1P0SE

Crystal structure of blood coagulation factor xa in complex with ecotin m84r
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
139
structure length
139
Chain Sequence
VQPLEKIAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTRMACPDGKKEKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Extended Interactions and Gla Domain of Blood Coagulation Factor Xa
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Coagulation factor X precursor
total genus 19
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2003-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF03974 Ecotin Ecotin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1p0sE00
1FI8C 1N8OE 1SLVA 1SLUA 1ECYA 1EZSA 1AZZC 1ECZA 1SLWA 1IFGA 1SLXA 2Y6TE 1EZUA 1XX9C 1XXFC 1XXDC 1P0SE 1ID5I 4NIYE 4IW4C
chains in the Genus database with same CATH superfamily
1R5IA 3WYRA 3NIFF 2DMBA 1HVXA 3ULSA 2I5YH 4GAYA 2C7UB 4PBVC 4PHZA 5DRWA 4N1EA 1O5PA 4IK6A 5GRYA 1F02I 4NBXB 4ALAH 1LLAA 2DDQL 2QADD 3HPLA 4FFYL 1IC1A 4LLMA 1IO4C 4Q6IB 1KBKA 4MNGA 4HOXA 1OL0A 2P52A 1URLA 1RJYA 2R9HD 1ANUA 3FU3A 4LAQL 4IU2B 4BFNA 3IJEB 2CE6A 3BGMB 4OI8A 3CPLA 3LQZB 4FMFA 3TBBA 1ZVSA 4YJZL 2GIXA 4OZGE 4Q56A 3MA7B 2Z8RA 3I9IA 5IHZA 3ZDZF 2Q3XA 1JV2A 3L3DA 4X4XB 1CJYA 4FLRA 5I1EH 4HEMA 3LS4L 5KSBE 1UZGA 1MDAA 1CDJA 3B9KA 1BOGA 4KROC 2RBLA 3BUQA 1E3FA 3ZZ1A 2ICWB 5CD5C 3QG6B 5D1XA 4NKIH 3P77B 4XBPA 3DTUB 5IQ7H 3GSOA 1BF5A 4IGBB 2XZCH 3CVHA 2EDMA 4N2NA 3PDDA 5DMGD 3JWDL 4KK5D 5DD6A 2X6CA 3T2LA 4ZD3L 1QEWA 4LHUG 2LU5A 4BFBD 3MXWH 1XCTA 4AT6A 1MHHA 3F04A 1KTKE 4XH2A 3HB3B 1YEDA 3QZWB 3VI3A 1WFIA 5F7KC 2FO8A 4NS0A 5HHMD 1K5NB 2PWGA 3CTTA 3HR5B 4KTEL 5IV2A 3ES6A 3VI4F 3GIVA 4G43A 1CQYA 4JCLA 4LEXH 5J6GA 1GY2A 3MRFA 5F0JB 4C8XA 4Z7UF 4ZSOA 4WWKA 1A02N 1IGML 3VSVA 3QXUA 3WHE1 4HSCX 1M7XA 1NMAH 1OPGH 5DT1H 1N6QL 3R18A 1ZD6A 4GRLA 3B2VL 3MOBH 3SYAA 2WVVB 4Z7AA 4G6FD 4DAGH 1A6PA 1MFMA 3W1ZA 4QHNB 4L4TD 1I7RA 2ZYRA 1HWWA 3D05A 1SBSL 2JE8A 2F8OA 1RI8A 4JRXA 3GM8A 4OBSA 1NCTA 5F7EL 3RVVD 2ZG1A 4BFFA 2CNZA 1EO7A 1JGLH 4NN6C 5E2TH 3D0VA 3NZ8A 3FH7A 4QOKE 4MJHA 1MAKA 1UOVA 5I73C 5JW3H 4R0LB 2A6IA 3HKZA 4BQCA 1E6JL 1LO2L 2WQ8A 3L5IA 4JY4B 4ZOAA 2XN9D 3LVTA 5I0DA 4EN3D 3LNDA 4UIKH 3IJYB 2EQDA 5I0YA 3TT1H 5LQBH 5JZ7C 4LSRH 1I1YA 2L7JA 5B1JA 1INDL 3IMWA 3WN5B 4LEOA 5JORA 1NEZB 3H2PA 4HFWB 5C2BH 1UZ8B 2E7LA 3X14A 4L29A 2CR0A 3T0AA 3VFWB 3DGGA 2XV3A 1W0YT 4NO2A 3TPUA 2AJYH 3PNWB 2FX9L 4ZTPL 4PLNC 3BEWB 1MG3C 1NUDA 4IOIB 4XP5L 2D7TH 3BWUC 4HIPA 5D1ZA 1H19A 4I88A 3PHSA 2E8YA 3DOSA 4WTXA 1NKGA 3AY4A 5IFHH 2XVBA 5DJYA 3D51A 4PGEA 2WXLA 2NY3B 4IRZA 4L3AA 4WUUB 1KN2L 5AL0A 1QBLH 1TQTA 2DICA 3FRUA 3IDGA 3QHTC 4O9HL 4Z76B 4WY7H 4CGUB 4PS4L 4M93C 5CP3A 4PJAA 2V7NB 2HWZL 3AQDA 1QYGL 5K59F 2P5PA 2B4CL 4K7FB 1OGTA 1BYOA 2QKIB 5HI5C 5DJZA 5E5RB 2D0GA 1T66D 3HUJF 3TYGH 2BSDA 2CIKA 1CXEA 5J57B 4UT9A 2D9QB 2EH8H 1NJ9A 2RMNA 1I3GH 2XWZA 4M43L 2Y25A 3PNWA 1MVUB 2VZ3A 3CN4A 3NEOA 2XTJD 4P46A 4D0BA 1DJZA 1ZMYA 1AOZA 1FDLL 1FFQA 1X5FA 4L0PB 2E27H 5INDB 2BOCB 4W9DC 5F0MB 2EINB 3ABGA 1ZTXE 5FO7B 2VAAB 4PVBA 3HN3A 1P4IL 3LKOB 3AQXA 1OZUA 5D7IE 4Q8BA 3ZQXA 1GC1C 1F4HA 3ZL4L 4FNTA 2X6BA 1DO5A 4HJUA 5FWQA 5DYFA 5I5MA 3CZGA 2BS71 4PB9H 3PGDA 4H25A 4JFXA 4L1TA 1NIBA 5J12C 1TQWA 3ZDZE 4FA6A 4X5QA 5L6YL 5SWZE 3WNOA 1CBJA 4MJ5B 1AKJD 5KSAA 4PJGF 1N7MH 4WU7A 2RR3A 3MAWA 3MLSH 3MV11 3H3KA 2B4CC 4R83A 3QEUB 4C56E 2EUZA 1HH6B 2K7PA 1FL5B 3TO2A 2MFNA 3SDAC 2WAHA 4KDTC 1UT1A 5TDOB 4JGJA 1TEGA 3F64A 4R5TA 3U0WL 4ERSL 3UTSB 4YVUA 1JVKA 1ZKAA 3ATFA 4M7JL 3FU0A 3L13A 3RPIA 1TYEB 2QGCA 1U8HA 4FXGC 2M2DA 4E9XA 2ATKB 1H3GA 1YNTA 2YZ1A 1EJFA 5J12B 3T4AA 3VFWA 3HS0B 2YHGA 3PYCA 3VI4E 3WIHH 1J0KA 3NQKA 3BZFA 4JY6A 2E8ZA 1OQOA 3FSZA 1JZ3A 1FGVH 3BEVA 4NJ9L 2VM4A 4WKXA 4BWTA 1TMCB 5AZUA 3DRQB 4OF8A 3LMJL 4KJQC 1DVFA 4WUKL 1LL1A 3JWNE 3PLYA 1YDPA 4W9HC 4CADB 5C9JA 2W0KA 2FVNA 4HHAA 3HNTH 4HK0A 2Q7NA 1PX4A 4QOKB 4FQHA 3NTCH 1JHTB 2FIRT 3D4CA 3U4BL 1D5MB 4PY8I 3SPJA 3GSVA 5CGTA 1TETL 3AXIA 4YXKH 3NJNA 1DQIA 4AC4A 3BWUF 1UT9A 2DD8L 4W9FC 1ZHKB 1V3MA 3O4LA 3MA7A 1KTDA 3EOBA 1XZ0A 3PXHA 4OZIB 2A5UA 1XSIA 3LXUX 2R7EA 3BO8B 1WDAA 4QRTB 4PJDA 2EE3A 5AOIA 5T1LB 2XY1A 5KYYB 3T04D 4OGXH 5EORH 3TVMB 2V7HB 4G1MA 2F7IA 1LMKA 4KRPB 4KUCF 4WRLA 4DP4X 2F19H 4XTRD 3ZDXE 3VFMB 2BDNH 2SEBB 2Q7YA 3K7UA 3OMZA 2VJ8A 1ZHBA 1K4DB 4X2UA 3LZFL 3FOMB 3TF7C 4L0ZA 2XZAH 3HMXH 4KC3B 3BUYB 1CT8B 4M29A 5EDXA 4P06A 4YWGH 1HXYA 3FQTB 4IGBA 2OMXB 4Y9CA 1J5DA 2N4IA 2VMDA 1TZIA 3SKNB 4CVZA 2ZWKA 3MMEA 3VI4A 3O3EA 4B9GA 4FFVC 3EYOA 6TAAA 3O6MH 1J86A 3STLB 3C08L 1KXVA 1MCWM 1A1OB 5CNHA 4X6DF 4U1KB 3S5ZA 2R1YA 4MD4B 1MQKL 4EUPB 2WPGA 3MJ8A 3QE5A 4M3JA 1S7TA 2ZP0T 1H6UA 3L54A 3UJTL 2ITDB 2V9RA 4FI8A 2OFQA 3AUVA 3NA9H 4LRIA 2LOEA 1L9MA 4E9LA 5JXED 4G9FB 4M02A 3PWUB 5CJQH 3JWOL 1X44A 2CCWA 4AQZA 3RVTC 1SEBB 1HJCA 4U6VL 4PJIB 5C0ND 2R8SL 3M46A 3FJTA 4G11A 2CIIA 4WEUD 3ZKND 4LARH 2NZ1A 5LJYH 2FATL 2ZQKA 4YSEA 4AVIA 3MUGB 2CRYA 2UXVA 3GSUB 4KZ0A 5SWQB 1F58L 4DESA 2JVUA 2MSPA 3BSHA 4BUHA 4YLCA 1DBMH 1SRDA 1UXSB 1W72A 2X89D 3KL0A 3QO1B 4IOSD 5CSBA 1R46A 3X3GL 3D1MC 2BOLA 4F5CA 4HIEB 3WFCL 2IAMB 4NJAH 1NDTA 4FQIH 3HHRB 3V4PH 1OARH 2AJVL 1W72L 3DUSB 5LWYH 4HAGA 4F7PB 3B2UC 2NX5B 4K4KA 5FDWA 2YAEA 3QCTL 3RX9A 4WHTB 4GS7B 7FABL 2CCVA 3ATEA 3W39B 2W9EL 2GI0A 1GYWA 1MUJA 6FABH 1MH5A 2Z93A 5DC4B 3QZLA 5IMKA 2ADFL 1WAPA 2GIYA 1BV8A 5SWSA 1BX2A 4ENEC 1NH6A 2Y3NA 5HDRA 1AE6H 1ZCRA 3QK0A 4KZCA 2X0VA 4LEXL 5GGTH 3NJKA 5ESVB 4JANB 2ARWA 2XFXB 4UTAA 1HXMB 1MWAH 3EOTH 2PYED 4GMTL 3BIAX 4UIMB 3TWYA 4A2GA 4WO4A 3KR3H 3NZ8B 4JO4H 5D71H 4PJ7A 4ZW7A 1XGTA 2DZEA 4KO9A 4XPTL 1JZIA 3NACH 3GLEA 5E0QA 3LNEA 4AJVA 2VLJA 3E6FB 1IBDA 3P4NA 32C2B 1BD2B 1BBDL 1NC2A 2JIXD 3OR6A 4FF9A 4HLZH 4H0LC 1NC2D 2JIXA 1RFDL 3VRLE 4Z77A 1F3DH 2WSKA 3IDUA 3RFZA 1NPJA 4I1PA 3LS4H 5F1SA 3S88L 1V5JA 4OKVB 1KIPA 2NY4B 3QUYA 2X7LB 3DBXB 3SJVD 1PG7H 2YD6A 3VFRB 3DRTB 4B7IA 3ARBA 1JIBA 2EIBA 2OSWA 1TVBB 3VXOA 3NSJA 1E9PA 4XP6L 5D6CA 5D7IF 1QNZL 2EDFA 2EIDA 2PETA 1SGKA 4XPHL 1FO0A 1RZ7L 4MJIA 1J8RA 2HP4A 3DOSB 3G3LA 5TDPA 3OXSB 4J4PC 5FYLH 4WO4D 1FBIL 5B39A 2NYYC 3NZUA 5GJTH 4FKEA 1T1ZB 4YHML 1FFPB 2BRRH 3TONA 5BZWA 2P7TB 1C8QA 4GBXC 2KZKA 3WIHL 2R2BA 4WFHE 3IGKA 3ULUC 1OPGL 2K3HA 1TFHA 3DV6B 5C0AD 5DO2C 3PP3K 3DUUA 2FJGB 1PSKL 3PIQB 4D7BA 3FU7A 3V2AR 3UG5A 5EIIB 4HF5H 4HWEL 5C8JA 3VXRD 4HUXB 2JJSA 2BX5A 3V5DA 1SN0A 3QUYD 3B8YA 3R0MA 4YEFA 4HS6A 4RRPG 1A4JB 1VFOA 3O2DH 4ZFZA 4KITB 4IDJL 3QXDA 3ZE1B 1N2RB 3EHBB 1FNAA 2VR6A 3RY5A 3VH8G 5IUSA 3TIDB 2Q7AA 4EN3B 1E8WA 3QIWA 3P3RA 1H8SA 4F7EA 1U8MB 1ND0A 2ZAIA 1XX9C 1T21A 2G75B 3RL2B 1D6EA 4L3EE 3TV8A 3RTQD 3ELQA 3F5WB 2F5BL 5EMYA 4FQCH 1NDGB 1FG2B 2GY7B 4DWHA 4NO0A 3WJMA 1P4IH 2FO1A 1C16B 3K6SA 2WTRB 5CZVL 3AU0A 2OPCA 4AW4A 4ELDA 1MG2C 2Z93B 2NCEA 1GZHA 1DQKA 1G0YR 1AYRA 3E6HB 2F8XC 4TLUA 4N8VB 3MLVL 4HHGA 5T3ZH 5C71A 3GXFA 3KPLA 3U9PL 1Z3GL 1JFQL 2Y36H 3C9NA 3KLHD 1RUAH 4F7KA 4WY7L 3BN9C 2BNUA 1WF5A 1KBPA 3FU5A 3GFUA 3MBED 3PHQB 3MBXL 4P2OA 3UTSD 3OMNB 2AERT 5T5FL 2W65B 5K5YA 3RA7H 4C4KO 2CSPA 2WWMC 4P23C 3T0WA 3O11B 1NCCL 4LSUL 4R0LC 4TOYL 3RUGF 3BP5B 5DMIL 5KTEH 3ZE0F 3L9RA 2IDFA 2OMBA 3EJYC 5SWQA 3FTSA 3U6RA 4WW2C 2R8SH 2X4SA 5CJXC 5BV7C 5DFAA 2OMNA 4M6MH 1T89A 4TNWF 1BVOA 1ZA6B 2MMXA 2FIKB 5LBGA 1FZJA 3TCTA 3S3PA 5GISL 3NIDE 3FUEA 4NZDA 4N9OB 1NOLA 1A65A 4JPKH 4ODWA 1FYHB 1KOAA 4ISVA 2BSTA 1RP9A 4JG1L 4KNUA 4FS0A 5HI3C 1HILA 4EUPA 4QCIB 4PJ8A 1RIHL 2AW2A 1RIUH 2IBZX 4PD4J 3U4BH 1N0LB 3MRPB 2XI9A 4FL4B 1TETH 2FBJH 3SCMA 3DO7A 4NHUB 1BF2A 4J6IA 1G1KA 4Z7VA 3ZW3A 1WS8A 5C0BA 4EIUA 5HJDA 5CLYA 4YPGB 2Y5EA 4JAMB 2J72A 4MKMA 4HPHA 4F2ME 5IW1A 5D7JB 4C56B 4UQ9A 4R84A 3CHXA 4GXVH 5CUSH 4JO1L 2CWRA 2V2WA 3PHAA 43C9A 5F7BA 2AXFB 2OJZL 4PW3A 2HLAB 1Z3GH 5BW7A 1XFPA 2P1YA 2QFRA 2IOMA 1AP2A 3ECQA 2JI2A 4WENB 5ID0A 3RUGA 3W39A 4L5FE 5FIEA 2P24A 4M9PA 2XZAL 3B37A 1OCZB 1PD0A 2H9GB 4O4YH 2FWUA 2MNUA 5IBTH 3T1WA 5ADPL 5F6HJ 4GW5B 3O6LL 1CK0L 4DN4L 4L1BA 3CMOL 1MUJB 2VYRE 5EWIH 3QFDA 3CFTA 1U3HA 3RVXD 4OGYL 2PXYC 2A74C 2GBTA 1KCVH 1UC6A 4UQCA 3MI6A 3SPVB 5JDJA 2AQQA 1TJXA 4DGWC 1H3VA 1MRDL 4V1DE 1L5GA 1Q38A 5C3LD 2KDYA 3CFEB 1PZDA 2W9DL 2FHFA 2N59A 3D4ZA 4H44C 5B39G 4ZRGA 1AP2B 2J12B 2YSSA 5GS0H 1PJWA 4XN8A 2Q8AL 4X99B 3IF1B 5IB5B 3QO0B 5D7LD 4G80B 3MRLB 5H35A 2AEQH 3TT3L 3ALXA 2CKBH 3DO4A 4HAKA 1HCZA 1OKEA 1EUUA 4HS8L 2JKXA 1INEL 3E3QE 1GW0A 3HEIB 2CRZA 4MMXA 1Z66A 4ORGA 1RZQA 3IJ7A 3HUJE 4FYTA 4P0DA 4ZXBD 1DQTA 2WXMA 2WXHA 2HRGA 1KJ2H 1MJ7H 4WW2F 2N01B 4OF5A 4PB0L 2VXTL 4WFHD 4ZDHA 3ZMNA 1XR9B 4X6DE 2CDFB 3FBQA 3VH8B 4CVWA 4LNRB 4XE5B 5HI5D 5IQLA 4UF7C 4UM9A 4J7RA 1YEKH 5B38B 4U1HB 5F3HB 1NBYB 1KCLA 3QQXA 3SE4A 1Q0YH 3V0WL 4IRJA 4AJYV 3HI1B 2DLTA 2LU7A 4OCNC 3NCFB 1M05A 3N06B 1S8DA 5F6IC 2NW3A 3UGUA 3BDXA 1R0AL 2C4FU 3I74A 4LIQH 1LDSA 1T20A 5TGBA 3JWOH 4F9PA 4FCHA 5I1EL 5C7XL 4Q9RH 4OUUA 3CSFA 1A64A 2COQA 2ZKMX 3NCYP 3KJ4C 5HPOA 3N85L 5B21A 1KT2B 1VCAA 3CVCA 4UIKL 5D93C 5E5MB 4MB5A 5FW7A 1OK0A 4ONGL 2BCKA 4DZ8A 4XPTH 3EBHA 4PRPA 3FRPG 2F53E 2XWDA 3LH9A 3NH7H 5CBAB 1HT6A 3SZ6A 1G0XA 2AZAA 2B20A 4FXKA 4NC1C 3I2CL 2FEDC 2B3IA 3RYMA 2WXFA 1A6AB 1NEUA 1U8QB 3HZKA 4PP1C 3TT3H 3BCFA 3MJ9A 5CU5A 5FGRA 1IL1B 1U21A 5E6YA 1QSFE 5EUOB 2V7NA 1PLGL 5DD5H 4TUUA 1IC4L 3QULA 4JPVH 4NI3A 3U2SB 4M8RA 5GJSH 1ED3B 1TCRA 3NEXA 4YGAB 1WK0A 3IETA 1UOLA 3OXRB 2FYYA 3KPRA 4JFSA 3L9YA 1XF2B 1S7VA 2W9EH 4PJBB 3EBGA 3QNFA 2NY1C 1T20B 3WFDH 5FM5O 1GPOH 5GHWH 1JG9A 1A22B 1R5VB 2QGDA 4M3KB 1IX2A 5L2KB 2WUBL 2GUYA 3DJ9A 3FB8B 3NSFA 5GS1B 5SX5K 1P84K 1UA6H 2Z9TA 5IREA 1E4XH 2J20A 4UTBA 4O02B 5EBMA 5K1JA 2R4SL 3ZVVA 3JUYA 1RZKL 5C0GB 1UH2A 5EOTB 4DNLA 1F6LL 3HC4L 3O45B 4FNLL 4L29B 4NDMA 5DQDH 3RP1A 1RAMA 4CJ0A 1P69B 5I6OA 1HKLL 4O5LL 1IMHC 4LASH 1E9QA 4B53A 2HRHA 1A9BA 3RL1B 1FC1A 3S36L 4QYOA 4PLJD 3UZEA 3VWJB 3GPEA 1A47A 3LIUA 4ORGB 3EFOA 3E1F1 4X4ZA 5I71C 2VDLH 5DI8A 5I2IB 5I24A 5J3HD 4IEFA 2DQ6A 2EDLA 2FT7A 2BM3A 4U7KA 2J88H 1BD2D 3KPRD 2EADA 4K3DH 1L9SA 1SUHA 2WGXA 3CH1B 1XXDC 2WBXA 3EJQA 3Q2NA 2Z8SA 2LFEA 1F3RB 5LO7A 3VTTA 1IM3B 3TBYB 1GS7A 3I2CH 4MCYA 1MXGA 2P8PA 2YPLA 3RB5A 4DCQA 5A2BA 5M95B 2JJUA 2Z8WC 4ELKA 2CGRL 3C6SB 4X6EB 5KANI 3O8XB 3NFPB 1CFSA 1I4FB 2IWKA 3QYCA 3GZKA 2ZOKA 2B5IB 3PAVA 4GNKB 4TQPA 1G6RH 1VENA 2HN7B 2VQ1B 4XVTL 5HPMA 3WL9B 3B83A 3IMTA 1INQA 3QAQA 2GBUA 2DTSA 5CEXB 1JGVH 4AUYA 1FL6B 5C07A 4IBTA 1MI5A 3VW3L 1XGRA 3KLDA 1HHIB 1JYXA 5CN3A 2B59B 3DX1A 3V4UL 2EC8A 1ZY9A 4LEEA 4NSKA 2LR4A 2VUYA 5HSFA 1B2WH 1FFTB 3LS5H 1ZOXA 1R34A 2CDGA 4ZXBC 3RUGB 3RVWC 4CSZA 2DYPB 3ARPA 4FYQA 3Q6GH 3DSNA 4BSWA 4OCSL 5ESAB 5FYKL 3ILDA 4W9IC 3EG9A 4OGYH 5D72H 4YSDA 5TQ0H 4ONFH 3TA3C 3P0YL 4J4PD 1BFTA 4P2QB 5JMRA 5IOPA 4YGVB 3PWPB 4HJJH 4FFWD 3P2BA 4NN5C 1YPZF 1SJHB 2VL5A 3FCSB 3KEHA 5ERWA 1KMGA 3WMPA 3C6EA 1E4WH 2VQ4A 4HEPA 2JKLA 3NJHA 1NCBL 5JNYA 5CJOH 1F86A 2XN9E 4IW4C 3X2QB 3CBKB 1X5ZA 1PKQE 4MNQB 5DVKA 1T4KB 2IWGA 4RAUA 4UT6L 1WAAA 4ZZKA 3VFGH 5INCB 2AJSH 5FECB 4LLQB 4NO0D 5F70A 2V17H 2O26U 2GFBA 1YMMB 3MRIA 3UAJC 1I3RA 2AJZB 3UAJA 1QSFA 2HXAA 3TBSA 3DIFA 4DPAX 1WA0X 1Q94B 2YSSB 4HBCL 4HW6A 3D07A 1EANA 4JFHE 3Q8AA 4UB0L 1WS7A 3H3PL 1DEDA 3LN5B 2Q2EB 2FBJL 3ZE1F 4CBPA 1RUQH 3D8MA 2FR4B 3MV9B 4EDXB 3GLZA 1Q9LA 4FOMA 3DKHA 3HC3H 3QO1A 1PX3A 1WT5A 4NUJB 3H1ZA 4RAVA 5E5LA 5I16A 5HJGA 1OE1A 2C9RA 1SN5A 5EZPA 2IH1B 4WSKA 1Q9WA 4JFDB 3QYNA 3R4DA 2WYZA 1E67A 1OCCB 5IBLD 3O3AA 3GMPA 3SKUD 3F6IA 3DX9A 4G1EA 2DQHH 4JFQA 4RNRA 4OFYD 1HYRC 2H7WA 1N5YL 4DK5A 2FECI 1D5BA 3GMMA 4LKCB 1NBYA 2ZSVB 2ED8A 2CO6B 1O9ZA 1EJ6A 1IEBB 2R15A 2OV0A 3CVIL 2BVQB 1RZ8B 1XGYH 1OK8A 3FN0L 4N0YL 4X4YA 1YN7A 4QY8A 4GW4A 4RRPM 3R8QA 5CJQL 5DO2D 1QUNA 1Y1DA 2GTWA 3GM0A 1E90A 1N8ZB 3PWNB 1JTPA 3QFJB 4GXUN 1OTTD 4JFFD 4POZC 3L3HB 4X0KA 4N0RA 2VDMB 3DXAD 3DX8B 3VWKD 5AD0A 3DHUA 2FL5A 2PXYB 4IDLA 4NNYB 2O61A 5E6ZA 4LHUD 5C0IB 4HC1L 5D4HA 5HD8D 5CLXA 4A2LA 2ZXCA 4O58H 1E50A 1NCWL 1V10A 1OWWA 2EILB 3QG6A 3Q8EA 4YE4L 4CAGA 4MXWH 4IU2A 2VXQH 3FTZA 1M7IA 3TVMC 3MC0A 3SDYL 4G8GE 4Q14A 3V95A 4PJBA 3MFGB 2VR9A 3IJ8A 1W15A 5DJ0B 4TL5A 3EJYD 4B7LA 3WTYA 2XIBA 1KJVA 1KPRB 1LP9A 3UMTA 4ABUA 2J7LA 2WLIB 5EU4B 5L0QB 3ILPA 1IFHL 3BKCL 1QP1A 2PW2A 2CKNA 4FC3E 4QIRA 2VLME 4FRWA 4ZW6A 1CLYL 1QHQA 1WT5C 3OAYK 1I7ZA 3OKNA 1H5BA 5C08B 1L6XA 1KYOJ 4PRNA 4Y19E 1ZVNA 1CXFA 4H7VA 2WLYA 5JPMA 1JGEA 4E0RB 1AY1H 3N2JA 3L7EA 5DQDL 2XDHA 1MOEA 4LCIL 1PU0A 1HKLH 2HT4D 1YECH 5JW4R 3N43F 2Z1PA 3U6XA 1KJ2L 4MD5B 4NCDA 1S7QA 1IFGA 3G6JE 2GG1A 1U8LB 1AACA 4UTCA 2O5ZH 3BE1L 4M8UA 1HHJB 2HT2D 2KYIA 4OFVA 3A47A 1AR2A 1OSPH 5K59E 4OCMC 3MCLH 3ZHDA 5BZWB 2VW4A 3NJIA 3CHRA 1JGLL 4JO4L 3GRBA 5E2TL 3WY3A 1LQSR 1F00I 5H37H 1GYAA 4W9EC 3QFGA 1J0ZA 3ARBB 3C6LC 1BVZA 3C8KA 3J07A 1WO2A 4GKNB 2OX5A 5T5FH 4P2RE 2GFBB 3GIVB 5GS1C 3DPDA 3B3BA 4P5MA 1K85A 3NPZB 1N3NB 3W0WB 1HL4A 1JF5A 3J7HA 1OF2B 2HKHH 3F7KA 2I60L 3D85B 2ESVA 4MNQE 3KW8A 4NFBA 4AH2B 3O6FA 2EIJB 1JPST 2ZWNA 1U58A 3RWGB 5GS0D 3O6FD 5SV3A 4AQOA 1LEIA 4WV1C 5EBWB 3SBWC 2J8OA 3DX7A 2X1XR 5GGSA 1QO3B 2Q3ZA 3LRHA 4Y4FA 5IBLC 5FO2A 3U82B 3V6OC 3VSUA 4N5EC 4JZJA 5KYXA 1JAEA 3EH2A 5DJ6A 4ES9A 5GISH 3NH7L 4WU7B 3W56A 4M5SA 1S7SB 3TN0D 3EJTA 1N26A 2VQTA 4R4FL 1YEHL 2H6UA 2QPUA 1P5UC 3DGGB 1AXIB 2N1TE 3L9EA 3QDGB 3VI3E 4Y2OA 3NYKA 3D69B 3L3OC 4UYQA 4X6DB 2H1XA 2HRPL 5HI4D 5D72L 2VLRB 1N2RA 3HRZB 4NSKB 4S1DD 5HYJD 1AQMA 4JS7A 2XIIA 2E59A 3JWDH 3KJ6H 1PSKH 4M7ZB 3QH3A 1E28B 3UGEA 4XN4A 4EOWL 5DS8A 3PJSA 3FRUB 3PV7A 4JDEB 4B3EA 3EJUA 1CCZA 2ADJA 4PJ9A 4XB3A 2MCMA 1G7QA 3VFSB 1CD8A 3K2MC 3QUZD 3K71A 3GKWL 1AMYA 1NAMH 5EO0A 3JTTA 4FQ1H 3BH8B 3FTWA 1CD1B 1RCYA 2AJSL 2GTQA 4P2RA 1ZE3H 5E1GA 1RVFH 4GLRI 3ZT7A 2ITFA 2MHAA 2IPKA 1BBJB 1YNLH 3N55A 3VXTA 4XPAH 4DVBA 1FZKB 1F41A 3E6HA 5C09D 5DQJB 5ITFB 1TDQA 2WZPD 2CK2A 2Q8BL 1A1MB 2I07A 3A4AA 5JHDD 5INCA 5FECA 2BXYA 3D3VB 3W9EB 1TNMA 4P9ML 3BUBA 4JFPB 5JHDA 4YHKH 3PU7A 1LD9A 2Q3AA 2OMTA 1QSFB 1M1XA 2JELH 3ARSA 2JJTA 2LLLA 4LHJB 4Y5VB 5EUOE 3TNMA 3DBSA 3GBNL 4M9OA 3PPSA 5EC1A 5MI0B 4OT1L 1H5BB 4N8VA 5E9DD 2DV6A 3Q6FB 5LDUA 5F89B 3UO1L 3PDOA 3TV3H 3V0VB 5DUML 1KJ3H 3NJLA 4F2MB 4GOSA 3IVKB 4IJ3C 4V1DA 2K1MA 1EUTA 5C0JA 3T0EA 1N0LA 3MCKA 3MRPA 4YLBA 1OCRB 5D96C 5F7AA 3NJGA 3M07A 4L4VA 3U46A 4TMPA 2ZICA 3HB3D 5IVXB 3VNZA 1JE6A 5BRQA 4LVNB 1N70A 2G3XA 2H32H 4FQXB 1MFBH 1R24B 4HJ0D 4Y4FB 5E2UL 4NQDE 3TH2T 2AABH 4EDWL 4ZG1A 3HFFA 2ITEA 3FF8A 5A2FA 3D0LB 5C3TA 2HRLA 1MJ7L 2YGVA 2NY3C 2VZVA 1TQCB 3C8DA 4P5SA 2IDUA 2AFNA 2J1WA 5DJ2A 2HSIA 5I0VA 5A2LH 1CGVA 4BZ1A 1YN7B 4BEIA 2HJLB 4DO5A 1A66A 4DUVA 1I31A 4PJGB 1JN6A 2R2EB 1LDPH 2AXHA 5BS0D 4X9FA 1C1EH 5AAMA 1QBMH 3E0GA 4JDVB 1BZDA 1KGIA 4XPFH 4XWOD 5DVMA 4AM0B 4BKLB 1KNOA 4PJ8C 4LIQL 5IHUH 1H0DB 3KCPB 2G9KA 1D5MA 1WFOA 1Z0NA 3NJFA 2GC7C 3SJVE 2BY0A 3WN5C 5J5EA 5T33L 3P0VL 4LSQH 3FU9A 4YQXH 2BP8B 4YZWA 1JZ8A 1RZPA 1JD9A 1ZHKA 3BJLA 5HHOD 4E9TA 1CTNA 2J1XA 4Y2DA 3SE9L 4M62L 3ZHNA 2VLKA 3IDNA 1G5AA 3MV9A 5EF1A 2X9YA 1JNLH 4FQHB 4OB5L 2BNQD 3FOLA 3ZXAC 3ILPB 1SXSA 3MLZH 1YPZA 3UC2A 3AREC 3WLBB 2WYHA 4WZ9A 4R5XA 2HMID 5DLLA 1QA9A 3BXNA 5JOFA 3HUJB 2IGLA 2F68X 4W1TA 2ADYA 5DJ0A 2AJXH 3JT2A 2KQMA 2X4UA 2GB2A 3WNMA 4I4WB 1LP9B 2D03L 4RSVA 2QPEB 4ABQA 1I8MA 2OMZA 1JYNA 2JV6A 3X1GA 3IGLA 4DP0X 3LXBA 4PSPA 3U7YL 1DN0B 4GAGH 1U8HB 2XFXA 4KVCH 3LRSA 3CDYA 3D39D 3TJEH 1E2ZA 3LH2H 5DC0A 3ZZSA 5M94B 2NCMA 2Q0ZX 5H35B 5E00B 5BZDB 5IF0A 4I2XE 1IGJB 1AGDA 2GTWB 5AKSA 1ZV9A 2WBJC 4QHLA 1XQ4A 5FUOL 1YEIH 1JPSH 2MTAA 2E86A 5I6LA 2Y23A 5I74B 2V8LA 3QJHB 5C6WH 4GKNA 4UUJA 3BT2H 1BZ7A 1EZUA 1OAUL 4HCRH 3JYCA 3WLBA 1H6FA 2RD0A 4LASL 2P44B 1MNNA 4LAJH 4WWPA 1OAQL 4Q2ZB 3QORA 1BREA 4Q6KA 5T1MA 4XN9A 2ODIA 1OZTG 2UY6B 3BD4A 3I6KA 3GMLA 4KAQH 4K07A 3VRIA 1IVTA 2AHIA 3VRJB 1BG1A 1MRCH 4FULA 2F9BT 1OARL 5KANG 5TE7L 2OM5A 4KO5A 1CFNA 1JF6A 3S6CA 3W9DB 5G4MA 2BCKB 5DJAA 4UAOB 5DZLA 3UTZB 3ULUE 3BW9A 2JTYA 1CICA 4HMEA 1CI3M 4PCYA 1MIMH 1U3HB 3SKMA 5ICYA 4O2EB 2R0KH 4OJFH 5HHNA 1NGQH 4M8QA 3AS3A 5ADPH 2FCBA 4MX7B 3WJJA 4LSTH 4PJ7F 5HGBB 4MJ4A 3WHXA 5B38G 2OL3L 5KSBA 2HH0L 2N0KA 5F0LB 4GRWF 5T3ZL 4AGNA 4XWGH 1CZ8L 4WTQA 5LBSL 3UTSE 5F72S 1GGBH 4Z1PA 2CR6A 4LLUA 4AX3A 5F7NC 4PREA 3L6FB 5GGTL 4HGWB 5A2KH 1LEGA 2GCYB 4LF3B 1Z3RA 3IMSA 4S1SH 4Z7UB 4F7MA 5L8KB 3HCVB 4NQDB 3I02A 1H3XA 3RPKA 2VW7A 3VI4B 2VMEA 5KYWB 5KSUB 4GSXA 1MCIA 5KOVC 3WCYA 1U91B 3IU4L 4BCYA 1I3VA 3EBIA 3QFJE 1SXCA 3MRMB 4HKZB 3A0OA 1S7TB 4UV4L 4WJ5A 4M5ZH 4FJZA 4MMXB 2KHAA 4PI0A 4R3SA 2CO1A 4MQXC 1L9PA 5F9WC 3WEMA 3ZTNH 3VWKB 4NKMA 4WFGD 2D9CA 2XACC 4ONFL 5D7SL 1OOWA 3KWWB 4JFZH 3HI6L 1OM3H 4CC4C 4XTRC 4Z23A 2K4WA 5HGDB 1CG9A 1G43A 3UYRH 3W0WD 5ICZA 3NN8B 2WZ5A 3IGFA 1EH9A 3DX7B 4NC0B 4JG1H 5KJ4A 4G8IB 4HIIB 5GGSY 1BYNA 1MRCL 1J12A 3B6SA 1CR9L 2NZIA 4J3WA 2QKIC 3A22A 1ICTA 3V4PB 1C08B 3SYOA 1HL5A 5D5MA 2QADC 4L18A 2Y7MA 3CQQA 1CYXA 4I77L 4XAWL 1ZLSH 3K80A 5DMYA 1OAKH 1EFXD 1QLEH 4AXWA 4B9CA 3WKPA 3K8LA 4OJYA 4QJ3B 4NRXA 2B15A 5LGHH 3ILQD 4K8RD 3UABA 1JZEA 1R33A 3FB7A 4RBPH 5C08D 3UZQB 4AVHA 1WBZA 4BUGA 4GW1A 3KLQA 2OJEA 4UI2A 4E9YA 5JQIB 3I9AA 4OZ4A 3NIFB 3GUTA 3TYGL 3ROOB 5HVHB 5KZCD 5JO5B 1QFWM 1D5RA 2RB8A 5F7LB 2HMIC 1NFDB 1AJ7H 1HKFA 4WI3A 3IRPX 4KY2A 1Y6MR 5BO0D 4QRQB 5GGRA 4KK6D 3GJFH 2OZ4A 1E5ZA 4BGLA 1OTSD 3TA3A 2NLJA 2MCPL 1GY1A 5GGVY 2V5YA 1VGEH 2DBLL 1OTTC 3ES6B 4TQ8A 4KNQA 1RD6A 3NDZE 4BHUI 1X5HA 3U4EA 3DYOA 3VXSD 3UG3A 4CN4A 1AZBA 4EQ2A 3SD5A 3QEQD 1PDKB 4OCLC 5CLZA 3DV4A 5D4QA 3OKEA 5L0QC 3NSCA 5DK0A 3B7UX 4NNXA 4UZUA 2AK4D 4KKCC 5L4IA 1EZSA 2NY2B 5I15L 4XMZA 1SF3A 2EE6A 3BWAB 3N50A 1AZRA 2DQUL 1BOGB 2A9ML 2X2JA 1F58H 3MO1A 4N2EA 1ZIBA 1A21A 3SDCA 4B9KC 1RZ8A 2VDRB 1UCBH 3K91A 4K7PX 2WB1A 3CC5B 5C2BL 1KCBA 3ZDYB 3BP6B 2H6PB 5D7LA 4XCNA 4NUGL 3LDBB 2I9TA 4HT1H 2Z4QB 4Z8FL 1PS3A 1JGVL 2V4LA 4B50A 3QWRA 1P4BH 5LVEA 4JRXD 4GO8A 3GO1L 1LO5B 4BZ2A 4F24A 2Q10A 3UTQB 4YHNB 2X6MA 1VDGA 5INDA 4YPJA 1JXGA 1PY0A 1G9ML 4J4PA 4LPUA 4A6YL 4JO5A 4NOFA 4QTHB 4K5LA 3MBXH 3OSVA 2IBZY 1UD8A 2ZXWB 7TAAA 3EO1A 4DK6A 5LXGH 2R2BB 1BMZA 1DJHA 4PS4H 4U6YB 1T5XB 1JI1A 2JB6A 3F84A 5B22A 4H26A 4K8RH 4PJDB 3D39E 3TZVA 4O02H 2QKIA 1XVSA 1FL3B 3VE0A 4ZSOB 2DI8A 3VD5A 3BGFC 4YDZA 5B7EA 2IPUG 4MXQC 2OZ4H 3AQZA 3R1GH 5L8LB 1J8HB 3SE8H 2IMMA 1MFBL 5E2UH 1PZUB 1RUPL 2ZXEB 3LIZH 2MKWA 4WSJA 4BBWA 1CE6B 5AB9A 4GFTB 4AMKL 4Y2NA 1LO5A 4P5RA 1EV2E 1UQSA 3F58H 3IAQA 4KUCD 5F9JB 4PH8A 4KAQL 5A2JH 3CCHA 3WD5L 1XIWA 1FV1B 4WNQA 3ROOA 2F15A 3JBG7 2E6QA 1T6WA 5E08H 4RH4A 1C7SA 2JH2A 4OLWH 4C56A 5AWNL 3SGEH 3IDGB 3KE0A 4F3FB 4GSDL 5C0BD 2EYTA 1FO0L 3TPUB 4X0KB 4P4RA 1P1ZA 4A7QA 3LZLA 4JO2L 4O51A 5ABDE 2PPEA 5IOPB 4K9JA 1A4JA 4WNSA 1MZYA 1FIGL 1IAMA 4OZGF 3UTPD 1JUFB 2B1HL 3DXAA 4XX1E 5I5RA 2NYKA 2X4RA 2ZSVA 3NCCB 5K9OB 2WHVA 3V6BR 5MHSE 2K6WA 4WUUD 5DFTA 5JHMA 2BSSA 3JZ7A 4JAMA 5IW1B 3MUJA 1XMEB 3RWGA 3O6ML 3RGVC 1IJNA 5J11C 1L9QA 1J5CA 2YRZA 4U3HA 4D9RE 1JZ5A 4NQED 4OV5B 3TA3B 4K15A 1UOWA 2CK0L 3MX0A 4AEIL 1I7UA 2FJUB 4KROB 4MYWB 3GPSA 2QT6A 5H2BB 5LGJA 5CZXC 2AJXL 1IEAA 3AS1A 3HZVB 5AOZA 3UC0H 1G84A 2CAKA 1X6LA 1KF9B 3FW6A 1KCVL 2F74A 5KYWA 2AEPL 3MV8A 5IEHB 3P3UA 3QHFL 1WD9A 2H2PC 2V9UA 3M88A 4U1JA 2XC8A 4XVSL 5FXCH 1WTGT 3SO3B 1UWGL 4JM2D 2BNUB 3X3GH 3ZYJA 2V2XB 3L6FA 1XCWA 3O6FC 5A16B 1RURH 1XF4A 4XAKD 1KCSH 5D70H 3W0WE 1NJ9B 1T2XA 2VE6B 3D9AL 1KDJA 4KK9D 4A2EA 5DS8B 5SWZA 2E9BA 4OH2A 1U3ZA 4W9CC 5JIQA 1L6PA 5T5NF 1RUQL 3UERA 3EYUL 4NPYB 1TTFA 2XRAH 4OFKA 5CFAA 1AC6A 4RDBA 2J2ZB 1AKJB 1IBFA 1RKRA 1T83A 3EO0A 2XQYK 2IDQA 1LNUA 3KH4A 3V6FA 3HE7D 4WI0B 5D96B 3NBNA 1KC5H 4G9FA 1B0WA 4WKZA 3MRKA 5L4JA 3MJ9H 1Y7VA 4JGUA 3BVDB 1LO4L 1QPKA 4FNRA 5JLZA 3RNKB 5FB8B 5FYJD 3W38A 4HH8A 5L7XL 3OWRA 2WXRA 1BFOA 3CLEH 12E8L 3GF8A 4DKEL 4Z7QF 3KPSA 3S5LG 3QWNA 3NSYA 3OKDB 1UWYA 4XVUC 3CX2A 3MR9B 3RWEA 3MLVH 1WGOA 2YPVH 5BRZE 4N9GA 1A14H 2OMXA 1GMEA 4DTGH 3LZRA 2WWNA 5CEZE 4N2BA 3U7YH 5BPPA 3T6ZA 1QSED 4M6NL 4Z7VB 2O5ZL 2Q7YB 5EOQH 4KQ3L 2J8UF 3WFEL 2JJTC 4XWGL 2OMWB 1KLFB 3FOMA 2PNDA 5F3BB 3IJHB 1DLHB 1T5KA 1X5JA 1VFMA 4LPYA 1B0RB 4IYKA 2O1AA 3CZKA 5JO5A 4YC2C 3TVMA 2G0LA 3S0PA 4JO3H 3EDFA 2OI9C 2XTJC 1ZEAL 5CBAA 4NKOA 1K6QH 4HIEA 2LVEA 4PRAB 2KI6A 2AS5M 1U3YA 4TSAH 4Y2LA 5DFVC 1RK0A 2PO6D 5LN4A 1IUZA 1V7NH 4HSAC 2WMPB 3SYCA 1NGWB 1KTDB 3EOBB 3K71B 4OZIA 1E3ZA 1KTBA 5AUMA 5KVEE 3H9ZA 3LYRA 3I85A 4QRUA 1IVLA 3UEQA 4BK8A 1D2OA 5CKGA 2H3NA 2BOBB 3CUPB 1XL6A 1TTCA 1BVLA 4G6AC 4M03A 4MD0A 5LAPA 1LE9A 2EDBA 2BSCA 5J6HB 2NW3B 2E5EA 2VDPB 5C09A 4JFHD 5KOMC 4G82A 4XNMA 5DHMC 4G3YH 2VABB 4XOBA 2MQ0A 4QAWA 3N44B 4NENB 5DJCB 2YIHA 1WGVA 2BHZA 4Q74A 5F88A 2FLBT 4ZAKB 3Q9PA 2VXSL 1MWAB 1CTMA 1ODUA 1CICC 2AGJH 5D2NB 2ITDA 35C8L 3HMXA 1XF4B 3SPCA 4P07A 3KYMA 1AR1C 1Q4NX 3D0AA 3VD2A 3MBWB 4TQIA 4I87A 1H3WM 1RK0B 1A9EA 4JN2A 4KK5C 3LHPL 2F74B 5IIEB 3G6JF 1MFUA 1NDGA 2EICA 2OCFD 3TTSA 4KJWC 1AQDA 4A37A 1YUHB 4LNVA 4ZMTA 2F7PA 5BO1H 1SJHA 4WWOA 2A6DA 3OXRA 2EECA 3OQRA 3KXFB 2ENPA 4O02A 5EBMB 3KGSA 3IU3A 1T7WA 3COOA 1BQHG 2EZ0C 4U6VH 4XE0A 1F90L 1ZS8B 2DTML 1VZGA 4X8JB 5LGKA 5DEGB 4I8DA 4G6AD 1BQSA 5IW3A 2XWCA 4KHTL 5L2KA 3O0RL 3Q5YA 4QXGL 1RSFA 3MYJA 2ARJA 3L08A 4FQXA 5FYKD 4Z7NE 3V0VA 2A6KA 3EKCA 3JTSB 1SY6L 1MREL 3KYOB 3KLSA 3EUDA 3UYRL 3IYLW 4OGAD 3H4HA 5LG6A 4N8PA 1A7PH 4X7SH 3GJFK 5HHOA 4L4VB 1KXQA 1K4CB 4HIXH 3SDCB 2QTEA 3NCWA 5IMKB 3BP5A 3UACA 5D93B 3GHPA 2YD9A 2YAQA 2IANA 3IMRA 3OPUA 4HPOH 3UO8B 2CO7B 3QCUL 4QLWA 5BMFH 2XN1A 1FI8C 2AI0L 3MRJB 1UXSA 4NUQA 4QT5B 4EDXA 4MJIB 3VGEA 4Y9EA 4ANUA 2YD1A 4MJJA 1G7MA 1I4FA 2BWDA 1EHXA 1R5WB 1NM9A 4J6RH 3RDTD 3DOHA 5ALCL 4F20A 4XN2A 2DQTL 5C0RL 4Y5YA 5DJ2B 4D9RD 3BQUC 5F93C 2FBOJ 3AACA 2R1WB 5E1IA 1QPPA 1JL8A 5IB4A 3QPXH 1NGWA 4Y5YC 4GI6A 5DQJA 5HDLA 4DOHB 1BZ9A 3ARTA 3MLUH 4KMQA 3VXOB 3ZJAA 4HKJA 1O6SB 4CMHC 3WJMB 4MBRA 3QIBB 2V2XA 1R17A 4EN2A 1HH9B 3KLLA 2IPTH 1XF3B 2VJ0A 4KHXH 5F7DA 4LVEA 4OFQA 4QRPA 4MQXD 4G5ZL 1GJWA 4YXLL 1EEUA 1I9IL 4I4WA 3QQDA 1QQDB 3WY1A 1ADQH 4X80L 3FO9B 5E2VH 3QI9D 4ILDA 5AD0B 3L4WA 4YSTA 3TIDA 5JW5B 2CO3A 2OXGB 1RZKH 2X4NA 1A2YA 2BFVH 4XXDB 3S37H 4HD5A 3GBNH 4ETQA 4Z9KB 4NQCA 3L1FA 1XHHA 1I75A 5HGGS 3BWSA 3ARRA 1LK3L 1Q0XL 3TFKD 1JZJA 2I60H 2VMJA 4PG9A 4Y16B 4ETYA 2HVJB 3Q7JA 2EO1A 4L1LA 3BKJH 3KPSB 1K2DA 1CICD 2Z4TA 3K8MA 4KRMB 2YMXH 4UV4H 3U6RB 4BQ6A 4ZOCA 2WSPA 4D0BB 2R27A 3WFBH 5DC9B 5B1KA 1HEZB 1CU4H 3ZGIA 2CJTA 2FWOA 1FPTL 5FYJE 3FH8A 3WY4A 4JRXB 4WI0A 1QPXA 3UJJL 3E9TA 1SBBA 3T0EC 1WUZA 2XWBA 3TN0A 3K0YA 4QRPB 1JGIA 4N0UB 4DVRH 5DMKB 5KSBF 2OP4H 2EVJA 4IIQA 4AG4L 2GBVA 2Y07H 1HL9A 3X13A 5J8OA 2R2CA 2OJ1A 1KFAH 2B1HH 4UINH 1Z2KA 5ISZE 1MHPH 1BW8A 2VITB 4JLRB 5J9PA 3ARYA 5BVPL 3FO0L 4PBWD 5ANMA 5HJ3A 1T80A 1WFNA 2BIPA 5H2BA 5TE4L 3WOVA 1ZLWH 5B1BB 3PAZA 1X4YA 4XVJL 4S1QH 1IAIL 1D5IL 3TXAA 1AXTL 1FNLA 1PTZA 4Q4EA 1AQKH 1KGJA 1T6VN 4ZNEA 3T2OA 3L5XH 3UYPB 3TFKC 2XWXA 5I6KA 3U30B 2BNRA 2ZCLH 2W1NA 3QUXC 4JFEE 4XZUA 5DD0L 3ZIYA 3HC0B 5L4FA 2H3NB 1T5WB 4LLYB 4MD0B 2G2PA 5BW7C 1NWOA 1I8LC 5TJWK 3UADA 5D1ZB 1B0GB 2OAAA 1SYSA 4NHUA 5D8JL 4G6FB 4V11A 4LOEA 1UGNA 5FLUA 1MCKA 2F58L 1U41A 1UKSA 4G71B 5JHDE 4NT6A 1DQDL 2B0SL 4MCMA 3ZUCA 4A7GA 1BAFH 4G3YL 2EDWA 4P2QA 3KPNA 3D34A 3ELAT 1E3XA 3FQ2A 5C0BB 1IM3D 4P46D 3GB7B 2OZNA 2D3LA 3GZOA 4KJPD 2EDQA 4U1GC 1KB5A 5D1QA 1KIRA 4RQQA 1T66C 3IGAA 2NY1B 3SDAA 2FEEL 1UFGA 2FX8H 4U1MA 4KXZI 3MJ9L 3LQAH 3IN0A 1QNZH 4HCRA 3BP7A 4ONHB 4LCIH 1S7WB 2DJMA 3BN9D 1DQLL 2Q76A 2YEQA 1CL7L 1Q1JH 2EUXA 3NIFE 1NCJA 3PUUA 4DOHE 4PU2A 1XZ0B 1IILE 2ZXAA 3H3BC 2CDEA 3SDXF 3CZJA 4QRTA 2H5UA 1YEFL 1DDTA 2F0CA 4UQ2B 4ZAKA 3CVBA 4G7VL 4GBXB 3LPGA 4CA4A 3CHOA 5CJBA 3FQNA 2YWZA 1VADA 1JRHH 4ODBD 1KGCD 4QOKA 1CK0H 3CSYB 4ONOA 5L2JB 3JWNC 2DBJA 1YHPA 2XX0A 2AITA 3CMOH 4D2NA 1MQKH 1HSAB 4P9HC 3RX7A 5A7EA 1S78D 4UQEA 1NLBH 2PWFA 5EEWA 2DQJL 2P26A 3JXAA 3QUXB 4P4KD 1MY5A 3S3SA 3UZVA 4L9DA 5JOPE 2A9NH 4K8RL 2HKHL 5I9QC 1QLEB 2KH2B 1T1YB 4K2UL 3RDTA 1S7XA 3VM7A 1UM6L 3ZHKA 4MA3B 4X4KA 4Y19A 2F18A 5IVZB 3RE0A 3RZCA 2UZYB 2WXJA 5CP7B 1NCDH 1UENA 3BP4A 2VXVL 2NY4C 2XTJB 3LY6A 4PRIA 3P54A 1M7IB 4KZDL 4XPBH 4XO4A 3BRGC 2Q8AH 5I1GL 3TU6A 3L2LA 5F89A 5D7JA 3MRDB 3ATBA 1TU2B 1LEIB 1A6VL 1I1FB 4MYPA 2WNWA 5IB2B 1YEJH 4JR9L 2FEEI 5DVPA 1MPAL 2CUIA 5I1AB 1FYTD 3D85A 3E2HC 4KRNA 3ZKXC 4OB5H 4QHMB 1D7BA 4L5FH 5FF6A 5BRZB 1WZ1L 2L0DA 3DETC 2NRDA 3FDWA 4JO2H 1MCWW 4AYGA 3ECUA 5KN5A 5CGMA 2V2TB 1RK1B 1X5YA 1FLRH 1NFIB 4JPQA 1IFHH 1UWEH 1YEFH 3FKUS 4OFYA 4P2YA 4Y9GA 2FK9A 2AQ1A 1I1AC 1JXDA 3GJFA 3B5TA 3HE7C 4KFMA 5IB1A 4DEPB 2UZIL 3Q44A 3ZZQA 5K9KB 1U8LA 2V9TA 3PY9A 5E70A 3EADA 4YAQB 5AOJA 3JVFC 3M17B 3VG0L 1KLGB 1HHIA 4K3JL 4QTIH 2YA2A 5KTEL 3O2WH 2NOYA 5F6IB 3EDKA 4NPJA 5ENWB 1HI6B 2WOBA 5F96H 3ALPA 4U1SA 4JB9H 1X7TA 2TAAA 2QQQA 1IJ9A 1F6AA 4JFFB 1A4BA 2BERA 1NMCB 3QWRD 4OM1L 3ZE2B 4K5MA 4P99A 4F9PC 2IAMA 5F21B 1O5DT 5AW5B 5LAXA 1MW0A 4HV8A 1AZUA 4TPRL 1BA9A 4K55A 2XN0A 1UJ3B 3JV4A 1OAZL 1THCA 4K73A 1F11A 2F7QA 5A6IA 1I8IB 5JIKA 1LEKA 1GTNA 3X3FH 3ZSSA 4UM9B 1G6RA 5KVFE 5TF0A 3DMMC 2E46A 4U3SA 4KKPA 4L8DA 2NSMA 4H0IA 4XP6H 4YDKL 1A4KB 1R3KA 1KWKA 3HC2A 4F1SA 3CIAA 5BOZG 3CXHJ 4H0GA 1TJIL 2RH0A 3C5SA 3PWVB 1P0SE 2F61A 3LAFA 4MCYB 1XTMA 4DCQB 5IK3B 1Y07A 1QRNE 1AGBA 4TYUA 3T3PB 2FWOB 4MNGB 4LLAA 3ZKNC 3RNQA 2ADGA 1DQMH 3JVGA 3U36B 4OSUH 1FE8H 4PGZA 4MAYC 5F71A 4DO4A 1E0OB 2GVYA 1VACB 2HKFH 2I69A 4FE9A 4H8WC 1SOKA 4A6YA 3MRDA 3CFCH 4XCNB 4ANXA 2R69L 1XH2A 2CD0A 4JY4A 3KXFD 1R5VA 1YQVH 1A5FH 4TF4A 4YBQD 5A43C 4K9EH 3WE1A 3BUDA 3IE9A 4LAQH 1MRFL 5FYJL 1A2YB 4XXDA 2FJGA 3OVUB 4HCIA 5AW0B 4PJCE 4TQHA 5ID1B 1MCQA 2K8MA 3QI9B 4YBLB 4PGCB 3V7AG 3B9AA 1VFAB 4YDLC 3FT9A 4GB9A 4O2FA 4Z5RB 4PJXA 1U8KB 2UWEF 4BE6A 3B9VA 4URTB 4G9FD 3O8XA 3MUUA 5CJ5A 3C2SA 2EEXA 4FTVB 2O6PA 2HLFD 3HG0A 3QUKA 3VTMA 3FOLB 3QHZH 1EBPA 5IV2B 4LLWB 4TSAL 2WLHA 3FNKA 4X9YA 4Y5VA 1CICB 5CJ8A 2L7QA 3LKRA 2QKSA 5DEFA 3IFLH 1J8HA 2XV0A 1NLDL 2DWYA 5F9OH 3DURA 2D0FA 2BP8A 5DD6B 4S0SD 2YPVA 3DPBB 3PUCA 2BIOA 2CXKA 4MXVF 1WWBX 3G7TA 4PWJA 1MHHB 5ITBL 2NXZC 5HHMB 3VFOB 3SD2A 1KNOB 1OM9A 2ICWA 3MLUL 1ITCA 2GT9B 2VLJD 5CLTA 1GZPB 3ZQ9A 2XBTA 4YVNA 2NYYD 3TV3L 3X11A 1V05A 5AW9B 3T2NL 1H9DA 2HFGH 3G5ZA 3SCMC 3BDYL 2ZOOA 1NTDA 4ABVA 4J3TA 2BC4A 1QTSA 2GUOA 5DCCA 3DTXA 1WHOA 2WZAA 4L4TB 3LDBC 4UDUA 1ACYH 3T1FB 4PJFB 3PJNA 4OD2B 3TPKA 3FUNA 1NAML 3NG5A 4XXWC 5I75C 3AJ7A 4AIEA 1TZHA 5EFIB 3LKOA 4QXVA 5IMMA 4XWOC 4EDWH 4FFYA 1A9EB 2VWEC 2OMZB 3NUKA 4JN2B 1URZA 3L3GA 3DVNB 4WFFE 4DGYH 5HYQA 3ULVC 3S36X 4IBLT 3ILEA 4N2HA 3BKJL 1QFUL 4BELD 5GPRA 5IVZA 4HOWA 4AK2A 2H26B 4K71C 5E95B 3KPSD 4ZUTB 1LGVA 1ZLVH 5I0XA 1T1ZA 5I6MA 5E9DA 2PABA 4GEIA 2CKBA 4OQTH 2WANA 4JRXE 1LWRA 4HOZA 4FERA 3LQMA 3O41B 1ZPUA 3N9GL 4HT1L 4NO3A 1FYTE 1I53A 1XSKA 4GQRA 4NQXA 2YUWA 4K94H 3GI8L 4F8TA 4YFEA 4UOW0 3AAZA 3IFPB 5DVNA 4APXB 1L0YA 1BVLB 1IZKA 1E4KC 3GINA 4KKBD 1WHPA 4NQSA 4OIIL 3NA4A 5EA0H 4PIRF 1RZFH 3L5HA 3NCMA 3UH8A 4TUOA 1DE4B 2OYMA 1NFDA 2ORBL 3G6JA 4BFRA 4JM2F 4M6NH 1AIZA 1H6TA 3K8KA 5IVXE 3LQAL 1W16A 3APFA 4P2QD 5HI4C 4I5BA 3PWPD 1JXJA 3ULVL 4LCWD 1S3RA 1AHWB 3T4AB 3AS2A 4FQXD 3V6ZB 1PY4A 4ATWA 2KLRA 4JB9L 3RVUD 3SE4C 4P4KA 2VDLB 4DP8X 3C5ZC 2YEVB 3QZNA 3CSTA 3ARZA 1LYQA 1OIOA 3QWQB 2B7DT 4TULH 4JFXB 2H9GA 4ADGA 5JOEA 5AW3B 3HNSH 3IGUA 1A6WL 4KVCL 4KX8A 3SB3A 4IRSA 4UUJB 3II2A 5FDYA 4N9GB 2XTSA 1MFDH 4OKDA 2W0PA 2PW2B 3LHAA 3QZOA 4I9WE 4W93A 2NY7L 1T0NB 4PJXF 5CZKA 1EX0A 2LT9A 4HUUB 5GSRA 3TIEB 1X9RA 4FQJL 1S9XB 4P46B 5IK3A 1WUNT 4ZFQA 1LXMA 4HJTA 1IM9B 3MRMA 4HKZA 1P4UA 4G72B 4APQA 4L37B 3MV9D 1E43A 4RBPK 5GIRA 4G6ML 3WFZA 5A6MA 4AZ8A 3WKQA 1G7PB 5KBMA 3CFUA 4OGZA 4KKAC 3WLWC 2BZCA 2NDFA 2VDKB 4OLEA 3SPVA 1JNLL 1S5HB 2ADIA 2RFXB 3WTSA 4Z3IA 4L3EA 4JQXC 4D94A 2DJ4A 43CAA 4TTGA 4RCAA 5EF0A 3B1UA 1AG0A 1F11B 2YN5A 3NIGE 1LEKB 4HJIA 4GG8A 4D0DB 4WI8A 3IRZA 5ITFA 5HHQA 4ISVB 1JXFA 3QIUC 5ESQA 3QSKB 1PPIA 4R7LA 2NSXA 5BS0A 3U1PA 4LBEB 5I28A 5DSCA 1X7QB 3GMMB 4G7SB 5C0FB 2DBLH 1IU1A 3I6SA 5EUKA 5FYJH 1DBJH 2VC2B 3TTYA 4EI6B 1G0DA 1XH3B 2F54A 2ESVE 4O2FB 1N5AB 3A5VA 3O3AB 1KLGA 2JKTM 4ZXBA 1JZDC 3AT8A 3N41B 4Z0BH 1HNGA 1E5CA 2V2WB 1KIQB 3PV6B 4FLSA 1CF1A 1EEYB 2ZWSA 4MD5A 1GXEA 3VI3F 4LVHB 3G08A 3OHMB 3CK0H 3PQYA 2RFXA 1HNYA 1EJOL 2H3XC 1FVCA 2B08A 2P9RA 3IXAA 3CSGA 4WI7A 5IHHA 5CJOL 3VXME 5B4MD 4JKPH 2A9MH 4IIZA 5JXAH 3SKOA 1JGEB 1BQLL 4X8GA 4ACTA 2VISB 2IGFL 2W5PA 4GO6B 4NNPH 3JV6B 1F1GA 4LLMB 4LARL 5FOBB 1CFBA 2OXGA 5KS9F 3H9SE 1BDYA 4QRBA 5JQ6L 1GMIA 3ZKMC 4PPTA 3LPWA 5EZIH 3CQFA 4PJHF 1S46A 2UXFA 2V5MA 5SX4H 2OYLA 3X11B 4JL2A 3PJLA 1KBBA 1EDHA 1B4LA 1UYWH 3O6KL 1PEWA 3JV0A 3Q43A 1OSYA 4Q6IC 1U3HD 2Z4QA 3GK8H 2APFA 5DHVH 5BO1L 3QIBA 3N5AA 5AOMA 4L4TA 1QFPA 1QR1A 3PV6A 4Y1AE 2DL2A 2A73A 3GJEA 2P42B 5CEZD 4E41D 5C0AE 4HWEH 4Z78B 2EDXA 5DR5L 4WHYG 5ACZA 4OLZH 5FGSA 3V5HA 4AGOA 1O7VA 4L1HA 3V6ZA 3OG4B 3K0WA 2BP3A 4QRSA 4JHAH 3IXTB 5TGBB 4LDOB 4IRJC 1NANH 3MLRL 2PYEA 2QV2A 4Z7UE 2ED9A 1BLIA 4PLOB 3F85A 3MUGA 4I85A 3G9VA 2ZPKH 2UXGA 2VLKB 3IDNB 4QT5A 1MJJA 2VDQL 1FNEB 2E3VA 1MFNA 2WQWA 4JFPA 3GKWH 4GG6A 3S7GA 1DJXA 2TRYA 1BQKA 3PG2A 1XF2A 3CFBB 1J9SA 4J3OC 2PYFA 1Z6JT 2OS7A 2HUEA 2XKUA 5CGBA 1A5FL 1FZKA 1T7XA 1VERA 2O5XL 5E9AA 4WCYH 5FFLA 5EU7C 3NEEA 1Q0XH 5IQOA 1F3JB 2V9QA 3G5XA 5ILTH 3SKJH 5FA3A 2R1YB 4MD4A 2DMCA 5IMOB 3KM1A 5H37A 2CBQA 1A9VA 1M7DB 5GIRB 1FO0H 5T1KD 4DT2A 2VUKA 2XWBB 5DMKA 3TN0B 4HH9B 1YJDC 3SGJC 4Z7WE 5DHEA 1WQVT 3KDMB 3BIKB 2J56A 2QJDA 2Y1ZA 3X13B 4HDIA 3OHXC 1ZV2A 3BZ4B 1NGPH 2NNAA 2BSED 2I9TB 2DD8H 1LK2A 4FMKA 1KGWA 4PD4K 2YFNA 5A2IH 2CR3A 1IM3A 4EZLA 1AI1H 3CZEA 3MNWA 3A3YB 3DMMA 4NERA 1U8PB 1CFVH 2AP2A 2YGOA 4WW1B 5T1KA 1U9KA 1V54B 4TRPH 4E5XB 2P5ED 2ZUVA 8CGTA 1IBBA 2FSEB 1EFXB 3GTNA 3WN5A 4A2DA 5DEZA 4IMKC 1M05B 1FVCB 3IXAB 5TE6L 5F7EH 1V7ML 1VB9A 5IWLA 1DO6A 2AQSA 2YA0A 3OWEA 3DSFH 3QGVA 4R8WH 1AE6L 1FFOA 1BZQK 1LO0H 5ACLA 1FBIH 2CA3A 1YEIL 3VQ2C 3EH4B 2GBAA 4OY9A 5DVOA 2DH3A 2V5RA 2VLJB 4TXVB 5TQ2L 4ZMWA 2D0HA 1T3FB 2GUOB 2N7SA 4U0QB 5G4OA 1A3QA 1F4XH 4UOW1 1OCOB 1F8TL 1SYSB 4QNPE 4P3DB 4OUOA 3MNZB 4ZPTB 2FTAA 2NY5H 4CGTA 4ZW3A 2RHEA 1IC5L 3KMDA 1MJ8H 2A6JB 1UWEL 1W8NA 1Z5LB 3VXPA 1VA9A 2X4PA 4GQPH 5HDQH 5B7FA 4YHYB 3VXSB 5HY9B 2JCCF 3QEQB 4NZUL 4WWNA 1XCXA 2ZOLA 4FQ2H 3CSYA 1A7OH 2AJUH 4NGHL 3QC5X 2WTRA 2P8LA 3G5VB 3MLWL 4FTVD 4UTAH 4JKNA 1BBJA 4JZNA 2IBBA 5E6ID 5E9DB 3T4AC 4HJ1A 5AVXB 3GXDA 3HHSB 5AVUB 4DH2A 3CXDH 3EF4A 3H42H 1CLVA 3ARBC 3K6FA 3OKLA 1VCBC 1TVHA 3HA0A 3QBTB 3WAJA 5ACMA 1CPUA 4J8RA 1MJUL 1S7WA 1W80A 4MNHB 3RHWK 2VN4A 3GYRA 3KPPA 1G7PA 3WUWB 4TTDC 3WEOA 5C70A 2EDOA 4YHMH 3FL7A 5K1VA 1WD8A 4JJ5A 5AZEH 2WP3O 5E8DL 1PEZA 2AF2A 1TITA 1MLBA 4LPVA 3VRJA 3ARDA 1FG9C 1MNUL 4XB8A 3B9EA 4Y4FD 3WIIH 4RVBA 5HY9A 4KKLD 1TF4A 1OLZA 3MRQB 3VVVA 3FXIC 4GT0A 1NKOA 1P5UB 1S9YA 3V4PA 1T1XB 2W8CA 2XWJA 2DLFL 3G08B 1DBBH 3NP3A 2XQ0A 4FHBD 1UZ6F 3LNHA 2ESVD 1EQWA 5FPIA 1QHOA 3KJ6L 1RLWA 1CGYA 4M1CD 4XC1H 4XNXL 2PCPB 2YBRB 4PWFA 4ZUUA 1XGYL 2WBJB 1DQML 1CO1A 1OOAA 3VXNA 4Z7OB 2FO4A 3PABB 3M7OA 3W37A 1B4RA 1X6NA 1X9UA 2ITCB 3BAEH 3QRGH 4OVUA 5FO9A 4JPSA 1PD6A 5DZNA 3LRSB 1SEQL 4FQ2L 2DWDA 5EH1A 5FHAH 4XAWH 1OGAE 1ZA3A 2CJUH 3AT9A 4C59B 5BCAA 1MCPL 4I0CC 2F54B 4U1GB 3ZE2E 3OZKA 2HJKB 3MREB 2OXHB 2D3VA 2W0FB 3KR3L 3P11H 3I02B 3ETBF 3RTQB 1YC8A 1INDH 3LEVH 5I8CB 4P5TD 1NSNH 4R7VA 3MNWB 2OKMA 5ENWA 3BN3B 3UGXA 1CS6A 2B8OT 1XF1A 4LKCA 4FADA 3BW9B 4ZOBA 4U1JB 1CF8L 2VGLM 1IGIL 4NLHA 2F5AH 4RETB 4XP1L 4Z7WB 4JR9H 4GQ9H 4N25A 4AGQA 1BYPA 1UEMA 5LAXB 2QSQA 2NXZD 5J6HA 2OCCB 3HB3C 4KK8C 4P04A 3WHXB 5HGBA 2A9AA 3MUZ1 3T6QC 3DX6B 3KS0H 5C0EB 1MFEH 2NTSP 3EDDA 1ZXKA 4PJXB 3QJOA 5ISZD 2H1LM 4GAGL 4IRSD 5EZJA 1GC1H 5D5ME 3QJTB 3KHOA 4BFIA 4EKJA 4LSPH 2O6FA 2HTKC 3D2UA 1FHGA 5HHVL 1UH3A 3EYQC 3X1BA 2OSLA 1ZK5A 2W65A 4LQFH 3V0JA 3EFDL 3ZK0A 4L8SC 3UMNA 2CLZB 4LCUA 4FABL 3I6KB 1DJIA 4LOUC 5IF0B 3UTSA 5BZDA 4P23A 5TPWH 1CVSC 1S7UA 3P73B 4G8FB 4WIQA 3RJOA 4BFJA 1KB3A 3RY6A 3L5XL 1LQBC 8FABB 1HYSC 2W07A 2FDBP 3FU6A 3MACH 1YNTB 1SY6H 2A6DB 5D7KD 3KXFA 5JA8B 3GXIA 5FF6B 1JHLH 4KTDL 3TA4D 3MGOA 2XV6B 2RACA 4JM2B 4POZD 1N59A 4FQXC 2I32A 4IKLA 4N90E 4HWBL 3S5LB 4G7YL 3S3DB 5I0ZA 1J1PL 5IUCA 3A6CL 4IHBA 4IS6B 4NWTH 4KX7A 5HGAA 3F65A 3PGCA 5H94A 1CBVH 2E7MA 4TUJA 3T65B 3BH9B 1R3KB 3FTUA 4HFUL 5FCSH 1HH6A 3P1VA 3GBMH 1F4YL 1WIOA 1JPFB 1PAZA 4ES8A 2PCXA 1IM9D 2A38A 2D7NA 1U8IB 4A66A 3MXVH 1GPOL 5GHWL 3HE6D 2GJZB 3FQ4A 4OF7A 2PP7A 4X6BB 5DRNA 3HE7B 1OP5K 2BW5A 3POCA 5KVDE 2BVTA 1KGYE 1V7MH 2CIIB 2VJXA 2FJSA 4RGOH 2MEJB 1H5BC 1L4IA 4HALA 5IT2H 1RHHB 3P3YA 4ODUA 3OF6A 4JFFA 1OD7A 3CUPA 3BZFB 2C9VA 2X09A 2H6OA 2XWEA 3QORD 3RIAK 1XWVA 1JCVA 4YIQB 3RLSA 2QQKH 5IROD 5I8CA 1VFAA 1RMFH 5EIQA 2EIZA 3F7PC 3PAUA 1JWMB 2VDLL 1YC7A 1GHFL 1MDTA 2UZXA 1CDBA 1I9IH 2Y1AA 4PJ9C 3T65A 2YD8A 3LNGA 4WI5A 3CU1A 1QI5A 3KCWA 4YSPA 4N6RB 4H13C 3MACL 4OLUL 3TCLA 1F0LA 2GSGB 2IALA 3CDZB 3BD3A 3K2UL 4WI2A 3EGXA 1AIFA 3H2QA 3T3MB 4DP6X 4OAWA 1HU8A 3DHJA 5IESL 3MLWH 4OI9A 3HAEB 1ESOA 1AZNA 3F7LA 5I17B 3LB6C 1NCIA 4N86A 4NZJA 1OP3H 4UDUB 3KYKH 4N5UA 4BV1A 1GS6X 4R3SB 1M56B 4PJHE 2XA3A 2Y1VA 4NZRH 1D5XB 2MIZA 1HX0A 2QLVB 3TJHD 3SY6A 2H6PA 5D7LB 4F8NA 3ARFC 2AMUA 1BOYA 3LVEA 1G7LB 3L7FB 3NDYE 3ZSTA 3RIAF 1QATA 1PAMA 5E4EB 2EACA 2QBWA 5D9SB 3MLTA 1RIVL 3QORC 2X4NB 1AKPA 4LP8A 1F18A 2OMUA 4LLDB 3GWJA 3WKYA 2DWEA 4IBUA 4HIXL 2ATAA 3UBXI 2EXYC 5GZND 3RX8A 3KPPB 5E8OB 5GJSL 1TJGL 2R39A 1JHKH 1GAFH 3UYOD 4O9HH 2Y06H 5FCUL 3QCUH 3T0EE 2P5EB 3SGDH 4F3FA 3OAZH 2ZE0A 4WV1B 1U92A 4XBGB 4WO4C 1UD6A 2BP0B 5GQBA 1KYUA 4X83A 2GK0B 2A0LC 2OJEB 1O6SA 3QUKB 4GKSB 1WA1X 1ED3A 1LO3H 3CCHB 1OF2A 4P59L 1KCSL 5D70L 3HTLX 3HVNA 4KTEH 4XI5D 3HAEG 3KD4A 1E4XL 2UZIH 1UXWA 3B2DC 2F8IA 4PJEB 4JRYB 4PP2A 5DGQA 3GHEH 2LFGA 4XBEL 2YKLL 3MMEB 2WVVA 3JSSA 1K3ZA 2WN3A 2WY3B 4KPHH 1BXVA 1HFUA 5IBUG 3FTGA 4R96A 4FI7A 4G59C 4WCYL 4O4YL 3DIDA 2WLLB 1D5ZA 3N0AA 5AW2B 7CGTA 2Z0UA 5CGYC 5EF2A 3ULUL 4ODVL 2E6PA 2MPAH 5E5MA 2I85A 5J6GB 3IFLL 2IIJA 5K9JL 2D73A 4L2LA 4I48B 5T8IA 4F93B 4KJYB 4PRDA 2EYRA 3FONA 5EU6B 3WXVH 5I71B 3EO1B 4NBZB 3IGAB 3DRTA 1HL8A 3OJDA 2YJQA 4L4VD 4E5XG 1I1YB 3Q2VA 3HG5A 4LLVA 3L5JA 1I1FA 4YR6A 3TASA 3ZMRA 3TFBA 3QQDB 4HPOL 2KZWA 4IU3A 1YUKB 1PD1A 5F7MC 2GABA 1DSYA 4J5VA 2VL4A 2X4RB 1A7QH 4LFHD 4GIPD 4LK4A 1A3RH 4E9VA 1N18A 1O9VA 4JFEA 2IALB 5C0DA 2MQ3A 3ULVE 4NWUL 4ZMVA 4ZO8A 5EU5B 3T0BA 3CFJB 5F1NA 4EBQH 3ZX1A 4BXSV 4RGNE 2CKBL 4M7JH 4WWID 1GA2A 5T3ZD 1ACYL 5IEKB 4WNJA 5EEYA 1QW9A 2XPZA 1CLZH 3L3IB 4U6HB 5I1KH 3QI9C 2D7TL 4C4BA 1KEML 1IGMH 3C6LA 3K1KC 4OTXH 2J5LB 4BSWB 2IPUK 2BMKA 2DQIH 2J6EA 1T0MA 2PYEE 4U05A 3WUWG 5EC1B 1V7NL 3NVQA 4X5XB 3S36H 1J87A 2YKLH 1MHPL 2GI7A 4V33A 1CE6A 2LU3A 5LGYA 3QZWA 5FYKH 4B0MM 2X4OA 3QZBA 2AK4A 3Q06A 4HZ1A 5F88B 3C09B 4U1SB 1PQZB 4AM0A 3FU7B 4LCCC 1QWNA 2WVSA 3GKZA 1PZ2A 4WDIA 1XXFC 4Y1AA 3D09A 5ACZB 5I6XB 5J9PB 2D7PA 4N2FA 4YO0A 1OV8A 1JWSB 1QAWA 4HU2A 4XNQA 2CDEB 1RZJL 2EEFA 2LGNA 3SYPA 4G8GD 5E8EA 4RFNB 3OZ9H 4H2CA 4KI5E 2ZJSL 2A4EA 4NUPA 2W60B 3U25A 4NYLB 1P7BA 4QAMB 3BKYH 4P5TB 4HFWA 5TFSL 3V4VL 5TDNA 4Y89A 5BV7L 2X5PA 3VAEA 1T1WA 3O9WB 2DQEH 1QBBA 1M6UA 1N12A 1OANA 2J6EL 5E56A 1ZAGA 3QIBC 4HZLB 5CINH 4NUGH 4XBGA 1ZXQA 4N0UE 5AZEL 2ZX6A 4Q0XL 4I3RH 1Z9MA 4Q6IA 3ARQA 4Y8DC 4LCVA 1S9VB 1XD1A 4GQ9L 5AB0A 5ICXB 4N1CA 4PR5B 5CLWA 5D2LF 3PFUA 3BSGA 4ODHL 4HUXA 2OR8A 5HDBE 4TSBH 4OCSH 3UBXB 1AGCA 3QIWB 3L2NA 4YH6A 1OB0A 3VXRE 4M4RA 3WAKA 1A3LL 4HDIB 5JYMA 1H3PH 3WFHA 3RTLA 4DW2L 1FLTX 3GSQA 4I0KA 4FNSA 4HUVB 3K2UH 4KGJA 1WCQA 2ERJB 5EPMA 1CVRA 2J2ZA 3UIZA 3IAGC 4GMSH 1CB4A 3PQYB 4JX0A 4LQFL 4Z7OE 2P80D 5CILL 5HVWA 3HZYA 3DVFA 5AVTB 2UV3A 5DO8A 4WGVB 5DJDB 2IDSA 3QRGL 2GTZA 2QPDB 3OJ2C 3QR0A 3NGBC 1QKZL 4NCC2 3WE6B 3RB7A 1N8ZA 4MNQD 3QDJA 3VFVA 4QRRD 3RVVC 3SE8L 1MLCA 1UM5H 4P05A 3T0XA 4L8BB 5DJXA 4P2CG 2J44A 5JW4Q 5DHVB 3U7WL 1L0PA 4F37K 3TOPA 1RIVH 3VGGA 1TT6A 1D3CA 2AQTA 1H8NA 4KI5F 2G60H 2X3AA 5JHBA 2R69A 3VFPA 2VAAA 2F5AL 4XP1H 2J88L 3US1A 1FFNB 2R7EB 1RULL 1G4RA 3IKCA 3QIUA 1FUNA 4PS8A 1CBVL 1HI6A 1DJYA 4I7ZC 4N8UA 4OR1A 5EG6C 1M7UA 1ETA1 5JA9A 4ZFFB 4PWHA 4POUB 3GXPA 3I6GB 1CGUA 5HHOB 1K8DA 4AM0Q 5D5MB 4WJKB 2SODB 4DP9X 5JPMB 4G5ZH 1MIEH 5EWIL 4RGNB 5FYLD 1RZFL 2FJHA 2BNQB 2P5EA 4X80H 4ZAKC 3T2QA 1PYWB 3VFUB 2H3KA 4JW3A 3UCQA 1SOSA 2I7SA 2XZQL 4YFDB 4XNYL 5EU4A 4EUPG 4LSUH 4S0TD 4DETA 3IFNL 4NXSA 4AQAA 2YRLA 5KVFH 4IHOA 1REIA 1B2WL 5CF3A 2R0ZL 1ECZA 2CXGA 4FDWA 4AENA 2P45B 4LCCB 4RESB 5KS9A 2VDNH 1MF2H 2EE0A 5KSUA 2PUQT 2O5XH 3MROA 4PGDA 3UAEA 2PXYD 1URIA 5EBWA 4XC3L 5C09E 1NFIA 3FRPA 3WS3B 4NFCA 2PXYA 4TNFA 4KKBC 4AVKA 3JUZA 2GQHA 3P02A 4EVNB 1ZS2A 5F44A 4G80A 4XMPL 3RY4A 1N68A 2G60L 3TNNA 5IFJB 1KN4H 2L8AA 3L4VA 5KSBB 3LXAA 1UB6A 3ETSA 1VFBA 4KTYA 3RQ3A 1J1OL 2EDNA 1CI5A 2WO4A 1JD7A 3DHPA 3VFGL 1WFJA 1PZAA 2UWEA 4Z8FH 1XCQA 4ELMA 4M1GH 2NQDA 1JERA 2B5IC 2APXA 3P11L 4TRPL 2G9HA 2PO6C 3TBCA 1DBML 2ICWI 4LL9A 4BINA 4JZNB 3MXWL 1AY1L 4ZBJA 3QQ9C 4X5WB 4FYSA 3O4LB 4CJ1A 2PO6A 2CPUA 4TNGA 2VERN 4AXWB 5GS0C 3V4PL 1CC3A 5DD0H 1U8QA 3Q1SL 3HJEA 1QRKA 1KYAA 4XMUA 4S0HA 3P4OB 1SHWA 4PYGA 2EO7A 1BM3H 5FHBL 4RISH 2VN5A 2WNGA 4X9GA 2R29L 4MDJA 3ZYOA 3WTUA 1FDLH 4J3OF 1IKNA 5SWSE 2ZOUA 2WB7A 3SDDC 2W80C 1NBVL 4F5CE 3ME0B 4CKVX 5ILTL 3V55A 4Q6YA 1CG9B 4GAYB 1RUKH 1MQ8A 1QQDA 2ZAGA 2DKUA 3LKQB 1CTOA 1MLCB 3VH8A 3OQ3B 1AQDB 4C4UA 2LV4A 5BOPA 3TC9A 4HUNB 1RZGB 2C34A 5IHLB 3MBEA 1GJUA 4ZX3A 1DVYA 3MUHL 4Z18A 5E94B 1E6JH 1LO2H 1OW0A 3VXMD 2OK0H 4QWWC 2Q76B 5BQDA 3WO4C 1DZBA 5CIPB 1W2KT 3V9FA 3EFFB 5KG9B 4KI5D 5FX3A 3O6FB 1PJ9A 5BVJA 1Z5YD 2X28A 2LHAA 4CNIB 2WBJA 1B4TA 4HIHB 1FZMB 2VDOH 2MPAL 2R0LL 3QUMB 4UILH 4P5MB 2Z31D 5FUCE 2P3YA 5GGSB 1A1NA 1QX1A 1MZZA 4ODXB 2DS4A 2H2SC 2XWJB 1HTYA 1R5WA 1ZK9A 4NAQA 5KS9E 2GJJA 3NT0A 3PL6A 3LRGA 3N91A 2VO8A 4ZUSB 3WTVA 4ICWA 2XETA 2NX5D 5EIVA 3CAFA 3GSNH 3FZUD 4Z5RA 2KUTA 2ORBH 4U6YA 5AB2A 1Q1PA 1T22A 3ARFD 3ASWA 2X4QB 2XXFA 4L23A 3UYPA 4AEHH 2VLRD 3K72A 4FQPA 2QR0B 5EU3B 3LV3B 1LD9B 4UINL 4P5TA 1BG9A 1JVLA 1QRNB 2YXVA 3NK4A 3L3OA 5D1ZI 3QUZA 5DMIH 4H40A 5IBUB 1CLYH 1ZT1A 1BZEA 5D2LA 4Y4KD 2VR5A 1RK7A 1U4EA 4FXKB 1VFBB 4YXKL 3BLBA 5I1KL 1R3IL 2GK2A 3QPQD 2AK1H 4JRFA 5AYQA 4PJ6A 3U2JA 5I1LA 4OBRA 1G9NC 3CZLA 4RDQF 5EO1A 1XBRA 1MVYA 2QVMA 1W72B 4ODXA 3VD3A 4MXVE 5LQBL 2YD0A 3QIWC 3BFWA 3HMWH 5FFOA 1MCCA 4ZNCD 1OXYA 5IJKA 3B2XA 3OAZK 1HZHH 2DDQH 2Z91B 1G6RL 3CH1A 2VQUA 3O81A 4PM1A 1JK9B 3QUMH 4PJCB 2EO9A 3RIFF 4DN3H 4Y9FA 2F53D 3INOA 3ZYZA 3MCLL 3T0DA 2Y24A 4BM7A 3C87A 1RIUL 3BAWA 1H6EA 3BVTA 1FN4B 3Q8BA 4XNAA 1TEFA 4CN6A 1G9MC 3AUWB 3DO3A 3EGDB 4NM4H 5FWRA 1NC2B 1XR8B 2GW5A 5I6NA 3ZTEA 2VL5B 3P77A 3F6LA 1IAOA 4YHLL 3U46B 1OE2A 3KS0J 1CURA 3ULUD 3SOBH 1SYVA 5FYKU 3S2AA 4A2MA 1X5LA 5GZOC 2CLVA 4GG6F 4U1IA 1U0QA 3C2AL 3PDOB 4QXWA 4EIZC 3KGRA 4J8QA 4MA3A 2ZWZA 1SN2A 4NKIL 3TJHC 4PGJA 3VQ1C 4ZMNA 2NY0B 2HZHA 2YMOA 4JFYA 3C60D 4NQVA 2AJ3B 3NRFA 1KGXA 2QZ5A 2XZQH 4B9JA 1QFHA 1QZNA 3S8WA 1K8DB 3KPOB 4XN1A 2X12A 4BK5A 3Q6FA 1IKFL 1J5OH 4KDTA 3N9GH 5I8EA 1TLMA 3P30L 1AC0A 1TJHH 2Q1EA 1Q1JL 1FL6A 1Z9NA 5C07B 4DPCX 5BOJA 2JQMA 2QHLA 1B9KA 1KLUA 2J25A 2WKOA 2N56A 4WW2A 4LHUA 1TJGH 2A74B 3U9PH 1CGTA 1OW0C 4HUMB 4OM1H 1ILSA 5MENA 4BKLA 3PWLA 3RTQC 5D7IA 5DJZB 2IAMC 4GUPB 3H85A 1OTUC 2NT1A 1A3ZA 2VDML 2B39A 3V9EA 1YSOA 3GD1C 3EO9H 1JGDA 2Q9OA 4DAGL 1ZGLP 3ULVF 3SHSA 5L9DL 4PRIE 3PQYD 2AQ3A 2A99A 3KPLB 3VDAA 3C6SA 2A9NL 2HVKA 1AQ8A 1Q9LB 4QGTA 5EU3A 5T3XE 1ZANH 3X1NA 1E5YA 5I1HH 5E1QA 1UM6H 4ELMB 5K9KA 4OI7A 1NOFA 4FI6A 2CBTA 3KPOA 2D4DA 1DBAH 2UY6A 4OZIE 5FW8A 1UM5L 4BSJA 4F33B 4AV0A 3ML9A 5BXFB 2DEYX 4A6YB 3SE9H 5LGHL 1T0PB 4FMVA 2BCMA 4IOIA 4X50A 4WTZA 1WBXA 2EXYD 3IJYA 5HYSG 1NOAA 1E8YA 1GRWA 1VPOH 2OMVA 4JHVA 3MTXA 1IM9A 3OR7A 3QJHA 2Q20A 4EVNA 3SDCC 3HG3A 2BFGA 3FT1A 5IROA 5C86A 1WZAA 3OB8A 4ZUWB 4RIRB 2YUXA 3F8UB 1MPAH 4X6FA 4YSAA 5HBBA 1KCRL 2JELL 3T8XA 4G7RB 4RMRA 2ENYA 1F56A 3QA3A 3UTTE 2BP5M 2JFCA 2QHRL 4FXGB 4LE8A 3Q1EA 3FULA 5KSVA 1WZ1H 1RPQA 1PY9A 3QIWD 3FB8A 4AUUA 2HB0A 5FV2A 2UXTA 3MBEB 2BXZA 2WO2B 4HEME 4M6OH 2NQCA 2FECL 4M6AA 3MRFB 3KDPB 2BVQA 4HC1H 2HTKD 4MZ3A 3GXMA 4C4KT 1T03H 2DYPA 3QUXD 1E4HA 5DZOA 2FSDA 2Z92A 2QMJA 5IR1A 3KG5A 1Q0EA 4HV8B 3FTYA 4ALAL 4KROD 4MJ2A 1MFAH 4JRYE 4HXBL 1QSEA 2UVFA 4GUCA 3EJCA 1ZT4A 4Y4HB 4FN0A 3OV6A 1NCBH 3Q2LA 3GBML 2DB8A 1D6VH 1AXSB 2B2XH 4QRRB 4X9IA 4ZS7H 4QWWD 4LRIC 3VGBA 5E1AA 3C75A 4JPKL 5HYSB 5IHBA 3MRGB 2ZAHA 5EU7E 2BRQA 4OGXL 3RVUC 3E8UH 5F7WC 1T83C 2FUQA 2PN5A 3O2VH 4R7NB 5GRUH 5ITBH 5DUBA 4R7DB 4DUWA 5AVSB 1U8JB 3L95A 4YLQT 3NFPA 4YK4C 4PVNA 2X70B 3QJXA 4JQVC 4KNTA 4XOEA 4GG6B 4EUPH 3GSNL 1S9WB 3ZL4H 5B8CC 4JHWL 3OMIB 3HS0C 4Y5XC 4Y4HC 15C8L 3RFRA 2NX5E 3B9DA 3BMVA 4Z95H 5IHUL 4MRCA 3H56A 3KWWA 1KB9K 3B56A 3FFCD 2VLLA 1U92B 4AIOA 2Z0BA 4PP1D 2X44D 5KSAD 1OHQA 4OZGA 3Q05A 2CM5A 3SQRA 2BK8A 3QUMA 4BYHA 1LK2B 1BQ5A 5F9AC 2BNQE 4O02L 3RPIB 3QDAA