1P0SE

Crystal structure of blood coagulation factor xa in complex with ecotin m84r
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
139
structure length
139
Chain Sequence
b'VQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTRMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coagulation factor X precursor
publication title The Extended Interactions and Gla Domain of Blood Coagulation Factor Xa
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 19
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2003-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1p0sE00
1XXFC 1ECZA 1SLVA 1EZSA 4IW4C 1SLUA 1N8OE 1SLWA 1FI8C 1ID5I 1SLXA 1XXDC 1AZZC 2Y6TE 1XX9C 1IFGA 1EZUA 4NIYE 1P0SE 1ECYA
chains in the Genus database with same CATH superfamily
2JKLA 2J1XA 1EIBA 1TO4A 2YEVB 4FG0A 4NSKB 5DFTA 2D0HA 4XR8C 3KLAA 3OF6A 5H37A 1F97A 5HI5D 5JUEL 1DL7H 2JJUA 3WD5L 2W92A 4KK8D 1RJLB 4DK3A 4XZ4A 1IAOB 3BWSA 5F96H 5E8PB 5TDOB 5SWSA 5LG1A 2G3MA 2VLJB 2WLYA 5IROD 4AL8L 5A2AA 2E0PA 3IJEB 1M7IA 4P59L 3EJZC 4Y5XB 3AVEA 3E6HA 3OXRB 5IQ9A 2X4UA 4H1LG 2ZX9A 3K4AA 4FF9A 3A4AA 2H0FA 3GBMH 5E6RB 4ZDHA 1RHHA 4RRPM 5D6CB 1RMFL 2I5YH 2MNJB 12E8H 1BLNB 3RUGE 4EDWL 1XR8B 1DR9A 3E3QC 4L5FE 1IILE 3DURA 3T4YA 3MLRL 3X3GL 1EFXB 4I48A 5HYSG 1Z6JT 2NMSA 4HV8A 2E4FA 1BM3L 2ZKHL 4Y4KC 3RWGA 3NZHL 1CURA 2APXA 3TPUA 3LNHA 32C2A 3LIZA 3TYGL 4PJDE 1YDPB 2C1PB 1PZSA 3CZLA 5CU9A 2QKIC 1MJ7H 4HPYL 5DRZB 3QUZD 1OTTC 3F7PC 3WFCL 3FPYA 1SQMA 3K4DA 1ZLEA 5DRNB 4GBXC 1RZ8A 2MCG1 1MRDL 3JYBA 3QHFH 3ZR6A 4AH2B 2CO3A 5IB2A 3SCMB 2X38A 1GAFH 5DJCA 4HC1A 2FECL 5FM5O 4MCZB 1J48A 3HHSA 2VCOA 4GMTH 5HI3D 3IJYA 4PD4J 2MHAA 3QEQE 2AK1H 4ZW6A 2IBGA 2B4CL 5HHPA 4XO8A 2RH0A 5TQ0L 5IJKC 2X7LB 5GGVH 2EUXA 4N22A 1QA9A 4XPFH 4XNMA 3NCYS 3GZKA 1BD2D 4UQDA 1XGPB 4GUPA 1JHLL 1QUNA 2I9LA 1AP2A 4PI2A 4QNPE 1NJ9B 1JRHL 2DRUA 1BQSA 1SDYA 2E75C 4HT1L 4Z7IA 3DV6B 5IQMA 3FRUB 1VHPA 2AQ1A 1UXMA 4G8GA 4FRWA 3IFPA 5EO1A 5DQJA 2VXQA 2P24B 4J3SA 4TQ8A 2Z9TA 4OGXH 2CBMA 5DFWH 3RWCB 1T7WA 1UZ8B 2B5IC 2VDLL 5DTFA 1Q9KB 3DJRA 4AT6A 1TEGA 3A6CH 3PABA 5D4JA 5K1NA 3ASOB 1USZA 3ASWA 1OZTG 5DJ2A 3RBGA 4HKZB 4M62H 4HPOH 4AMKL 2GEQA 1ES0B 1SJEA 2XX1A 1FO0A 4PFEA 1E5CA 1ZWIA 2W0FA 4C4KT 4TUKL 4X2UA 1D5MA 3O2DL 5AB1A 5D7JB 1MJUL 4F9PA 3VI4A 5HPMB 1D7FA 4FA7B 4Y9BA 2ED9A 1XAUA 3L7EB 3FH5A 2APVA 5IVZB 1QX1A 2EDTA 2Q3XA 5FUCC 2OL3H 3ECUA 4UZGA 3OG4B 5EEUA 2A4EA 2LR4A 4L3AA 3EJTA 3FQTA 1NCGA 3Q3GA 3QO1A 3EYQD 3EYSH 5D7IA 4NQDE 1DDTA 2BSTB 1OGPA 2R1XA 1A7RH 1J1OH 1O9WA 3FFCD 4F37F 4GY4A 5SV4A 2XI9A 3GWJA 3HZYA 1N5YH 1TFHA 4WWPA 1IGIH 3GUTA 2BSDA 2ICWB 5F0MB 1DVFA 1W0WA 2YRPA 4XNXL 1J9CT 5I1KL 2IOOA 5D55A 3B9KA 4YDMA 4NCC1 3TA3B 5F7UA 5INCA 2WBJD 3T3PB 4OF5A 1G7PB 2VZOA 4G9FD 4JFWA 4FEIA 3MRKB 4DP6X 3FXIC 4U4BA 1YMMD 4NO0D 1INQA 3AM8A 4EF3A 4M02A 2BSCA 2WP3O 5LO7A 1ZTXH 3TVMB 2IH3B 4HISA 4G80A 5FKPA 1GL4B 3GMPA 4LARH 5DS2A 3RA7H 2WXNA 1ID2A 4F8LA 2DEXX 4AENB 4OZIB 1BWMA 3TBSA 3U2JA 4LNRB 3FSVA 5AW7B 2E5EA 3HPJB 5HDBB 5JR1H 1JYWA 3BP5B 3K0WA 1DVTA 5INDA 3JTTA 4ZAKA 5KYYB 3RFZC 3FMGL 1YNKH 2ITCA 4ZXBB 4PJFF 3FT0A 5DWUH 5ELIA 1NBYB 5B8CB 4Y4HB 5I9QB 1OT1A 5E9DB 1DANT 3VG0H 4M48H 1AGFB 5DJ6A 1A02N 3I3BA 5JQ6H 2YA2A 2OTPA 4YGVA 1A6TB 5HHXH 3KNBB 3CVIL 3HI5L 2G75B 2DQTH 4JQIL 4S1DC 3ARBD 2FT6A 3HE6D 1ZSDA 2DICA 1UEMA 3MX0A 3NZSA 1KLUA 1DSFH 5KBKA 4BFFA 1EQWA 4YE4L 2KH2B 2ZAIA 4DQOL 1IGFL 3NJJA 5D6DC 2FL5B 1WCBA 3C09B 2C34A 4GQ9L 4PJ5A 4R97C 1I1AB 3D3VE 5GJSL 5CD5C 3VMOA 2DY2A 3W37A 4XX1G 2R29H 3AU1A 3N2JA 1JPSL 2QGEA 4ZO8A 4ZNEE 1CFQB 3NAAH 2B1OA 1AGDB 3RY6C 3VXTB 1QFWM 2VKXA 4GXUM 2R0LH 4U05A 3BRDA 2FIRT 3OQRA 5AW0B 1KC5H 1NBZB 1U8CB 4WV1A 2J5LB 2VT0A 2OXGA 5I8KH 4DF9A 1GZQB 4U1SB 4ZMNA 2CHDA 1W8OA 3EO1A 3HUJA 4DW2H 5I1GH 1NANH 1ASPA 2F54D 4NQSA 5D5ME 5HHOD 2XRAH 4MMYB 1ZS2A 3BT2H 3CLFH 4QRRA 1QLFB 3IGFA 3QIWD 2ADJA 1MCFA 4YHZL 1EX0A 2CKNA 4PJ7B 5AW2B 1Q9LB 3E0GA 4YWGL 1A2YB 5IY5B 2JIXD 1NAMH 1E4KC 2CGYA 4L8DB 2XVBA 4PB9H 5HDQH 1IMHC 1OCZB 3OZLA 3HIZA 4PJHA 2PNDA 1ZHBA 3CBKB 1R3JB 2ATKA 2Z7ZA 3VWKC 3MJ8A 1CE6A 1KPUA 4C56D 2GFBA 4AEFA 5AG8A 1U8KA 2ZONA 4MJIE 3M7FB 1JRHI 2AITA 5GHWL 5LB1A 3RWEB 3F12B 4AUUA 1JGUL 1MHPH 2ED6A 4NAJA 2FGWH 3UEZA 4MD0B 4HJEA 3K6SB 4AQAB 4E9QA 5DZJA 2J8UE 4WUUE 1XDTT 1WC7A 3MTXA 3PU7A 2DWYA 3MRPB 4UQEA 5DS8B 3BWAA 3PWNA 1HNGA 1I1CA 1QFOA 4OCMC 3M6DA 4WK4B 3ZIMA 2FR4A 3MV11 5ERWB 3D12B 5TFSH 4FQIH 2ITDB 2BDNL 3PP3K 2R69H 3HHMA 5DLLA 1LP9B 1JNHB 3C9NB 4NWTH 5F7DA 4JM2A 4V11A 1JWMA 1SOXA 2H2PC 1K8DB 2ZUTA 3B2UD 1U8NA 2VLMD 3DIVA 4AX3A 4ODSH 2D7MA 4HK0A 3TXAA 3U7AA 3DA0A 3HBPA 1HHKA 4HIJA 4JZJB 3JWNE 3UC0L 2IGLA 4XE0A 2F8VA 2BVQA 5GSVA 1PAMA 4JFOB 1JERA 4OM0L 2ZNXA 5D1XE 4EI6A 4YX2H 3HKFA 5GXBB 5EUOF 4FAAB 1T3FA 5CUSL 2FBOJ 4H40A 3TV3L 5GZNC 1S7TB 3BQUA 4TLTA 3NDYE 1KDJA 2CK2A 4NO3B 1G6RL 4UNUA 1UD4A 4K3EL 5E8EA 3VH8G 1G7MA 3O2DA 3WXVL 3IS0X 2W59A 3ZKSD 1G9NL 5IHZA 3ML9A 3ZTNL 4Y1AB 5KS9A 3WE1A 1LWJA 2MWCA 3U0WH 1S78D 2WAHA 3US1A 2UZIL 4N28A 3PAUA 1JP5A 2JB6B 2D3LA 2W9LA 4N6RB 5F0JB 2CE6A 5H4ZA 1AZRA 4NQXA 4P57A 4KTGA 4A67A 3ZRCC 3QUYC 5TH2B 4QOKE 3HZVA 4G6KH 5FPIA 3IFOB 3OAUL 4DEUA 1UWGH 4IU2A 3HN5A 4L18A 5IOKA 3KBEA 5CJXC 3CG8A 4XCNB 4L1SA 2A4ZA 5ALBL 2CLVB 2OMTB 3B6SA 3CWGA 4NUQA 4PJAB 1UXWA 1EDQA 2FJFB 2RMNA 1AO7D 5JW3H 1P2CA 1CGXA 2BP0A 4HS3B 4B9ZA 3C60B 1LQSR 1CN4A 3DX1A 4JPSA 5JZ7C 3RVXD 4XC1H 5D1QC 4EIGB 1A4KB 4JY6A 4HFUH 4QAWA 2QVKA 5CP7B 4NRZB 1QFWH 4L9LC 3C12A 3RGVC 1O7DC 1UD3A 2P5EA 2DBJA 2W65A 3EJUA 4LCWB 3MNVA 4HJ0D 3HHRB 2Z93A 4FTVE 4OVUA 3F65A 1A5FL 3BOVA 1KBGL 1KN4L 1KJ3L 1OAZL 1AFVL 3MI6A 2Q8AH 2X4RA 1BQLL 4NKQB 4NUGL 3S4SB 4EN3D 1R33A 5CCKL 2E86A 4Z95H 3QC6X 1OP5H 4TQPA 3IETA 5CGYC 4UV4L 5IW3A 4BZYA 1LK3L 1QRKA 1UG9A 5DJXA 1G7HA 4X4MA 2G9HB 2XPGB 3QEGH 4H20H 3L3GA 2D9QB 4MNQB 4JQIA 3WNOA 1F90L 1U4EA 4CU6A 3OAZH 5FXCH 2EC9U 2AI0L 2BOCA 3V55A 3LEYL 4M7ZB 3RG1C 2P43B 5IV2B 3IMTA 3MKGA 1NFAA 1E2VA 2Y5TB 5FO8B 3H7LA 1YEKL 2CDGA 4HUXA 2FT7A 5D7IE 4JB9L 3OKMA 2HRPH 1UB6A 4I5BA 3HFFA 4CVXB 3G5YA 1S9XA 3CGTA 1WE5A 4WK2B 4C58B 4I4WA 2EJ1A 3VGBA 1ZHNA 1T1XA 2CLRA 4O5LH 3ZGHA 2IMMA 1L0QA 3FU7A 3LZFH 4ZS6C 1R34A 3P3SA 4U2YA 4Q9QH 2XIIA 3P2BA 4QMEA 5A7EA 4DK5A 3ME0A 3UYRL 3L16A 3U4EB 4CNIB 4E0RB 2EE3A 1LO2L 1HN1A 5D1ZC 4OV6F 4HJTA 4K8RH 3ESUF 3GXMA 3OVUB 3SN6N 3ABKB 5BMFL 4WEBL 4WENB 5HYSA 5F7AA 3FONA 3MLVL 2OYKA 3M1CA 3M88A 5TQ2L 1HEZB 4B3VA 2QMJA 5CJBA 3QHZH 2R8SH 1UYWH 2PR4H 4QTIL 4IRZL 3FSAA 2YMOA 5I1CL 1XXFC 2CUAA 3QARA 3BVXA 3NGBC 4UCFA 3C2SA 2FHCA 4GLRH 4K3DL 4CMHC 4E2OA 5IEKA 2VMJA 2FHBA 4MKMA 1XSKA 3IJSB 3PWPB 3DVFA 3CQPA 5IK3A 3G5XB 4M3HA 4ZFFA 4QEGA 3UTPE 1BZQK 4J3OG 4ZMWA 3S3CB 4BA8A 2UX7A 2RALA 2VR6A 2V33A 3BIKA 2BXZA 3UXFA 3QZBA 4HJGB 3UIZA 3RYMA 3GDBA 1RLBA 3CCHB 4FI8A 4GEJA 4MNGB 2GK0A 3ULVC 2YWYA 2YKLH 3U4AA 4PJ5E 2XWBA 3D08A 1YUHB 2N56A 2VRKA 4M5TA 3WIHH 1WLHA 2R23B 3LNIA 1C8PA 1Q94A 1QEXA 3BUBA 2OA9A 3E9UA 4PJCB 1V8HA 4M43H 3VU1A 3T8MA 3SZKC 2IWGA 2X40A 2AW2A 2Y2YA 3H9SD 5DO2C 1DLHA 4NQCB 5D7LA 3OLGA 4BK5A 3GJFK 3ECVA 3TOPA 4UQIM 1TCRA 2PP7A 2Z65C 3KYOA 3MRCB 4U7MA 2A1WH 3MFFB 4Q6KA 3CSBA 1T03L 1AE6H 4QRRE 2P8LB 1GS6X 3QZWG 1MQKH 2JKJA 2DQGH 4I2XA 1QG3A 4LLDA 1D5ZB 3RB7A 1BECA 3JV6A 4A7SA 4ZFGH 4XAKD 1VZHA 1PVHA 3ZO9A 1N4XL 2FYYA 3FTVA 4PS8A 1CLOH 5GGQL 3TIEB 3U9PH 1IC7H 2NXZC 3BKCL 1DQLL 4P5SA 2NRDA 4EI5B 2OTUA 4PJHE 3VFMB 3FFDA 3N04A 4POZD 4IBWA 2GUOB 3LHPH 2NX5B 1BXXA 1QRNA 2R0WL 3IXAA 4NHCL 3MLUH 1GR7A 3UC2A 3S37X 3I6SA 3QQ3B 1MXGA 1RZIA 2C3VA 1JGVL 2OS7A 1KGWA 1JVOA 2G60H 3L48A 3Q1SH 4ZFOL 1PEZA 2HN7A 3RVUD 3UJTL 2FJGA 5E08L 2GKIA 4PI0A 1YYMH 3WFBL 4L4VE 2EDKA 5KYWB 2DQJH 3PLYA 3QQ9C 1RUML 4MHHI 4ZW3A 2G3NA 3L95B 3FQWB 3K5SA 3EH1A 3QDHA 4KTDL 2E7HA 3FUIA 2CNZA 2VYRE 2SEBA 2F7QA 1FFNB 4S1QH 5ENWA 1WHPA 2OW7A 1A4AA 3AGVA 2XCMC 2AABL 3VRLE 2BY3A 2EYTB 2X4SA 4NKOA 3VRJB 3NACH 2NQDA 3DK0A 1Q38A 1CDUA 5C08D 4EE2A 4X0NA 1RUAH 4OBRA 2ZICA 1ODUA 3KCPA 5J0BA 2A9ML 4KK9C 2D3NA 5G4NA 5AOJA 3U30B 1ORSA 2J57A 1LD9B 4GW4A 4QD2E 4Z9KB 3EYUL 1UT2A 5KUKA 5C71A 2W60B 3CSGA 3QDJD 3N1GC 4TTGA 3L5IA 5EZIL 5L88L 3HS8A 1HILA 3V0AC 3BP7A 3DDFA 3GDCA 1HCFX 1KV7A 4MA1B 4KTEH 2RFXB 3UBXB 3UDWC 1TZGL 2WC7A 5E2TL 1ZLVK 4LSUL 1VRSA 4H0IA 3O8XC 5DC4B 3ULUD 1KTKE 3KYAA 1FH5H 5DC0A 1CK0H 1JV5B 3I74A 1RH8A 3VE0A 5KS9E 3KW7A 4HYTB 4HG4K 1RI8A 1EAOA 4WTQA 1UXLA 1LTXA 4K8RC 2ORBL 5EBLB 1JWUB 2AHIA 5TDNB 2BP8B 3ZE1B 4LF3A 4QCIA 1JGEA 4XCEA 2PMZA 2I85A 4TSCL 4MD4B 4JFFE 4N0YL 5DQ9B 4LSDA 1X5GA 4HAGA 1U93B 3BP6B 5IROA 4NDMA 5J6GB 1KB5H 4PV9B 2A6KB 3VI3F 1U8LA 4UM8B 1AIFA 1CQYA 4LSTL 4A6YB 4AJWA 1G94A 4ZFQA 4HJ1A 4XP9H 1KEML 1GRWA 2ZAGA 1MHCA 4WW1A 1I85C 5CWSA 2MNUA 3Q8CA 4EMZA 3EO0A 3G5VB 3TYFA 3V0JA 5C3LD 2HX8A 3IDXH 4N25A 4BKTC 2IXQB 1Z0MA 3FT4A 1I7ZA 4NRXB 3L2NA 4NBYB 4U1NA 3EIFA 1KT2A 2IH9A 1XIWD 1EGJL 3A0OA 4IRZA 1MZYA 2IGFL 2OR9L 2P5EE 2G2PA 3OJDB 4KKCD 4YS4A 4KRMB 4YDJB 4KKLD 3WN6A 3VXRD 5CSGA 2AQNA 2OZ4H 5I15H 3SCMC 1YQVH 1AR1C 5LNGA 4PCTA 1S9WA 4L4TD 1JFQH 1PZ5B 1TTAA 4X6EB 1BZ7A 4AQ8A 2ZCHL 4KXCA 4FXGC 4ORGA 1XF5A 3CXDH 2E7CA 3Q7JA 4IHOB 3QUMH 4PRBB 4PWHA 5FO9B 3QH3B 3UO1L 3QUZA 3V6ZA 4TF4A 4GAJL 4CSPA 2WQVA 5I2IA 3OTTA 4U1LA 4PS4H 3SQBB 5J57B 5C0EB 2NY2C 4FFWC 2DMKA 3RVVD 1IT9H 2DQDH 3GM0A 2QTVA 4P9ML 4P4RB 4V1DB 3V10A 4JFTA 2UY7B 1V10A 1JPGB 3B8YA 1BVKB 3PNWA 2OMBA 5MEOB 5IMLA 4I18A 5DJYA 4ENED 1SMDA 5JIKA 3JT2A 3BGMA 3NT0A 3B9EA 3I50H 1BD2A 5AOKA 3MCKB 4ZD3L 5DZVA 4IBLT 4YN3A 1RUKL 2VIRB 3MOAH 5GJTL 4U1MA 3WYRA 2V37A 3L9BA 1SYSB 2PWDA 4P46D 3L4CA 2ODHA 3FH8A 3S37H 4WFHD 4PRAA 3G6JA 4DT2A 4UT7H 6PCYA 4M4RB 3KJ6H 4WSKA 3KHOA 3N91A 4PTTB 5EPMA 4E5XG 1OPGH 1DJWA 5T3XH 3L4VA 4N2LA 4DGVH 1N8OE 2BCKB 3LCYA 2A0LD 3NJFA 3KPNA 5BZXA 2JB5H 2BNQE 2I24N 2Q3ZA 1SJVA 4OY9A 1QI3A 4LSPH 5JLZA 1CFTA 3ARDD 4XB7A 2WUCL 1GYUA 1L9MA 2EEDA 3QZLA 4AEHH 5JPNB 3ZDZB 5TE6L 3L45A 4M93C 4A66A 1HH6B 1AZBA 2XBTA 4X9IA 1VGKB 2CJUL 3SYAA 1U92A 1D9KB 3G6AA 3BEWB 2HFGL 3GXUB 5DO8A 2CH8A 4MX7A 4UQ2B 2YIHA 2XFXB 4BWUA 4OD3L 3LNEA 5EC2B 4OF7A 3EF7A 4OW6A 1KY6A 1T2QL 3CXHK 3CSFA 4F93B 3ZDYE 4ZFOA 1KIQA 1O6SB 5CJOL 1CGUA 5DVNA 3WS3A 1HC1A 1U36A 4R7NB 4FERA 4BXVA 3HNSL 1IFGA 3FFCA 2VDRB 1VGEL 2ICEB 2V6HA 4GW5B 1K8IA 4JPWH 2DTML 4OCXH 5GGRA 3TN0C 3MV8B 1YJDH 5KVDH 1KLGA 3FTSA 4XBEH 1ECZA 2QADD 5LGHL 1FV1A 1U30A 4JFPA 5CIPB 2LVCA 3U2IA 2WBJA 4G9FA 2Y07L 4ILDA 1BMWA 1YMMA 4NO0A 4KHXL 4IEFA 2C26A 3GSWB 2M8XA 2W07B 4LHQB 4HOZA 5IB4B 3L1EA 1E9QB 3Q0HA 5G4OA 4Y9GA 3GMRB 4XBGA 5D7LE 1DQTA 3OMIB 4EDXA 4W6WB 4JFDD 3RPKA 3V5DA 5IMMB 5E8DL 4WO4D 4PJGA 4R26L 2EDJA 4KJYA 25C8H 5J5EA 1NPUA 2X0WA 3MRIA 2O6PA 5IUSA 5LXGL 4HUVA 4BELD 3DOSA 1CDJA 3EUUA 3OLIA 4B96A 4EIZC 2AXFA 2NNAA 1NMAH 3QNFA 2ITFA 3RU8H 1IQDA 4MJ4A 4QT5A 4A63A 4BJLA 2BK8A 5LBGA 1GYCA 3BYYA 4MWFA 4ZOEA 3GTTA 3UO8B 2VMFA 1ZEAH 4RNRA 4YXLL 1S5IL 3RZCC 3K2UH 4HFWA 4IS6A 5I0ZA 3V4PL 3RKDC 2WK2A 4HF5H 1OB0A 3UZEA 3T4AB 3ARBA 3HE6A 3H6AA 1HESA 1KCRH 4WI9A 5K39B 3II1A 2IAMC 4ZTOL 3C5ZB 4FLOA 1EO5A 1QRNE 4XRCA 3NZ8B 4EAEA 2FBRA 2PPCA 3DMMD 3KW8A 3D18A 1OAUH 2C9RA 2XBDA 3KXFD 5HYJD 3LSOB 5B3JE 2RIKA 1SHSA 5IR1A 3V2AR 2ENJA 4WUKH 5SX4I 4DUXA 2VRAA 1OTTD 3VA2C 3L17A 1ETZB 1IAMA 2ZWKA 5ETUA 1IKFH 4GBXD 1P9MC 1FN4B 5FDWA 1MJ8H 4G6FB 4OFIA 4W9CC 4H88L 4YUEH 1P53A 4AV4A 4JQVA 2VRQA 1KNOB 2I32A 5CMAA 5GRWA 2IADA 5IOPB 2F54A 2P48B 5HHOA 4EOWL 5EBMB 4UUJA 5JXAH 1A7NL 4MMXB 2PPEA 1HL8A 3QIWA 3ARQA 5AAWC 4F8OA 3VXOB 5E9AA 1J9TA 3KEHA 1CLZH 4IQHA 4N0FB 4JO2L 5EIIA 3VDAA 3NCYP 1AOHA 1ASQA 2JIXA 5JOPE 4ZMTA 4Z7UB 5B1JA 5DHVH 4R4ND 1OM9A 5ADPL 4HPHA 4UF7C 5I6PA 3CZNA 4MCYB 4AQ1C 2NY7H 2BC4A 2OMZB 1M9WA 3CHOA 2HVBA 1MWAA 3UTSD 3BAEH 1IGJA 1OVZA 1HAWA 4K4KA 1LO0H 3GMOA 3BKJL 3EGSA 4FXLA 4M8VA 3VWJC 5KVEL 2X4TA 3FF8A 4KDVA 4X6DF 1ZA3B 1AOZA 2W91A 1ZGLB 4P3WA 2YD1A 2RA1A 3LTVA 3O11A 2NR6C 1F8TH 5FYJH 4NO2A 4S11A 3SPCA 3S3PA 2A9NL 4Y2OB 4L37B 3VYNA 1VIWA 4XX1E 2MMXA 3D2UB 2JNZA 4OZGA 1U3JA 4X7TB 3H9HA 1HQ4B 3B7UX 2WTOA 3VFUB 1L0XA 4B9KC 3NABL 4JFQB 1EXUB 4MVBC 3BZEB 3MV01 5B1AB 2X1PA 5I18L 1NAKH 1QSFB 5IT2L 4BQ8A 2BWIA 5C0IB 5I1HH 3HAEH 5CBAA 1BDYA 1DSYA 2FSEB 1SPDA 5KOMC 3QS3A 3WV0A 4I13B 3UZQA 4M61B 4PREA 3D9AL 1TKWA 1S3RA 1U8HA 2IPKA 3QZWA 4DP1X 1O7SA 4HIXH 4D0BA 4DP2X 1KYFA 2WANA 3NIGE 5HDBF 2IH1B 5CN2A 1RJZB 2NY1C 5E2WH 1ED3B 4WZ9A 3SBWA 3H3BC 2FX9L 1YJDC 1MIEH 1SFDA 1PG7W 4JAMA 4L0PB 5IFJB 4ZSOA 4PLOB 3KGSA 4X5XA 3T0AA 1RVFL 3WCYA 4NOBA 2E9JA 4FZEH 3VM7A 4A37A 3AQZA 4PEEA 3OB8A 5DVMA 5ICXB 1CIUA 3NRPA 1XF2B 1WRFA 4GP4B 1YRKA 4WEEA 4UU9A 1PGRB 3AXLB 4J12A 4M5ZH 5C0GA 1Q72H 4NENB 1SUHA 1LEKA 4LDOB 2GT9A 2E7BA 4UM9D 1CG9B 4ODTH 3BI9X 3T0XA 3LD8C 3G9VA 2YD3A 3TBVB 4WI6A 4W6YB 4L1BA 2GI7A 3M17B 4PMFA 2WJ7A 2XJLA 1CE1H 4PP1D 1WAAA 4OGZA 4KUZL 3DI3B 4AXWA 1I1YA 4XCCH 1AO7A 3II2A 4S1DD 2QL1A 4XN5A 1SF5A 3SKMA 3U25A 4C59B 1BD2E 2F6AA 3BVVA 5SV3A 1A9BB 1MUJB 4YHPA 4JREC 2LU5A 1CDHA 2YD8A 5CJQH 1QZ1A 1T0OA 3UEQA 2FWOA 3CFKB 2YJQA 1NFDB 2DWXA 1MPAH 1S7QA 1Z66A 4G7YH 2ZF9A 3LN4B 1CGSH 5CD5D 4ABWA 1PFCA 4F2ME 1FNGA 3AJ7A 4LPVA 5DUBB 2DQMA 2WXMA 3JT0A 4XH2A 5D4HA 5E4OA 4D94A 1EZSA 4IW4C 2UZYA 3G6JE 2ZP0T 1UT9A 3T77A 1CICA 1U9KA 2EDQA 4PJ7F 4EN3A 3KDMB 4F15C 4LVNB 1A8ZA 4MQ7A 1JMZA 1TZAA 1Y1UA 1NCAL 1YEHH 5FX3A 4B6ZA 1BYNA 3SGDI 5CO1A 1FDLH 3G7TA 3U0TB 1BZ9A 1FZKB 3V4PA 3VFOA 3GGWA 4OFKA 5DI8B 5IJBC 5F0PB 1KJ2L 2XZQL 2NTSP 5JNYA 4LEEA 1A1OA 2WQSA 4YNYB 3QFDB 4JQXC 3GSNB 4XC3H 3RVWC 8CGTA 3NN8B 3MHZA 2I60L 1BLIA 4K3GA 1YYCA 4NQQA 1NCCH 4FNPA 5BS0B 1F58H 5CU5A 4UTBL 1QBLL 3FHEA 4DKAA 5HBBA 2V8LA 4WHTA 1I75A 5T5FH 1FFOA 1GKEA 3FFOA 1JK9B 3FFCE 3GXIA 5AAPA 1EANA 5I17A 3Q9QA 1IQWH 3MGTA 2FQFA 3ZHKA 4CSZA 4URKA 4N87A 2DBLH 1BVOA 1C5BH 2AMGA 1MCWW 4R7XA 5DDHB 3UPCA 4FFYH 4FHKA 1MY7A 1R5VB 2VE6B 3BLKA 2DJSA 4WWID 2E9IA 4AV0A 1QR4A 4ZYKB 4ZS7H 4G9FE 3RVTC 1QD0A 1E2WA 4ONFL 3NFPA 1YMME 1K5WA 2VZUA 5SX5H 1E30A 2AKRB 4IBYA 2H6UA 4PGEB 3SDXF 2R1YB 1QBAA 2G5BA 4ICWA 3UGUA 4WCYH 1L9RA 5T5NF 5F3HB 1OAQH 1DN2A 3V9EA 4N4YB 1H6UA 3OX8A 5SWZD 4XMPH 4LHUD 4G1MA 1NGQH 1A3LL 4N8VA 4DO6A 2B59A 2IG2H 3FKUS 3A23A 4K94C 1FJ1B 4FP8L 1YEEH 1P4BH 2AXHA 1JGLH 3FUMA 5LWYH 7CGTA 3VD4A 1UADC 2VH5H 1CCZA 4FZ8L 3TNNA 4Z6AT 2P49B 1IM3D 3OMAB 3PL6D 4I77L 4YHKH 4Q97A 4MJJA 3DSNB 4HD9A 3NP3A 4Z5RB 4Z7AA 2JV6A 4GT7A 4JRYB 3T1WA 1DJGA 3WJLC 2H8PA 3BW9B 2V5SA 3E7JA 4KKBD 2QEJA 3O0LA 1A3RL 4RETB 3QXDB 5IHUH 3H0TB 4HDIA 4ZOAA 5FF6A 1BZEA 3QJQB 3QEHB 4L48A 1SUJA 2BSRA 4HWNA 4H5SB 3D4GA 5C09D 3W38A 4KTYA 3O9WD 1JDCA 4OZFH 4ZODA 2NT0A 2B20A 2I69A 2QVIA 4E9SA 1S46A 1D3CA 1LK2A 2IIJA 5ALCH 2AK4B 4WI2A 4PM1A 4PJAF 1U8MA 4UAOB 4U6YA 2VDOB 1SNRA 3H9SA 5FUOH 4PIBA 4UTAL 1WS8A 5DK2B 4OFQA 3RE0A 2GJ6B 3WY2A 5C9JA 2V17L 3OHXC 4E5XA 2GY7B 1S5HA 2VM3A 4ZMYA 3A4DA 2QFRA 1CBVH 1FGNH 1MEXL 1WIUA 3KYKH 4OKVA 4HIPA 3FUNA 4M1DH 2F54E 3ZL2A 5HHOE 2HKFH 4RX4D 3WJJA 2XA3A 2NXYC 1NDGB 3CVHL 1MVFA 3F83A 3O4LE 2BZDA 2JELH 1JAEA 4NUJA 2EADA 1T5XB 3ZZLA 5JPMB 5KSUA 5D1QD 4N8PA 4X8GA 2VM9A 1GGBH 2X3AA 5GISH 4N2KA 4P4KB 3WDIA 3RAJL 1D5IL 1KIRB 2NLJA 4CADB 4LPTA 3W39A 3EJJX 3EOTL 1KXHA 1JHKH 3B3IB 4C56E 5A16A 3QJOA 2X9XA 2UZPA 2DM7A 4R4BB 3JVFC 5DEJA 2WV3A 5BJTB 1ODAA 5C0ND 2WVTA 1XH0A 1ICTA 1WUNT 3BZFB 3I6LE 4PD4K 5CGYD 1E43A 4D0DA 1GCFA 5BXFB 2VUKA 3FCBA 5CCHE 4ZO7A 5H8DA 4KH2A 4J6IA 1RV6X 1G5AA 4F8QA 4JO3L 4NFCA 2Q0ZX 2TSAA 2WLJA 3DJTA 3U30C 4DOHB 2FYVA 2N01B 2Q87A 1EJ6A 2VDRH 1CGTA 5TE4L 2X28A 4GRWE 4OI9A 1BG1A 1HKLH 4NBZB 3KPSD 4RMQA 3DKHA 4KK6D 4Q58C 4W81A 4X42A 2J1KA 3IDIA 3ROOB 2PXYB 1MRFH 3C5XA 1OLZA 1R17A 1TJXA 1X5YA 4MA1C 4LNVA 3AY4C 3IXTA 5C08A 4GUOA 3LKQA 5CP3A 3V4UL 2PCPB 4WKZA 5EFIB 1FG2B 3T04D 4BV1A 2JVUA 4ZT1A 4JGMA 2HG5A 3OAYK 4KI1A 3JTSA 4F7CB 4QRSB 1CYWA 3HCVB 3I02B 4LCCB 3OC8A 4PQXA 5TJWK 1NKRA 3STBA 1WV7T 3LMJH 3QDJA 4QRUA 4FGMA 3BISA 4ZS6D 2ZCLL 5MP6L 1N3NA 4HCGA 4HKJB 4KMTL 2EVHA 1HINH 1KIUB 1OIOA 1N64H 3K6OA 3IB4A 2WLLB 1T4WA 5D1ZD 1MHHA 3GB7B 3PCYA 1KJ2A 1CBJA 3GLEA 4PG2A 4U1HA 2R7EB 5I16A 2Z1KA 4XPGH 1FYHB 1Z5YD 1VF5C 5CN1A 4XNDA 1AD9A 3K72A 3NPSB 1RURH 1EMTL 3PXLA 4ZSOE 4PWJA 1KBPA 3BT0A 3WEAA 2UWEF 4F7EB 3ZDWA 3LZRA 5KOVC 4TSAL 4B7LA 5H35B 3A24A 4KQ4H 4U6XB 1DUYA 1AJ7H 4UTBA 2MRYA 3WJMA 2Z31C 3HFML 1M2VB 3CNKA 4PJ8C 4EZLA 2YUXA 4NJAH 3V0FA 4XMUA 4EIBA 4FADA 2BIHA 4K73A 4MAYC 5B38G 3LS4L 4ESKA 4EBQL 3DC0A 2HT2C 1B9ZA 2OULB 1T1YA 2YZ8A 1TYJA 1FPTH 5EO0A 3S88L 4U1IA 3TBYB 3IK2A 5ACLA 4TUUA 3BN9C 1PZBA 4PLJC 2C4XA 4JZNB 3MCYA 3HZ3A 5DSCA 5FA3A 5IMKB 1KOAA 4PJCF 1A1MB 1AO7E 3U4BL 1LYQA 3W2DH 3SKUD 4S0TD 3REWA 1H5BC 3HBGA 3CDYA 1KIPA 1TVDA 4UT9H 4W9KC 5JHDD 5E5MA 4GSDL 3SD2A 2XTJB 1NOLA 4OCRL 4PJXF 3X1NA 5DT1L 1XIWA 3UAEA 3NK4A 5A2JH 4FXKC 3CK0H 4MA3B 1DBJL 5BRZD 3EDJA 5F1IB 5HDLA 3VXRA 4F3FA 3VQ2C 4JO5A 2H7WA 4L4TA 5DO2D 4YC2B 1UQSA 4LHUG 3EDFA 2M2DA 2L04A 4JO4L 1R3HA 3KPMA 4FYTA 2HKAA 3ARGD 1E4WL 4MJ5A 3WIAA 1N2RB 1XGTB 4HD5A 3VFTB 4O58H 3LQAL 1T1ZB 4OM1H 4B27A 4U0QB 4F27A 4Q4EA 4YDIH 3VXMB 3N40F 5T3ZH 4PS3A 4B60A 4DTGL 3BZ4B 2QLYA 2LOEA 4IRSC 5DMGC 3JV4A 2YC1B 5CGMA 1RFDL 4P5TD 5HSFA 2Q5BA 5CEZD 4Z7QE 2ERJC 4NX0A 4NKMA 3QCVL 2R39A 4KGJA 1WZ1L 3O6FC 2WGXA 3TCLB 1UACL 2EO9A 4LQFL 2BNRB 3QXUA 5KYXB 1YAIA 2G2RA 5H94A 4O51B 3OLEA 1I8KA 3H7BA 2F5AH 5DJ0B 5EC1B 3R8BB 2XN0A 5KZCB 2WVVA 1T04B 4LEOB 4FA6A 3NFSL 4F92B 2VXTL 4XN4A 2BCMA 3OB0H 3PAVA 4UTAA 3TF4A 5F3BB 4NKDA 5HGBA 4XP6H 1KCVL 1OF0A 4P46A 4M9OA 1KTBA 2WYIA 1R24B 4JFEA 1SEQH 4PHZA 4Y16C 4JRLA 2Y24A 5ICYA 2XA8H 3CFBA 1M57B 1LDPH 1ZSHA 4W6XB 1NC4B 3MBEB 2BJML 4OGAD 3CVHA 5KBMA 5EUKB 2WXHA 3MBXH 1L6PA 4GO8A 2C3WA 4ZUSA 2DWSA 3RJOA 4NZFA 4R3SA 4QO1A 4N90E 1W6WA 2A77L 3MNZB 3RIAF 1T4KB 3ARDA 3S5LB 4IOIA 2VDQB 2VN6A 3O6ML 4Y7OC 3NFNA 1C7SA 1DTUA 3UJIH 4ZUTB 1EHLH 3DHUA 7FABH 4Y19E 1Z9SB 1KCSL 4U31A 4ZPTB 2MOVA 4TNVF 3NG5A 5CSZA 4TVUA 5F6HJ 4AZ8A 1UCBH 3WY4A 5LQBL 5KVEE 1DL7L 4PJBB 1IKNC 4RWYL 2OYMA 1DANU 5L2KB 5GGTH 2B1AL 3SDDC 5EB9A 2YK1L 1VKXB 3WO4C 1C5CH 4NEHB 2E76C 4ONHB 5GS1C 3QZNA 5DA4A 1G7QB 3SPVB 3O8XD 3VFRA 1CD0A 4NZUH 2XYCA 5MEQB 2VLJD 1C12A 3MRHA 4KQ3L 4ODUB 5DMKA 2YBRB 2B3RA 2VDMB 1A6UL 3LB6C 4Q6IC 4WU5A 5J11C 5EO9B 4K8RD 1XB8A 3GBML 1XGUA 4N9GA 1L5GB 5E1AA 3CZFB 3U6XS 2I5YL 1E7VA 2FWLB 1M4KA 4H1LB 4WJG3 4OJFH 4QHMA 4TLKA 5I66A 1N5AB 1HI6A 3H3PL 1S9VB 5DZNA 4YR6A 2FX8H 4JFDA 3FB6B 3MROA 1SVBA 3KYNB 5D96C 3I6KA 2GQHA 4PGCB 4OTXH 2EVJA 4KJWC 1NDMA 3TZVB 2V3FA 4O02H 1BFOA 1DE4A 1EFXD 3BVTA 2PYEE 3FCTA 3LNGA 1T7YA 4G83A 4MRBA 5BQDA 3VTTA 4LLWA 3VMPA 5C0CD 2LLNA 3C5ZC 1J11A 4WHYH 1WQVT 1JZ3A 5AW5B 1FIGH 2ALAA 2P5WE 3C2AL 3RNKB 3IU4L 4KO6A 4HUUA 1MJ7L 1DFBH 1R75A 2ZXGA 2DLFH 3FOMB 1UUSA 3IN0A 5LXVA 2BSSA 2VQ1B 3BEVA 4KRNA 3QHFL 2GSMB 2J2ZB 5JIDA 4MMZB 4DZBB 4YHYB 1J7VR 3L1OH 1F02I 2RD0A 3Q2WA 4BM7A 1AXTH 1GAFL 5E6YA 3UMNA 1RERA 3OR6A 3SCMD 4JVWA 1JXJA 4U7SA 2AERT 1BJ1H 3DMMA 5GGVL 1U3NA 4D7BA 1H9DA 4UILH 5IV2A 1AS8A 2E6PA 3KXFA 4UQ3A 3NSCA 4FNTA 1JGDA 1X3DA 2AV7B 4MQTB 3N55A 3VJ6A 2CM5A 2XNAA 2A6IA 3F7VA 4NZ8A 2EIMB 2C7UA 4XOBA 3Q06A 1H3PH 1NCBH 4MFHA 2AMUA 2ZPKH 4GBXA 4YO0A 2DWDA 4R0LA 2NY2D 3LPOA 4FFWD 4S1RH 1NM4A 4NWUH 1LDSA 4OB5L 1FVCA 1AZNA 3GD1C 4PP2A 3ARPA 3D09A 4NPJA 2QVFB 2Q8BL 4HEPG 2EABA 3KJ4B 4OZHE 3QZOA 5IJKA 4MD5B 3ARFB 1PCSA 1TNNA 2WVUA 5C08E 3EYFB 2J1YA 2YPVA 3TFKC 3QDAA 3WUWG 2FCBA 4OUUA 2F7OA 3VXPB 4KX9A 1J8HB 1CXEA 3FQ2A 1DO6A 3VG9C 4M62L 3LEXA 5IUCA 3BH9B 1D6EB 5AW1B 2GJZB 3HNVH 4XWOC 5IVXA 2ZJSH 3QDJE 3U0PB 1CC3A 5GRJL 2QJDA 3UTSA 2MPVA 3PWUB 2NW3B 2NNRA 1KTDA 3P4NA 4U33A 4U6VH 5L9DH 1FE8L 1NWPA 4JR9H 3V4VL 3T8VA 3L9EA 4JRWA 4PGBA 1K4DA 3BD5A 4PU2A 2PCFB 1OGTB 1SDDB 1VEMA 3CSYB 5D72H 3RPIB 1BVLB 5AALA 1U0QA 4QPEA 1A7RL 1J1OL 2VABA 3HC0A 3DNKA 1FO0H 3UMTA 1OAKL 2FATH 3MYJB 1PYWB 3RGBA 4E36A 3QUXB 1U58B 2EDNA 1FFPB 1NC2D 2NY3C 4XHJC 3TBWA 4F2FA 3GHEH 2C9AA 5JW4N 2BNUB 2HB0A 3EFFB 3PIQA 2FWSA 3MRQB 4TNFA 3R18A 4QYOB 4LRNH 1QR1B 3DRQA 5I6OA 4M4PA 3ARYA 1HSBB 2VLKB 1F4YL 1EPFA 1UM4H 3PNRB 2EXTA 3TA3D 1FZJA 5EH1A 4ZPVA 5TPWL 4O9HH 1JZ7A 3S3BB 1KBVA 5I74B 3RA7L 2EDHA 2ZUXA 2F8OA 3D87B 3TN0D 3CHPA 4AVIA 3CE1A 1T83C 3B37A 3VFVA 3VFGH 5I75B 5JR1L 3IDGA 3MREB 2E27H 5GZOC 2ZUQC 2XVLA 3A67H 3DX9A 7PCYA 4W4OC 5KSBF 3OR7A 5F7NC 4W9HC 4DNLA 3A47A 2FZ3B 3D39B 3VXRE 4M48L 3V52L 4YBQC 1FRGL 3QUGA 3SJVE 5C0AD 1XCQA 5JQ6L 4L4TE 1OKEA 5L4JA 1KWKA 5HHXL 4Y4HD 5E9DD 3GRGA 2DQTL 3TCTA 2OXHB 4K5OA 2XTSA 4RESB 4K23H 5AUMB 4QUOA 1WBZB 4BSWB 3CQQA 1NSNH 1ERNA 2XV3A 3R7QA 1BOGA 4AC4A 1V5JA 2JJTA 4R9HA 3NCFB 4UM9A 5HYEA 2LGNA 1HHGA 4TOYH 5IFAL 2WIMA 4ZX3A 1AY1L 3HOGA 3U82B 3TTSA 2VLLA 3BPLB 1I1AD 1TPXB 1MRCL 2BRRL 2NYYC 3JWNC 3SBPA 3WGUB 4B3EA 4UQBA 1LE5A 3NAAL 3EO9L 3WD5H 5JUEH 4WJ5A 2NW2B 3RZCD 3S3DB 2R0LL 4AIZA 5D1XC 4CSSA 3RKDD 5JW5B 3MN8A 2WYZA 4B7IA 1WS7A 3V0GA 2DKUA 4F57L 4A7UA 3RNQA 1E27B 1TZ8A 2W95A 2O4EA 4JO1H 3QJZA 2EIDA 5JW4Q 3BT2L 3GSRA 2P7TA 4GRLB 2GSGA 4JRXA 3Q8AA 1E9PA 3IGKA 2XVKA 1U41A 4X9BA 3N0PB 4WFHE 2QGBA 3PDDA 1NGPL 5IHWA 1ASOA 2WNWA 5J13B 2ADYA 4YEEA 4Y1TA 1C5DB 4GH7B 5HDQL 2YPLB 4PGZA 2FJUB 4Z7UF 4P5KA 4EDWH 1VSCA 3DGGA 3DUUA 2JCCB 3ZVVA 1OZUA 2C8NA 4FNUA 3PPSA 3S96A 1PZAA 2J55A 3DHMA 5MHSD 2Q76A 1UB5B 4I9XA 1ZXKA 1Y6KR 2I25N 3WFHA 3CUPA 1SLWA 3DYMA 5EZPA 3P9MB 2CO6B 1HYSC 1DQQA 3L5XL 1MF2L 2UZXB 3ZU8A 3VGAC 3QJHA 5ISZB 3MRBB 4LGRB 2A6JB 2O30A 1PAZA 3LIUA 4L1TA 4WW2C 3C5JA 4HPYH 2D3VA 3L4XA 4GW1B 2Y7SA 2X6CA 3P77B 3FUJA 2WD0A 2OSWA 1MRDH 2R69L 4C83B 2BSED 3QJTB 4NWTL 4XWGH 2R2HA 2WLIA 2OLDA 4FG6C 4RFEA 3O3DA 1LWHA 4ODSL 5J6HA 4QHUA 3DETC 2IDFA 1NIBA 5D93B 1C8QA 2NR6D 4APXA 5DD3L 1X7TA 4LVHC 1FC1A 1EVUA 2JI3A 1T0MA 3N1PC 1HXMB 1L9TA 4A7GA 3U6XA 1MSPA 1JHLH 5F6HI 2F74B 5CZVL 3PHOA 3US0A 4JHWH 4I1NB 4JFDE 4Y9CA 5AKSA 5SWZA 1I8MB 4F9PC 2HT4C 5D7KD 5IMOB 3ILDA 3MA9L 1P5UC 4O2CA 1YPZA 3BUYB 2W5PA 4FYSA 3DX8A 4R90L 4TL5A 3U0WL 1T6BX 5GGUB 3MACH 4ENZA 2X4QA 2CZNA 1XX9C 2CBPA 2OL3A 3GMLB 4TRPL 2A38A 4UTCA 3ETBF 1IM3A 3EYOB 3PL6A 5JA8B 1XGRA 3HS0C 4LLUB 5DUML 4XAWL 2X53A 4I0PB 2VDKB 2XWJB 4JGNA 2V3DA 4AMKH 4KX7A 1VDGA 5HYQB 4TUKH 1C1EL 4G6KL 1ILSA 3VGFA 1TVBA 3IN2A 1UWGL 5IB5A 1XH2A 4ELMF 4RFNB 1RY7B 5CEZL 3B9KC 1AGEA 2WXJA 4PJEA 4GG6A 1UWXK 4YK4B 1FZMA 5C09A 2P42B 2XVGA 3O9WA 3DXAE 3L3HA 4ABVA 3FS9A 4K3JL 5E03A 1DJZA 5JW3L 3SYCA 3VUAA 5FFLA 2FAUA 3AY2A 5HYJE 1RIHL 3ZY7A 5I0XA 4HS6A 3MRNA 4DEPB 1KV3A 1NCDL 4YSCA 4HFUL 5DHDA 2VXUH 4NC2B 3ZYIA 3BH8B 3LKSB 4YPGB 4N0UA 1BIIB 3C60D 5ESQB 2FO8A 2ZYSA 3QRFM 1J05A 5DRXB 3WLWC 1E4XL 3B7YA 1QFWL 4XNXH 2J43A 5F9DC 1MVUB 3APMA 4GQQA 1NFDF 3D2TA 5F9JB 3U9UA 1T22A 2X3CA 2X05A 4RRPA 3FQNB 1N70A 4RX4A 2WMPA 2VDNB 2EYRA 3HN3A 5HHVL 2Q8AL 5JYMA 4NQVB 4XHQA 1ZT7A 2K7PA 1FL3B 4Z95L 5DS1A 1QBBA 3W3BA 5A3IC 3ECQA 1SXNA 4ELKA 1JZ2A 3O3BA 5D1QA 2X2IA 3STZB 4Y89A 4H20L 2Z4TA 3VD7A 1FNEB 5I8OL 4FLQA 3AADB 3OKNA 3W9DB 2H5UA 2VO8A 3B83A 3UTSE 4N2IA 2BO0A 4MNQD 3NCJH 1L0YA 3K6IA 4U3SB 5C8JB 1NANI 3FMGH 3RWHB 1ILUA 5JIIA 2LV4A 3GMMA 3RWJB 2PO6B 43C9B 1IGTA 4FQHB 1TYEB 2R29A 4WI0B 1P0SE 4LBEB 3RP1A 3GXNA 4NNPH 1G5GA 3IJHA 2BM3A 5FGSA 3QAZB 2HRPL 3MO1A 3HG1B 2YD5A 1OWRM 1FQ9C 3GS4A 1HDMB 1T5WB 2ZWZA 3WEOA 5AG9A 3SPJA 2DPKA 3EXJA 5C7XL 4Z77B 3CC1A 3GMQA 3NH7H 4LEXH 4GQ9H 2H2SC 3IAGC 4LCCC 2Z4QA 2B9BA 2FNBA 1MJJB 1ORQA 4JFVA 1MN4A 3KPSA 5GJSH 1W0VB 1AS6A 4L8SB 4K8RL 4JL1A 5D1ZI 1JPSH 2XKUA 2OMXB 3JWOL 2GSIB 2VDMH 3ULVF 1V7NL 1NAMA 4HWEH 2FIKA 3LRMA 4OCSH 2R8SL 3MR9B 1UYWL 1VZIA 2EDYA 2WINA 5EUOE 1KBWA 2EE6A 1IBBA 1I3GH 3CC5A 4DGYH 4X98B 2VZTA 3OG6B 2BVTA 1SJHA 1J5HA 5JDSA 1NEUA 1YN7A 5IVOA 1LILA 2JMRA 3PREA 4ZOCA 3RJDA 2J44A 4PJIA 3B9DA 2ENQA 2N7AA 3APDA 5D1ZA 4D8PA 3BUDA 2OMUB 3VA6A 2EC8A 3NTCH 4BFGA 2JQAA 3ZL4H 2EYSA 3Q5OA 1L9QA 4YWGH 4HK3N 1W91A 2BS9A 1CFVH 2ZX5A 2E6QA 3O4OB 5A2FA 2H9GA 4I3RH 1M2OA 3PWPD 3UJJL 2ZKMX 1K85A 2KPNA 3WO3B 3BD3A 1KTRL 4UIKH 5EN2A 4Q2ZA 5C70A 1UENA 5AVTB 2KLRA 3PPEA 2CIIA 3DPDA 4J1UB 3OJMB 2R69A 1AR2A 4P2QD 3OGCA 4RBPK 1ND0A 3PJLA 5GHWH 4OCLC 1OEZW 4A7VA 1JGUH 7PAZA 4NCC2 5CEXA 4NO5B 1QW9A 3IDYB 4PRNB 4M43L 1MCLA 4Y9EA 1EAPA 4GSUA 1FVEB 3RDTB 4M56A 4JCMA 2HLFD 3X17A 3MRGB 5IM7A 2G2NA 1SXSA 1YEWA 2CBQA 3BAIA 1IGCL 3C5SA 3M1BA 3BQUC 3DVGB 4JDEA 5DC2A 1PQZB 2CO7A 5I1AA 2BDNH 2NNCA 3KAAA 5FHBH 5JHDA 4X4YA 2HJKA 1JHTB 2VMCA 3L3DA 4RLDA 1Q4NX 4FYRA 3EOBB 3FRPG 3TBBA 3RL1B 4DP9X 1WICA 2GYSA 2EKSA 3MV7D 2YEZA 3GJFB 3GUFA 5BRZA 5T5NG 4YAQA 3QXAA 4UNTA 4XCYB 2VJ0A 4WIQA 1BQHA 4OM0H 2WZPD 4HCFA 4YVUA 4DZ8B 3OLDA 4QTHA 3U9PL 3ARGA 1IC7L 4AM0A 5JW4M 5B4MD 1YNTA 5HY9B 1B4JH 5I73C 4CW1A 1G6RH 3MODH 3RL2B 4CVZB 1OL0A 1XGZA 3LHPL 5ANME 5HVWA 2V7HA 4K3EH 3QWNA 3WIIL 3QA3B 2J56A 1QASA 3MLUL 1IFHL 2NX5D 3K5RA 3FB5B 4P5TA 4Y5YB 4BDVA 1QFWI 4FC3E 3IPBA 3ARSA 3QUKB 3NIFB 3GKZA 3ZTNH 1FSKC 5DZ9A 2WB1A 1YYML 2UZIH 3RTQB 5HJ3B 1CD9B 2GCYA 2APFA 1Z5LB 5I8EB 3NEXA 3L3OB 3AG1B 1UH4A 2CKBB 3ARUA 5AVRB 1MCIA 2HLAA 4LQ1A 4S1QL 5TE7H 3CPLB 1Z3GL 4JFHD 4GRMA 1IC1A 2AXWA 3OAUH 4RMRA 3L8QA 5L2JA 1NMCC 4Z7NE 1EDYA 3WL9B 1CU4L 4PIRF 2F08A 3CVDA 1FLTX 4LVOB 4CL7A 4MS8C 2X42A 2CLZB 3I75B 1RUAL 2CD0A 4YXHL 4G11A 1DBKH 1ZLUK 1H8NA 1I1FB 1FHGA 3LKOB 1TZIA 1AGCA 2WW8A 4JUSA 1LLAA 3I9GL 3DPBA 4B97A 4KDTA 4PRPB 2R0ZL 2IV9A 3BHBA 4GG8B 4YDVB 4KTEL 1M71A 2XN9E 3IBEA 3MXWH 3FCGA 5SWZE 3MGOA 3FO2B 1XT5A 2AJUH 1X6NA 1FH5L 4JUTA 4PRIB 4QJ3B 4Y4FB 1KBGH 5HGDB 1KJ3H 3US9A 1BQLH 4OGYL 3SKJL 2R9HD 3FO1B 1UZ6F 1KN2H 4LKXB 4ZUWA 4NSKA 1DUZB 4UV4H 4KOBA 4X6FA 1LK3H 1OB1B 5FS5A 3FUHA 3FO0L 4AYMC 3S48A 2B7DT 4AY0A 1RJLA 4R83A 1F90H 3UDWA 4L3CB 1EEZB 1KB5L 1UH3A 1IAOA 1BBJA 1J9QA 2F0CA 5CCGE 3DYOA 3UZVA 5E8PA 5J06A 3O8XA 5L8KB 2AI0H 5TDOA 1W16A 3GRWL 2VLJA 1AHWC 3LEYH 4PJEE 5ID0B 4GG6E 2ATPB 2F7PA 3X3FH 5C09E 5E8OB 3IJEA 4U6TA 1AAJA 1WHOA 4GLRI 4JW3A 4U2ZA 1MNNA 1OGAB 1YEKH 4Y5XA 4MLIA 3OXRA 3IDXL 4JB9H 1TZOA 3SDYH 3K8KA 2P4AB 3H85A 2ZQKA 2HAZA 4YHIB 5AVWB 5KEZA 3RB5A 1ZPUA 2YQ2A 4JPIB 4N0UE 1RZ7H 3Q2NA 3FUFA 5F7EH 1A6WH 4MAYD 2V5TA 1BLNA 1MCEA 2HT2D 1XR8A 5DXWA 4AGQA 5FK9A 3U48A 3MGAA 2WOYA 2NUPA 4ZW8A 1EFXA 3BN9D 1LO2H 4PLJD 5BO1L 5D7HA 4MMZC 1TVHB 2DQHL 5C0CA 4KQ0A 5ILTL 3H42L 4KHTH 1Y18B 3ZDXF 4S2SB 5BMFH 1QI4A 2PTTB 1NCWH 1H8OA 5F7KC 1SQ2N 1X5LA 3PGCA 5AVZB 5D1QE 3HB3C 3FB7A 3OM3B 1DDHB 2C1PA 4JFZH 3K1DA 3LPGA 3LQMA 5DRZA 3INOA 1RZGB 2DQDL 3ZE2E 4B41A 5JIPA 5I1CH 2XWEA 5DRNA 1TDQA 1H19A 3WMSA 4AH2A 5CLXA 2WXKA 2XKNB 4K5NA 3SCMA 2ZCZA 1AACA 1XFPA 4V1DD 1SY6H 3C8KA 1JVLA 4JG1L 3IKCB 1Z9MA 3DV4B 5C0BB 4FXGA 1KPVB 2F53B 1G7LB 5L8LB 4J8QA 5E2VH 1B0IA 3F2LA 3L5HA 2X7LA 3ARFC 4MDIB 3N85H 4KY1H 1U95B 1BMZA 3PUCA 4QXUH 1DQMH 2CDFA 4BK5C 5HTSA 5DMGD 1XGPA 1VACA 2WKGA 3VNYA 4WQOA 1IARB 3D4ZA 3NVQA 3FHQA 3CFDB 1NJ9A 3BXNB 1JTPA 1N0LA 1OQXA 2D31B 5TF0A 3DV6A 3FRUA 4G8IB 3GJEA 2H0JA 1OPGL 1XH1A 3WTTA 3K0YA 4XBMA 4DGVL 1H3GA 3TO2B 3ZIYA 1JWSB 4KVCH 2JKRM 1N26A 1QBMH 3RWCA 3ZT6A 3O6LL 2YZ1A 1Q9KA 3REVB 4MXVF 2NYZA 3VFWB 1QFUL 3MA7B 1BZDA 3HMWH 1UXSB 4IK6A 3LRSB 3S8GB 3X14B 4HKZA 5DD5L 3DX7A 1ES0A 2CUMA 3KLQA 4PW9A 5M94B 1YMHA 3INUH 3ATBA 1R5IB 1VA9A 3FB8B 4IJ3C 5F93C 2OYPA 2P3YA 2EH7L 2AFNA 4NM8L 4J3BA 4BCYA 3T6QC 1D9KD 3SKNB 5FW7A 5IVZA 3IDNA 1LE9A 3UBGA 4HGMA 3FK3A 4PJBF 5CINL 2KPWA 1E6OL 1OHQA 3BGAA 5I71C 1N4XH 2QZQA 3ZYJA 5GGQH 4JPWL 1BM7A 3BKCH 2GK2A 4GKOA 2AEOA 1DQLH 1DQDL 4ICXA 4OCXL 3ZLQC 2BSTA 2CJTA 1NC2A 2VDKH 1JZ8A 2HXAA 3FQ4A 2XACC 4ODXB 1OTUC 4UV7H 1THAA 4HZLB 4JPKL 5IIEA 2ICWA 3MV8D 3LEVH 4XXDA 5FOBA 4I1PA 5DUPL 3PHSA 5SWSB 4OQTL 5FECB 3TA3A 2H3XC 3IAQA 2VXSL 4G42A 4WEMB 2XQYA 4KKAC 2FJSA 1QLEB 3QWRD 1Q1JL 2EINB 5CEYB 3QAQA 3SZ6A 4X8JB 1RUMH 3WS6A 4P2OB 2BOBA 3E6HB 2X4UB 1A6AB 4KTDH 3TN0A 2CM6A 4KKZA 2IH3A 4ZDHB 25C8L 3VYPA 5JHDE 4POYA 2WM0A 2AGJL 3OPUA 2PWEA 3BVDB 2IFFH 3FQXB 2XX0A 3RIAK 4AENA 4LNRA 4OZIA 1S7RB 3HPJA 3A21A 2ZXDA 3V0DA 4KH9A 2JLPA 3DURB 4F7TA 3B7TA 3TEXA 4NQTA 3RU8L 1F3JA 1T66D 5KYYA 2VDNH 3JBG7 2VSKB 3SDAC 5HI5C 1ZEAL 2WIIA 5C0AA 5ANHA 1I7RB 1EZVX 1NBYA 3QO0A 5B8CA 4Y4HA 5E9DA 1PEWA 3RWGB 4HF5L 4KK8C 5GGSY 5D2LA 5GPRA 1TTGA 1ESOA 2GG1A 3ECWA 3UBXG 1NOFA 2MOGA 32C2B 3LDBB 4KJWD 4RVBA 4HJUA 5HYFA 1JF6A 2G75A 1T89A 3S4SA 2DMGA 4HWBH 3BFWA 5E2TH 2D7PA 4LSUH 1KB5A 2HH0L 2AEIT 3C5ZD 4XT1C 3IJ9A 5ESAA 1OAUL 1BXVA 1QHQA 2NY6B 4XMKH 1I1AA 1QFHA 4HSCX 5CEZE 4HIHB 5IB2B 2VUYA 3EOAA 5DJCB 2YQ3A 2B14A 3RZCA 3HHSB 2ORBH 2WXQA 1Q9OB 1IKFL 2CRMA 2MHAB 1CFQA 4X4XB 3VVWA 1MJ8L 1AGDA 4HH9B 5BCAA 3WEBA 4TSCH 4XNMB 3QNXB 5J13C 3DTUB 4N0YH 3VDBA 1NBZA 1U8CA 3IM1A 5LAPA 4G6FD 4GUPB 1GGTA 1GZQA 3LRHA 1GXEA 4LSTH 1KBBA 1S7XA 2ZCKL 1U8OB 2VDPB 1ZHLB 1JF5A 2BLFA 4NAMA 1ECYA 3U7YH 4BE5A 3Q2LA 4G8GB 4N9OB 1QLFA 1Z7JA 3QJVB 2DQIL 2ZYIA 3IFPB 2OZ4A 1JL8A 2X1WL 4BFIB 5DQJB 4AQ8C 3CPUA 3B2VH 1P9MA 1Q9LA 1A2YA 1N18A 1WWCA 1AQDB 1CDCA 1ZV2A 3QUMA 4L8DA 5DTFB 2BS71 3R0NA 4DP0X 4EN2A 1ULVA 1SXBA 3BAEL 4M7KL 5FV1L 3TEUA 3IRCA 3PYCA 4PMEA 3MUGB 2X09A 5T3ZD 4XVUD 1I4FA 1EGJH 2HRHA 4UMGA 3D30A 1R3JA 2IGFH 2OR9H 3BLBA 1SJEB 1MFNA 1TQTA 2PUQT 1D5MB 4FQPA 4H26A 3BO8A 3TFKD 3VI4B 4ZBJA 4I18C 1F8TL 3RWEA 4RMVA 2X5PA 5T8IA 3U46B 1YY8A 2ZCHH 1BF5A 4MD0A 4XWOD 5IB3A 3K6SA 2YRBA 2XC8A 2FTAA 1O75A 1NEZA 3UO1H 1TTBA 4CVWA 4FNQA 2BS8A 3EJQA 5DS8A 4GAJH 1HWGB 4ES8A 4J3OH 1HHIA 3D3VD 3UYPB 1WVZA 4BKLB 4X6BB 2BSEA 2R1XB 1H8LA 1B3JA 3D2UD 2X6AA 2QGDA 4DKEH 5ERWA 4GUQA 4P9MH 2ITDA 4MGXA 1X5XA 1YN6B 2H26A 1NAKL 2VLJE 3WN5C 1CGYA 1LP9A 3BCDA 5I1HL 1KXVC 3KWTA 1DVFB 3DJSA 2WGNB 1X5JA 1K8DA 2NR6A 5F9AC 3V6OE 4N86A 1QSFD 1VFAB 4WTWA 4XTRD 1I53A 4JZJA 4XHJD 2NY3D 2Y1AA 4ZD3H 3QEUB 4KROC 1INQB 4HIXL 1L6XA 1YEGH 1EO8H 2N59A 5F7HA 3ZRFC 1M42A 4XBPA 1S7TA 1J0JA 4G80B 3GMPB 4GI8A 4MB4A 3S34L 2QZ5A 1CFSA 1BPLB 1EH9A 1HE7A 1PX3A 2DI9A 3GSXA 3TBTA 2XXMB 3QULB 3IMBA 1D5RA 3JTTB 3DUSB 4ZAKB 1FGVH 5D70L 1JUFA 4OCWH 5HPOA 3P9LB 3DRTB 3RWFA 2X4PB 3SPGA 4RSYA 1UA7A 3ELAT 5GZOD 4M5ZL 1Q72L 2BW4A 4L29A 5DJ6B 3PGDA 2WUCH 4MAZA 4GUCA 4N6RA 4AGPA 5FEBA 4YJZL 5TE6H 4YGVB 3QZMA 2DYRB 1N10A 1OT2A 2CJUH 3FQRB 4APQB 2HFGH 2KYIA 1ZSDB 4XOEA 3IF1B 3P1VA 5L4FA 3PFUA 4B0MB 3IFOA 1U91A 4WUUD 1JI2A 4Y5VC 3QQXA 8FABB 1AD0A 1EBAA 1W8EA 5EOTA 1HQRB 1N6UA 3ATEA 4XCCL 3LRKA 4JG0L 4X80L 2WCPA 3GM8A 2A2QT 3FTUA 1YEIL 2ZZUT 2CLVA 2OMTA 3HNSH 4MZIA 2ARWA 2FJFA 2ZWLT 3AU1B 4QKXB 3BD4A 5CJQL 4JG9A 4NHUB 4M6OL 3ZR5A 4K5PA 4ZZFA 4RMWA 1X4XA 1L4IA 1UGNA 2DTMH 3C60A 2F68X 3MNMA 4J28A 1A4KA 1RLWA 3QSKB 2EIBA 4WV1B 4U3HA 3LN9A 1KACB 5CP7A 5LGHH 4UOZA 4YHNB 2B3IA 4IOFD 2X6BA 4R84A 1XTLA 2DMBA 3EO1B 3HUJB 2Y07H 4PW3A 5D1XD 4KHXH 4YIQB 4FQLL 3AW5A 4RISH 1ZLSL 2ADJB 2AJXH 4TSBL 2OZNA 5ICZA 5J12B 1OSZB 3UZEC 5F1SA 3VGHA 1W80A 3FULA 3FTYA 3AITA 3MLZL 4R26H 5DD0L 3U1QA 1WBXB 2JCCF 4MKTA 5SWQB 1CXKA 4LB8A 5EA0H 4PJFB 4MNQA 1QAWA 4TMPA 5F9WC 5HI4C 4LP5A 4WNQA 1IFRA 1BXAA 1ZHBB 2L4OA 3BPNB 5D4IA 3P0YH 3MJ8B 4PJ9B 3Q43A 1CE6B 5ID1B 2ICCA 2X10A 4OLUH 1U8KB 1NCCL 4WSJA 5F2FA 1F58L 5AZUA 3VGDA 4OLEA 3HI1A 1JYVA 1T6WA 2J88H 1TJHH 4YXLH 1S5IH 2AEWA 3FOLA 2Y5TA 1WZMA 4R2GC 4QOKD 1ZLVH 1KEGH 2ROXA 3GC3A 1FG9C 1WC7B 4N2NA 5DJDB 1VAHA 1G7JA 4CVXA 4ZTOH 2DBLL 4TV3A 1CFNB 4JN1L 3FQYA 5KBDA 1XZ0A 4WTZG 4JDVB 2EECA 2J8HA 4A6YL 4P99A 3HA0A 2HT3C 3PXJA 4LT7A 5F7DB 2V7NB 4JM2B 4CNIA 1JWMB 3U4EA 2IDQA 3T3PE 4E0RA 4FABH 2AXGA 5B1JC 4GXFA 1MAMH 1MLCB 5DHVA 4BWTA 1E5UI 1HHKB 4YL9A 1PG7L 3CN1A 3C08L 3V7MA 1TTFA 4HK3J 2BVQB 3O4OC 1TEYA 4FG6D 2WLNA 4H88H 1IBYA 3VB9A 4EI6B 2VDLB 4KZDH 3F58H 4UNVA 2X4NB 4U7KA 2Y7NA 4TVPD 1YEEL 4J3OC 3TH2T 4EOWH 5C0FA 2COVD 4OZIE 3HPLA 2VH5L 5HDBE 4M7LT 5F1NA 5E6ZA 5MEPA 3T6ZA 4H2CA 1K5NB 1X4YA 4YHKL 5E8EB 3WTXA 1IE4A 1ROCA 5BOJA 1S7VA 2ZKXA 1A9EB 1TIUA 2PP9A 5IHZB 4Q7DA 4A39A 3IJSA 4XB8A 3BSGA 3PWPA 3Q9PA 4MJHA 4JRYD 5E9DE 4PSPA 3BGFB 4FQ2L 5IHUL 2HT4D 3LXCA 2ICES 3NDZE 1N59B 2A99A 3BKJH 3SY0A 4EKXA 3I6GA 3W0WB 4LGPB 4DN4H 4YSUA 5D7EA 5KVEH 4P2QA 4P57B 1AZVA 4AWJC 1MFCL 3CCHA 4OH2A 1WFTA 1TJGL 3B2UC 3SO3C 1XH3B 5TGBB 1QSEB 1YUHA 3RI5K 3HAEA 3GI8H 3WJLA 3H8NA 1BPVA 3MV9B 3UTQA 2MEJB 2FQEA 5FUOL 2AK4D 4LFHG 1XSIA 2BWDA 4M1GL 5J1AB 2OCCB 4KI5C 3V5HA 3VXSA 4PG9A 2Y7LA 2YSTA 4X99B 3FSWA 4MXWL 4E9WA 1F41A 2BP0B 1E5ZA 2GJ6D 3VXNB 4R8WH 4WVRA 1TSHA 2YEQA 2HKFL 3SBWC 3I2CH 4JY6B 3C6LC 3G5ZB 2XIDA 3NIDB 3ZHNA 4U0RC 5EZLA 2JELL 5IT2H 3BPCB 3MFFA 3MV7A 4X9FA 3TNMB 1S78C 1ZJAA 2P8LA 3HRZB 2ZUYA 3CN2A 1BFTA 4Y5YC 3SEPA 2VAAB 4E9VA 2WZPA 3MRMB 5B39G 1WAEA 3KS0J 5DFAA 4PJ7E 1GGBL 5DVKA 5GISL 1D5ZA 3PV6A 3WLWD 4FE9A 3OBAA 4ZUVB 3D9AH 2F61A 5IQ7L 1NUNB 3QXTA 1RD6A 4PLNC 3LXUX 4LPWA 4P4KD 2OKMA 1HTYA 1L0PA 4P8QA 1NCHA 1G7HB 1QOKA 2FX9H 3LRLA 2GUOA 3L3GB 2NX5A 4KRLB 5KANG 2N7SA 3LQZA 5C07B 2F18A 4R7VA 5A3ID 2CR6A 1CGVA 3P0GB 3EH5B 2BOCB 5BV7B 1LXMA 4LVOC 1G4MA 5LHDA 1EEUA 5IHBA 2L3BA 1A6VL 4TKWA 4R5TA 1SBSL 3DX4A 2E4TA 2FUQA 2UXGA 1OP3H 1B2YA 2IDSA 3RVXC 2RACA 1ZS8A 2VDRL 1IC5H 3AACA 2ZSWA 5DCCA 1PD0A 2C9UA 3L95A 5AL0A 1HKLL 5FO7A 3OKMB 1AQMA 4KVPA 4UOQA 3G5YB 1S9XB 2N1TE 1A0QL 2EDLA 4YLCA 4HJ0C 1MLBA 1LP9E 4AW4A 3MRJB 1ZHNB 3BAJA 1T1XB 3FU9A 3AMLA 4FQCH 2PXYD 1JSYA 4KUZH 4GAYB 2V5MA 3VRJA 5KTEH 4EN3C 2ENPA 2J5WA 3EBHA 4Y4FC 1URIA 1QLEH 3EF4A 2VR3A 4AQZA 3K7UA 1I3VA 2Z8VC 2NTFA 1IM9A 5M95B 1IV8A 1LD9A 2H2SD 4P23B 4Y2DB 1HINL 3AT9A 2W60A 2P47B 3F85A 1G7IB 2Q6WA 4F7PB 2ZUWA 1D7DA 2RFXA 4ZQKA 4JMXA 4NLHA 2D7QA 4HQQH 4BINA 2X9YA 2Z7WA 5BW7C 4EVNB 3UAFA 4Y1AE 3AREC 4KQ4L 4Y88A 2VR8A 1NCAH 3D6GA 3DVNA 4WU7B 3APNA 4M5YL 3IRPX 5E2UL 1QNZH 2NUTB 1JWUA 4NJAL 5EBLA 5TDNA 1IGML 1NBVL 4G72B 2BP8A 4B0MM 2IPTH 4PV8B 1KJ2H 2XZQH 5GQBA 1FPTL 3CXHJ 1U93A 4ODHH 2BWQA 5B38B 1BHGA 3TT1H 3K8LA 2A6KA 3B4NA 1AXSA 5EIVA 4UM8A 4F1ZA 2QPDB 2GK0B 2XV0A 4L4VD 1XGYL 2MIZA 2XWBB 4J2QA 3N44F 5E70A 4EI0A 2EE0A 1O6TA 1QBLH 4AW7A 1Q94B 4PJAE 4UT9L 3JWDL 4G9DB 3Q6FB 4XMLL 3G5VA 1S7SB 5F7LB 1HEJC 3F7KA 4WO0A 4LLVB 1BXUA 5DJZB 4MAYA 4S10A 2IXQA 1K9TA 4NRXA 1DLHB 4Q9CA 2XTJD 2KI6A 1PD1A 4C8XA 3CK0L 3K71B 2D7NA 4N85A 4HWZA 2AJSL 2R1WB 2VDPH 5C7ZA 2N3JA 4ONFH 4LCWE 1NGYB 4HMEA 4YDJA 3TPKA 1MY5A 3K80A 4KPHH 1H5BA 1BQRA 4GQRA 1PZ5A 4G2AA 4QWWC 4X6EA 4OM1L 4WGWB 4I2XB 4LLDB 5K9KA 5T3ZL 5FO9A 3JV6B 4PRBA 3VCLB 3KCWA 2CDEA 4PJDF 3QH3A 1BIHA 5J1SC 5LN8A 1UM6L 5AOZA 3VXMD 1BJ1J 4FOMA 4FXKA 4MNQE 2O5YH 3EHBB 2JJSC 1UT1A 5DHXB 5C0EA 4FZ8H 2LLLA 5IBUG 4V1DA 1BV8A 2KZKA 3NIFF 4I77H 2VITA 3ZYOA 1JPGA 1BVKA 1CFBA 2HVJA 2WXLA 4PBXA 5DMIL 5F9OH 3NSXA 4UT6L 4AVJA 2C3VB 1VPOL 1ZMYA 4JFFD 2BNRD 3NJGA 2FJGB 1A3RH 1ZT1B 1LO5B 5K9QI 2VC2B 2TRYA 4XP6L 3LPPA 1NFIB 4FNSA 1MCRA 1FNAA 2VIRA 3GSVB 3F6JA 3LN5A 4L1LA 4LKCA 3T0EB 2CHWA 2Y5QA 2H1LM 1JBJA 4BH8A 3S0PA 2XA8L 1BVNT 1LDPL 5ENWB 2ZUVA 1E2ZA 3WKMH 2QHRH 1A65A 3MBXL 3FHAA 5JA9A 4NKOB 3MBED 3SYPA 2VZSA 4PTTA 4MB1A 4UTAH 4HW6A 4IK7A 4LVEA 3CFMA 3KCPB 2V17H 3OAZK 3QCTL 2D4DA 3Q5YA 1BMGA 2XPZA 2Z8WC 1ZXQA 4MS8D 4B95C 2VWEE 2GBTA 5JPNA 2PF6A 3CVHH 1HH6A 3BP7B 4M6NH 1VGKA 3NA9H 1D9KA 3O3AB 3BEWA 1WZAA 3QB7C 4N5EC 2Z91B 5E7BA 3VXUB 1X9QA 4XO5A 5FB8A 2Q1EA 5GGTL 2YXFA 2F8IA 5IW6B 4G5AA 4AUJA 3NQIA 3UG4A 3PWPE 5L2KD 1O6SA 4RGOH 1SLUA 2C1OB 1F3DH 3ALXA 2ESVB 4UAHA 1WZLA 4XN7A 3MRFB 4HKBB 1B4LA 3FTWA 4R7NA 2DWTA 5E4IA 4NZUL 3EOTH 1UUNA 2ICEA 4IGBB 4GW5A 4P2RB 2XY1A 4G5ZH 4LF3B 1ZDQA 4OV5B 5TK4A 3MV8A 1T7VA 3PXHA 1BSIA 1JGEB 1N8ZB 3G6DH 1T0NB 2NDFA 3CH8A 4MNGE 1CI5A 2RCSH 3QJFA 2H32B 1MFBL 2VN7A 3QWRA 4TUJB 1IBHA 4JO3H 3FC8A 2A9DA 3KPLB 3GSWA 4PJCE 2W07A 5GS1A 3WEMA 5FW8A 1YC7A 5IB4A 1ZLWH 2FX8L 3ZBMA 1E9QA 4MASA 3GMRA 4OTXL 4C4BA 4NQCE 1XV8A 1JD7A 2CPUA 4HSAC 3U2SA 5FCSH 1PBYA 5DF0A 5IMMA 3ES6B 1EJOH 1I7ZB 4FEMA 4PG2C 3TZVD 2A74B 5KVMC 1KT2B 1J8KA 4XVTL 3V4UH 4BZ1H 1FIGL 5L4IA 1I8LC 2BNQD 1F6AA 2K4AA 1DFBL 1TQCB 3UPAA 2DLFL 1HOEA 4YHLH 2WBXA 1RK1A 1AIZA 4F91B 4YSEA 5FW6A 1S9WB 1U8PB 2ZCLH 5MP6H 1AXTL 4ORGB 2JJVA 4HXBL 3UADA 3QUZB 4JPQA 5K39A 1OE2A 3V6ZB 5J9PB 1CDBA 2NX5E 3C5ZA 3WENA 1U3HB 2X3BA 3L1FA 4MZ2A 3OKEB 1UD2A 1HIML 4GT0A 4XNYH 5AAMC 3HB3D 4TSAH 3ESOA 5AVSB 3PNWB 4WTZA 3AB0C 3LSOA 5IMLB 1BA9A 5MENB 1D5XB 4X7EC 5M7QA 5AFAA 4S1RL 3VI3B 1ETZA 1H3VA 3B7RL 3F62A 4LOUD 4OIFA 4UT9A 3LKNA 4JFHE 4LZKA 4NZRL 3NMEA 6FABL 4JHVA 4JY5H 1U33A 4D7PA 1QTPA 4UQAA 5IOPA 1QHOA 3T8XA 5EBMA 3ZK0A 4MMXA 1YLBB 2HFTA 3ARFD 4F80A 2Y3NA 1F5WA 4N0FA 3G6JB 4L8BB 3WUWB 5I6MA 3H55A 2ZJSL 1Z0NA 4BUHA 1YSOA 4MLSA 4TVPL 4OCRH 1H8SA 3KL0A 3ZL1A 5L9DL 1AG6A 5DT1H 1CFTB 3HE7C 4DVRH 1SM3L 4K7FB 1D7BA 1JYNA 1DBJH 1ZD6A 5D72L 4X9HA 2OMVB 2X4OB 4ENEC 1U92B 3G6AB 1H3XA 3ZUCA 3AQYA 5B7EA 3SPHA 1E4WH 1IBZA 4M1CC 3LQAH 3D34A 4ZFOB 3BQVA 4ANKA 4PVBA 5LUMA 3HG5A 3D3VA 3CDZB 4Y2OA 3ZE1E 4LRNL 5AVUB 4M3KB 4L37A 3H56A 4GQZA 3D2UA 1ITCA 1UM4L 3L6FB 1Y1DA 2BW5A 4PHXA 1QATA 4X7TA 2Z3FA 3DHJA 1JXFA 3VFUA 1BOYA 4JDTH 2VLKD 1KLGB 4ALAL 1QSFA 5C0IA 1O0VA 2I7OA 2WBJB 2XY2A 2A0LC 2LLGA 2XWTA 2DLGA 2VDOL 1OTUD 3B5GA 3NJKA 3VFGL 3R8QA 2VXTH 1H15B 2JKIS 2E27L 4HAKA 5F6IC 3QIBB 1KB9J 1CXHA 2E6JA 3ARDC 1Q0EA 1KCVH 1XD1A 2I9TB 4C55A 4XBGB 4AJ0A 2PLTA 1SDAB 4EDXB 4IJTA 3V5DB 3ZSTA 1TQUA 1KCLA 4KKAD 4PJGB 2LHAA 5JOPD 1ED3A 3GK8H 4KJYB 1LWRA 1WK0A 3ZKMD 3MRIB 2BJMH 3F05A 1WG3A 3X1FA 4APQC 3DOSB 3D39D 2C5DC 1NCUA 5AKRA 5IFJA 2EUWA 2NNAB 3EDEA 2WCSA 5GGTA 5BUAA 4Z3HA 1T83A 1J5DA 5EF3A 3ESNA 2AV1B 3MFGB 4QT5B 2RQ8A 3X13A 2NZ9C 2OM5A 2JTDA 1LEGB 5GZOA 4MWFB 1T2XA 3O6MH 1U8JB 1GYAA 5JQIB 4HULB 4W4OA 1XF2A 4TOYL 3AXLA 3BPOB 2QADC 3B9VA 4HLZG 4KMLB 1KCSH 3RGHA 3ARBB 4NENA 3HE6B 4C4KO 1ZE3H 3D07A 4LCYB 3D69A 3SDAD 4DGIH 5LQBH 4FQ1H 1BG9A 2J8UA 4WUUA 1SHXA 1HHHB 2WBWB 4RWYH 4V1DE 1INEL 4AKQA 4C57C 4URTB 3DGCR 4XRCB 4GIOA 3UL4A 1U21A 5E1HB 2B1AH 4HLEA 2YK1H 4XP5L 2WLMA 3WNLA 5C9KA 2WSPA 4JO1L 1OP4A 3V7AG 4WO4C 1Y6MR 4OD2A 4U1GC 4KQ3H 4V33A 3GEWB 3CFKA 5FDWB 1IEBB 1NCOA 4O02A 4GOSA 4IIZA 2VUOA 4P5MB 1BWWA 3LN4A 1A6UH 2J6WA 5GS2H 2NDGA 2MPAH 3ZTEA 5D1XA 2ED8A 5DUBA 3BUIA 2XZZA 1QKZL 2ED7A 3LRGA 4P2YA 4UUJB 1DN0B 5GRVK 3QIWB 3IDJA 3KDMA 2LTQC 2YPLD 3H3PH 5EIIB 2H4EA 4NUPA 5DVPA 4K0OA 2JIXB 3L5JA 3FUKA 2YLHA 1GMIA 3DGDA 3QQDA 1XSOA 2EXYD 1MI5B 3RY5A 1RZFH 1FZKA 2B08A 5DI8A 2K1MA 2BC4B 3GSQB 4YXKH 1MWAB 3VD3A 3ZDZE 4KDWA 2V2TA 3DMMC 5I1LB 3GMOB 3VO0A 2YGNA 1IO4C 3EGSB 4YNYA 3EJYC 3RDJA 1MCHA 3C2AH 5IG7B 3VI4F 5LGJA 5DD1H 3QI9B 1GIGL 3NN8A 3IU4H 1F4HA 1JNJA 4QIRA 1P1ZB 4QHLB 2BFVL 1I8IB 4CILA 4HS8L 1YAZA 3X1GA 3PAZA 3O11B 1DZ0A 3QNYB 4QOKA 2L7UA 4R0LC 4GO6B 4XWGL 5E94A 3AUWB 5EU4B 4NO2B 2MFNA 3N40P 1JK9A 3TO4B 2FGZA 1I7TA 4WAFA 2EQDA 5D7IF 3F04A 2DDQH 3SKOB 1AANA 1P7BA 4ZZKA 3MV8E 4OZGB 4EUPB 1NBCA 2ZX6A 2IEPA 3F7RA 2VOTA 3OGOE 2FLRT 1R5VA 1QWUA 2VE6A 3CZSA 2YHGA 1SXAA 2X1XR 4WW2A 4JANB 4R4NC 3U4KA 2GPZA 2AKRA 2PCYA 4JHWL 5IKCA 2V2WA 2R1YA 2WY3B 3CDFA 4NS0A 1R3LB 3LQAC 3TEYA 1AHKA 1HE8A 4OB5H 3UZQB 4FMKA 4FTVA 5F0LB 4YDLC 4PCSA 4PREB 1TKWB 2IPKB 1U8HB 2Q8BH 3MACL 1XCTA 5E6IB 3D4YA 4MYPA 2WVSA 3FH7A 3SY6A 1FJ1A 2F5BH 2OAAA 4KROD 3TL5A 3FZUD 3APCA 4RAUB 2Y9RT 5GGRY 2DS4A 4JAMB 3DSNA 1J1PL 2G5RA 1J1XL 3EFOA 4JRYA 4ZSOB 1E50A 5CHNA 1TQBC 2ZXEB 5MI0B 5I8CB 2HTKD 4HHGA 4X5XB 3BW9A 3F01A 3MJ7A 5GRJH 1NL0H 1KXTA 3BJ91 1IRAY 3QNZB 1P5UA 4X6DB 5CLWA 5IWLA 1DBML 4OD1L 2MQGA 5LDSA 2WNKA 3QXDA 2DQCL 1FE8H 1IAKA 3V4VH 4UU9B 2XZAL 4G71B 3ALWA 3L3KB 3QEHA 5C0GB 5DHEA 3SDCB 1MELA 2WXIA 2GT9B 3HS0A 2MH4A 1QTSA 5DHYB 3W9EB 3JZ7A 4L2LA 5CSBA 1AYRA 3F6LA 1P5VB 4HA1A 1J5OL 5I30L 1OAKH 2VXUL 4OIIL 2AK4A 2VNCA 4WWNA 3HRZC 2HG0A 3WFDL 3BE1L 1N68A 2DKMA 1C9SA 2DLHA 1WAPA 5BZWA 2VC2H 4YFLI 5D2NB 2VQ4A 4MCNA 1HL5A 2FO4B 1F4YH 2W9EL 3J07A 4X7DC 1VESA 1VCBC 5TPWH 3HUJF 1ZE3C 1F18A 1CL7L 3P0VL 1FNGB 4NLAA 1WT5C 3HG4A 3L5WA 4QXVA 1MNUL 2K78A 4XH2B 1EJFA 2UZYB 1R6VA 2A83B 3T77B 1CICB 2AJYH 2QHLA 3KH3A 4Z7UE 2I27N 1GH7A 3KHQA 3CTTA 4P4KA 3NCJL 3MLPA 3THML 2JJTC 4MQ7B 5T3ZE 1L3NA 4Z7WB 5AWNH 3Q5TA 3B3IA 4PJHF 1BJMA 2DH3A 3V52H 3FF7A 3WG7B 1FRGH 4NNPL 4PP1C 2PO6D 1A1OB 2WUBH 2NY4C 1DCLA 2IWFA 3BZFA 3T6XA 3BUPA 2ZOWA 3N0AA 1SLXA 3Q6GL 4XODA 1J87A 1NINA 3K74B 3EDKA 3HG1D 3NH7L 1VFUA 2VSCA 4LEXL 2V9RA 3ABGA 1B3IA 4WHTB 5HI4D 1FFOB 4AITA 2JJWA 4K7PH 5IFAH 2QVMA 2F1EA 1AY1H 4NC1C 2JE8A 5I17B 1PPIA 2YOCA 3OL2A 1MRCH 2BRRH 3E2HB 5JTWA 2VDML 3EO9H 4YZWA 2YXWA 4QLRA 2PXYA 4UI2A 4HWEL 1RULH 4JM2F 5LN4A 3VRLF 1QSFE 4R2GD 4OCSL 1VERA 2PCPA 4F57H 1FG2A 2XXFA 1FI8C 3E8UL 1I3GL 4KV5E 4DGYL 4F7CA 4HBQA 2P28B 2HJFA 4LCCA 4M6MH 3ISYA 3TT3H 1UHVA 2H6OA 1BW8A 4FL4C 2HT3D 1I9EA 3O4LD 1OT4A 4FULA 4HKJA 3BKYH 1G43A 1U3YA 4ANWA 3NTCL 3GIZL 3ZL4L 1KIUA 4BA0A 5F71A 4YPJA 1NGPH 4JKKA 4N8VB 2WLLA 2FECI 1CFVL 2C9VA 4MQSB 3NESA 1HXKA 4I3RL 3W57A 5EDSA 2BMKB 2R7EA 1KG0B 3UX9B 3T5WA 4YQXH 2WXFA 3DX0A 5HDWA 2NZIA 3OV6A 4E42B 2K9FB 3CIQA 4UIKL 1SHMA 4AG4L 4CKVX 4F7EA 3FN0L 1KTCA 4J3OD 3VD5A 5FFOA 5H35A 3CXFA 2H8PB 4U6XA 3IWUA 1M2VA 3CSTA 4G6JL 4XXCA 3I6LD 3MUY1 2XWZA 5I26A 2O6DA 2ZE0A 3L5XH 4IRJC 1MF2H 3UACA 4IU3A 4QYAA 5EU3B 3H53A 4NN5C 3TWCL 1NICA 4L4VA 1GPOH 4NPKA 2H45A 1TZHA 4X5WB 1EEQA 2Z34A 5C2UB 3AFLA 3OQ3B 4HWUA 4X4KA 5ACZB 4WFGE 3RDTD