UA 4LIQH 4PV8A 4C4KT 1WAAE 4EBQH 3KCPA 5EO0B 5TD4A 2R29A 3C8DA 2BHYA 4OGQC 4U1GC 2G2RA 3TIEA 3NCYP 3V6FA 1DQVA 4NXSA 2Z31B 1YYML 2YD1A 4WI9A 3T3MF 2BSRA 5DJ2B 1UD2A 2EIZA 2AEPL 4HK0B 3FQTA 4PYHA 3GLAA 3EJPA 1D9KB 5FO8A 3WGVB 1B90A 2WKOF 2YD8A 4XVJL 2FEEL 3H6AA 5F89A 1E4WH 3DROB 3NN8B 2BY3A 5FOBA 4TQEH 4NAJA 4EJ1C 2B1AH 4B9ZA 4X9FA 1IILE 4ISVB 4NZ8A 2Q8AH 1JDCA 1I53A 4YHZH 4OI7A 1BQLL 1L0PA 4JBSA 4Z7WA 2V4LA 1IE5A 4YSSA 1N7ML 1M56B 4UYQA 4F8NA 1UVQB 1B4JL 4I4WB 1AZBA 4G1MB 4XVTH 3FT3A 3MLXH 1CFSA 1QPPA 1GW0A 2IPTL 5A1AA 5CZVH 1RZ7H 4I2XB 1P4BL 1KN4L 4KROC 1OP5H 5E5LA 2DJ4A 2ZOTA 2I9LA 3PWUB 3OAZH 4TTGA 3WKPA 4ZXBC 2IBZY 1FP5A 3EJQA 4LKXB 1E42A 3D2UB 3QS2A 3REVA 4B60A 1A1OA 2DDQH 1V7NH 4D9LL 2Z92A 3MJ9H 3WXVL 3PHOA 2O6CA 4L2LA 4Z0BH 4QF1A 1EANA 2QT6A 4AMWA 4WIQA 1N64L 3D4YA 4OKVA 4EAEA 4FHKA 1N9PA 1AQKL 3FTWA 2W60B 4BJLA 3QDGD 1E8WA 5I5RA 1IAKA 1M05A 3NPSB 4AXWA 4KZDH 3QFJE 1HXKA 2NSQA 3IGAB 4PGBB 4UTAA 5IJCC 1NFIA 4R97C 2EEDA 2W0LA 1U3HB 4HCRL 1UCBH 4JHZA 1T5KA 3WFCH 1NSNL 5HDBE 1LO4H 2XN9E 3HMXL 1KTBA 4JS7A 3G5VA 2OMYA 4HGKC 5DR5H 1LTXA 5IM7B 3U9UA 3SIKA 4RCAA 4A04A 2GSIB 3MA9L 2CE6A 3IDGB 4LCCA 2BXZA 4YPJA 1ETZA 4NQSB 1S9WA 4QT5A 2HZHA 1GKEA 2DQ6A 4YDKH 1KB5L 4LVHB 5ANMB 3SJVE 5BW7A 1OQOA 5EU6B 1TDQA 3WXWH 5J8OA 4ZMQA 1OTSC 1BIIB 2W65B 2JTDA 2VDOL 2ATKB 2AI0H 4M48H 3QUYD 5B3SB 4XXWC 2WTOA 4YGAB 3CX5K 1CBJA 3CG8A 3ULVC 3DK0A 3SGJC 5CLWA 3IDMA 4PJGE 5TDOB 1J1XL 1KEGH 4I18B 4QRRA 1XWVA 3BFWA 3NCYS 1INEL 1DSWA 2A0LC 1CICC 2D7TL 2L7EA 4OF8A 3STZA 2W81C 4ABUA 3AAZA 4JL2A 4HIXL 3U6XS 2YD2A 3RWHA 4L3AA 3TEYA 2LU4A 4IKLA 3PS6A 4MXVE 4AQOA 4JDTH 5E8NA 5LCVH 3U4AA 4A7TA 1CFTB 3QNXA 3HE6B 3L3OA 4AYMC 3CVDA 4GEIA 2E7CA 4UT7H 4TVPE 5AVSB 4RDQF 1NBYB 1T0NA 1R19A 2FIRT 3L3KB 4FTVA 1BAGA 2X6MA 5C0AE 4L8BB 1YHPA 4J2QA 2WBKA 5J1TC 1U91A 1QSFD 4N2NA 1ZXQA 5EUOF 1Y18A 4FQXD 2WV3A 3NVQA 3NA4A 2F68X 1WFJA 2Y07L 5I8CA 1FCCA 2Y5TB 1BGXL 3VWJB 2AF2A 2WQWA 1KJ2A 2JLLA 4HJTA 4JFEA 3WNMA 5KTEH 1JF1B 4BBWA 4OFQA 1JAEA 2ITCB 3VXTA 3TCTA 3IRCA 4NN6B 4QNPE 1M2VB 2A6JB 5B3NA 3LKSA 3J2PA 3IDJA 2BOCB 3RUGA 1MCBA 4Y5YB 1G6VK 5GS0H 3T4YB 2XV3A 4QO1A 2ZAHA 4JG9A 2FO4A 1P4IH 3LRKA 1I8IA 3MFFB 4KO5A 2F5BH 2QSQA 4XZUB 5BMFH 2YGQA 1LGVA 3RA7H 5TH2B 2NY0C 2OMVA 3S34L 3T71A 3VGAB 5ADPH 2WNXA 3EYQD 1YJDH 1Y0LB 1I9JH 2W92A 3G08A 5DXWA 1U8HA 2ZYHA 1IZJA 4P9HL 5D7IF 3QG7H 3SDCB 3LD8B 4P2RD 4Z7OF 2Y1YA 3P9LB 1FAIL 5DJ6A 4O02A 5MENB 2Z31D 4RFOL 2FE0A 1FO0A 2OXHB 2UY7A 4ZMLA 2F18A 1SPDA 4Y19D 4WUUA 4K8RC 1YMMD 4OUUA 1BF2A 1XCXA 3HW7A 3QE5A 1T5WA 1QFPA 2PCYA 3H9SA 4AT6B 1AMYA 5EA0L 1AY1H 1VENA 3FPXA 3LN4B 4HMDA 1YY8B 1IBGH 5L2KD 1TLKA 4GG6F 4BQ8A 4R3SA 4GB9A 1KBBA 1EZSA 1G7JA 4XAWL 2DWXA 3FFOA 5DWUH 4HX1A 1OAXL 3UJIL 4F33A 4PP1C 5C0FB 2GEEA 1ACZA 4AE0A 1Z5HA 3AROA 3GSNB 3AS2A 3TBTA 4JE0A 2JF1A 7FABH 4CSZA 5IROA 3LNGA 3MGTB 1G6RA 4G3YH 1HYSC 3O4LB 4M6OL 1AZZC 5T1DH 1CWVA 4UDUA 4ETYA 4HJIA 1VADB 1V7ML 1XH3B 3BP7A 3BW9B 4JY4B 1JHLL 1OAQL 1H3PL 2XXMB 2HRGA 4IRZL 4QLRA 5LG1A 1UB6B 1CDIA 3QNZA 3PDDA 2IVFC 3WTXA 1CIUA 3V9CA 2C3GA 4BSVA 2Z93A 4FP8H 4LVNB 2OULB 3KPQB 4YDMA 2XQYK 4MNQA 3DXAB 1FRGL 5E5MA 2HT2C 3MLTB 4IJ3B 2NCEA 5HHOE 1VPOH 3I6LE 1JV5B 2XWJA 4GXUN 4UDTB 2YKLL 4MMZC 3RVTD 4AVHA 1JRHI 5KSAC 4QXGH 1JV2B 4BRJA 5BO0D 3E8UL 1GW6A 1V3KA 2ZKHL 3IPFA 4Y4HC 2HPTA 3T8XB 1NMCC 4P2YA 5DMKA 4G71B 1URLA 1ZT1A 4Y0GA 2DWDA 1ZGLP 2Q7AA 3G9AB 4M5ZH 2YARA 4X6DA 2FQFA 2NY7L 2YAOA 1WS7A 2BH0A 2VE6A 4C57C 4YJZL 3MACH 3WUWB 3B2UD 1ADQL 2ICWB 3S36X 4D9QE 1MFCL 4LAJH 1X7QB 2WCSA 2ZUQB 4WHYG 4NM8L 4KNSA 4EKXA 1K6QL 4WJ5A 4AC4A 1JCVA 1QA9A 2AJ3A 3II3A 3ZR5A 1SXBA 4YSOA 4K0OA 1SEBA 5J6SA 1KYAA 2VJ0A 2ZX8A 2NX5A 4E41A 1W72B 3LZRA 1SBSH 4ZUUA 4FFZL 3QQ3B 1M6OA 3DUUA 2FNBA 3IJHB 3ARYA 2HTKC 3BN9C 3B9VA 4WDIA 3PXHA 1JJUA 4Q2ZA 5JO5A 4JFTA 2B8OT 4HUXA 3PWPD 5C86A 2KERA 1RZIA 1TYRA 1TVBA 4XNUL 4RRPM 2H6UA 5AALA 3S3BB 3TJEL 2BVPA 3PQYD 5C92A 4Y2DC 5D7LA 3HE6D 1NEPA 1TVHA 5CWSB 5IKCA 2OMWA 3A24A 4LEXH 3L8QA 4P5KB 3SDXE 4OZFG 4PB9L 5FR3A 2K1MA 4C59B 4YHNA 1V10A 2F58L 4KPHH 3NJGA 2ALWA 1RZKH 2BVTA 2XXGA 4WO0A 4ZMXA 4X9BA 2NTFB 2X2IA 2ZAIA 4N3UA 1DL7H 1QVOB 1KIPA 1GGBH 1PZDA 2K45A 3DSNB 4X7EC 5TF1L 1RU9L 4PJBB 4UF7C 4JRXB 2QPEB 2YD5A 4PRBA 2JKXA 2VZUA 2FWOB 3MJ7B 4LDOB 3QCVH 1HH9A 2EEXA 3EO9L 4DHLA 1CVSC 2Q7NA 1FNEA 3L9BA 1BJ1H 5AYUL 1YO4A 3VFNA 1DVTA 3BUPA 1BBJB 4NM4H 1NQBA 1E30A 3CFKB 3GSNH 1KXVC 1LE5B 5EIIA 4RAUB 3GSVA 3VFOA 4Z8FH 5ITBL 1HILB 5CILL 4OZGA 1RVFH 1FYTD 1OSZA 4FNQA 1XIWD 1AHMA 5FCUL 3IU3A 3OXSA 3MJGX 3BZEA 1B3IA 1CE6A 2W38A 3F12A 2GAZB 3QQ9C 1RUQL 2QTEA 1NDTA 1D9KC 2A9MH 4NKOA 3CSTA 2ZJSL 1RK1A 4PH8A 3WBDA 3TO4B 2CRIA 5K9QG 2IPUG 3Q8AA 4GUPA 4HH8A 1VFBB 1MQKH 1QG3A 3FBKA 5MEND 3QRLA 2VW6A 4FQLH 3LPOA 1KLFA 4K3EH 4OY9A 5FHAL 1JN6B 2VRQA 4EI6B 5ILTH 4DKFL 1QHQA 3QJTB 1G5GA 3P73B 2Z3FA 5E2VL 3NJKA 3KEHA 5GS0C 4TUKL 1JGEB 4LSSH 2Y7LA 4OB5H 3PGCA 3HJEA 1CT8A 3MRIA 3U1QA 4JDEB 5BJTB 4TMPA 2XTJB 1NCBH 1RZ8B 4R0LA 1LK3H 4KK8C 3I74A 2IH9A 1UWXK 2AJXH 4YUEH 1TT6A 4GP4B 1B0GB 1AO7D 5LGJA 7PCYA 3MCKB 4M7LL 1YJDC 3VFTA 4BDVB 3BP6A 1EJOL 4KO9A 5IHLB 3QRFM 4F93B 2VZ1A 2GIYA 3H85A 4N6QA 3UZQB 3O4LD 2WWKT 4LRIA 4GBXD 2YRPA 3P02A 5F3HA 4ZG1A 1A2YB 2XFXA 3VACA 4J4PA 4JRYA 1EFXA 3C6LA 1TIUA 1AKJA 3L6FA 1W72H 5ISZE 3VWKA 4MMYA 3EGXA 2OR8A 2ITDA 5J89A 5CJXC 4ZUTB 2R7EA 1U3HC 1H3UA 1ZGLB 5B7EA 2DQTH 5L7XL 4M7LT 5C07E 2X05A 4B9KC 2H5UA 4N68A 5TQ2H 2E74C 1GMEA 1NBCA 2FQGA 2ZUWA 4G6MH 5JZ7C 3GMOA 4PJAF 2OP4H 5K9QI 3PGFL 1E9PA 2VL5A 2K8QA 4Q8BA 1PYWB 3FCUB 5C97A 3NCXA 3PGDA 1U8PB 2WSPA 3B1UA 4LVHC 1TMQA 2DEYX 3F2LA 4XBPB 4Z7VF 3GMQA 5J7CC 4CW1B 4JQIL 1TPXB 1EDYA 2J71A 1PIFA 2LAAA 3CFDA 5AOKA 3IMUA 3Q6GH 2YAQA 2X4UB 3OGCA 3IJ7A 4PJHA 1AXIB 4U3SA 3SODB 1HHKB 5B1AB 2YPLA 3O6KL 3MROA 4ICXA 5HGAA 4A66A 3DHUA 4Y7OC 3G04B 3ILQC 2ISDA 1IFRA 4OFYD 5JOFB 1ZT4A 3Q6FA 5EC2A 1T7WA 3RHWK 1FHGA 2MMXA 2J5LB 1P4LB 4YDJA 2LE9A 1UJ3A 1IFHH 2F54A 3GFUA 4NC1E 2ZX5A 3VFRB 1KNOB 4BK8A 4YHIA 1UH4A 5HHQA 4MTMA 4OLVL 4UAHA 1QO3B 2P8LB 5I76B 4ORZC 3FQ4A 4AQ1A 4LKCB 2FAUA 2YXWA 4G1EA 2CIIB 2EE9A 1C5DA 5IESH 4K3GA 1B2WL 2DBLH 1BAWA 2X53A 3NEXA 1RHHB 1NBVH 4JFXB 1TU2B 1J5OH 2CDGB 3MRJB 4LCUB 3UJTL 5DZVA 5SX5H 4I88A 2ZUVA 3PWNA 3TBWA 2PF6A 4JPKL 5FX3A 1FGNH 2E9JA 4GXUM 3GI8L 3ROLA 3SYOA 4ZT1A 3E0GA 3AU1B 3TNNB 4PJDF 2XRAL 3BKCL 2WPGA 5DRWB 4Y88A 1RULH 4K7FB 1S6NA 5H8DA 3JWNG 5C70A 3VWJC 4WJKB 5DZPA 1U8OB 5I1HH 1T5XA 2UXVA 4NOBA 2GBAA 4PRIE 3U36B 5AG8A 1HN1A 1PZBA 2O26U 4NN6C 1FV1A 2AAAA 5GRZA 4E9RA 5I6LA 4S1QH 3CHXA 1D2OA 4Y5YC 2QSCH 1K5NB 1S9XB 1NJ9A 1DBMH 4TNFA 5GXBB 4DZBB 1TTAA 4HUCA 3NT0A 1NOLA 4K23L 4PW9A 4QRSA 1ZLWH 5IVXE 3VJ6A 4PVBA 1IEBB 3IXTA 1UENA 5K1JA 3DX1A 1N5AA 1T1YB 4NUJA 3QO1B 1JVLA 3WIIL 3ECUA 3SJVD 2DD8H 3P11H 5D1ZB 3X1FA 2ZXDA 3M1CA 1NA8A 2VUKA 3W1ZA 3MLYL 2DYPB 2NQDA 3ZDXE 3RFRA 5B3JF 2ZG3A 3SDCC 3LD8C 1AHKA 4L3CB 4OF6A 3B7RL 1XR8A 3ABLB 5CMAB 4ZX6A 4G9FE 4JZOB 3JVGC 2N7AA 3FQ1A 1FL3B 5JPNA 3MXVH 4IU2B 4J8RA 4QPEA 1RZKC 2NZIA 3GUFA 2ADIA 3EOBB 1NUDA 3K8MA 2UX7A 2XNAB 3TWCL 2R69L 4X98A 5FGBC 5ESVB 3ZL2A 5I5JA 1CGWA 4LPXA 3TO4D 5JPMA 4WENB 3NZSA 2H8PA 4I48B 1NINA 5K9JH 1KTKE 5MEOB 3LHPL 2VH5H 2BSCA 3CXHK 2WZPA 1OGAE 2OZNA 5I8OL 3UPRA 2KZWA 3QI9A 1FVDA 4S2SB 1MUJB 2G30A 2UVEA 4HS3A 4GPVA 1UKTA 3SDDA 3GIZL 2JH2A 3GSQB 3LH9A 3LVTA 2YO3A 3DOHA 3MDJA 2YN3A 3KZ8A 3ME0B 2Z6FA 4U6VH 1OT4A 1DQDH 1UZ8A 2NUPB 4A68A 1MCRA 5EBLA 1ZPUA 1CF8H 1AQ8A 3LB6D 4KUZL 1QNZH 3QUXD 4E41E 3GZQA 4W9GC 3QDGA 4KRLB 1PG7H 2GJ6E 3QO0B 1NCOA 1ZJBA 1KTDB 1A6AB 1QHPA 4IW4C 4K7PH 1MWAH 4ANUA 2Y06L 3WLWD 1NDGB 5C6TH 4CL7A 3QQDB 1T1XB 5CEYA 4YHML 1AXTH 1NAKH 5DUML 3D34A 3TA3C 4BH7B 1X9RA 3H2QA 1AI1L 3MBXH 4GRMA 2Y69B 5I1EH 3UG3A 3RGVA 4PJEF 4ZAKA 4GEJA 2VQUA 2OYKA 5B8CB 4IJ3C 4IK6A 5IHZB 1HIMH 2Q76A 1CO1A 5EO9A 1CDYA 3MKGA 1UUNA 5E1GA 3RPBA 2WLHA 3MV9A 4ZPTA 5JQ6L 5IQ7L 2O5XH 2HVKB 4MA8L 1LO3L 4U6XA 3QVAA 3V10A 4NIYE 1QRNE 4NFDA 3QUYA 1CDGA 2IDCA 3F5WB 3CZSA 3DGCR 4Y8AA 1D5XB 2KZKA 3DX9B 4LGPB 4PW4A 4Y9CA 3ARDB 2DH2A 1WT5C 4HXAH 1DBJL 4ZS6C 3K91A 3CDYA 4MDJA 1HEZB 1MHEB 2HRPL 4OIIH 4JPWH 1P5VB 5DVPA 1LE9B 2ZUQC 4TV3A 3U9PL 2BP8B 2EIDA 3POCA 4EUPG 1NC2B 2M83A 5G4MA 5CD3B 1HH6A 4MHHG 4HC1L 4OT1H 5AD0B 2NY1B 4JRFA 2WXRA 5SWZA 1UXLA 3QCUL 3RILA 3V4PA 5J12B 1ZANH 4QUOA 2VSDA 3FFCE 3MGAA 1RIHL 1ZWIA 1ZHNB 1A6TB 3FSOA 3BE1H 5I1LB 1I9EA 1A02N 1SJVA 4MXQD 4Z3JA 3F05A 1CYWA 4KV5E 3KWXA 4PCKA 4UUJA 1LO0H 4XCFL 5HJGA 4KZEH 1K72A 5T3XL 4HA1A 1TTUA 4U1SB 5BZWB 1YA5A 4QJ5B 2CKBA 1OTUC 3SKJL 3IDXH 4PGZA 4B9FA 4AYEC 1CLOL 4JUTA 4OCXL 4BZ2A 3KL5A 2XQBL 2Q10A 1G94A 5E4EC 5ITFB 3RU8L 4B97A 4S0SD 1OD9A 3SE3A 4KBPA 2KS0A 4FKHA 3W9DB 4OJEH 1BXVA 1OZUA 1BWMA 2AJUH 5IT2H 1MJ7L 5B1JC 1OF2B 1WIUA 5IR1A 1I7ZA 4L0YA 4XCCH 4JPIA 5JHBA 2A77H 2IFGA 4GW4A 5FHBL 5ERWA 2G0LA 3HUJE 4YSCA 4NZJA 1IC7H 4IHBA 3EBHA 4HAFA 2IQAA 2H6OA 4PJ7F 5HHOD 3AXLB 3T6XA 3ESMA 5E08H 3PHAA 2KLTA 1AIZA 3VXOA 3OR7A 3KR3L 2O6EA 2OSWA 2AHIA 3GRWL 4LP5A 4JZJB 1DBAL 2H4EA 4MS8C 4YBQC 4BYHA 4MHHI 4JKNA 1SXCA 4HIIB 1HHGB 4ZUSA 2VZOA 3LPWA 4K9EL 4P2RA 1VGEH 2AJYL 1GR7A 2HP4A 3VE0B 5BCAA 3NP4A 5F7AA 1P7KB 3LZQA 4ZBJA 4FA6A 4Y19A 2IWEA 3SE8H 3CXFA 3HC0A 4LFHD 1V55B 4OLXL 1YMMA 3CD4A 2IXQB 3TFKD 5CEZH 5D1ZD 4CADB 1QLRB 4H25B 3F58H 2CHWA 2R0LH 5KUMA 2GTZA 4KVCL 4MQXC 4LIQE 2DM7A 2EICA 1A3RH 1CFQB 1FBIL 3ZU8A 3O9WA 1Q72L 4MJ5A 3ULUD 3CFJB 4XC1H 2ZOKB 1FIGL 1FN4B 5F7DA 1JFHA 5L4MA 2QPUA 1RL1A 3ARZA 3VQ1C 4HJEA 3ET9F 2OKMA 3V8CA 3Q9PA 3MRNA 1MCIA 3GSUB 3GGWA 5LN8A 2F5AH 4QGTA 3ZTNH 3WIFA 3TEZA 2BIPA 1HNGA 2ZUYA 4FERA 1NFDF 2ZYSA 4LVOB 2XTJC 5DRZB 3VXMA 2V7HA 1HX0A 4A1RA 3L5XH 1A4JA 5KSBA 4PFEA 1JK9B 5BS0A 4YDNA 3H7BB 4XN8A 3WGUB 3NJJA 1U6AL 4FXKB 1MZYA 1VFMA 4GSDL 1PZSA 1Z9SA 4TUJB 5D7SL 5DHVH 2C9XA 1ZS8A 4OZHE 4Z7UB 1TSHA 3BT2H 3D4CA 3CGTA 1JZ6A 3EYVA 1VDGA 1I9IL 2F53B 3HLAA 4GUQA 3L2LA 4CNIA 3RP1A 5T1JA 2NLJA 3ARGD 1NCCL 3I9AA 3RL2A 5DMIL 3AITA 1JZ4A 1SJHA 5LHDA 1N26A 4LL1A 2CR3A 4FLHA 4EF3A 2FGWL 1A4BA 3B5HA 3IJEB 1S7RB 4TYUA 1BCIA 2UUDK 4JY5L 1QFOA 4C83A 3ABMB 2W9EH 4JFFD 4HSCX 3GKWH 4PJIA 1R3IL 1WZMA 2CO7B 4YHKH 1BSIA 3OJDB 3QXAA 4JDVB 5EO1B 4E42A 4X7CC 4PJ9A 3HPLB 4LOEA 4ALAH 5DUBB 2NSMA 1SUJA 3UTQB 1M71B 3WS3A 2JNZA 1QFWI 3U83A 3OHXA 3QUMH 3WV0A 1LILA 3NCEB 4TN9A 1M42A 1TPXC 4UIMA 5DMYA 1HYRC 4ZYKB 1TUPA 3VQMA 3KJ4B 4G8EA 4DVRL 3C5JB 2WLKA 1OALA 3ARDD 2YA1A 2X89A 2VJ8A 3B7TA 4OJDH 3EJZC 1G9HA 2YPVL 3MV8D 3R1GL 5HSFA 1CYGA 3QC6X 3QUZC 4J3OD 4DGIH 2ARJQ 4HU2A 1IGIH 4QXVA 1A25A 3PWPA 1TZGH 3MJ6A 2BFVH 3DTXB 1YVLA 4RA3A 4AG4H 2WUCH 1C12A 4KQ4L 3LJ3A 2O5ZL 5TPWL 3UYOD 1QLEL 2B59B 5C0IB 2FX8H 1Z6JT 5IGXL 2N3JA 4HQQL 4WWOA 4P2QD 1LEGA 1IGMH 3P4LA 3MV7A 3IS0X 3HLKA 3BEVA 3QWOA 4APQB 5LAXB 2WSKA 4WFGD 1CLYH 3TNMA 5T33H 4HJJH 3PJNA 1ID2A 4NQEB 4FAAB 3DRQA 4JN1H 1CUOA 2JFCA 4JO3L 4YZWA 1OOAA 2PR4H 1I9RL 1XB6A 2ED6A 2GTWB 1MAJA 1JFQH 5JIPA 3ZQ9A 2LFEA 2VMDA 1ZLUK 3QWRA 2F8VA 1RH8A 3RVVD 4DNLA 2WXPA 2TRYA 2B1HL 1U8LA 4WZ9A 4B9PA 2J8UF 1EGJA 2XPYA 1I7RB 3GMPA 1W91A 2DLEA 4G83A 3GEWB 4AYID 1ZHBA 3JQOB 3FDWA 5GJTL 4OQTA 3MYJB 3IYLW 2X4NB 3MQIA 3ZDZF 3EGDB 1OGTA 1L0YA 3HS8A 1KDIA 4RBPH 3LIZA 3CSYB 2PCXA 1DJWA 3E6FA 3A6BL 5FPIA 2PCPB 4PRPE 3U2IA 1E4XL 2JWYA 4PG2C 3KPNA 1JXGA 1U3JA 5I1JH 1OW0A 3ZMEA 2KPNA 2XUWA 3HR5B 3S4SA 3DBSA 1OGPA 2PPFA 1NH6A 4X6CF 5HHXH 1TTRA 5K1NA 1Z9NA 4MX7B 4M1DL 4XPHH 4UT9L 2H32B 2WXGA 1KB5B 1W0WA 1WFMA 4GOSA 4EVNB 2H6PA 3TEWA 4M43H 4Z77B 4P2CG 2ZPKH 1IM9B 3EHBB 1WLHA 2IH1B 3K7UA 3FC8A 2VDOB 1BJ8A 3MVSA 5CBAB 3W9EA 5I18L 3TZVD 4WK2B 1S7VB 3WAKA 1C7TA 4Q89A 1SM3H 3HPJA 1NCNA 5DT1H 3IE4A 2YHGA 2I26N 3O6FB 3FUDA 1NEZA 1IAIL 2OR7A 4MB3A 1D6VL 3KMDA 3H9HA 1NIBA 4P57B 1WEJL 3OKMA 1NCTA 3MRKA 4PBVC 4PVNA 3CCHA 3RPIB 4CMHB 3COOA 5CGMA 4BFIA 4APXA 1WK0A 5KS9B 1NM9A 3MRLB 3X11A 1ZD6A 2ADYA 1WBZB 5FO7A 2WC7A 4UQ2A 2G9HA 3KXFA 1JUFB 4K7PY 4E9LA 4M56A 1TJGL 4JVPA 3CMOH 4M9PA 2Y36H 2I9TA 1KYOJ 1TJIH 1CFNB 3VSUA 3VI4A 5EU3B 3PF2A 4L0PB 1D5BB 4NKDB 3KWUA 3LS5H 4K2UL 1Q94A 4GS7C 4GKLA 2H2PC 4KUCD 3QUKB 5D93C 4X6FB 1RKRA 2R27A 3OQ3B 3QJQB 2AEPH 5HGHA 4XMPL 2MCPL 2E7BA 4NQCE 3FU8A 1RPKA 5FGCE 4HEPG 4NC2B 1JERA 1E3XA 4XVJH 3F7YA 4WI8A 2XN0A 5DD0L 3ZO9A 3N42B 1QD0A 4ATWA 1F5WA 3X3GL 2ESVB 4FGMA 4P5TA 1UT9A 4MD5A 3TVMB 5L0QB 3E1ZA 1NUFA 5AW5B 5E24E 3NA9L 1IIKA 2A83B 4PJXA 3A4DA 4HWBA 3T1FA 1N7MH 4X0KB 3RZWA 3EYUL 3WKML 3FU9A 4H1LA 3EJYC 4EKJA 3TC9A 2IPTH 3TESA 2F53D 4LSVH 3MLVL 4S10A 4DO4A 3IU4H 1P4BH 3EXJA 5B8CC 1KBWA 4FI8A 3QEUA 5ESQB 4PWJA 1WAAA 4B5EA 1XF3A 5DJYB 3Q48A 5C09E 4RDBA 2YQ2A 4D9LH 1RSFA 2X10A 4OCMC 5GS1B 2EEFA 2X4OB 4FNSA 3WXVH 4CVUA 3AFLA 2P24B 4EZLA 4HZLB 2NY2C 1KCUL 3ASOB 3N43F 3OGOE 5HY9B 4QCIB 4UI2A 1IE4A 2WZ6A 2Y6TE 3QYNA 1AQKH 4BFGA 1PIGA 4A63A 3OAYH 3FO9B 3WDJA 5JXEA 3S7GA 1HSBA 4G9FD 1VACA 2FK9A 1JPGB 1HDMA 5D9SB 3SZ6A 4HCRH 1PKQE 3VXUB 3VW3L 4YPGA 3DX3A 1SLXA 2OMZA 3T1WA 3S9DB 2UZYA 4CSSA 2XQYA 2EDRA 2NY1C 5GIRA 1VEMA 2CBOA 3MA9H 1ZIAA 3QFGA 5EZLB 3DETC 2Z4QB 1OWRM 2QHRH 3B7YA 5IFHL 1DZ0A 2H32H 5JHAA 1KB5H 2GUOB 2ZUSA 4GMSL 2CHDA 4XH2A 2ZP0T 3FQWA 4MJ2A 3V0GA 1U8QB 2PTUA 5DFVD 2DLHA 2GHZA 3FHQA 3PIQA 5T1KA 2AEOA 3B83A 5F71A 1TFPA 2VDOH 3V7AG 5DJAA 4FEIA 4G8FB 2X70A 1LDPL 4TLKA 3RNQB 5CAYB 1TJXA 1PD0A 5LUMA 1UD6A 1KENH 3C60B 2ZIDA 4W68A 4ALAC 4APQD 5D1XD 4RFNC 2NUTA 1TETH 1QABA 1Q9LB 1J1XH 2HUEA 3INOA 3NFPA 3VB9A 1INEH 3QNYA 4E41D 3M17B 1MI5B 5TTRA 4V33A 3QFJA 4TNVK 3BVNA 4P07A 1CDHA 4QI3A 2KZ1B 4RZKA 5SWSE 4BEIA 4PGCB 4F7MA 3OX8B 4XCEA 3FH7A 4QRQB 5ICXB 2P5EB 2XN9A 8CGTA 2C3VA 2OTWA 3L54A 5DJXA 2PTTB 2VMCA 2Z35A 3KS0J 1XD0A 2HLEB 4LHUD 2G2NA 3SDYL 2YXMA 2O61B 2WM0A 4ZQKA 1UEMA 4BUQA 1F8TL 1WRFA 5L88L 4I8DA 3CZJA 4ZX5A 3SJVA 5HTSA 4YSDA 3N2JA 3AUWB 3QZWA 3KGSA 4JZJC 3U46A 1QRND 2QSVA 1QWHA 3HAEA 3FRUA 4XN2A 5EUOB 3GJFK 3WS6A 5KWYC 2Y07H 1GJUA 2CR0A 3JTTA 1BGXH 1BM3L 1H0DB 1MIEL 1VZGA 2HJLA 5IF0A 4YWGH 4PJGA 5GGQL 4JQXA 2CJSA 5DK2A 3FU7B 3U0TB 4YDIL 3O3AA 2IDSA 5BPPA 2NDGA 2JB6A 3U7WL 2COVD 3K71B 1T1WA 4N5UA 5HYSG 2AK4B 1AXSA 4JFWA 3V52L 3VFVB 1VKXB 3L4CA 1HEHC 4R4BA 2WINB 4MJ4A 2OK0L 3EOAB 3UTSB 2AJZB 1Q9OB 2OJ1A 2FT8A 2ZSWA 3E3QC 2NYYD 3QJSB 4UBDC 1UKQA 2XKNB 4V11A 3CZUB 3VFPA 4JJHA 5C0AA 3MZTA 4B9GA 2P47B 4MS6A 1AP2B 3IVKB 1C5CL 1MH5A 3EYOA 1SY6L 3OKNB 2EDOA 4Q9BA 3RDTD 1XR9A 3ZZSA 4P9HH 1F4AA 1NC4B 1T21B 3OLEA 4YGVA 4LVOC 5ESAB 4L37A 4MQ7B 1DP0A 1WBXB 1FAIH 3QUXA 5ES4B 1JI2A 4FNLL 4Z7OB 2J4WL 4M1CC 4QXTB 4RFOH 4AGOA 4BCXA 4U4BA 4KRPB 2D2OA 2WBJA 4NZDA 3QIWD 4FXKC 1NLDH 4FG6D 2WCPA 2OZ4L 3L5IA 2KL6A 5HDLA 1F41A 2Z34A 1NUGA 5CUSL 3JWDL 2BVQB 2ARWA 4HUWA 4YFLI 1BAFL 3HEIB 5EU7E 2V5SA 2WMPB 3KW7A 1JVOA 3AQXA 4HIHA 4HWNA 4U1LB 5DZLA 3SDAC 2XA3A 3UBXB 5B4MC 4ATTA 4N5ED 3KPLB 4KOBA 4R5XA 2D03L 2E75C 3TVMD 4EE2A 3DV4B 3P2BA 3V55A 2XI9A 3UJIH 1G9EA 4D8PB 1OAXH 1LO5A 5MP6L 3FJTA 1FVEA 2C8NA 4YFEA 4DUWA 3KM1A 1QASA 1KLUB 2D7PA 5IJBC 1SVCP 3GXTA 5CZXD 3FCGA 4XI5C 4M6OH 1L7IL 3LEVL 3AM8A 4XT1C 1JZIA 2FT7A 1A1MB 1G7MA 1JHLH 1OAQH 3GZPA 3OVUB 3B9KA 2VKWA 5JDSA 2EVHA 1YY9D 1MXDA 2AQ1A 2VXSL 4LLVB 5DHMC 5CSZB 1G7QB 2EYRA 3KJ4C 1I3UA 4AGNA 1JHTA 1FRGH 4G5ZL 3HBGA 1QNIA 3GYRA 3MRQB 1I8AA 3VXRE 2WWNA 3S48A 2YN5A 2WZ5A 1X4YA 4IRSC 2WP3O 3DYMA 4JREB 4MDRA 3BD4A 5DA0B 5FO9A 1JF5A 1Z5LA 3WUZA 2YKLH 2Y5QA 1ACCA 3OPZL 2CM6A 4FJ6A 3SGKC 2BS8A 3VXUD 4F7TA 4U1JA 3UTZA 2V2XA 3E8UH 1OCZB 2ZKHH 5FFOA 1YYLL 4MZ2A 4DKEL 1S7SA 4X80L 2BPBA 4UT6A 1A9BB 3SKNB 2X5PA 3WMSA 2NY7H 2YAEA 1ZT7A 1I7UA 4PCTA 3WEOA 4Y1SA 4U33A 4LPYA 1ADQH 4XPBL 5B39B 5T5FA 4TOYH 1NCWL 3DSFL 4JRXE 5DO2C 2FRGP 3D39B 1MFCH 5J6HB 2FQDA 1RK7A 1ZY9A 5BV7H 4MNHA 1K6QH 2PYEB 3HNSL 4M3HA 4AIZA 1WZAA 2ZQKA 3DVNB 1AHWB 3V9EA 1M7IA 4PSRA 4ZOCA 4FQHB 5I1DA 2HLAA 3D08A 1DN0A 2DM2A 3O81A 3BD3A 3L2NA 3LKNA 1S7QA 1WBYA 2UY6A 4J3VA 1U58A 5HHOA 3MNWB 4N0YH 4NKIL 5E03A 3RRQA 4XNMB 1I1AB 1MI5D 4XMXA 3D25B 2CHNA 4IHOB 1G0DA 1HSAB 3ORJA 4PU2A 4F57H 2VDRH 4XNUH 1CXKA 2HFTA 3K8LA 3KJ6L 3TJEH 1M1XA 2VZVA 2J21A 1V3MA 2A6KB 1SYVA 3GB7A 4UINL 4CILA 1WPCA 3N1MC 3H2WA 5E7FA 4HKJB 2A9DA 2G5UA 1NGYB 1JXDA 2Q7YA 4PB9H 4TSCL 3AQYA 3HZYB 2LW3A 3O3EA 4B9CA 3EHBC 2IAMA 2F58H 3ULSA 1DUYB 5LDUA 4Q9RL 3STBA 3BN9D 4ZW8A 1OAZL 1BZ7B 4IGBB 1MNUL 3O6FC 4HMCA 6PCYA 3S8WA 5DDHA 4W6YB 4UILL 3A47A 2CO2A 2D31B 3GIVA 5TF1H 1RU9H 4CMHC 4N1CA 1P84K 2WLIB 2DJMA 3KDMB 4PS4L 2KHAA 1R5IB 5GQBA 2H7WA 3EO9H 4OLZL 5D8JL 1G7HB 4NDMB 3T3PF 4UQ3B 3ZN6A 5I1IL 5AYUH 1O5DT 3FMGL 2DMHA 3FUHA 1UUSA 2FEDD 1X9UA 1OSEA 1PZUB 2B9BA 3ZRSA 2X4SA 5D7JA 3WNOA 4WI4A 5IBUB 3FB5A 4CDHA 5HVHB 3UTSD 2DZEA 5ITBH 5HHVH 5CILH 3DX2A 3SDXA 4P99A 5FCUH 1C16A 5CN1A 5JW5B 3RIFK 3H4HA 1AMXA 1UYWL 2ARJB 4YFLF 5KOVC 4ZK8A 3X13A 1RUQH 3CDGA 1WO2A 4EOWL 9PCYA 4ODSL 4N90E 3TBYB 3W0WE 5EU5A 3IFLL 4KI5F 3V5KA 4AZUA 1AGCA 3O6LL 2ZJSH 1JGDA 2V3FA 2EYTB 4JUSA 4XWOD 2YRBA 3CPUA 5EWIL 2Q0ZX 3ARGA 1TEGA 1W8EA 4R83A 1BVNT 1KPVB 1BV8A 4ZX3A 5DYOB 4MBOA 5EZJA 5FHAH 3LXCA 5L0QC 3FXIC 4KRPD 3RWFA 4DKFH 5IB5B 5F3FA 3NJHA 1QLFA 4P4RA 5CD5D 3L3GA 4JO2H 5E2VH 4PRPD 4LZKA 3U0PA 4TUKH 2BSEA 2YUVA 3GJEA 4KK6C 1WFOA 4EEEA 1RFDL 3FQXA 4JDZB 4XVUC 5FYLL 2PP9A 4AYSA 3F83A 1PU0A 3BESR 3A22A 5HYJB 1EXUB 5I30L 4NWTL 1MRFL 4LLQA 1R3HA 2Y3NA 2Z0UA 3CX5J 3NJVA 3R8BB 4Q6IA 2CH8A 5JA9A 4M7LH 1KGXA 3MREB 4F2EA 1EJOH 3C75A 5AB2A 2CQVA 1LD9A 4U2YA 4P9HC 1NPJA 3VI3E 1DVYA 3NCFB 2RMNA 3HE7D 3U4EA 1ZJAA 1SMOA 1TZOA 1PDKA 2BZ7A 2OS7A 2W0FB 2KQMA 4GQ9H 4ORGB 3TPUB 1MCDA 1PX8A 4WWKB 1JYNA 1KY7A 1UKSA 4KY1L 4YNYA 3ZIMA 3QDME 5EOTB 2G3MA 4J27A 5SWQA 1DQQA 1XSJA 1BMGA 3QZOA 4WI6A 1HHIA 1X4ZA 2AXGA 2FUTA 1PCSA 5L7XH 2QKSA 5EEVA 3CWGA 5C2BL 1GC1L 4ONGH 3D18B 3PGFH 2JI3A 4FFTA 3SCMB 1KYFA 3Q8BA 4PJAB 5KBKA 1KCSL 2DQDL 3DTUB 3VYNA 3SGEH 4QTHA 1JHKL 5B1BB 3MLRL 5ABDE 4FA7B 4FZ8H 3K6OA 3NEOA 3RUGF 5HP5A 4JQIH 4OFPA 3K2MC 4BCYA 3KBHE 2VLJE 4NQCD 2QMJA 4WEMB 3CE1A 4GNKB 2BNQB 2YOAA 3GS7A 5I19L 3C60C 2GKIA 4XAKD 3O6KH 1E43A 2B0SL 1BJ1J 1GMIA 1MHHA 2HT3C 4W9DC 5ISZA 3KEDA 3ZE0F 1OK0A 5IIEB 4NC0B 3LXBA 1EAJA 2ZAGA 4N0FB 3B43A 4X50A 5GGTA 4WNQA 1Z9PA 3ULAB 5CXPA 1A9EA 2DL2A 5ALBL 1SF5A 4OLVH 3PJSA 5HHNB 3TCLB 3QS3A 5C07A 1DEDA 3MR9B 2SEBB 5DUJA 3RJOA 5JORB 2JCCE 4FC3E 1A21A 1S9YA 4R7DA 1I1AD 4R7VA 1B2WH 2HLFC 2WO2B 3BC9A 3TZVA 5IOPA 5JQIB 1OB0A 3UJTH 4UTAL 1MVUB 1HXYA 3GI8H 2Y7SA 5EUKB 4JHWL 3TO2B 4G42B 5A2AA 1TQVA 2HX9A 4XHJC 5HDWA 1ETA1 3UEZA 3BKCH 2YD9A 4RMSA 3SPIA 2WN3A 4HH9B 1G0XA 2GFBA 5E8EB 1FVCB 2AZUA 2ZD0A 4GY4A 3OSKA 1MHPL 5BV7C 4M7ZB 3OKKA 3I9PA 1ZV9A 4AYFB 4ELME 5HPMA 3ZYOA 2H1LM 2ZSVA 4JJ5A 5E94A 3RFZA 4IGBD 4KKLC 4ZDHA 4FFYA 1U0QA 3CC5B 3WNIA 5F7YC 4YK4B 5KZCB 3DUSA 4QHNA 1BQHG 3TH2T 5JW3L 4NUQA 4NFCA 5H37A 2BVOB 3GBEA 4X6BB 2IH3A 4Q9CA 2I07A 4K23H 4DP2X 4BK5C 2PW2B 1PFOA 2WWOA 1QI3A 3LPPA 2VWEC 3WTVA 1A6VL 4LCVA 2ICWJ 3WIIH 1TFHA 2PTVA 3GEFA 4PY7A 3T0BA 5FYJL 2K6YA 3BVDB 3QIUB 2DQCL 1ADWA 3RI5F 5CEZE 2VB5A 4OLUL 3C2SA 4W9LC 2IWFA 3ZSTA 1XBRA 1BOYA 3GXFA 3MLYH 3NH7L 3QIBA 1S9KC 2Z1KA 5TE6L 4QR7A 2GJPA 1FH2A 3A67L 4BCZA 1DCLA 5I66B 2CUIA 4KJPD 3IBEA 4WY7L 3HG3A 2WB1A 5KBPA 3ATEA 5IFJB 2V2WA 3QG6B 5B1CA 3PWLA 4PRIA 3PXJA 3KPMA 3M7FB 5KW9L 2EKSB 3TWCH 3VMPA 1J48A 2R69H 2NRDA 3FUFA 3C8HA 3PHQB 3U6RB 2FYVA 1Y1DA 3L7EB 4JX0A 3ZSSA 2PPCA 3FU5A 4GRLD 1JNHA 2EEAA 2VMFA 2X6UA 4F7CA 3FOLA 1F11A 3LHPH 3IXAA 3Q5OA 6TAAA 3RZCD 3UBGA 3AT0A 5ECGA 2IADA 1JWUA 5IVXA 3UTPD 2P52A 4JM2D 2EEBA 4E9TA 3HVDA 2E76C 5FB8A 3GIZH 5HVFB 2YC1B 4LF3A 1WH0A 4FE9A 4BFKA 5I73B 4YLBA 4D0CB 2OMUB 2ZONA 2FO8A 3OSVA 3P2DA 1MJJB 3P3RA 5I16B 1GTNA 1RK0B 3ES6B 1FLRL 4GAGL 4OJFL 1DVQA 4KXDA 1YEEL 3HNVH 5HYJD 2EDKA 3GT6A 1KPRB 5J6GB 4OBRA 5CCJA 1MKFA 4M5TA 1BBDL 1LK2A 3DOSB 2CHZA 2ZXBA 4G9FA 3T0XA 4KK9C 1GPOL 2EIMB 4G70B 3A3YB 3WHXA 2VMJA 2Y06H 4U3XA 4DERA 1IJ9A 4IBYA 1J87A 2EC9T 4W93A 4YHMH 5DUMH 3KYAA 1JD7A 3B6SB 2X1OA 3ROOB 2F8IA 1EEQA 3FSZA 3KGUA 3WENA 1CURA 3ETSA 4QHLB 2L7QA 2Z4TA 4PJEB 5IW6A 2G75B 3B5TA 3TBVB 4JREC 1QEXA 1SLVA 3WNPA 1OGAA 4O02L 4HJGB 1UGNA 1IAOB 3I3EA 5JQ6H 5IQ7H 4Q56A 4P49A 2WQXA 3TXAA 1FO0L 3M8OL 3ZE2F 4MA8H 1LO3H 4UANA 1HL8A 3H7LA 3HG1D 1GAFL 3ALXA 5CGYD 2MQCA 2AXHA 1RJLA 3IPBA 3ESNA 1BW8A 3SCMD 4L8CB 3P1VA 2BNRB 1T3FB 1YEFL 5GRUH 1UZ6F 2BMKA 5CFHA 2HRPH 2QPDB 3HA0A 4GAYA 1I1FB 2ATPA 4WTZA 4XE0A 4M4RA 4Y4FB 2GJ6A 4WHYH 3UGUA 3MUUA 3U9PH 4P23B 1V3LA 4W9FC 1EZVY 3LY6A 4AMKH 2ITEA 1S78C 1T6WA 2FJUB 4WF7A 1WP6A 5DEZA 3TYGL 1AHWC 1BD2E 1ZEAL 2PO6B 1KYDA 2F8OA 1S3KL 3QCUH 4LHUA 4CN4A 3CDFA 1UOVA 2NNAA 1MF2L 4GP8B 4PJ5B 5EPMA 3GMRB 1LP9B 9CGTA 3MO1A 1RIHH 2C7UB 4XXWA 4AIOA 3PFUA 2NW2B 5EEUA 4QOKE 1FLTX 5LDSA 1LXMA 3SGJA 1NCJA 4POZD 1MCOL 4RQQA 2R2EA 2VDML 3MRPA 4DN4H 4MAYD 4PP2A 1CICA 3KYOB 4XCFH 4HIEA 1QRNA 5T3XH 1UB5B 2CLRB 2ZICA 4OVVA 4BFEA 1ZVSB 1CLOH 3VGGA 4OCXH 3TF4A 5JOEA 3O2VL 2XQBH 3KYNA 1R5WA 3M45A 2B1OA 3GBML 3NFNA 3BRFA 4KO6A 5E51A 3L7FB 1AGFB 3E3QE 1YG9A 3RVUC 1O0VA 2V7NB 3M07A 3IJSB 4ZZKA 4JCLA 1BOGB 4ZW6A 3V7MA 1IEAA 1ITCA 1MJ7H 2AFNA 2IQ9L 2BZDA 1J8SA 3MCLL 1AGEB 1OP4A 4KO7A 1NUNB 1M4KA 4GQQA 3FB8B 5CJQL 3TTSA 3A6CL 5FHBH 5J56B 1ZS2A 3MRCB 3DDGA 1E6JL 4ELKA 3FFCA 4HZ1A 5FKAA 3LH2L 4PJ7B 1JCKA 3QUHA 3WJMB 4YHYC 4XNYL 3PWVB 1QLEB 4ONHA 4ZOBA 5AZ2L 3ARFD 4G43A 1QHOA 5E5UB 3GRWH 3NRPA 4BFJA 3LV3A 1DBAH 3QAZC 4MNGE 3RDTA 3O45A 2NXZB 2X1WL 3P54A 5HVHC 1FFOB 1X9QA 4Z7UE 1UATA 5I82A 3OKEA 1UM4L 4JLRA 1IL1A 1YN7A 1MLCA 4QTIL 4K4KA 5FFGA 3PAUA 1A64A 3G5XA 3TIDA 4ZFZB 1XZ0A 4OLXH 4P3CL 1UG9A 2DTML 5DWPA 4KDTC 3ELAT 1FFPA 1NGQL 2G60L 4F80A 4PRDA 3ZT6A 3ZT7A 2WXQA 5ACZB 3GHBL 1BZ9A 4MCMA 4HPOL 5ABAA 4BFBD 2VN5A 4JHUA 4LLUB 3S96B 1Q72H 2FECI 1FGVL 3HUJA 4GW1A 2A3TA 1E50A 4LBEA 5FA4B 1KELH 5KOMC 4OM0L 2XN2A 1IZKA 2IBBA 1HHJB 1FIGH 1W8NA 2Z0BA 3RTQB 4R5VA 4HIJB 1UEYA 4OD2B 2UYLB 1S9VA 1MCHA 3NIGE 2Y3AA 3FQRB 4PJCE 2BIMA 3HIZA 2B39A 4DP4X 3GSXB 4F1ZA 2DWEA 4U1KA 5TFSL 3PE9A 6FABL 3GXIA 1JGVL 3CPLB 2W07A 3IJ8A 3DI2B 5C0BB 1UQSA 3CNKA 4P3DA 4G6AD 4UAOB 5E95B 1EEZB 5DS8A 3VD9A 1PLAA 2WVVB 2EXWD 1EZLA 1HXMB 1X5JA 1U6AH 2ROYA 4NBXB 5BZDA 1QQDA 2P5WB 4G7YL 4YO0B 2YMOA 4GSDH 4GT7A 2P44B 5D7SH 4L3EE 1EBPA 4H5SA 3ETTA 3GSRA 1U4EA 1L9PA 1I9IH 2Y25A 1WIPA 3BIKA 3CV5A 3EUUA 4DETA 4EO5A 2R59A 1XF4B 3L3HB 1NCCH 2HJFB 2F7IA 4FI6A 4WWKC 4RA0C 4HHAB 5DMIH 3NCWA 1MREL 5JW4R 4HV8A 4NQEE 2DQFA 1DO6A 1MRCL 2ZWLT 3KCWA 2FGWH 1FDLL 1OE1A 2V9QA 3P77A 5I17A 4LCYB 4LP4A 1KCRL 2FHCA 3PV6A 4PVLA 4YE0A 3QXWA 4D7BA 5AVYB 4DWHA 1R3IH 1UD3A 4GJTB 4QTFA 5G5DB 1BYNA 3QZPA 2H0EA 2FL5A 4AC2A 3MOQA 3QQ4A 1U8CA 3BWAB 4JVUA 1U8NA 1PEWA 1MLBB 2PN5A 3SPVA 4WW2F 1YAIA 1LL1A 3V5DB 3MODL 4RNRB 1W0YT 3US9A 3D0LA 3GBDA 2EDLA 3RVWD 3SB3A 4QYOB 1F1DA 5IWLC 4MMZA 5KSAA 3W0WD 3EYFA 2WTRB 1SDAB 4OZHA 2KDYA 5J1AB 2FSEB 2HWZL 4KMLB 5GRVL 2UWEE 3WNNA 2K8MA 3BQUB 3R1GH 2CPUA 3OKDA 3LN5A 3NIDE 2ZKMX 1ROCA 3PAYA 4Y4FD 3DK2A 3P4OB 5EC1A 3K72B 3T0EE 4P23D 3PCYA 5ID1A 4ZNEE 2AMGA 4WO4C 4FADA 3MRGA 1CFMA 2ED8A 2NZ9D 1NGXB 2O5ZH 2QVKA 3KPRB 3HFML 3PUCA 3OZLA 2LR4A 5GSVA 1QLEH 3VU2A 4UNVA 5IGXH 2DICA 3T0DA 4HQQH 4X9GA 3LMJL 1SYSA 1OSPH 1A14L 1I8LC 2MPVA 4Y2NA 5I2IB 3IDNA 2BSDA 2ZXWB 3DDFA 3IAPA 3GSWB 2IANB 3OLDA 3RKDD 1ZA6A 4JO5A 1F0LA 2VN7A 2WXOA 3WLBB 1I9RH 1MFAL 4OLEA 4Q74A 4ZOAA 2ICEB 4OVUA 4G6FB 1I1CA 1ZV2A 5KVDL 4Z7NF 1S7TB 2APXA 2Y7OA 5F1IA 1UWYA 3C5ZD 4NQVA 4Q6YA 1CI5A 4JFHE 2B1HH 3WIAA 3FT2A 4JFSA 3L4XA 4K9JA 2UVFA 5HHME 5E23A 1T4KB 4V1DE 3ARXA 2RCSL 1W6LA 4J3WA 4FFVC 1DVFB 1MCWM 3QGVA 3JWNH 4Y2DA 1ND0A 1AGDA 4OZIE 1BEYL 3DO3A 3ZDZB 4EUPB 5ID0B 3CXHJ 3A6BH 3IRZA 4KKRA 2G2PA 1E4XH 2X4RA 1DCEA 3FO2B 2XIIA 4O9HL 4YK4C 3T3ME 2WQVA 2GJZA 2EACA 5GGRY 4WTXA 1AQMA 5DFAA 4XOEA 4M1DH 4X6CB 4JFPB 1MELA 3HHMA 4UT9H 3OAWA 3P4NA 3WFHB 3BUYA 2Y6SD 3F8UB 1X44A 3GXDA 3MNDA 4IOIB 2VLKD 3POHA 4XCYB 4WW1B 4PM1A 3PABA 2DF3A 2QMKA 3S35L 5I18H 4PRNB 1LYQA 5C0CE 2HTLC 2PXYC 4GO6B 4XX5A 1VFOA 3QIUC 1MVFA 1EAPB 3CSBA 1IAIH 2CLZA 3D0VB 3KHOA 3SOBL 1D6VH 4ANVA 2GPZA 1WEJH 1K4CA 1JWMA 5LCVA 2QFRA 1T22B 4HFWB 5A3IC 4AE1A 2H2SD 2JKWA 3O41A 1F6FB 1HE7A 1OZTG 1PLCA 1FZJB 2YMXH 3FAWA 4PLKC 1IBDA 3X17A 3LNDA 2X4TA 1O7VA 1YNTF 2DRUA 1R47A 4N26A 3GF8A 1UWEL 2NR6D 5C0GA 5EF3A 4YHPB 4PRPA 4I9XA 3AB0B 5J11C 2CJUL 4EN3C 2WVTA 1TJGH 4K3JL 4AH2B 4HK0A 2E56A 1MW0A 4HEME 4ANKA 1D9KA 3UERA 3GUTA 3I75B 1D7FA 4NAMA 4KKAC 2B5IB 3BRGC 1A3LL 3NN8A 4K2UH 2YQGA 3SD2A 1KTLB 3EFFB 5JQHC 4ISVA 2KDGA 2IALB 3VXPA 4Z23A 3F6LA 2BIOA 4XMPH 2YBRB 2HVBA 4MYPA 2MCPH 3OR6B 2HA1A 3DMMB 5EULV 5I73C 4NLHA 5K9OA 5DD0H 3PP3K 4OTXL 4Y5XA 2XZQL 3DX0A 4XODA 4ODUA 2QGDA 5F1OB 3KWVA 2VZTA 1HINH 2HT4C 5LGHL 4LPCA 3RX7A 5C0BD 3CDCA 4R4ND 4G1MA 2IFFL 1IBHA 3ZYZA 4S0HA 4XMTA 2VM9A 3NA9H 3AT9A 4A38A 2P5WD 2PYFA 4P5RA 1ETB1 3PWUA 1AD9B 2BHFA 2FCBA 3WTUA 4IS6A 3VGHA 5JMOC 3EYUH 3WKMH 1IGJA 3T2NL 4H8VA 3BH9B 3TYFA 1N59B 1KIUA 3O8XC 2F74B 3MLVH 2XX1A 2E5EA 3TN0B 1PY0A 4GKSB 4WEBL 5IB4B 3DX7B 4Y5VB 1T04A 1WZLA 1FFNA 2V33A 5AW3B 5IY5B 1BLIA 4GUCA 3V4LA 1I8MA 1MZZA 1Y07A 4QXUL 4IMLA 2VC2L 5DSCA 2C1PA 2ZOWA 3L1OL 2APWA 5D71L 5DJZA 2YD4A 4AUYA 5I1AA 4FXGC 4NQCA 4ETQB 4MZIA 4H26B 1UXSA 1KCUH 4NN5B 4DGVL 4NLAA 5CJXA 1PJWA 4LEOB 5CN2A 4L9LB 2H47C 3N43B 4HW6A 3QEGH 1XXDC 5EEYA 2FX9L 3GM0A 2P5EE 1T66C 5CNHA 3QRBA 1HL5A 1Z0NA 4DP5X 3TCXA 2WIIB 1KTCA 4XB3A 4N0CC 4AV5A 1TTGA 2IDUA 2Q5BA 3IDGA 4N8VG 1IUZA 4EUPH 3VW3H 5K59E 2WB7A 4YS4A 3I02B 3QFDB 2XETA 1PMYA 2Z9TA 2DKUA 2FNWA 1A7OL 4FJYA 4PRHB 5FA3B 2PO6C 3S98A 2M2DA 3CFTA 1FORL 3K81A 2D3NA 3C2AL 1IO4C 2YS4A 5DMGD 3OAYK 5EUOE 3OB0H 5IFHH 2BZCA 1HFUA 1P7QA 4H0GA 1PVHA 2C5DC 4GMSH 3W82A 5DEFB 5C09A 1GJIA 4U7SA 3V4VA 1M7UA 2FD6L 1TCRB 5FS5A 1AFVL 4O58L 4PV9A 2A6DA 3MGOA 3FZUD 1KJVA 1LDPH 1HAUA 1RUPL 3DX8B 5A2LH 1S7XB 3FOMA 4CC4C 4ZZFA 2IAND 4Q9QL 1ZLEA 1DUZB 5MHSE 3BP5A 4DOHB 1ZK5A 1U36A 3FB6B 1AD0A 4X5XB 4IKKA 2XICA 1NBYA 2ADGB 1PKQA 3EUDA 3F7PC 5AB9A 2ADJB 3L3KA 5K93A 1L9NA 3ARBB 4A2EA 5B38A 3B3IA 5GRJH 1SDYA 5AVRB 1SJEA 2I27N 5IVOA 4AM0A 2Q86B 3I6GB 3SDYH 3WUWG 2DB8A 1F4HA 3SBQA 2X38A 3O2DA 5D7IE 2RFXB 1F8TH 2QQQA 3DVFA 1EEUA 4QMEA 1BJMA 1U8MB 5L88H 1KXTB 2X12A 1DQLL 4UV4L 4E0RB 5M7QA 2CR6A 4PGEA 4WV1B 1J0KA 1XGUA 2MHAB 4X5WB 2RR3A 5C0JB 1IGYA 2ID5A 4MAZA 4QRUB 5ENWB 5E6ID 3BVWA 4B50A 4JM4L 2L0DA 2EXYC 2NXZC 5AW2B 5FDWA 4AZ8B 2BOCA 2NQCA 2JKNA 3LSOB 1BM3H 4NXKA 1MIEH 2W88A 4Y5YA 5IEHB 2JJUA 2VXVL 4NPYB 5GGQH 3T4YA 3FTVA 1HZLA 2AP2A 2V5TA 4OW6A 4YDIH 4F8QA 3Q13A 3GWJA 3U7WH 1UM6L 4QYAA 4GG6E 3GBNL 1XAUA 2AANA 2CA3A 3MFFA 1C7SA 1DEEB 5SWSA 2X9YA 4HKXA 2JIXD 5TH2A 4ZQTA 1ZA3A 1F1AA 4GRLA 3JWNC 3SE4A 2WYIA 3U48A 2OK0H 1BD2D 2CKBL 3HB3B 3RZCA 5CFAA 4NT6B 2XN1A 4YC2C 4FYRA 5PCYA 4L23A 3SDCA 2AGJL 4BZ2L 2Y1AA 5GZND 4UQIM 3MV01 5T3ZE 2CK0L 2DQIH 3RTQC 4ONOA 3P9LA 3VG0L 4F3FB 5L2JB 4RWHA 4QOKD 5DJDA 4FA8A 1R75A 1XGPA 1BVKA 1EMTL 3HC2A 2OXHA 4KKCC 4BELD 4PIBA 2N01B 3HI5H 1KGCE 1SY6H 1MVYA 1YEDA 3GLDA 4M62L 4XP1H 4N2BA 4LLYB 5FGBA 5DQDL 1KWGA 4ZI8A 4NENA 2ALAA 4FNLH 2DN7A 3TJHD 1N2RA 4AT6A 1FHNA 5D1QB 5CJ5A 4KKNA 3LN4A 2XZCH 3LKRB 3H42L 4GINA 3SQRA 2DQUL 2ICWI 1YY8A 3A4AA 4C4BA 1SHSA 4LSTL 5AW4B 4HOWA 4E5XB 4K07A 4V2BA 3Q05A 1AR2A 5FCSH 3MRRB 4A6YH 1OF0A 2CLVB 3VVVA 1BAFH 2ENJA 2MTPA 3FS9A 3PAVA 5DZ9A 3IK2A 5ALCH 2D03H 1GZHC 4EDWL 3T4AA 1GSKA 2IBZX 3MZGB 5MP6H 4Z3IA 1XH3A 4WEEA 3D39E 4KDWA 4RIRA 4G9DB 5DD1H 1N5YH 4WWPA 1UB6A 5ECJE 3GLZA 5KYUB 5MERA 4KTDL 4DN3L 2H9GA 4LCIL 3BKJL 3VRIA 3LEVH 4YSPA 2Z7ZA 1UOLA 1H8LA 3TA3A 1JTOA 2X7LA 4Q97A 3C5SA 1WD8A 4HWEH 4G80B 4KJYB 2ERJB 3A0OA 5DHXB 1F86A 3NPZB 5FC9A 1BYOA 4X4ME 4IM8A 1KFAL 4TNWF 3NSJA 3H55A 2XXFA 3N06B 5AUMB 2D0HA 2BHZA 5A6MA 4R7LA 1JV2A 1EO8L 2CIKA 3QEQE 2K9FB 2CGZA 4G5ZH 3LEXA 1I7TB 3FN0L 4NNXB 3DIFA 1RZJH 4L8SC 3BQUC 4EN2A 1ILSA 3PL6B 4ZS7L 1ZK9A 4UOW1 1GIGL 3QXVA 3ZTJH 1OCWL 2F0CA 1J86A 4MAYA 3CSFA 2B4CL 1ONQA 5F9OH 4IOFD 2NMSA 2EDTA 5LWYL 4X80H 1OOWA 2EVJA 1XEUA 5D7KE 4AK1A 3QDJE 4X4YB 2VOTA 5EORL 5IUCA 4X8JA 1YPZB 4TLUA 4U1NA 3IEAA 1NCWH 3DSFH 4LP8A 2NCMA 5AW7B 4C56D 3S37X 3VCLB 5C0DB 3DPBA 3V0VA 4E9YA 4U1MA 1G5AA 3HNSH 5IV2B 1TF4A 5HGBA 1JG9A 1WWWX 3BDYH 4L2YA 4RISL 5D6CB 2P43B 4J2XA 5AWNL 4PV8B 3KCPB 3SYQA 3IDYB 5JA8B 2QVTA 2G2RB 1DVFC 2GBVA 3VXRA 4PI0A 5JHLH 5DHDA 1XD1A 4NKIH 1TNMA 2BSRB 2P8PA 2EIZB 3RE0A 3FQTB 5FO8B 2P8MA 4I85A 3IETB 4JFDB 3RY5A 4PTTA 1GL4B 1IVLA 4MA3A 2WTPA 3APFA 3KJ6H 4W9IC 4YDZA 2RIKA 5AAMC 3KPSB 4KK5C 1ACYH 2VXUL 3ISWA 3W39A 4AYDC 4ENED 3FT4B 2Z1PA 4UINH 2P7TA 4MVBC 3IFOA 2ZWYA 4D2NA 3ILPA 3RURA 4Y16D 2WW8A 5B1JA 3EW3B 4FRWA 3GSOB 4TSCH 4Z7WB 1GSMA 1B6DA 3N41B 4QIRA 1KG0A 2ZKXA 4Q9RH 4JRXA 4UNTA 5ICYA 1OAZH 4ADIA 3HZMA 3U4BL 3FT3B 1CFSB 2HG5A 3GXNA 3SE9L 4UILH 2HMID 3OXRA 1KGJA 1MFVA 4XP9L 3S2AA 4Y9GA 4NQXA 3QJRB 1PZ5B 1LE5A 1OM3H 1J0HA 1A1OB 1WCQA 4OLZH 3TX4A 5D8JH 5I1IH 3PHOB 5IBLD 3BRDA 3FMGH 3SQBB 2UXFA 3BKYL 1B0RB 4QF1B 5AOJA 3T0ED 3AB0C 2EIKB 1TQCB 4HVBA 4OKVB 4PS3A 1LWJA 2ZCLL 2IGFL 3SKMB 2YWYA 1DBKL 2B5IC 1N0XL 5T8IA 5M95B 4F9LC 1M05B 1P7HL 4OQTL 4F5CE 3N85L 3QYMA 1UYWH 1NFIB 2JELH 4L48A 3B2DC 3AADB 3B8SA 4EOWH 3IMWA 2WY3B 4RGOL 4ODSH 3FPYA 3MMEB 3IFLH 3DMMC 1QUPA 4IMKA 4X5QA 3TPKA 4E2OA 3O6LH 3TBSA 3MTRA 4N6RA 3KLQA 4JFHD 3AXHA 1NMBL 3IRPX 3U9UB 4G6KH 5EWIH 5I5IA 2A9NL 4LCCB 5HHMD 2QLVB 4V1DD 1ETZB 1F1GA 2WXJA 1Z1WA 1Q9WA 1S9WB 4CMMA 1HCZA 3ESVF 1OB1A 3CVHA 1PKOA 1QYGH 4NGHL 4PJAE 5DC0A 5I6MA 2AJVL 1F18A 4I0PD 4F20A 4U6HA 1WGOA 2BXYA 4IOSD 1MCCA 2EYSA 4LFHG 1UM5L 1N68A 1XCQB 5GZOC 3MCKA 4BDVA 4Z7VE 3BHBA 1BVZA 1F3JA 1RFDH 1MIML 1NKRA 3AY4C 2VO5A 1B4RA 3TN0C 5I24A 3IDMB 3RBSA 2BNQE 1T20B 2JI2A 1MRFH 2VN3A 4QRRB 4Y5VC 3STZB 4IDLA 2EDXA 2XZZA 1N0LB 3ZKND 3OC5A 5BUGA 4M1GH 4Y4KD 1QATA 1JS4A 3WTSA 2J20A 3BUQA 1W0VB 2FBRA 5C0CD 5E8NB 4PJBF 4UU9A 2WLZA 3W0WA 1GZPB 2AQSA 3QNXB 3X1BA 4NN5C 2X44D 3L3OB 3ZKMC 4GXVL 4ZUTA 4L9LC 1KYUA 2MQGA 5A43C 5EIQA 1DQJA 4XNXL 1T0NB 3VMNA 4FEMA 1U8KA 4FTVB 4IK7A 1IT9H 4KY1H 5AKRA 4DEWA 4HG4J 4TNGA 1LM8V 3AREC 1BX2A 4O2CA 3CN4A 5D7EA 3LRMA 2CG9X 1BIHA 1T83A 4L4JA 1U91B 1U8PA 2ZX7A 1Y18B 1WYJA 4AJYV 4JQVC 3AWGA 4CW1A 3AABA 5C2BH 1GC1H 4WTWA 4GO8A 4PJGF 5I8CB 3FYIB 3PL6D 4AQEA 1KCSH 4JFEB 5TGBA 1XHHA 12E8L 3MBED 4K15A 2QTVA 2OMTA 4PJDE 1JHKH 3I6KA 3VXTB 3RL1A 3MLRH 4HK3J 1FH5L 1S7WA 1WAPA 3BQVA 5J13B 1MWAA 3QUZA 5JXAL 3C5ZA 5FYLD 2N4IA 4NP4H 3IDJB 3LS4L 4HWBL 3ETBJ 3RUGB 4HLEA 5JOFA 5PAZA 3TV3H 4QO1B 3VI3A 4X7SL 4F58L 2NYKA 4PIRF 2WWMD 4A37A 2CBQA 1JIBA 1R3LA 3WHE0 1I8IB 1JSYA 3SYAA 2B08A 4AW7A 5I23A 2B0SH 4R2GB 2V6HA 1Q1PA 1V27A 2OMVB 2XPGA 7PAZA 3QDMA 4ZFOA 2RD0A 3KWWA 3SD5A 3G08B 5AAPA 2Z8VC 2G3ZA 2R2BA 1U8HB 3ESUF 3K4DA 4N25A 4JFQA 5BO1L 2Z91B 3K2UL 3V0DA 1J18A 2MQ0A 5T3XE 3ARBC 2VDNL 3BYYA 2VQTA 1RZJC 1Q0EA 4LCUA 1U2YA 2P48B 3QEHA 4Z7AA 5CN3A 2BIHA 5DJ6B 2ZOLA 4ZMZA 4O02B 3IFNL 3VMOA 1I85C 3N5AA 3BEWB 2WQAA 1FO0B 3AU1A 2UY7B 5DQJA 5B3JE 2MKLC 4J3OG 2W5PA 4WUUB 3H3PH 3ZMRA 1XH0A 4OUUB 3G5ZA 1T5WB 4XXDA 1DANU 1HEJC 1ZHKB 2EDMA 5LNDA 4XZ4A 4WV1C 1PZAA 2HT3D 3H9SB 4JHWH 4JL1A 3TV8A 4PG2A 2H1PH 2VLJA 5DJ8A 1P9MA 2B9AA 1VGKA 1TTBA 5IB1A 4R3SB 1IC4H 5EF2A 1MHPH 1G7JB 2CGRH 4GAFB 5BQDA 5L8LB 4HX1B 1QPKA 1JXKA 2CDEA 3ZDYB 1IQDA 2NR6A 3EGSB 3TBTB 3VTTA 2FIKA 4F2ME 1IEBA 3OL2A 2UZIL 3D6GA 4TSAL 2R9HC 3AQZA 3QO1A 1BXAA 5JW3H 2VR7A 3C09B 4LOUC 4N2CA 1J7VR 4UDUB 3L9RA 2O5YL 4H40A 4CJ1A 2WHVA 3HC4L 3HB3C 1ZTXE 2BP5M 1U3YA 1RJZA 2JCCA 2DYPA 2VDMB 3D85B 3QNZB 4N24A 2X87A 4WI5A 1R33A 2G0KA 4JGJA 1J5HA 4BSVB 2Z93B 4N0UE 5FYJH 2JJVA 1SEQL 2DQCH 3VSQA 4HGWA 4MJIE 4IU2A 5FKPB 4MNQB 3UC2A 1DJHA 1PLGL 1OAJA 3OQRA 4YHOH 4DFIA 2CUMA 3NH7H 5CR8A 5D70L 5E5MB 3K6NA 5MEQA 5TE6H 3ZHDA 4R26L 1QWUA 4KKBC 4QRTA 4CU6A 1EK3A 5D1QC 4CDGC 3HG5A 2CM5A 2EP6A 2O93L 2DKMA 4U6YA 1FNAA 4ELMA 4XBMA 4HWUA 5DMKB 5KW9H 1E5CA 1R5VA 1KJMA 2DWDB 1C1EL 4PS7A 2MQ3A 2HKHL 5E4AA 2YK1L 1HS6A 1GHFL 4BIKA 5DLML 1W2KT 2PWHA 1CGTA 1GGUA 3RVXD 3V0WL 1AR1B 3BSGA 2BW5A 4HJ0D 1PD1A 3WN5C 1ZV5A 1I4FB 1QA9B 1ZSDB 3CU7A 4H44C 2Y4SA 4XMLH 3QO0A 3KD4A 1M9SA 1A6AA 2EDDA 2SODB 1M9WA 1CK0L 1FLRH 4GAGH 1SOSA 4OJFH 1YEEH 3BP4A 3DUUB 2DI7A 5DI8A 1N4XL 2RQEA 4WDIB 1BBDH 2ZYRA 4Q2ZB 3LZLA 5JO5B 4R4FL 3ZVVA 3RHWF 1JYVA 4HUXB 3WFEH 3GRGA 3D2TA 5FXCH 1GPOH 2X0WA 5B8CA 2ERJC 4TVPL 1TVBB 3D69B 3QORC 4JHAL 4B7LA 4KRMB 2BVPB 4NQQA 2QSTA 1RZQA 5D7LB 4PD4J 1TVHB 5CKGA 2AW2A 5IKCB 2OMWB 2FJFA 4P0DA 5E99L 3HZVB 3GTTA 3GXMA 3H2PA 1OLZA 4U49A 3VGDA 2NNRA 2C1OA 1D5XA 1WA2X 3DX9A 4O02H 4XNZC 3GHEH 4Y2LA 3RKPA 2WBXA 2JCWA 2BWDA 3M8OH 5T3ZD 4F15B 4DK3A 2XWTA 1P5VA 3JZ7A 1GAFH 1KIPB 2BP8A 5DHVA 3MRBA 3ULUF 3PG2A 1PQZA 2X6VA 3FU6A 2F1EA 1YECL 4PRBB 1YEFH 3N1FC 2QV2A 4X83A 1J88A 3FTYA 1HH9B 5AD0A 1XF2B 1HWWA 1FNEB 5C7XH 1P84J 2MEJB 3PV7A 2NZ1A 4H20L 3B1TA 1RIVL 4FQ1H 3VFNB 5HHPA 3ZL4L 4O2FA 1KZYA 5E1AB 2CHXA 4M5YL 4PJ7E 1ZHNA 3BO8B 5DZAA 3S5LA 1N10A 4GYBA 5EIIB 1B4LA 4WVRA 3TYGH 3GSVB 3BLKA 3QR0A 1QSEB 1ZEAH 1H8OA 1S3KH 2JVUA 4FCHA 5E9DE 4URKA 3SBWA 1MF2H 1OP9A 3IU3B 3OXSB 2XPZA 4RGNC 1CE6B 5BZWA 3SGDH 3F12B 1AZCA 1MAKA 1KGWA 3BLBA 2V5MA 5TE4L 1MCOH 2VDMH 2IO5A 3LKOA 3QUMA 3UPAA 5DD6B 5JDJA 5KYWB 4D3CL 4P4KC 3MNVA 3G7TA 1GC1C 3W9DA 2I7OA 5E2TH 2L7UA 4GUPB 4ANXA 4XMKH 1ID5I 3T77A 1TTCA 3GMMA 3OMNB 4IRJC 1KPUA 1U9KA 4JY6B 5EN2A 2X41A 4PJFE 1OF2A 3JWNE 4YFDB 3O2VH 3BVUA 3BX7C 1A7NL 1Y1UA 1A4AA 2X6AA 3QYCA 4WUUD 3GBMH 2GITA 3LKQB 4NCC1 1P53A 4ANWA 3MBWB 4OD3H 1E6OL 3QR1A 3CLEL 3DYPA 3PGCB 4DFHA 2JIXA 2IQ9H 3MRIB 1HE8A 1RMFL 1HOCB 3HJ0A 4R0LB 4UT6L 5D6DC 2OSXA 1BD2A 5CJQH 2ORBL 1E8ZA 3QEQD 5HI5C 5LGJB 5AVVB 1E6JH 4BSJA 4HIIA 4JPQA 1NFDE 3LH2H 3BP6B 4ODBD 5T5FL 4XNYH 4FQCH 4QOKA 4NJ9L 1P7KA 5IROD 4KU1A 1A4CA 2R83A 3ZUCA 1TQCC 5F3HB 1DJXA 3NCBB 4CKVX 2XFXB 4J3OF 2E9IA 3C6LB 4JRYB 1RUKL 4IEFB 4PS8A 5D7KD 5MI0B 1AKJB 4HCIA 3QDJD 3L6FB 3QK0A 5F7UA 3HZKA 5FUCC 3VWKB 4MMYB 3EGXB 2ITDB 4JKPH 1MCSA 1FYHB 4QTIH 3UTTE 3FUKA 1J8KA 3CN2A 1THAA 1MCQA 3IFPA 4P3CH 1AZNA 2DTMH 2E7LA 1NGQH 5L9DL 2G60H 3CFJA 4GMTH 4MNQD 5LJYH 4XMWA 2P4AB 1SFHA 1FN4A 3GHBH 4KI5C 5F0MB 2DWYA 3GMOB 1R0AL 1MDAA 3DTDA 1A8ZA 3STLB 3GS0A 4HPOH 1INQA 1E9PB 2X0VA 2VL5B 2XVLA 3GSUA 1YMHB 3UGXA 1X5IA 1HHHB 1FGVH 1FFTB 1OTTD 2X2HA 4NNYB 4PWKA 2WLNA 4J12A 5H94A 1EDHA 1N8ZA 1BQHB 4LGSB 4GG8A 3CFDB 3OGCB 4XR8C 3HI6L 4PJHB 4U3SB 4N2DA 3CFBB 1HC1A 1SOQA 4MNGA 5TFSH 7CGTA 1MPAL 2IPUK 2YPLB 4D94A 3LEYL 4TUJA 3CTTA 3MROB 4H2CA 5CLTA 5HGAB 4F8LA 3UZVA 4CJ0A 1AR1D 4Z7UA 3KH3A 3OPUA 3QQNA 1LEIA 3X2QB 1ZT4B 3Q6FB 5EC2B 2GUYA 2VLME 4JFVA 3SDAA 5DUPL 2FYYB 2GW5A 3BPCA 1UJ3B 3ESPA 4G7YH 2Z8RA 5DVLA 2DW5A 4P2OD 5I0WA 2K6WA 4YHIB 5A2FA 3ERXA 1UA3A 5I1KL 3CHQA 4NX0A 2NX5D 2Y7NA 3ZK0A 2QVMA 2A4CA 3L3OC 4AQ1B 5IJKC 4FYQA 4UMSA 3CZGA 1H6EA 1SXSA 4F8OA 1C5DB 3II2A 1ORQB 1A6PA 2FBJH 1IFGA 2CO7A 1MREH 4QY8B 1D3CA 3ALWA 3EFOA 4Y1AE 3PWNB 1FDLH 4OV5A 3ROLB 5D7LD 1PPIA 3G6AB 1KCRH 5C0NC 4GH7B 4PJCA 3S37H 2EIBA 3A4FA 4GIAA 5AAWA 1VZHA 2IH8A 3KPPA 4DKTA 2J8UE 1T5XB 1FNSL 3OZKA 3FRPG 3SKOA 1SOXA 3ALPA 4XX1G 5JYMA 2VN4A 5J13C 4IRSA 1FV1B 1X5AA 3ZDZE 3D09A 3U4KA 4UB0L 1WD9A 4HT1L 1E0OB 1RSYA 1NJ9B 1XV8A 5LBSA 4L3EA 2NY6B 3D52A 2HWZH 4NO3A 4OCYL 4X4XA 4KUCF 4QRSB 4OLYL 1M7DB 3IXTB 5C0IA 5F6HJ