1P2EA

H61a mutant of flavocytochrome c3
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
568
structure length
568
Chain Sequence
b'ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASAFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords flavocytochrome c3
molecule tags Oxidoreductase
source organism Shewanella frigidimarina
publication title Histidine 61: An Important Heme Ligand in the Soluble Fumarate Reductase from Shewanella frigidimarina
pubmed doi rcsb
total genus 194
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1p2eA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1p2eA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1p2eA01
4Q1OA 3ALJA 2BYBA 1DJQA 4B69A 2NVKX 1KFYA 1BVBA 3BHFA 3LZWA 4WJYA 3D1CA 3QSMA 4IV9A 4U8NA 2PHHA 3QJ4A 2GQWA 2R0PA 2YG4A 2YLWA 4B68A 2IIDA 4H4ZA 3AB1A 3AEAA 4EIPA 3AD7B 3F8RA 3OZ2A 2WU5A 3D1IA 1NHPA 1PBFA 4JDRA 4M52A 1MOKA 3CNJA 1TDOA 4K5RA 1H81A 1GNDA 4KX6A 2R4JA 3CPHG 2E80A 3V76A 2WDRA 3NK0X 3UKQA 3I6DA 1GRHA 2WBAA 1IUTA 3G5SA 4K8DA 4YKFA 4RG3A 1XDIA 1CC2A 1PJ6A 2DKIA 2VRLA 1KNRA 2RABA 3AYIA 1EL7A 1PDHA 4X4JA 2CDUA 1PBEA 2FBWA 3H8IA 1NG3A 4CNJA 2ZZCA 1B8SA 5HYMA 2C76A 2GR1A 3ICRA 2ZO5A 2C64A 1CHUA 1GEUA 3ADAB 3KVEA 2E1MA 4ZCDA 2YM1A 3H8LA 3SQPA 2LFCA 2ZBWA 2BC1A 3CN8A 2C73A 2XLPA 3UOXA 3DK8A 1GOSA 4OPTA 1GERA 1P2EA 3II4A 1KF6A 3PO7A 1NEKA 1F8SA 1QJDA 2V60A 1ZOYA 4USQA 4CCRA 3NYCA 2VVLG 3AE6A 1V59A 1XPQA 3AE5A 2QA1A 1PJ5A 4Q5CA 2H89A 2WESA 4YWOA 3DMEA 3NN0X 2YQUA 4N9XA 1IUWA 1TDEA 4U2SA 3KLJA 2QCUA 4HB9A 4Q17A 1LPFA 2WOVA 3IF9A 4CBQA 3UP5A 3DA1A 1DODA 2IVDA 4NTCA 1D7YA 2Y6QA 3AE2A 4GDPA 1GRFA 1H6VA 2BXRA 2W0HA 3S5WA 1GT8A 3NYEA 2VOUA 2WPEA 3UTEA 2A87A 4D03A 1IUUA 2I0ZA 2WOWA 2V3BA 4Z2UA 2DKHA 3UOVA 4YXDA 4L3YA 1DOEA 2IVEA 3UU9A 3L1RA 4Y4MA 1IUSA 3AD8B 2F5ZA 4DSGA 3K7MX 2OLNA 1EL9A 1XANA 3BNJA 1PXBA 2FJBA 2RDZA 3GMBA 4U8PA 2OAMA 2ZZBA 3LB8A 1TDNA 3NNEA 2RGHA 1RYIA 3ZYXA 3DGHA 4I58A 1TDFA 3DK9A 2YLSA 2JB1A 2C65A 3GYJA 5IQ4A 3NGCX 1P2HA 3IC9A 2GB0A 3M0OA 2C3DA 3AYJA 4APNA 4BK1A 4B65A 4YTPA 1D4EA 2ZZ0A 2E81A 2C75A 3BNUA 4NEWA 3JSKA 1ZDLA 4H2PA 4NZHA 4Y4NA 2JK6A 3ICSA 4LU6A 4YT0A 2VRMA 1PBDA 4OPUA 3RP8A 1IUXA 3UTGA 2R0CA 4FX9A 5KOWA 3K7TA 3ALLA 2X8HA 2QA2A 3ISHA 2WPCA 5KRQA 3NTAA 1GV4A 3NYFA 4J36A 2JB3A 2V6OA 2X50A 3C4NA 3BNMA 3VRBA 3LG1A 4A65A 1IUVA 4H4WA 4DNAA 3KKJA 3QFBA 1FCDA 4C74A 3AE3A 1FEBA 2V3AA 2GAGB 3R9UA 1FECA 4YTNA 4RSLA 2B9YA 3AD9B 3DJEA 1GPEA 1OJAA 5JCMA 5M10A 1QO8A 1FT6A 3REDA 3ICTA 1VDCA 4EIQA 1FT5A 1N1PA 1CF3A 4A5LA 3P4QA 1M1RA 3QFAA 2A8XA 2B7SA 2RGOA 4TM3A 1F6MA 5KWFA 1W4XA 2BK3A 3UCLA 3B3RA 3F8PA 1K4QA 1GETA 3GMCA 4TLZA 2PYXA 3COXA 1YKJA 4GCMA 4CY6A 3L8KA 2GRTA 4BV6A 5HXIA 3UKFA 2AAQA 3CIRA 4TM4A 1B37A 2VVMA 1Y56A 2WQYA 1LV0A 3GD4A 4U2TA 1GTHA 2Q0LA 2GH5A 1S2YA 2WU2A 4OVIA 4JY3A 4WX1A 5FS6A 4XWRA 1SP3A 3HZLA 3B6DA 3SFDA 5HHFA 1X31B 3RP7A 4YTMA 1BGNA 1CC6A 2CVJA 5KXJA 2B7RA 4FK1A 1Z6LA 3RNMA 2YVFA 3M13A 3DK4A 4J57A 3ATRA 1O95A 3AWIA 4ZCCA 2WP6A 3F29A 2EQ8A 4J2WA 3EANA 4UP3A 3UKAA 2YAUA 1NHRA 1CJCA 2E4GA 4P9SA 4ADWA 1EL5A 3WE0A 3M12A 3DGZA 4H4RA 1SEZA 1N4VA 2WP9A 3H4KA 2FJAA 2X99A 2GR0A 5GSNA 2R46A 5JCNA 5JCIA 1S2QA 4H4UA 5U25A 3NTDA 1NG4A 1D4CA 2EQ6A 4OPDA 5BVAA 4H2RA 1E1LA 1E1KA 3QSEA 1FOHA 1NENA 3NIXA 1BGJA 2XLRA 1RSGA 1GALA 2VVLA 1E1NA 3BNGA 4KPRA 3AEDA 4U8KA 1F8WA 3LOVA 4H4YA 4H2QA 4CRTA 1PXAA 1QLBA 2B9WA 2R9ZA 2YLXA 1ZMDA 1H82A 2YG5A 2Z5XA 5IQ1A 3CGDA 2BC0A 1M64A 3OWMA 1L9EA 1LQUA 5BRTA 1YY5A 4C5OA 1NDAA 2AQJA 4E0VA 1KSSA 2BCPA 3C4AA 3SGLA 2ACZA 1KNPA 1TRBA 3GWDA 1PHHA 2C3CA 2JB2A 1UKVG 2WS3A 3Q6JA 3QVRA 4Z26A 3FO3A 1VRQB 3BI4A 2AR8A 2R0GA 3UBRA 2X8GA 4OPCA 3VRAA 4Z25A 2UZZA 2Q0KA 4J56A 5DBJA 1N4UA 1K0LA 2GVCA 1TDKA 2C72A 3O0HA 1ZX9A 1E7PA 4TLXA 1JEHA 4U8LA 3CNTA 1GXFA 1BZLA 1N4WA 4A6NA 4EMWA 5EB5A 4L38A 1QDBA 1KDGA 2XYOA 3AEEA 2YG6A 3NG7X 4AP3A 4EM3A 1H7WA 3OC4A 1CJ2A 4PABA 4CNKA 4L3XA 1B5QA 1F8RA 3FMWA 1PN0A 3AYLA 1PJ7A 1CJ3A 1E1MA 2BXSA 4OCGA 4Z43A 4B66A 3CNPA 1PXCA 2GQFA 3GDPA 2YG7A 3NHOX 4FK1C 3P4SA 4AT2A 2QAEA 1CJ4A 1L9CA 1S3EA 5J60A 2Y6RA 4K22A 4H4SA 4YKGA 1YQZA 2APGA 2R4EA 3CTYA 2XLSA 1ZOVA 4U8JA 4U8OA 2TMDA 4UDQA 3CNSA 1K0IA 5JCKA 2B76A 5FMHA 5U63A 1E39A 2JBVA 1Q1RA 1CBOA 1OJCA 4PAAA 3UTFA 3UTHA 2TPRA 3SCEA 4Z44A 1YQ4A 3CPIG 3AEFA 1COYA 2BK4A 1K0JA 3EF6A 2X3NA 4C3YA 4H2NA 1CC4A 4GUVA 4WCTA 2GMJA 4AT0A 1GRTA 5M0ZA 1VG9A 4O5UA 3EAOA 4H4QA 1NAAA 5LV9A 3UOYA 4B1BA 2YR6A 3P1WA 1FEAA 3AXBA 3IHMA 4CY8A 2J7AA 3GM6A 1GTEA 3CPJG 1H84A 2JKCA 2VQ7A 4AOSA 3LZXA 3V3NA 1DJNA 2WOIA 4X9MA 5C3JA 4H4XA 3AECA 1CL0A 1LTXR 3UKPA 2YLTA 4A79A 2HQMA 2YLZA 3IHGA 4IA6A 1EBDA 1GREA 1OJTA 3MMOA 2GAHB 4MJWA 5U1OA 1JNRA 1B4VA 2A89A 4H50A 3NLCA 1AOGA 1Y0PA 3SM8A 1GSNA 2YR5A 1JNZA 3G5RA 2XFUA 2BS4A 3ZDNA 3URHA 3LJPA 4B63A 3TORA 4Q4UA 1ZK7A 3UOZA 2XFQA 1DOBA 4JY2A 4H4VA 1OJDA 4Q5BA 3PVCA 3NN6X 5GRTA 1MXTA 3LXDA 4FDCB 1VQWA 1XHCA 3T37A 2Z5YA 4TM0A 3VR9A 4U2LA 2WPFA 1EL8A 1ONFA 4EMJA 4NTDA 3VRDB 4YSHA 2YVGA 2VR0A 5BULA 1Q1WA 2WP5A 2JAEA 2GR2A 5EOWA 4C3XA 5CKUA 1LJ1A 1PBBA 1VG0A 5C2TA 1D4DA 1GU6A 3SFEA 4K5SA 3DJJA 4O5QA 4X9NA 1M1PA 4B64A 3P9UA 2OT4A 4CCQA 2YWLA 3KD9A 2BCGG 2BS2A 3AEGA 3FG2P 4H7UA 5J7XA 3AE1A 4EQRA 3UKKA 1M1QA 1H83A 4HA6A 4D04A 4JQ9A 1NHSA 4IA5A 3PS9A 2C70A 2FJEA 2RGJA 4JN9A 2C67A 1S3BA 2BK5A 2ARDA 3RP6A 3FPZA 5JCLA 2XVFA 1TYPA 1TYTA 1LVLA 3CGEA 5FS7A 3BNFA 1PBCA 3KU9A 2V5ZA 3GYIA 3CGCA 4Z2TA 4IVMB 4A6NB 4A9WA 1YQ3A 3BHKA 2J3NA 2B9XA 4B67A 3CNDA 4ZN0A 4REKA 3E1TA 4EM4A 2VQBA 4EQSA 4IVOB 4L3ZA 4GRTA 4Y4LA 5FS8A 4C77A 2V61A 2WHDA 3BI5A 3NT6A 4BJZA 3UP4A 4XXGA 1JU2A 3NKSA 1H86A 4Z2RA 4U8IA 2YG3A 2WDQA 3S7WA 3VQRA 1JOAA 1E6EA 2XFOA 3S61A 4A7AA 3G5QA 3SXQA 1Q9IA 1KSUA 3L1TA 2YR4A 3ITJA 5IPYA 3KA7A 3GDNA 3BI2A 1FS7A 5TR3A 1DNCA 2Q7VA 5HY5A 2C7GA 2YVJA 1ZP0A 4LA1A 1IJHA 3DH9A 2R45A 3K30A 2XVHA 1MO9A 2VZ2A 3RHAA 2C66A 3NK1X 1ZMCA 2YLRA 4GR1A 2O9ZA 4ECHA 3GWFA 4BK3A 2XVIA 1BKWA 5BUKA 4JNQA 2XCGA 4BURA 3TTBA 1FL2A 2XLTA 4UDPA 5CQFA 1Y56B 4GF7A 4DGKA 4YSXA 5KVHA 3AE7A 2XVJA 4H4TA 3GYXA 1PS9A 3D8XA 2CFYA 1ELIA 3RKHA 4ICYA 3V3OA 4GDEA 2WDVA 3LADA 4JNAA 1O94A 2BABA 2XVEA 3C96A 5FS9A 4J34A 4LIIA 2GV8A 2XDOA 3AE8A 2Q6UA 2H88A 3AE4A 4OPGA 4TM1A 3GD3A 3GSIA 1O5WA 1ZKQA 2E5VA 3IWAA 2WETA 1ZY8A 3BNHA 2GEWA 1L0VA 4I59A 1DOCA 1JRXA 2BS3A 1JRZA 2K3VA 3NK2X 2OALA 5L46A 1GRBA 4RG4A 3AEBA 3LGQA 1OAHA 2NPXA 3UKLA 1JRYA 1GESA 2BA9A 4H4PA 4A99A 1FS8A 4J33A 2CULA 3F8DA 4YSZA 3DJGX 2RF7A 1GRGA 1H7XA 1D5TA 3I3LA 3ATQA 3P4PA 3EPTA 1NHQA 1FS9A 2XFPA 4OPLA 4UDRA 3CGBA 4EQWA 4NEVA 4NTEA 4YSYA 2XFNA 1F3PA 1L9DA 1NPXA 3P4RA 1D7LA 4EQXA 3DJDA 4AP1A 5KOXA 3UKHA 1GRAA 1REOA 3K7QX 3FBSA 4BK2A 4EMIA 3Q9TA 4DSHA 3FIMB 4Z24A 2GMHA 2X8CA 1OJ9A 3NH3X 4USRA 5ER0A 3ALMA 4K7ZA 3VR8A 3NRNA 1M6IA 1RP0A 2EQ7A 3QVPA 2OLOA 3AE9A 1DXLA 2OA1A 3GRTA 3GRSA 4Q0TA 2GF3A 2WEUA 2FJDA 3QSSA 2BACA 4U8MA 1LQTA 4AOXA 3KPFA 2GR3A 4XWZA 5EB4A 4BJYA 1BWCA 2YM2A 1JNIA 2EQ9A 5EBKA 1BF3A 4K2XA 5KVIA 2XLUA 3ABVA 4OPIA 1HYUA 4J31A
chains in the Genus database with same CATH superfamily
4Q1OA 3ALJA 2BYBA 1DJQA 4B69A 2NVKX 1KFYA 1BVBA 3BHFA 3LZWA 4WJYA 3D1CA 3QSMA 4IV9A 4U8NA 2PHHA 3QJ4A 2GQWA 2R0PA 2YG4A 2YLWA 4B68A 5KMRA 2IIDA 4H4ZA 3AB1A 3AEAA 4EIPA 3AD7B 3F8RA 3OZ2A 2WU5A 3D1IA 1NHPA 1PBFA 4JDRA 4M52A 1MOKA 3CNJA 3SZWA 1TDOA 4K5RA 1H81A 1GNDA 4KX6A 2R4JA 3CPHG 2E80A 3V76A 2WDRA 3NK0X 3UKQA 3I6DA 1GRHA 2WBAA 1IUTA 3G5SA 4K8DA 4YKFA 4RG3A 1XDIA 1CC2A 1PJ6A 2DKIA 2VRLA 1KNRA 2RABA 3AYIA 1EL7A 1PDHA 3KPKA 4G9KA 2CDUA 1PBEA 2FBWA 4X4JA 3H8IA 1NG3A 4CNJA 2ZZCA 1B8SA 3SX6A 5HYMA 2C76A 2GR1A 3ICRA 2ZO5A 2C64A 1CHUA 1GEUA 3ADAB 3KVEA 2E1MA 4ZCDA 2YM1A 3H8LA 3SQPA 2LFCA 2ZBWA 2BC1A 3CN8A 2C73A 2XLPA 3UOXA 3DK8A 1GOSA 4OPTA 1GERA 1P2EA 3II4A 1KF6A 3PO7A 1NEKA 1F8SA 1QJDA 2V60A 1ZOYA 3CMMA 4USQA 3NYCA 2VVLG 3AE6A 4CCRA 1V59A 1XPQA 3AE5A 2QA1A 1PJ5A 4Q5CA 2H89A 2WESA 4YWOA 3DMEA 3NN0X 2YQUA 4N9XA 1IUWA 1TDEA 4U2SA 3KLJA 2QCUA 4HB9A 4Q17A 1LPFA 2WOVA 3IF9A 4CBQA 3UP5A 3DA1A 1DODA 2IVDA 4NTCA 1D7YA 2Y6QA 3AE2A 4GDPA 1GRFA 1H6VA 2BXRA 2W0HA 3S5WA 1GT8A 3NYEA 2VOUA 2WPEA 3UTEA 2A87A 4D03A 1IUUA 2I0ZA 2WOWA 2V3BA 4Z2UA 2DKHA 3UOVA 4YXDA 4L3YA 1DOEA 2IVEA 3UU9A 3L1RA 4Y4MA 1IUSA 3AD8B 2F5ZA 4DSGA 3K7MX 2OLNA 1EL9A 1XANA 3BNJA 1PXBA 2C4CA 2RDZA 2FJBA 3GMBA 4U8PA 2OAMA 2ZZBA 3LB8A 5KMQA 1TDNA 3NNEA 2RGHA 1RYIA 4NNJA 3ZYXA 3DGHA 4I58A 1TDFA 3DK9A 2YLSA 2JB1A 2C65A 3GYJA 5IQ4A 3NGCX 1P2HA 3IC9A 2GB0A 3M0OA 2C3DA 3AYJA 4APNA 4BK1A 4B65A 4YTPA 1D4EA 2ZZ0A 2E81A 2C75A 3BNUA 4NEWA 3T14A 3JSKA 3SZ0A 1ZDLA 4H2PA 4NZHA 4Y4NA 2JK6A 3ICSA 4LU6A 4YT0A 2VRMA 1PBDA 4OPUA 3RP8A 1IUXA 3UTGA 2R0CA 4FX9A 5KOWA 3K7TA 3ALLA 2X8HA 2QA2A 3ISHA 2WPCA 4G6HA 5KRQA 3NTAA 1GV4A 3NYFA 4J36A 2JB3A 2V6OA 2X50A 3C4NA 3BNMA 3VRBA 3LG1A 4A65A 1IUVA 4H4WA 4DNAA 3KKJA 3QFBA 1FCDA 4C74A 3AE3A 1FEBA 2V3AA 2GAGB 3R9UA 1FECA 4YTNA 4RSLA 4G73A 2B9YA 3AD9B 3DJEA 1GPEA 1OJAA 5JCMA 5M10A 1QO8A 1FT6A 3REDA 3ICTA 1VDCA 4EIQA 1FT5A 1N1PA 1CF3A 4A5LA 3P4QA 1M1RA 3QFAA 2A8XA 2B7SA 2RGOA 4TM3A 1F6MA 5KWFA 1W4XA 2BK3A 3UCLA 3B3RA 3F8PA 1K4QA 1GETA 3GMCA 4TLZA 2PYXA 3COXA 1YKJA 4GCMA 4CY6A 3L8KA 2GRTA 4BV6A 5HXIA 3UKFA 2AAQA 3CIRA 4TM4A 1B37A 2VVMA 1Y56A 2WQYA 1LV0A 3GD4A 4U2TA 1GTHA 2Q0LA 2GH5A 1S2YA 2WU2A 4OVIA 3SZCA 4JY3A 4WX1A 5FS6A 4XWRA 1SP3A 3HZLA 3B6DA 3SFDA 5HHFA 1X31B 3RP7A 4YTMA 1BGNA 1CC6A 2CVJA 5KXJA 2B7RA 4FK1A 1Z6LA 3RNMA 2YVFA 3M13A 3DK4A 4J57A 3ATRA 1O95A 3AWIA 4ZCCA 2WP6A 3F29A 2EQ8A 4J2WA 3EANA 4UP3A 3UKAA 2YAUA 1NHRA 1CJCA 2E4GA 4P9SA 4ADWA 1EL5A 3WE0A 3M12A 3DGZA 3HYVA 4H4RA 1SEZA 1N4VA 2WP9A 3H4KA 2FJAA 2X99A 2GR0A 5GSNA 2R46A 5JCNA 5JCIA 1S2QA 4H4UA 5U25A 3NTDA 1NG4A 1D4CA 2EQ6A 4OPDA 5BVAA 4H2RA 1E1LA 1E1KA 3QSEA 1FOHA 1NENA 3NIXA 1BGJA 2XLRA 1RSGA 1GALA 2VVLA 1E1NA 3BNGA 4KPRA 3AEDA 4U8KA 1F8WA 3LOVA 4H4YA 4H2QA 4CRTA 1PXAA 1QLBA 2B9WA 4NWZA 2R9ZA 2YLXA 1ZMDA 1H82A 2YG5A 2Z5XA 5IQ1A 3CGDA 2BC0A 1M64A 3OWMA 1L9EA 1LQUA 5BRTA 1YY5A 4C5OA 1NDAA 2AQJA 4E0VA 1KSSA 2BCPA 3C4AA 3SGLA 2ACZA 1KNPA 1TRBA 3GWDA 1PHHA 2C3CA 2JB2A 1UKVG 2WS3A 3Q6JA 3QVRA 4G6GA 3FO3A 4Z26A 1VRQB 3BI4A 2AR8A 2R0GA 3UBRA 2X8GA 4OPCA 3VRAA 4Z25A 2UZZA 2Q0KA 4J56A 5DBJA 1N4UA 1K0LA 2GVCA 1TDKA 2C72A 3O0HA 1ZX9A 1E7PA 4TLXA 5KMPA 1JEHA 4U8LA 3CNTA 3SXIA 1GXFA 1BZLA 1N4WA 4A6NA 4EMWA 5EB5A 4L38A 4G74A 1QDBA 1KDGA 2XYOA 3AEEA 2YG6A 3NG7X 4AP3A 4EM3A 1H7WA 3OC4A 1CJ2A 4PABA 4CNKA 4L3XA 1B5QA 1F8RA 3FMWA 1PN0A 3AYLA 1PJ7A 1CJ3A 1E1MA 2BXSA 4II3A 4OCGA 4Z43A 4B66A 3CNPA 1PXCA 2GQFA 3GDPA 4II2A 3SZFA 2YG7A 3NHOX 4FK1C 3P4SA 4AT2A 2QAEA 1CJ4A 1L9CA 1S3EA 5J60A 2Y6RA 4K22A 4H4SA 4YKGA 1YQZA 3SY4A 2APGA 3T0KA 2R4EA 3CTYA 2XLSA 1ZOVA 4U8JA 4U8OA 2TMDA 4UDQA 3CNSA 1K0IA 5JCKA 2B76A 5FMHA 4GAPA 5U63A 1E39A 2JBVA 1Q1RA 1CBOA 1OJCA 4PAAA 3UTFA 3UTHA 2TPRA 3SCEA 2CZSA 4Z44A 1YQ4A 3CPIG 3AEFA 1COYA 2BK4A 1K0JA 3EF6A 2X3NA 4C3YA 4H2NA 1CC4A 3HYWA 4GUVA 2GMJA 4WCTA 4AT0A 1GRTA 5M0ZA 1VG9A 4O5UA 3EAOA 4H4QA 1NAAA 5LV9A 3UOYA 4B1BA 2YR6A 3P1WA 1FEAA 3AXBA 3IHMA 4CY8A 2J7AA 3GM6A 1GTEA 3CPJG 1H84A 2JKCA 2VQ7A 4AOSA 3LZXA 3V3NA 1DJNA 2WOIA 4X9MA 5C3JA 4H4XA 3T2YA 3AECA 1CL0A 1LTXR 3UKPA 2YLTA 4A79A 2HQMA 2YLZA 3IHGA 4IA6A 1EBDA 1GREA 1OJTA 3MMOA 2GAHB 4MJWA 5U1OA 1JNRA 1B4VA 2A89A 4H50A 3NLCA 1AOGA 1Y0PA 3SM8A 1GSNA 2YR5A 1JNZA 3G5RA 2XFUA 2BS4A 3ZDNA 3URHA 3LJPA 4B63A 3TORA 4Q4UA 1ZK7A 3UOZA 2XFQA 1DOBA 4JY2A 4H4VA 1OJDA 4Q5BA 3PVCA 3NN6X 5GRTA 1MXTA 3LXDA 4FDCB 1VQWA 1XHCA 3T37A 2Z5YA 4TM0A 3VR9A 4U2LA 2WPFA 1EL8A 1ONFA 4EMJA 4NTDA 3VRDB 4YSHA 2YVGA 2VR0A 5BULA 1Q1WA 2WP5A 2JAEA 2GR2A 5EOWA 4C3XA 5CKUA 1LJ1A 1PBBA 1VG0A 5C2TA 1D4DA 1GU6A 3SFEA 4K5SA 3DJJA 4O5QA 4X9NA 1M1PA 4B64A 3P9UA 2OT4A 4CCQA 2YWLA 3KD9A 2BCGG 2BS2A 3AEGA 3FG2P 4H7UA 5J7XA 3AE1A 4EQRA 3UKKA 1M1QA 1H83A 4HA6A 3T2KA 4D04A 5KNLA 4JQ9A 1NHSA 4IA5A 3PS9A 2C70A 2FJEA 2RGJA 2BRYA 4JN9A 2C67A 1S3BA 2BK5A 2ARDA 3RP6A 3FPZA 5JCLA 2XVFA 1TYPA 1TYTA 1LVLA 3CGEA 5FS7A 3BNFA 1PBCA 3KU9A 2V5ZA 3GYIA 3CGCA 4Z2TA 4IVMB 4A6NB 4A9WA 1YQ3A 3BHKA 2J3NA 2B9XA 4B67A 3CNDA 4ZN0A 4REKA 3E1TA 4EM4A 2VQBA 4EQSA 4IVOB 4L3ZA 4GRTA 4Y4LA 5FS8A 4C77A 2V61A 2WHDA 3BI5A 3NT6A 4BJZA 3UP4A 4XXGA 1JU2A 3NKSA 1H86A 4Z2RA 4U8IA 2YG3A 2WDQA 3S7WA 3VQRA 1JOAA 1E6EA 2XFOA 3S61A 4A7AA 3G5QA 3SXQA 1Q9IA 1KSUA 3L1TA 2YR4A 3ITJA 5IPYA 3KA7A 3GDNA 3BI2A 1FS7A 3T31A 5TR3A 1DNCA 2Q7VA 4GAVA 5HY5A 2C7GA 2YVJA 1ZP0A 4LA1A 1IJHA 3DH9A 2R45A 3K30A 2XVHA 1MO9A 2VZ2A 3RHAA 2C66A 3NK1X 1ZMCA 2YLRA 4GR1A 2O9ZA 4ECHA 3GWFA 4BK3A 2XVIA 1BKWA 5BUKA 4JNQA 2XCGA 4BURA 3TTBA 1FL2A 2XLTA 4UDPA 5CQFA 1Y56B 4GF7A 4DGKA 4YSXA 5KMSA 5KVHA 3AE7A 2XVJA 3GYXA 4H4TA 1PS9A 3D8XA 2CFYA 1ELIA 3RKHA 4ICYA 3V3OA 4GDEA 2WDVA 3LADA 4JNAA 1O94A 2BABA 2XVEA 3C96A 5FS9A 4J34A 4LIIA 2GV8A 2XDOA 3AE8A 2Q6UA 2H88A 3AE4A 4OPGA 4TM1A 3GD3A 3GSIA 1O5WA 1ZKQA 2E5VA 3SYIA 3IWAA 2WETA 1ZY8A 3BNHA 2GEWA 1L0VA 4I59A 1DOCA 1JRXA 2BS3A 1JRZA 2K3VA 3NK2X 2OALA 5L46A 1GRBA 4RG4A 3AEBA 3LGQA 1OAHA 2NPXA 3UKLA 1JRYA 1GESA 2BA9A 4H4PA 4A99A 1FS8A 4J33A 2CULA 3F8DA 4YSZA 3DJGX 2RF7A 1GRGA 1H7XA 1D5TA 3I3LA 3ATQA 3P4PA 3EPTA 1NHQA 1FS9A 2XFPA 4OPLA 4UDRA 3CGBA 4EQWA 4NEVA 4NTEA 4YSYA 2XFNA 1F3PA 1L9DA 1NPXA 3P4RA 1D7LA 4EQXA 3DJDA 4AP1A 5KOXA 3UKHA 1GRAA 1REOA 2BRAA 3K7QX 3FBSA 4BK2A 4EMIA 3Q9TA 4DSHA 3FIMB 4Z24A 2GMHA 2X8CA 1OJ9A 3NH3X 4USRA 5ER0A 3ALMA 4K7ZA 3VR8A 3NRNA 1M6IA 1RP0A 2EQ7A 3QVPA 3HYXA 2OLOA 3T2ZA 3AE9A 1DXLA 2OA1A 3GRTA 3GRSA 4Q0TA 2GF3A 2WEUA 2FJDA 3QSSA 2BACA 4U8MA 1LQTA 4AOXA 3KPFA 2GR3A 4XWZA 5EB4A 4BJYA 1BWCA 2YM2A 1JNIA 2EQ9A 5EBKA 1BF3A 4K2XA 5KVIA 2XLUA 3ABVA 4OPIA 1HYUA 4J31A
chains in the Genus database with same CATH topology
4Q1OA 3ALJA 2BYBA 1DJQA 4B69A 2NVKX 1KFYA 1BVBA 3BHFA 3LZWA 4WJYA 3D1CA 3QSMA 4IV9A 4U8NA 2PHHA 3QJ4A 2GQWA 2R0PA 2YG4A 2YLWA 4B68A 5KMRA 2IIDA 4H4ZA 3AB1A 3AEAA 4EIPA 3AD7B 3F8RA 3OZ2A 2WU5A 3D1IA 1NHPA 1PBFA 4JDRA 4M52A 1MOKA 3CNJA 3SZWA 1TDOA 4K5RA 1H81A 1GNDA 4KX6A 2R4JA 3CPHG 2E80A 3V76A 2WDRA 3NK0X 3UKQA 3I6DA 1GRHA 2WBAA 1IUTA 3G5SA 4K8DA 4YKFA 4RG3A 1XDIA 1CC2A 1PJ6A 2DKIA 2VRLA 1KNRA 2RABA 3AYIA 1EL7A 1PDHA 3KPKA 4G9KA 2CDUA 1PBEA 2FBWA 4X4JA 3H8IA 1NG3A 4CNJA 2ZZCA 1B8SA 3SX6A 5HYMA 2C76A 2GR1A 3ICRA 2ZO5A 2C64A 1CHUA 1GEUA 3ADAB 3KVEA 2E1MA 4ZCDA 2YM1A 3H8LA 3SQPA 2LFCA 2ZBWA 2BC1A 3CN8A 2C73A 2XLPA 3UOXA 3DK8A 1GOSA 4OPTA 1GERA 1P2EA 3II4A 1KF6A 3PO7A 1NEKA 1F8SA 1QJDA 2V60A 1ZOYA 3CMMA 4USQA 3NYCA 2VVLG 3AE6A 4CCRA 1V59A 1XPQA 3AE5A 2QA1A 1PJ5A 4Q5CA 2H89A 2WESA 4YWOA 3DMEA 3NN0X 2YQUA 4N9XA 1IUWA 1TDEA 4U2SA 3KLJA 2QCUA 4HB9A 4Q17A 1LPFA 2WOVA 3IF9A 4CBQA 3UP5A 3DA1A 1DODA 2IVDA 4NTCA 1D7YA 2Y6QA 3AE2A 4GDPA 1GRFA 1H6VA 2BXRA 2W0HA 3S5WA 1GT8A 3NYEA 2VOUA 2WPEA 3UTEA 2A87A 4D03A 1IUUA 2I0ZA 2WOWA 2V3BA 4Z2UA 2DKHA 3UOVA 4YXDA 4L3YA 1DOEA 2IVEA 3UU9A 3L1RA 4Y4MA 1IUSA 3AD8B 2F5ZA 4DSGA 3K7MX 2OLNA 1EL9A 1XANA 3BNJA 1PXBA 2C4CA 2RDZA 2FJBA 3GMBA 4U8PA 2OAMA 2ZZBA 3LB8A 5KMQA 1TDNA 3NNEA 2RGHA 1RYIA 4NNJA 3ZYXA 3DGHA 4I58A 1TDFA 3DK9A 2YLSA 2JB1A 2C65A 3GYJA 5IQ4A 3NGCX 1P2HA 3IC9A 2GB0A 3M0OA 2C3DA 3AYJA 4APNA 4BK1A 4B65A 4YTPA 1D4EA 2ZZ0A 2E81A 2C75A 3BNUA 4NEWA 3T14A 3JSKA 3SZ0A 1ZDLA 4H2PA 4NZHA 4Y4NA 2JK6A 3ICSA 4LU6A 4YT0A 2VRMA 1PBDA 4OPUA 3RP8A 1IUXA 3UTGA 2R0CA 4FX9A 5KOWA 3K7TA 3ALLA 2X8HA 2QA2A 3ISHA 2WPCA 4G6HA 5KRQA 3NTAA 1GV4A 3NYFA 4J36A 2JB3A 2V6OA 2X50A 3C4NA 3BNMA 3VRBA 3LG1A 4A65A 1IUVA 4H4WA 4DNAA 3KKJA 3QFBA 1FCDA 4C74A 3AE3A 1FEBA 2V3AA 2GAGB 3R9UA 1FECA 4YTNA 4RSLA 4G73A 2B9YA 3AD9B 3DJEA 1GPEA 1OJAA 5JCMA 5M10A 1QO8A 1FT6A 3REDA 3ICTA 1VDCA 4EIQA 1FT5A 1N1PA 1CF3A 4A5LA 3P4QA 1M1RA 3QFAA 2A8XA 2B7SA 2RGOA 4TM3A 1F6MA 5KWFA 1W4XA 2BK3A 3UCLA 3B3RA 3F8PA 1K4QA 1GETA 3GMCA 4TLZA 2PYXA 3COXA 1YKJA 4GCMA 4CY6A 3L8KA 2GRTA 4BV6A 5HXIA 3UKFA 2AAQA 3CIRA 4TM4A 1B37A 2VVMA 1Y56A 2WQYA 1LV0A 3GD4A 4U2TA 1GTHA 2Q0LA 2GH5A 1S2YA 2WU2A 4OVIA 3SZCA 4JY3A 4WX1A 5FS6A 4XWRA 1SP3A 3HZLA 3B6DA 3SFDA 5HHFA 1X31B 3RP7A 4YTMA 1BGNA 1CC6A 2CVJA 5KXJA 2B7RA 4FK1A 1Z6LA 3RNMA 2YVFA 3M13A 3DK4A 4J57A 3ATRA 1O95A 3AWIA 4ZCCA 2WP6A 3F29A 2EQ8A 4J2WA 3EANA 4UP3A 3UKAA 2YAUA 1NHRA 1CJCA 2E4GA 4P9SA 4ADWA 1EL5A 3WE0A 3M12A 3DGZA 3HYVA 4H4RA 1SEZA 1N4VA 2WP9A 3H4KA 2FJAA 2X99A 2GR0A 5GSNA 2R46A 5JCNA 5JCIA 1S2QA 4H4UA 5U25A 3NTDA 1NG4A 1D4CA 2EQ6A 4OPDA 5BVAA 4H2RA 1E1LA 1E1KA 3QSEA 1FOHA 1NENA 3NIXA 1BGJA 2XLRA 1RSGA 1GALA 2VVLA 1E1NA 3BNGA 4KPRA 3AEDA 4U8KA 1F8WA 3LOVA 4H4YA 4H2QA 4CRTA 1PXAA 1QLBA 2B9WA 4NWZA 2R9ZA 2YLXA 1ZMDA 1H82A 2YG5A 2Z5XA 5IQ1A 3CGDA 2BC0A 1M64A 3OWMA 1L9EA 1LQUA 5BRTA 1YY5A 4C5OA 1NDAA 2AQJA 4E0VA 1KSSA 2BCPA 3C4AA 3SGLA 2ACZA 1KNPA 1TRBA 3GWDA 1PHHA 2C3CA 2JB2A 1UKVG 2WS3A 3Q6JA 3QVRA 4G6GA 3FO3A 4Z26A 1VRQB 3BI4A 2AR8A 2R0GA 3UBRA 2X8GA 4OPCA 3VRAA 4Z25A 2UZZA 2Q0KA 4J56A 5DBJA 1N4UA 1K0LA 2GVCA 1TDKA 2C72A 3O0HA 1ZX9A 1E7PA 4TLXA 5KMPA 1JEHA 4U8LA 3CNTA 3SXIA 1GXFA 1BZLA 1N4WA 4A6NA 4EMWA 5EB5A 4L38A 4G74A 1QDBA 1KDGA 2XYOA 3AEEA 2YG6A 3NG7X 4AP3A 4EM3A 1H7WA 3OC4A 1CJ2A 4PABA 4CNKA 4L3XA 1B5QA 1F8RA 3FMWA 1PN0A 3AYLA 1PJ7A 1CJ3A 1E1MA 2BXSA 4II3A 4OCGA 4Z43A 4B66A 3CNPA 1PXCA 2GQFA 3GDPA 4II2A 3SZFA 2YG7A 3NHOX 4FK1C 3P4SA 4AT2A 2QAEA 1CJ4A 1L9CA 1S3EA 5J60A 2Y6RA 4K22A 4H4SA 4YKGA 1YQZA 3SY4A 2APGA 3T0KA 2R4EA 3CTYA 2XLSA 1ZOVA 4U8JA 4U8OA 2TMDA 4UDQA 3CNSA 1K0IA 5JCKA 2B76A 5FMHA 4GAPA 5U63A 1E39A 2JBVA 1Q1RA 1CBOA 1OJCA 4PAAA 3UTFA 3UTHA 2TPRA 3SCEA 4Z44A 1YQ4A 3CPIG 3AEFA 1COYA 2BK4A 1K0JA 3EF6A 2X3NA 4C3YA 4H2NA 1CC4A 3HYWA 4GUVA 2GMJA 4WCTA 4AT0A 1GRTA 5M0ZA 1VG9A 4O5UA 3EAOA 4H4QA 1NAAA 5LV9A 3UOYA 4B1BA 2YR6A 3P1WA 1FEAA 3AXBA 3IHMA 4CY8A 2J7AA 3GM6A 1GTEA 3CPJG 1H84A 2JKCA 2VQ7A 4AOSA 3LZXA 3V3NA 1DJNA 2WOIA 4X9MA 5C3JA 4H4XA 3T2YA 3AECA 1CL0A 1LTXR 3UKPA 2YLTA 4A79A 2HQMA 2YLZA 3IHGA 4IA6A 1EBDA 1GREA 1OJTA 3MMOA 2GAHB 4MJWA 5U1OA 1JNRA 1B4VA 2A89A 4H50A 3NLCA 1AOGA 1Y0PA 3SM8A 1GSNA 2YR5A 1JNZA 3G5RA 2XFUA 2BS4A 3ZDNA 3URHA 3LJPA 4B63A 3TORA 4Q4UA 1ZK7A 3UOZA 2XFQA 1DOBA 4JY2A 4H4VA 1OJDA 4Q5BA 3PVCA 3NN6X 5GRTA 1MXTA 3LXDA 4FDCB 1VQWA 1XHCA 3T37A 2Z5YA 4TM0A 3VR9A 4U2LA 2WPFA 1EL8A 1ONFA 4EMJA 4NTDA 3VRDB 4YSHA 2YVGA 2VR0A 5BULA 1Q1WA 2WP5A 2JAEA 2GR2A 5EOWA 4C3XA 5CKUA 1LJ1A 1PBBA 1VG0A 5C2TA 1D4DA 1GU6A 3SFEA 4K5SA 3DJJA 4O5QA 4X9NA 1M1PA 4B64A 3P9UA 2OT4A 4CCQA 2YWLA 3KD9A 2BCGG 2BS2A 3AEGA 3FG2P 4H7UA 5J7XA 3AE1A 4EQRA 3UKKA 1M1QA 1H83A 4HA6A 3T2KA 4D04A 5KNLA 4JQ9A 1NHSA 4IA5A 3PS9A 2C70A 2FJEA 2RGJA 2BRYA 4JN9A 2C67A 1S3BA 2BK5A 2ARDA 3RP6A 3FPZA 5JCLA 2XVFA 1TYPA 1TYTA 1LVLA 3CGEA 5FS7A 3BNFA 1PBCA 3KU9A 2V5ZA 3GYIA 3CGCA 4Z2TA 4IVMB 4A6NB 4A9WA 1YQ3A 3BHKA 2J3NA 2B9XA 4B67A 3CNDA 4ZN0A 4REKA 3E1TA 4EM4A 2VQBA 4EQSA 4IVOB 4L3ZA 4GRTA 4Y4LA 5FS8A 4C77A 2V61A 2WHDA 3BI5A 3NT6A 4BJZA 3UP4A 4XXGA 1JU2A 3NKSA 1H86A 4Z2RA 4U8IA 2YG3A 2WDQA 3S7WA 3VQRA 1JOAA 1E6EA 2XFOA 3S61A 4A7AA 3G5QA 3SXQA 1Q9IA 1KSUA 3L1TA 2YR4A 3ITJA 5IPYA 3KA7A 3GDNA 3BI2A 1FS7A 3T31A 5TR3A 1DNCA 2Q7VA 4GAVA 5HY5A 2C7GA 2YVJA 1ZP0A 4LA1A 1IJHA 3DH9A 2R45A 3K30A 2XVHA 1MO9A 2VZ2A 3RHAA 2C66A 3NK1X 1ZMCA 2YLRA 4GR1A 2O9ZA 4ECHA 3GWFA 4BK3A 2XVIA 1BKWA 5BUKA 4JNQA 2XCGA 4BURA 3TTBA 1FL2A 2XLTA 4UDPA 5CQFA 1Y56B 4GF7A 4DGKA 4YSXA 5KMSA 5KVHA 3AE7A 2XVJA 3GYXA 4H4TA 1PS9A 3D8XA 2CFYA 1ELIA 3RKHA 4ICYA 3V3OA 4GDEA 2WDVA 3LADA 4JNAA 1O94A 2BABA 2XVEA 3C96A 5FS9A 4J34A 4LIIA 2GV8A 2XDOA 3AE8A 2Q6UA 2H88A 3AE4A 4OPGA 4TM1A 3GD3A 3GSIA 1O5WA 1ZKQA 2E5VA 3SYIA 3IWAA 2WETA 1ZY8A 3BNHA 2GEWA 1L0VA 4I59A 1DOCA 1JRXA 2BS3A 1JRZA 2K3VA 3NK2X 2OALA 5L46A 1GRBA 4RG4A 3AEBA 3LGQA 1OAHA 2NPXA 3UKLA 1JRYA 1GESA 2BA9A 4H4PA 4A99A 1FS8A 4J33A 2CULA 3F8DA 4YSZA 3DJGX 2RF7A 1GRGA 1H7XA 1D5TA 3I3LA 3ATQA 3P4PA 3EPTA 1NHQA 1FS9A 2XFPA 4OPLA 4UDRA 3CGBA 4EQWA 4NEVA 4NTEA 4YSYA 2XFNA 1F3PA 1L9DA 1NPXA 3P4RA 1D7LA 4EQXA 3DJDA 4AP1A 5KOXA 3UKHA 1GRAA 1REOA 2BRAA 3K7QX 3FBSA 4BK2A 4EMIA 3Q9TA 4DSHA 3FIMB 4Z24A 2GMHA 2X8CA 1OJ9A 3NH3X 4USRA 5ER0A 3ALMA 4K7ZA 3VR8A 3NRNA 1M6IA 1RP0A 2EQ7A 3QVPA 3HYXA 2OLOA 3T2ZA 3AE9A 1DXLA 2OA1A 3GRTA 3GRSA 4Q0TA 2GF3A 2WEUA 2FJDA 3QSSA 2BACA 4U8MA 1LQTA 4AOXA 3KPFA 2GR3A 4XWZA 5EB4A 4BJYA 1BWCA 2YM2A 1JNIA 2EQ9A 5EBKA 1BF3A 4K2XA 5KVIA 2XLUA 3ABVA 4OPIA 1HYUA 4J31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q1O A;  3ALJ A;  2BYB A;  1DJQ A;  4B69 A;  2NVK X;  1KFY A;  1BVB A;  3BHF A;  3LZW A;  4WJY A;  3D1C A;  3QSM A;  4IV9 A;  4U8N A;  2PHH A;  3QJ4 A;  2GQW A;  2R0P A;  2YG4 A;  2YLW A;  4B68 A;  2IID A;  4H4Z A;  3AB1 A;  3AEA A;  4EIP A;  3AD7 B;  3F8R A;  3OZ2 A;  2WU5 A;  3D1I A;  1NHP A;  1PBF A;  4JDR A;  4M52 A;  1MOK A;  3CNJ A;  1TDO A;  4K5R A;  1H81 A;  1GND A;  4KX6 A;  2R4J A;  3CPH G;  2E80 A;  3V76 A;  2WDR A;  3NK0 X;  3UKQ A;  3I6D A;  1GRH A;  2WBA A;  1IUT A;  3G5S A;  4K8D A;  4YKF A;  4RG3 A;  1XDI A;  1CC2 A;  1PJ6 A;  2DKI A;  2VRL A;  1KNR A;  2RAB A;  3AYI A;  1EL7 A;  1PDH A;  4X4J A;  2CDU A;  1PBE A;  2FBW A;  3H8I A;  1NG3 A;  4CNJ A;  2ZZC A;  1B8S A;  5HYM A;  2C76 A;  2GR1 A;  3ICR A;  2ZO5 A;  2C64 A;  1CHU A;  1GEU A;  3ADA B;  3KVE A;  2E1M A;  4ZCD A;  2YM1 A;  3H8L A;  3SQP A;  2LFC A;  2ZBW A;  2BC1 A;  3CN8 A;  2C73 A;  2XLP A;  3UOX A;  3DK8 A;  1GOS A;  4OPT A;  1GER A;  1P2E A;  3II4 A;  1KF6 A;  3PO7 A;  1NEK A;  1F8S A;  1QJD A;  2V60 A;  1ZOY A;  4USQ A;  4CCR A;  3NYC A;  2VVL G;  3AE6 A;  1V59 A;  1XPQ A;  3AE5 A;  2QA1 A;  1PJ5 A;  4Q5C A;  2H89 A;  2WES A;  4YWO A;  3DME A;  3NN0 X;  2YQU A;  4N9X A;  1IUW A;  1TDE A;  4U2S A;  3KLJ A;  2QCU A;  4HB9 A;  4Q17 A;  1LPF A;  2WOV A;  3IF9 A;  4CBQ A;  3UP5 A;  3DA1 A;  1DOD A;  2IVD A;  4NTC A;  1D7Y A;  2Y6Q A;  3AE2 A;  4GDP A;  1GRF A;  1H6V A;  2BXR A;  2W0H A;  3S5W A;  1GT8 A;  3NYE A;  2VOU A;  2WPE A;  3UTE A;  2A87 A;  4D03 A;  1IUU A;  2I0Z A;  2WOW A;  2V3B A;  4Z2U A;  2DKH A;  3UOV A;  4YXD A;  4L3Y A;  1DOE A;  2IVE A;  3UU9 A;  3L1R A;  4Y4M A;  1IUS A;  3AD8 B;  2F5Z A;  4DSG A;  3K7M X;  2OLN A;  1EL9 A;  1XAN A;  3BNJ A;  1PXB A;  2FJB A;  2RDZ A;  3GMB A;  4U8P A;  2OAM A;  2ZZB A;  3LB8 A;  1TDN A;  3NNE A;  2RGH A;  1RYI A;  3ZYX A;  3DGH A;  4I58 A;  1TDF A;  3DK9 A;  2YLS A;  2JB1 A;  2C65 A;  3GYJ A;  5IQ4 A;  3NGC X;  1P2H A;  3IC9 A;  2GB0 A;  3M0O A;  2C3D A;  3AYJ A;  4APN A;  4BK1 A;  4B65 A;  4YTP A;  1D4E A;  2ZZ0 A;  2E81 A;  2C75 A;  3BNU A;  4NEW A;  3JSK A;  1ZDL A;  4H2P A;  4NZH A;  4Y4N A;  2JK6 A;  3ICS A;  4LU6 A;  4YT0 A;  2VRM A;  1PBD A;  4OPU A;  3RP8 A;  1IUX A;  3UTG A;  2R0C A;  4FX9 A;  5KOW A;  3K7T A;  3ALL A;  2X8H A;  2QA2 A;  3ISH A;  2WPC A;  5KRQ A;  3NTA A;  1GV4 A;  3NYF A;  4J36 A;  2JB3 A;  2V6O A;  2X50 A;  3C4N A;  3BNM A;  3VRB A;  3LG1 A;  4A65 A;  1IUV A;  4H4W A;  4DNA A;  3KKJ A;  3QFB A;  1FCD A;  4C74 A;  3AE3 A;  1FEB A;  2V3A A;  2GAG B;  3R9U A;  1FEC A;  4YTN A;  4RSL A;  2B9Y A;  3AD9 B;  3DJE A;  1GPE A;  1OJA A;  5JCM A;  5M10 A;  1QO8 A;  1FT6 A;  3RED A;  3ICT A;  1VDC A;  4EIQ A;  1FT5 A;  1N1P A;  1CF3 A;  4A5L A;  3P4Q A;  1M1R A;  3QFA A;  2A8X A;  2B7S A;  2RGO A;  4TM3 A;  1F6M A;  5KWF A;  1W4X A;  2BK3 A;  3UCL A;  3B3R A;  3F8P A;  1K4Q A;  1GET A;  3GMC A;  4TLZ A;  2PYX A;  3COX A;  1YKJ A;  4GCM A;  4CY6 A;  3L8K A;  2GRT A;  4BV6 A;  5HXI A;  3UKF A;  2AAQ A;  3CIR A;  4TM4 A;  1B37 A;  2VVM A;  1Y56 A;  2WQY A;  1LV0 A;  3GD4 A;  4U2T A;  1GTH A;  2Q0L A;  2GH5 A;  1S2Y A;  2WU2 A;  4OVI A;  4JY3 A;  4WX1 A;  5FS6 A;  4XWR A;  1SP3 A;  3HZL A;  3B6D A;  3SFD A;  5HHF A;  1X31 B;  3RP7 A;  4YTM A;  1BGN A;  1CC6 A;  2CVJ A;  5KXJ A;  2B7R A;  4FK1 A;  1Z6L A;  3RNM A;  2YVF A;  3M13 A;  3DK4 A;  4J57 A;  3ATR A;  1O95 A;  3AWI A;  4ZCC A;  2WP6 A;  3F29 A;  2EQ8 A;  4J2W A;  3EAN A;  4UP3 A;  3UKA A;  2YAU A;  1NHR A;  1CJC A;  2E4G A;  4P9S A;  4ADW A;  1EL5 A;  3WE0 A;  3M12 A;  3DGZ A;  4H4R A;  1SEZ A;  1N4V A;  2WP9 A;  3H4K A;  2FJA A;  2X99 A;  2GR0 A;  5GSN A;  2R46 A;  5JCN A;  5JCI A;  1S2Q A;  4H4U A;  5U25 A;  3NTD A;  1NG4 A;  1D4C A;  2EQ6 A;  4OPD A;  5BVA A;  4H2R A;  1E1L A;  1E1K A;  3QSE A;  1FOH A;  1NEN A;  3NIX A;  1BGJ A;  2XLR A;  1RSG A;  1GAL A;  2VVL A;  1E1N A;  3BNG A;  4KPR A;  3AED A;  4U8K A;  1F8W A;  3LOV A;  4H4Y A;  4H2Q A;  4CRT A;  1PXA A;  1QLB A;  2B9W A;  2R9Z A;  2YLX A;  1ZMD A;  1H82 A;  2YG5 A;  2Z5X A;  5IQ1 A;  3CGD A;  2BC0 A;  1M64 A;  3OWM A;  1L9E A;  1LQU A;  5BRT A;  1YY5 A;  4C5O A;  1NDA A;  2AQJ A;  4E0V A;  1KSS A;  2BCP A;  3C4A A;  3SGL A;  2ACZ A;  1KNP A;  1TRB A;  3GWD A;  1PHH A;  2C3C A;  2JB2 A;  1UKV G;  2WS3 A;  3Q6J A;  3QVR A;  4Z26 A;  3FO3 A;  1VRQ B;  3BI4 A;  2AR8 A;  2R0G A;  3UBR A;  2X8G A;  4OPC A;  3VRA A;  4Z25 A;  2UZZ A;  2Q0K A;  4J56 A;  5DBJ A;  1N4U A;  1K0L A;  2GVC A;  1TDK A;  2C72 A;  3O0H A;  1ZX9 A;  1E7P A;  4TLX A;  1JEH A;  4U8L A;  3CNT A;  1GXF A;  1BZL A;  1N4W A;  4A6N A;  4EMW A;  5EB5 A;  4L38 A;  1QDB A;  1KDG A;  2XYO A;  3AEE A;  2YG6 A;  3NG7 X;  4AP3 A;  4EM3 A;  1H7W A;  3OC4 A;  1CJ2 A;  4PAB A;  4CNK A;  4L3X A;  1B5Q A;  1F8R A;  3FMW A;  1PN0 A;  3AYL A;  1PJ7 A;  1CJ3 A;  1E1M A;  2BXS A;  4OCG A;  4Z43 A;  4B66 A;  3CNP A;  1PXC A;  2GQF A;  3GDP A;  2YG7 A;  3NHO X;  4FK1 C;  3P4S A;  4AT2 A;  2QAE A;  1CJ4 A;  1L9C A;  1S3E A;  5J60 A;  2Y6R A;  4K22 A;  4H4S A;  4YKG A;  1YQZ A;  2APG A;  2R4E A;  3CTY A;  2XLS A;  1ZOV A;  4U8J A;  4U8O A;  2TMD A;  4UDQ A;  3CNS A;  1K0I A;  5JCK A;  2B76 A;  5FMH A;  5U63 A;  1E39 A;  2JBV A;  1Q1R A;  1CBO A;  1OJC A;  4PAA A;  3UTF A;  3UTH A;  2TPR A;  3SCE A;  4Z44 A;  1YQ4 A;  3CPI G;  3AEF A;  1COY A;  2BK4 A;  1K0J A;  3EF6 A;  2X3N A;  4C3Y A;  4H2N A;  1CC4 A;  4GUV A;  4WCT A;  2GMJ A;  4AT0 A;  1GRT A;  5M0Z A;  1VG9 A;  4O5U A;  3EAO A;  4H4Q A;  1NAA A;  5LV9 A;  3UOY A;  4B1B A;  2YR6 A;  3P1W A;  1FEA A;  3AXB A;  3IHM A;  4CY8 A;  2J7A A;  3GM6 A;  1GTE A;  3CPJ G;  1H84 A;  2JKC A;  2VQ7 A;  4AOS A;  3LZX A;  3V3N A;  1DJN A;  2WOI A;  4X9M A;  5C3J A;  4H4X A;  3AEC A;  1CL0 A;  1LTX R;  3UKP A;  2YLT A;  4A79 A;  2HQM A;  2YLZ A;  3IHG A;  4IA6 A;  1EBD A;  1GRE A;  1OJT A;  3MMO A;  2GAH B;  4MJW A;  5U1O A;  1JNR A;  1B4V A;  2A89 A;  4H50 A;  3NLC A;  1AOG A;  1Y0P A;  3SM8 A;  1GSN A;  2YR5 A;  1JNZ A;  3G5R A;  2XFU A;  2BS4 A;  3ZDN A;  3URH A;  3LJP A;  4B63 A;  3TOR A;  4Q4U A;  1ZK7 A;  3UOZ A;  2XFQ A;  1DOB A;  4JY2 A;  4H4V A;  1OJD A;  4Q5B A;  3PVC A;  3NN6 X;  5GRT A;  1MXT A;  3LXD A;  4FDC B;  1VQW A;  1XHC A;  3T37 A;  2Z5Y A;  4TM0 A;  3VR9 A;  4U2L A;  2WPF A;  1EL8 A;  1ONF A;  4EMJ A;  4NTD A;  3VRD B;  4YSH A;  2YVG A;  2VR0 A;  5BUL A;  1Q1W A;  2WP5 A;  2JAE A;  2GR2 A;  5EOW A;  4C3X A;  5CKU A;  1LJ1 A;  1PBB A;  1VG0 A;  5C2T A;  1D4D A;  1GU6 A;  3SFE A;  4K5S A;  3DJJ A;  4O5Q A;  4X9N A;  1M1P A;  4B64 A;  3P9U A;  2OT4 A;  4CCQ A;  2YWL A;  3KD9 A;  2BCG G;  2BS2 A;  3AEG A;  3FG2 P;  4H7U A;  5J7X A;  3AE1 A;  4EQR A;  3UKK A;  1M1Q A;  1H83 A;  4HA6 A;  4D04 A;  4JQ9 A;  1NHS A;  4IA5 A;  3PS9 A;  2C70 A;  2FJE A;  2RGJ A;  4JN9 A;  2C67 A;  1S3B A;  2BK5 A;  2ARD A;  3RP6 A;  3FPZ A;  5JCL A;  2XVF A;  1TYP A;  1TYT A;  1LVL A;  3CGE A;  5FS7 A;  3BNF A;  1PBC A;  3KU9 A;  2V5Z A;  3GYI A;  3CGC A;  4Z2T A;  4IVM B;  4A6N B;  4A9W A;  1YQ3 A;  3BHK A;  2J3N A;  2B9X A;  4B67 A;  3CND A;  4ZN0 A;  4REK A;  3E1T A;  4EM4 A;  2VQB A;  4EQS A;  4IVO B;  4L3Z A;  4GRT A;  4Y4L A;  5FS8 A;  4C77 A;  2V61 A;  2WHD A;  3BI5 A;  3NT6 A;  4BJZ A;  3UP4 A;  4XXG A;  1JU2 A;  3NKS A;  1H86 A;  4Z2R A;  4U8I A;  2YG3 A;  2WDQ A;  3S7W A;  3VQR A;  1JOA A;  1E6E A;  2XFO A;  3S61 A;  4A7A A;  3G5Q A;  3SXQ A;  1Q9I A;  1KSU A;  3L1T A;  2YR4 A;  3ITJ A;  5IPY A;  3KA7 A;  3GDN A;  3BI2 A;  1FS7 A;  5TR3 A;  1DNC A;  2Q7V A;  5HY5 A;  2C7G A;  2YVJ A;  1ZP0 A;  4LA1 A;  1IJH A;  3DH9 A;  2R45 A;  3K30 A;  2XVH A;  1MO9 A;  2VZ2 A;  3RHA A;  2C66 A;  3NK1 X;  1ZMC A;  2YLR A;  4GR1 A;  2O9Z A;  4ECH A;  3GWF A;  4BK3 A;  2XVI A;  1BKW A;  5BUK A;  4JNQ A;  2XCG A;  4BUR A;  3TTB A;  1FL2 A;  2XLT A;  4UDP A;  5CQF A;  1Y56 B;  4GF7 A;  4DGK A;  4YSX A;  5KVH A;  3AE7 A;  2XVJ A;  4H4T A;  3GYX A;  1PS9 A;  3D8X A;  2CFY A;  1ELI A;  3RKH A;  4ICY A;  3V3O A;  4GDE A;  2WDV A;  3LAD A;  4JNA A;  1O94 A;  2BAB A;  2XVE A;  3C96 A;  5FS9 A;  4J34 A;  4LII A;  2GV8 A;  2XDO A;  3AE8 A;  2Q6U A;  2H88 A;  3AE4 A;  4OPG A;  4TM1 A;  3GD3 A;  3GSI A;  1O5W A;  1ZKQ A;  2E5V A;  3IWA A;  2WET A;  1ZY8 A;  3BNH A;  2GEW A;  1L0V A;  4I59 A;  1DOC A;  1JRX A;  2BS3 A;  1JRZ A;  2K3V A;  3NK2 X;  2OAL A;  5L46 A;  1GRB A;  4RG4 A;  3AEB A;  3LGQ A;  1OAH A;  2NPX A;  3UKL A;  1JRY A;  1GES A;  2BA9 A;  4H4P A;  4A99 A;  1FS8 A;  4J33 A;  2CUL A;  3F8D A;  4YSZ A;  3DJG X;  2RF7 A;  1GRG A;  1H7X A;  1D5T A;  3I3L A;  3ATQ A;  3P4P A;  3EPT A;  1NHQ A;  1FS9 A;  2XFP A;  4OPL A;  4UDR A;  3CGB A;  4EQW A;  4NEV A;  4NTE A;  4YSY A;  2XFN A;  1F3P A;  1L9D A;  1NPX A;  3P4R A;  1D7L A;  4EQX A;  3DJD A;  4AP1 A;  5KOX A;  3UKH A;  1GRA A;  1REO A;  3K7Q X;  3FBS A;  4BK2 A;  4EMI A;  3Q9T A;  4DSH A;  3FIM B;  4Z24 A;  2GMH A;  2X8C A;  1OJ9 A;  3NH3 X;  4USR A;  5ER0 A;  3ALM A;  4K7Z A;  3VR8 A;  3NRN A;  1M6I A;  1RP0 A;  2EQ7 A;  3QVP A;  2OLO A;  3AE9 A;  1DXL A;  2OA1 A;  3GRT A;  3GRS A;  4Q0T A;  2GF3 A;  2WEU A;  2FJD A;  3QSS A;  2BAC A;  4U8M A;  1LQT A;  4AOX A;  3KPF A;  2GR3 A;  4XWZ A;  5EB4 A;  4BJY A;  1BWC A;  2YM2 A;  1JNI A;  2EQ9 A;  5EBK A;  1BF3 A;  4K2X A;  5KVI A;  2XLU A;  3ABV A;  4OPI A;  1HYU A;  4J31 A; 
#chains in the Genus database with same CATH topology
 4Q1O A;  3ALJ A;  2BYB A;  1DJQ A;  4B69 A;  2NVK X;  1KFY A;  1BVB A;  3BHF A;  3LZW A;  4WJY A;  3D1C A;  3QSM A;  4IV9 A;  4U8N A;  2PHH A;  3QJ4 A;  2GQW A;  2R0P A;  2YG4 A;  2YLW A;  4B68 A;  5KMR A;  2IID A;  4H4Z A;  3AB1 A;  3AEA A;  4EIP A;  3AD7 B;  3F8R A;  3OZ2 A;  2WU5 A;  3D1I A;  1NHP A;  1PBF A;  4JDR A;  4M52 A;  1MOK A;  3CNJ A;  3SZW A;  1TDO A;  4K5R A;  1H81 A;  1GND A;  4KX6 A;  2R4J A;  3CPH G;  2E80 A;  3V76 A;  2WDR A;  3NK0 X;  3UKQ A;  3I6D A;  1GRH A;  2WBA A;  1IUT A;  3G5S A;  4K8D A;  4YKF A;  4RG3 A;  1XDI A;  1CC2 A;  1PJ6 A;  2DKI A;  2VRL A;  1KNR A;  2RAB A;  3AYI A;  1EL7 A;  1PDH A;  3KPK A;  4G9K A;  2CDU A;  1PBE A;  2FBW A;  4X4J A;  3H8I A;  1NG3 A;  4CNJ A;  2ZZC A;  1B8S A;  3SX6 A;  5HYM A;  2C76 A;  2GR1 A;  3ICR A;  2ZO5 A;  2C64 A;  1CHU A;  1GEU A;  3ADA B;  3KVE A;  2E1M A;  4ZCD A;  2YM1 A;  3H8L A;  3SQP A;  2LFC A;  2ZBW A;  2BC1 A;  3CN8 A;  2C73 A;  2XLP A;  3UOX A;  3DK8 A;  1GOS A;  4OPT A;  1GER A;  1P2E A;  3II4 A;  1KF6 A;  3PO7 A;  1NEK A;  1F8S A;  1QJD A;  2V60 A;  1ZOY A;  3CMM A;  4USQ A;  3NYC A;  2VVL G;  3AE6 A;  4CCR A;  1V59 A;  1XPQ A;  3AE5 A;  2QA1 A;  1PJ5 A;  4Q5C A;  2H89 A;  2WES A;  4YWO A;  3DME A;  3NN0 X;  2YQU A;  4N9X A;  1IUW A;  1TDE A;  4U2S A;  3KLJ A;  2QCU A;  4HB9 A;  4Q17 A;  1LPF A;  2WOV A;  3IF9 A;  4CBQ A;  3UP5 A;  3DA1 A;  1DOD A;  2IVD A;  4NTC A;  1D7Y A;  2Y6Q A;  3AE2 A;  4GDP A;  1GRF A;  1H6V A;  2BXR A;  2W0H A;  3S5W A;  1GT8 A;  3NYE A;  2VOU A;  2WPE A;  3UTE A;  2A87 A;  4D03 A;  1IUU A;  2I0Z A;  2WOW A;  2V3B A;  4Z2U A;  2DKH A;  3UOV A;  4YXD A;  4L3Y A;  1DOE A;  2IVE A;  3UU9 A;  3L1R A;  4Y4M A;  1IUS A;  3AD8 B;  2F5Z A;  4DSG A;  3K7M X;  2OLN A;  1EL9 A;  1XAN A;  3BNJ A;  1PXB A;  2C4C A;  2RDZ A;  2FJB A;  3GMB A;  4U8P A;  2OAM A;  2ZZB A;  3LB8 A;  5KMQ A;  1TDN A;  3NNE A;  2RGH A;  1RYI A;  4NNJ A;  3ZYX A;  3DGH A;  4I58 A;  1TDF A;  3DK9 A;  2YLS A;  2JB1 A;  2C65 A;  3GYJ A;  5IQ4 A;  3NGC X;  1P2H A;  3IC9 A;  2GB0 A;  3M0O A;  2C3D A;  3AYJ A;  4APN A;  4BK1 A;  4B65 A;  4YTP A;  1D4E A;  2ZZ0 A;  2E81 A;  2C75 A;  3BNU A;  4NEW A;  3T14 A;  3JSK A;  3SZ0 A;  1ZDL A;  4H2P A;  4NZH A;  4Y4N A;  2JK6 A;  3ICS A;  4LU6 A;  4YT0 A;  2VRM A;  1PBD A;  4OPU A;  3RP8 A;  1IUX A;  3UTG A;  2R0C A;  4FX9 A;  5KOW A;  3K7T A;  3ALL A;  2X8H A;  2QA2 A;  3ISH A;  2WPC A;  4G6H A;  5KRQ A;  3NTA A;  1GV4 A;  3NYF A;  4J36 A;  2JB3 A;  2V6O A;  2X50 A;  3C4N A;  3BNM A;  3VRB A;  3LG1 A;  4A65 A;  1IUV A;  4H4W A;  4DNA A;  3KKJ A;  3QFB A;  1FCD A;  4C74 A;  3AE3 A;  1FEB A;  2V3A A;  2GAG B;  3R9U A;  1FEC A;  4YTN A;  4RSL A;  4G73 A;  2B9Y A;  3AD9 B;  3DJE A;  1GPE A;  1OJA A;  5JCM A;  5M10 A;  1QO8 A;  1FT6 A;  3RED A;  3ICT A;  1VDC A;  4EIQ A;  1FT5 A;  1N1P A;  1CF3 A;  4A5L A;  3P4Q A;  1M1R A;  3QFA A;  2A8X A;  2B7S A;  2RGO A;  4TM3 A;  1F6M A;  5KWF A;  1W4X A;  2BK3 A;  3UCL A;  3B3R A;  3F8P A;  1K4Q A;  1GET A;  3GMC A;  4TLZ A;  2PYX A;  3COX A;  1YKJ A;  4GCM A;  4CY6 A;  3L8K A;  2GRT A;  4BV6 A;  5HXI A;  3UKF A;  2AAQ A;  3CIR A;  4TM4 A;  1B37 A;  2VVM A;  1Y56 A;  2WQY A;  1LV0 A;  3GD4 A;  4U2T A;  1GTH A;  2Q0L A;  2GH5 A;  1S2Y A;  2WU2 A;  4OVI A;  3SZC A;  4JY3 A;  4WX1 A;  5FS6 A;  4XWR A;  1SP3 A;  3HZL A;  3B6D A;  3SFD A;  5HHF A;  1X31 B;  3RP7 A;  4YTM A;  1BGN A;  1CC6 A;  2CVJ A;  5KXJ A;  2B7R A;  4FK1 A;  1Z6L A;  3RNM A;  2YVF A;  3M13 A;  3DK4 A;  4J57 A;  3ATR A;  1O95 A;  3AWI A;  4ZCC A;  2WP6 A;  3F29 A;  2EQ8 A;  4J2W A;  3EAN A;  4UP3 A;  3UKA A;  2YAU A;  1NHR A;  1CJC A;  2E4G A;  4P9S A;  4ADW A;  1EL5 A;  3WE0 A;  3M12 A;  3DGZ A;  3HYV A;  4H4R A;  1SEZ A;  1N4V A;  2WP9 A;  3H4K A;  2FJA A;  2X99 A;  2GR0 A;  5GSN A;  2R46 A;  5JCN A;  5JCI A;  1S2Q A;  4H4U A;  5U25 A;  3NTD A;  1NG4 A;  1D4C A;  2EQ6 A;  4OPD A;  5BVA A;  4H2R A;  1E1L A;  1E1K A;  3QSE A;  1FOH A;  1NEN A;  3NIX A;  1BGJ A;  2XLR A;  1RSG A;  1GAL A;  2VVL A;  1E1N A;  3BNG A;  4KPR A;  3AED A;  4U8K A;  1F8W A;  3LOV A;  4H4Y A;  4H2Q A;  4CRT A;  1PXA A;  1QLB A;  2B9W A;  4NWZ A;  2R9Z A;  2YLX A;  1ZMD A;  1H82 A;  2YG5 A;  2Z5X A;  5IQ1 A;  3CGD A;  2BC0 A;  1M64 A;  3OWM A;  1L9E A;  1LQU A;  5BRT A;  1YY5 A;  4C5O A;  1NDA A;  2AQJ A;  4E0V A;  1KSS A;  2BCP A;  3C4A A;  3SGL A;  2ACZ A;  1KNP A;  1TRB A;  3GWD A;  1PHH A;  2C3C A;  2JB2 A;  1UKV G;  2WS3 A;  3Q6J A;  3QVR A;  4G6G A;  3FO3 A;  4Z26 A;  1VRQ B;  3BI4 A;  2AR8 A;  2R0G A;  3UBR A;  2X8G A;  4OPC A;  3VRA A;  4Z25 A;  2UZZ A;  2Q0K A;  4J56 A;  5DBJ A;  1N4U A;  1K0L A;  2GVC A;  1TDK A;  2C72 A;  3O0H A;  1ZX9 A;  1E7P A;  4TLX A;  5KMP A;  1JEH A;  4U8L A;  3CNT A;  3SXI A;  1GXF A;  1BZL A;  1N4W A;  4A6N A;  4EMW A;  5EB5 A;  4L38 A;  4G74 A;  1QDB A;  1KDG A;  2XYO A;  3AEE A;  2YG6 A;  3NG7 X;  4AP3 A;  4EM3 A;  1H7W A;  3OC4 A;  1CJ2 A;  4PAB A;  4CNK A;  4L3X A;  1B5Q A;  1F8R A;  3FMW A;  1PN0 A;  3AYL A;  1PJ7 A;  1CJ3 A;  1E1M A;  2BXS A;  4II3 A;  4OCG A;  4Z43 A;  4B66 A;  3CNP A;  1PXC A;  2GQF A;  3GDP A;  4II2 A;  3SZF A;  2YG7 A;  3NHO X;  4FK1 C;  3P4S A;  4AT2 A;  2QAE A;  1CJ4 A;  1L9C A;  1S3E A;  5J60 A;  2Y6R A;  4K22 A;  4H4S A;  4YKG A;  1YQZ A;  3SY4 A;  2APG A;  3T0K A;  2R4E A;  3CTY A;  2XLS A;  1ZOV A;  4U8J A;  4U8O A;  2TMD A;  4UDQ A;  3CNS A;  1K0I A;  5JCK A;  2B76 A;  5FMH A;  4GAP A;  5U63 A;  1E39 A;  2JBV A;  1Q1R A;  1CBO A;  1OJC A;  4PAA A;  3UTF A;  3UTH A;  2TPR A;  3SCE A;  2CZS A;  4Z44 A;  1YQ4 A;  3CPI G;  3AEF A;  1COY A;  2BK4 A;  1K0J A;  3EF6 A;  2X3N A;  4C3Y A;  4H2N A;  1CC4 A;  3HYW A;  4GUV A;  2GMJ A;  4WCT A;  4AT0 A;  1GRT A;  5M0Z A;  1VG9 A;  4O5U A;  3EAO A;  4H4Q A;  1NAA A;  5LV9 A;  3UOY A;  4B1B A;  2YR6 A;  3P1W A;  1FEA A;  3AXB A;  3IHM A;  4CY8 A;  2J7A A;  3GM6 A;  1GTE A;  3CPJ G;  1H84 A;  2JKC A;  2VQ7 A;  4AOS A;  3LZX A;  3V3N A;  1DJN A;  2WOI A;  4X9M A;  5C3J A;  4H4X A;  3T2Y A;  3AEC A;  1CL0 A;  1LTX R;  3UKP A;  2YLT A;  4A79 A;  2HQM A;  2YLZ A;  3IHG A;  4IA6 A;  1EBD A;  1GRE A;  1OJT A;  3MMO A;  2GAH B;  4MJW A;  5U1O A;  1JNR A;  1B4V A;  2A89 A;  4H50 A;  3NLC A;  1AOG A;  1Y0P A;  3SM8 A;  1GSN A;  2YR5 A;  1JNZ A;  3G5R A;  2XFU A;  2BS4 A;  3ZDN A;  3URH A;  3LJP A;  4B63 A;  3TOR A;  4Q4U A;  1ZK7 A;  3UOZ A;  2XFQ A;  1DOB A;  4JY2 A;  4H4V A;  1OJD A;  4Q5B A;  3PVC A;  3NN6 X;  5GRT A;  1MXT A;  3LXD A;  4FDC B;  1VQW A;  1XHC A;  3T37 A;  2Z5Y A;  4TM0 A;  3VR9 A;  4U2L A;  2WPF A;  1EL8 A;  1ONF A;  4EMJ A;  4NTD A;  3VRD B;  4YSH A;  2YVG A;  2VR0 A;  5BUL A;  1Q1W A;  2WP5 A;  2JAE A;  2GR2 A;  5EOW A;  4C3X A;  5CKU A;  1LJ1 A;  1PBB A;  1VG0 A;  5C2T A;  1D4D A;  1GU6 A;  3SFE A;  4K5S A;  3DJJ A;  4O5Q A;  4X9N A;  1M1P A;  4B64 A;  3P9U A;  2OT4 A;  4CCQ A;  2YWL A;  3KD9 A;  2BCG G;  2BS2 A;  3AEG A;  3FG2 P;  4H7U A;  5J7X A;  3AE1 A;  4EQR A;  3UKK A;  1M1Q A;  1H83 A;  4HA6 A;  3T2K A;  4D04 A;  5KNL A;  4JQ9 A;  1NHS A;  4IA5 A;  3PS9 A;  2C70 A;  2FJE A;  2RGJ A;  2BRY A;  4JN9 A;  2C67 A;  1S3B A;  2BK5 A;  2ARD A;  3RP6 A;  3FPZ A;  5JCL A;  2XVF A;  1TYP A;  1TYT A;  1LVL A;  3CGE A;  5FS7 A;  3BNF A;  1PBC A;  3KU9 A;  2V5Z A;  3GYI A;  3CGC A;  4Z2T A;  4IVM B;  4A6N B;  4A9W A;  1YQ3 A;  3BHK A;  2J3N A;  2B9X A;  4B67 A;  3CND A;  4ZN0 A;  4REK A;  3E1T A;  4EM4 A;  2VQB A;  4EQS A;  4IVO B;  4L3Z A;  4GRT A;  4Y4L A;  5FS8 A;  4C77 A;  2V61 A;  2WHD A;  3BI5 A;  3NT6 A;  4BJZ A;  3UP4 A;  4XXG A;  1JU2 A;  3NKS A;  1H86 A;  4Z2R A;  4U8I A;  2YG3 A;  2WDQ A;  3S7W A;  3VQR A;  1JOA A;  1E6E A;  2XFO A;  3S61 A;  4A7A A;  3G5Q A;  3SXQ A;  1Q9I A;  1KSU A;  3L1T A;  2YR4 A;  3ITJ A;  5IPY A;  3KA7 A;  3GDN A;  3BI2 A;  1FS7 A;  3T31 A;  5TR3 A;  1DNC A;  2Q7V A;  4GAV A;  5HY5 A;  2C7G A;  2YVJ A;  1ZP0 A;  4LA1 A;  1IJH A;  3DH9 A;  2R45 A;  3K30 A;  2XVH A;  1MO9 A;  2VZ2 A;  3RHA A;  2C66 A;  3NK1 X;  1ZMC A;  2YLR A;  4GR1 A;  2O9Z A;  4ECH A;  3GWF A;  4BK3 A;  2XVI A;  1BKW A;  5BUK A;  4JNQ A;  2XCG A;  4BUR A;  3TTB A;  1FL2 A;  2XLT A;  4UDP A;  5CQF A;  1Y56 B;  4GF7 A;  4DGK A;  4YSX A;  5KMS A;  5KVH A;  3AE7 A;  2XVJ A;  3GYX A;  4H4T A;  1PS9 A;  3D8X A;  2CFY A;  1ELI A;  3RKH A;  4ICY A;  3V3O A;  4GDE A;  2WDV A;  3LAD A;  4JNA A;  1O94 A;  2BAB A;  2XVE A;  3C96 A;  5FS9 A;  4J34 A;  4LII A;  2GV8 A;  2XDO A;  3AE8 A;  2Q6U A;  2H88 A;  3AE4 A;  4OPG A;  4TM1 A;  3GD3 A;  3GSI A;  1O5W A;  1ZKQ A;  2E5V A;  3SYI A;  3IWA A;  2WET A;  1ZY8 A;  3BNH A;  2GEW A;  1L0V A;  4I59 A;  1DOC A;  1JRX A;  2BS3 A;  1JRZ A;  2K3V A;  3NK2 X;  2OAL A;  5L46 A;  1GRB A;  4RG4 A;  3AEB A;  3LGQ A;  1OAH A;  2NPX A;  3UKL A;  1JRY A;  1GES A;  2BA9 A;  4H4P A;  4A99 A;  1FS8 A;  4J33 A;  2CUL A;  3F8D A;  4YSZ A;  3DJG X;  2RF7 A;  1GRG A;  1H7X A;  1D5T A;  3I3L A;  3ATQ A;  3P4P A;  3EPT A;  1NHQ A;  1FS9 A;  2XFP A;  4OPL A;  4UDR A;  3CGB A;  4EQW A;  4NEV A;  4NTE A;  4YSY A;  2XFN A;  1F3P A;  1L9D A;  1NPX A;  3P4R A;  1D7L A;  4EQX A;  3DJD A;  4AP1 A;  5KOX A;  3UKH A;  1GRA A;  1REO A;  2BRA A;  3K7Q X;  3FBS A;  4BK2 A;  4EMI A;  3Q9T A;  4DSH A;  3FIM B;  4Z24 A;  2GMH A;  2X8C A;  1OJ9 A;  3NH3 X;  4USR A;  5ER0 A;  3ALM A;  4K7Z A;  3VR8 A;  3NRN A;  1M6I A;  1RP0 A;  2EQ7 A;  3QVP A;  3HYX A;  2OLO A;  3T2Z A;  3AE9 A;  1DXL A;  2OA1 A;  3GRT A;  3GRS A;  4Q0T A;  2GF3 A;  2WEU A;  2FJD A;  3QSS A;  2BAC A;  4U8M A;  1LQT A;  4AOX A;  3KPF A;  2GR3 A;  4XWZ A;  5EB4 A;  4BJY A;  1BWC A;  2YM2 A;  1JNI A;  2EQ9 A;  5EBK A;  1BF3 A;  4K2X A;  5KVI A;  2XLU A;  3ABV A;  4OPI A;  1HYU A;  4J31 A; 
#chains in the Genus database with same CATH homology
 4Q1O A;  3ALJ A;  2BYB A;  1DJQ A;  4B69 A;  2NVK X;  1KFY A;  1BVB A;  3BHF A;  3LZW A;  4WJY A;  3D1C A;  3QSM A;  4IV9 A;  4U8N A;  2PHH A;  3QJ4 A;  2GQW A;  2R0P A;  2YG4 A;  2YLW A;  4B68 A;  5KMR A;  2IID A;  4H4Z A;  3AB1 A;  3AEA A;  4EIP A;  3AD7 B;  3F8R A;  3OZ2 A;  2WU5 A;  3D1I A;  1NHP A;  1PBF A;  4JDR A;  4M52 A;  1MOK A;  3CNJ A;  3SZW A;  1TDO A;  4K5R A;  1H81 A;  1GND A;  4KX6 A;  2R4J A;  3CPH G;  2E80 A;  3V76 A;  2WDR A;  3NK0 X;  3UKQ A;  3I6D A;  1GRH A;  2WBA A;  1IUT A;  3G5S A;  4K8D A;  4YKF A;  4RG3 A;  1XDI A;  1CC2 A;  1PJ6 A;  2DKI A;  2VRL A;  1KNR A;  2RAB A;  3AYI A;  1EL7 A;  1PDH A;  3KPK A;  4G9K A;  2CDU A;  1PBE A;  2FBW A;  4X4J A;  3H8I A;  1NG3 A;  4CNJ A;  2ZZC A;  1B8S A;  3SX6 A;  5HYM A;  2C76 A;  2GR1 A;  3ICR A;  2ZO5 A;  2C64 A;  1CHU A;  1GEU A;  3ADA B;  3KVE A;  2E1M A;  4ZCD A;  2YM1 A;  3H8L A;  3SQP A;  2LFC A;  2ZBW A;  2BC1 A;  3CN8 A;  2C73 A;  2XLP A;  3UOX A;  3DK8 A;  1GOS A;  4OPT A;  1GER A;  1P2E A;  3II4 A;  1KF6 A;  3PO7 A;  1NEK A;  1F8S A;  1QJD A;  2V60 A;  1ZOY A;  3CMM A;  4USQ A;  3NYC A;  2VVL G;  3AE6 A;  4CCR A;  1V59 A;  1XPQ A;  3AE5 A;  2QA1 A;  1PJ5 A;  4Q5C A;  2H89 A;  2WES A;  4YWO A;  3DME A;  3NN0 X;  2YQU A;  4N9X A;  1IUW A;  1TDE A;  4U2S A;  3KLJ A;  2QCU A;  4HB9 A;  4Q17 A;  1LPF A;  2WOV A;  3IF9 A;  4CBQ A;  3UP5 A;  3DA1 A;  1DOD A;  2IVD A;  4NTC A;  1D7Y A;  2Y6Q A;  3AE2 A;  4GDP A;  1GRF A;  1H6V A;  2BXR A;  2W0H A;  3S5W A;  1GT8 A;  3NYE A;  2VOU A;  2WPE A;  3UTE A;  2A87 A;  4D03 A;  1IUU A;  2I0Z A;  2WOW A;  2V3B A;  4Z2U A;  2DKH A;  3UOV A;  4YXD A;  4L3Y A;  1DOE A;  2IVE A;  3UU9 A;  3L1R A;  4Y4M A;  1IUS A;  3AD8 B;  2F5Z A;  4DSG A;  3K7M X;  2OLN A;  1EL9 A;  1XAN A;  3BNJ A;  1PXB A;  2C4C A;  2RDZ A;  2FJB A;  3GMB A;  4U8P A;  2OAM A;  2ZZB A;  3LB8 A;  5KMQ A;  1TDN A;  3NNE A;  2RGH A;  1RYI A;  4NNJ A;  3ZYX A;  3DGH A;  4I58 A;  1TDF A;  3DK9 A;  2YLS A;  2JB1 A;  2C65 A;  3GYJ A;  5IQ4 A;  3NGC X;  1P2H A;  3IC9 A;  2GB0 A;  3M0O A;  2C3D A;  3AYJ A;  4APN A;  4BK1 A;  4B65 A;  4YTP A;  1D4E A;  2ZZ0 A;  2E81 A;  2C75 A;  3BNU A;  4NEW A;  3T14 A;  3JSK A;  3SZ0 A;  1ZDL A;  4H2P A;  4NZH A;  4Y4N A;  2JK6 A;  3ICS A;  4LU6 A;  4YT0 A;  2VRM A;  1PBD A;  4OPU A;  3RP8 A;  1IUX A;  3UTG A;  2R0C A;  4FX9 A;  5KOW A;  3K7T A;  3ALL A;  2X8H A;  2QA2 A;  3ISH A;  2WPC A;  4G6H A;  5KRQ A;  3NTA A;  1GV4 A;  3NYF A;  4J36 A;  2JB3 A;  2V6O A;  2X50 A;  3C4N A;  3BNM A;  3VRB A;  3LG1 A;  4A65 A;  1IUV A;  4H4W A;  4DNA A;  3KKJ A;  3QFB A;  1FCD A;  4C74 A;  3AE3 A;  1FEB A;  2V3A A;  2GAG B;  3R9U A;  1FEC A;  4YTN A;  4RSL A;  4G73 A;  2B9Y A;  3AD9 B;  3DJE A;  1GPE A;  1OJA A;  5JCM A;  5M10 A;  1QO8 A;  1FT6 A;  3RED A;  3ICT A;  1VDC A;  4EIQ A;  1FT5 A;  1N1P A;  1CF3 A;  4A5L A;  3P4Q A;  1M1R A;  3QFA A;  2A8X A;  2B7S A;  2RGO A;  4TM3 A;  1F6M A;  5KWF A;  1W4X A;  2BK3 A;  3UCL A;  3B3R A;  3F8P A;  1K4Q A;  1GET A;  3GMC A;  4TLZ A;  2PYX A;  3COX A;  1YKJ A;  4GCM A;  4CY6 A;  3L8K A;  2GRT A;  4BV6 A;  5HXI A;  3UKF A;  2AAQ A;  3CIR A;  4TM4 A;  1B37 A;  2VVM A;  1Y56 A;  2WQY A;  1LV0 A;  3GD4 A;  4U2T A;  1GTH A;  2Q0L A;  2GH5 A;  1S2Y A;  2WU2 A;  4OVI A;  3SZC A;  4JY3 A;  4WX1 A;  5FS6 A;  4XWR A;  1SP3 A;  3HZL A;  3B6D A;  3SFD A;  5HHF A;  1X31 B;  3RP7 A;  4YTM A;  1BGN A;  1CC6 A;  2CVJ A;  5KXJ A;  2B7R A;  4FK1 A;  1Z6L A;  3RNM A;  2YVF A;  3M13 A;  3DK4 A;  4J57 A;  3ATR A;  1O95 A;  3AWI A;  4ZCC A;  2WP6 A;  3F29 A;  2EQ8 A;  4J2W A;  3EAN A;  4UP3 A;  3UKA A;  2YAU A;  1NHR A;  1CJC A;  2E4G A;  4P9S A;  4ADW A;  1EL5 A;  3WE0 A;  3M12 A;  3DGZ A;  3HYV A;  4H4R A;  1SEZ A;  1N4V A;  2WP9 A;  3H4K A;  2FJA A;  2X99 A;  2GR0 A;  5GSN A;  2R46 A;  5JCN A;  5JCI A;  1S2Q A;  4H4U A;  5U25 A;  3NTD A;  1NG4 A;  1D4C A;  2EQ6 A;  4OPD A;  5BVA A;  4H2R A;  1E1L A;  1E1K A;  3QSE A;  1FOH A;  1NEN A;  3NIX A;  1BGJ A;  2XLR A;  1RSG A;  1GAL A;  2VVL A;  1E1N A;  3BNG A;  4KPR A;  3AED A;  4U8K A;  1F8W A;  3LOV A;  4H4Y A;  4H2Q A;  4CRT A;  1PXA A;  1QLB A;  2B9W A;  4NWZ A;  2R9Z A;  2YLX A;  1ZMD A;  1H82 A;  2YG5 A;  2Z5X A;  5IQ1 A;  3CGD A;  2BC0 A;  1M64 A;  3OWM A;  1L9E A;  1LQU A;  5BRT A;  1YY5 A;  4C5O A;  1NDA A;  2AQJ A;  4E0V A;  1KSS A;  2BCP A;  3C4A A;  3SGL A;  2ACZ A;  1KNP A;  1TRB A;  3GWD A;  1PHH A;  2C3C A;  2JB2 A;  1UKV G;  2WS3 A;  3Q6J A;  3QVR A;  4G6G A;  3FO3 A;  4Z26 A;  1VRQ B;  3BI4 A;  2AR8 A;  2R0G A;  3UBR A;  2X8G A;  4OPC A;  3VRA A;  4Z25 A;  2UZZ A;  2Q0K A;  4J56 A;  5DBJ A;  1N4U A;  1K0L A;  2GVC A;  1TDK A;  2C72 A;  3O0H A;  1ZX9 A;  1E7P A;  4TLX A;  5KMP A;  1JEH A;  4U8L A;  3CNT A;  3SXI A;  1GXF A;  1BZL A;  1N4W A;  4A6N A;  4EMW A;  5EB5 A;  4L38 A;  4G74 A;  1QDB A;  1KDG A;  2XYO A;  3AEE A;  2YG6 A;  3NG7 X;  4AP3 A;  4EM3 A;  1H7W A;  3OC4 A;  1CJ2 A;  4PAB A;  4CNK A;  4L3X A;  1B5Q A;  1F8R A;  3FMW A;  1PN0 A;  3AYL A;  1PJ7 A;  1CJ3 A;  1E1M A;  2BXS A;  4II3 A;  4OCG A;  4Z43 A;  4B66 A;  3CNP A;  1PXC A;  2GQF A;  3GDP A;  4II2 A;  3SZF A;  2YG7 A;  3NHO X;  4FK1 C;  3P4S A;  4AT2 A;  2QAE A;  1CJ4 A;  1L9C A;  1S3E A;  5J60 A;  2Y6R A;  4K22 A;  4H4S A;  4YKG A;  1YQZ A;  3SY4 A;  2APG A;  3T0K A;  2R4E A;  3CTY A;  2XLS A;  1ZOV A;  4U8J A;  4U8O A;  2TMD A;  4UDQ A;  3CNS A;  1K0I A;  5JCK A;  2B76 A;  5FMH A;  4GAP A;  5U63 A;  1E39 A;  2JBV A;  1Q1R A;  1CBO A;  1OJC A;  4PAA A;  3UTF A;  3UTH A;  2TPR A;  3SCE A;  4Z44 A;  1YQ4 A;  3CPI G;  3AEF A;  1COY A;  2BK4 A;  1K0J A;  3EF6 A;  2X3N A;  4C3Y A;  4H2N A;  1CC4 A;  3HYW A;  4GUV A;  2GMJ A;  4WCT A;  4AT0 A;  1GRT A;  5M0Z A;  1VG9 A;  4O5U A;  3EAO A;  4H4Q A;  1NAA A;  5LV9 A;  3UOY A;  4B1B A;  2YR6 A;  3P1W A;  1FEA A;  3AXB A;  3IHM A;  4CY8 A;  2J7A A;  3GM6 A;  1GTE A;  3CPJ G;  1H84 A;  2JKC A;  2VQ7 A;  4AOS A;  3LZX A;  3V3N A;  1DJN A;  2WOI A;  4X9M A;  5C3J A;  4H4X A;  3T2Y A;  3AEC A;  1CL0 A;  1LTX R;  3UKP A;  2YLT A;  4A79 A;  2HQM A;  2YLZ A;  3IHG A;  4IA6 A;  1EBD A;  1GRE A;  1OJT A;  3MMO A;  2GAH B;  4MJW A;  5U1O A;  1JNR A;  1B4V A;  2A89 A;  4H50 A;  3NLC A;  1AOG A;  1Y0P A;  3SM8 A;  1GSN A;  2YR5 A;  1JNZ A;  3G5R A;  2XFU A;  2BS4 A;  3ZDN A;  3URH A;  3LJP A;  4B63 A;  3TOR A;  4Q4U A;  1ZK7 A;  3UOZ A;  2XFQ A;  1DOB A;  4JY2 A;  4H4V A;  1OJD A;  4Q5B A;  3PVC A;  3NN6 X;  5GRT A;  1MXT A;  3LXD A;  4FDC B;  1VQW A;  1XHC A;  3T37 A;  2Z5Y A;  4TM0 A;  3VR9 A;  4U2L A;  2WPF A;  1EL8 A;  1ONF A;  4EMJ A;  4NTD A;  3VRD B;  4YSH A;  2YVG A;  2VR0 A;  5BUL A;  1Q1W A;  2WP5 A;  2JAE A;  2GR2 A;  5EOW A;  4C3X A;  5CKU A;  1LJ1 A;  1PBB A;  1VG0 A;  5C2T A;  1D4D A;  1GU6 A;  3SFE A;  4K5S A;  3DJJ A;  4O5Q A;  4X9N A;  1M1P A;  4B64 A;  3P9U A;  2OT4 A;  4CCQ A;  2YWL A;  3KD9 A;  2BCG G;  2BS2 A;  3AEG A;  3FG2 P;  4H7U A;  5J7X A;  3AE1 A;  4EQR A;  3UKK A;  1M1Q A;  1H83 A;  4HA6 A;  3T2K A;  4D04 A;  5KNL A;  4JQ9 A;  1NHS A;  4IA5 A;  3PS9 A;  2C70 A;  2FJE A;  2RGJ A;  2BRY A;  4JN9 A;  2C67 A;  1S3B A;  2BK5 A;  2ARD A;  3RP6 A;  3FPZ A;  5JCL A;  2XVF A;  1TYP A;  1TYT A;  1LVL A;  3CGE A;  5FS7 A;  3BNF A;  1PBC A;  3KU9 A;  2V5Z A;  3GYI A;  3CGC A;  4Z2T A;  4IVM B;  4A6N B;  4A9W A;  1YQ3 A;  3BHK A;  2J3N A;  2B9X A;  4B67 A;  3CND A;  4ZN0 A;  4REK A;  3E1T A;  4EM4 A;  2VQB A;  4EQS A;  4IVO B;  4L3Z A;  4GRT A;  4Y4L A;  5FS8 A;  4C77 A;  2V61 A;  2WHD A;  3BI5 A;  3NT6 A;  4BJZ A;  3UP4 A;  4XXG A;  1JU2 A;  3NKS A;  1H86 A;  4Z2R A;  4U8I A;  2YG3 A;  2WDQ A;  3S7W A;  3VQR A;  1JOA A;  1E6E A;  2XFO A;  3S61 A;  4A7A A;  3G5Q A;  3SXQ A;  1Q9I A;  1KSU A;  3L1T A;  2YR4 A;  3ITJ A;  5IPY A;  3KA7 A;  3GDN A;  3BI2 A;  1FS7 A;  3T31 A;  5TR3 A;  1DNC A;  2Q7V A;  4GAV A;  5HY5 A;  2C7G A;  2YVJ A;  1ZP0 A;  4LA1 A;  1IJH A;  3DH9 A;  2R45 A;  3K30 A;  2XVH A;  1MO9 A;  2VZ2 A;  3RHA A;  2C66 A;  3NK1 X;  1ZMC A;  2YLR A;  4GR1 A;  2O9Z A;  4ECH A;  3GWF A;  4BK3 A;  2XVI A;  1BKW A;  5BUK A;  4JNQ A;  2XCG A;  4BUR A;  3TTB A;  1FL2 A;  2XLT A;  4UDP A;  5CQF A;  1Y56 B;  4GF7 A;  4DGK A;  4YSX A;  5KMS A;  5KVH A;  3AE7 A;  2XVJ A;  3GYX A;  4H4T A;  1PS9 A;  3D8X A;  2CFY A;  1ELI A;  3RKH A;  4ICY A;  3V3O A;  4GDE A;  2WDV A;  3LAD A;  4JNA A;  1O94 A;  2BAB A;  2XVE A;  3C96 A;  5FS9 A;  4J34 A;  4LII A;  2GV8 A;  2XDO A;  3AE8 A;  2Q6U A;  2H88 A;  3AE4 A;  4OPG A;  4TM1 A;  3GD3 A;  3GSI A;  1O5W A;  1ZKQ A;  2E5V A;  3SYI A;  3IWA A;  2WET A;  1ZY8 A;  3BNH A;  2GEW A;  1L0V A;  4I59 A;  1DOC A;  1JRX A;  2BS3 A;  1JRZ A;  2K3V A;  3NK2 X;  2OAL A;  5L46 A;  1GRB A;  4RG4 A;  3AEB A;  3LGQ A;  1OAH A;  2NPX A;  3UKL A;  1JRY A;  1GES A;  2BA9 A;  4H4P A;  4A99 A;  1FS8 A;  4J33 A;  2CUL A;  3F8D A;  4YSZ A;  3DJG X;  2RF7 A;  1GRG A;  1H7X A;  1D5T A;  3I3L A;  3ATQ A;  3P4P A;  3EPT A;  1NHQ A;  1FS9 A;  2XFP A;  4OPL A;  4UDR A;  3CGB A;  4EQW A;  4NEV A;  4NTE A;  4YSY A;  2XFN A;  1F3P A;  1L9D A;  1NPX A;  3P4R A;  1D7L A;  4EQX A;  3DJD A;  4AP1 A;  5KOX A;  3UKH A;  1GRA A;  1REO A;  2BRA A;  3K7Q X;  3FBS A;  4BK2 A;  4EMI A;  3Q9T A;  4DSH A;  3FIM B;  4Z24 A;  2GMH A;  2X8C A;  1OJ9 A;  3NH3 X;  4USR A;  5ER0 A;  3ALM A;  4K7Z A;  3VR8 A;  3NRN A;  1M6I A;  1RP0 A;  2EQ7 A;  3QVP A;  3HYX A;  2OLO A;  3T2Z A;  3AE9 A;  1DXL A;  2OA1 A;  3GRT A;  3GRS A;  4Q0T A;  2GF3 A;  2WEU A;  2FJD A;  3QSS A;  2BAC A;  4U8M A;  1LQT A;  4AOX A;  3KPF A;  2GR3 A;  4XWZ A;  5EB4 A;  4BJY A;  1BWC A;  2YM2 A;  1JNI A;  2EQ9 A;  5EBK A;  1BF3 A;  4K2X A;  5KVI A;  2XLU A;  3ABV A;  4OPI A;  1HYU A;  4J31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...