1P2EA

H61a mutant of flavocytochrome c3
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASAFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Histidine 61: An Important Heme Ligand in the Soluble Fumarate Reductase from Shewanella frigidimarina
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
molecule keywords flavocytochrome c3
total genus 194
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1p2eA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1p2eA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1p2eA01
2WEUA 1ZMDA 2WOWA 4Z25A 4OPIA 3LG1A 3GDPA 4WX1A 1Y0PA 3CTYA 1FS9A 1E1LA 1Q1RA 2I0ZA 3UOXA 2IIDA 4REKA 4AOXA 2R4JA 4IV9A 1RSGA 3I3LA 4CY6A 3M13A 2XVIA 3NK0X 1NHRA 1IUTA 1PXBA 3VQRA 4OPLA 4CNKA 5BRTA 4N9XA 1M1RA 2R4EA 3UBRA 2V5ZA 3CNJA 2WU2A 3NNEA 1CBOA 1ZMCA 1EL7A 4LU6A 3QJ4A 4H4TA 4CNJA 2B9WA 4L3YA 4B1BA 1VG0A 4LA1A 1KNPA 3VR9A 1CL0A 1D7YA 4YSXA 4Y4MA 3CPJG 2YLZA 2XVHA 1L9DA 2C67A 4K22A 3V76A 4Z2TA 1DOEA 3NTDA 4L3ZA 1NG3A 4EMWA 3Q6JA 1BF3A 2GRTA 5EBKA 2VVMA 4GDPA 1OAHA 2FJAA 5LV9A 3AE7A 3QSSA 2C76A 2JBVA 2J7AA 1D5TA 2WDQA 1TDNA 1GV4A 4H4XA 4ZCCA 1XPQA 4OPGA 2J3NA 2WDRA 3BHFA 1LVLA 3DGHA 1FCDA 3CNPA 2C73A 3DMEA 3M0OA 3AE5A 2PYXA 2X8GA 1FOHA 3URHA 3UOVA 2YR5A 2XLPA 3LGQA 4NTEA 2OLNA 2XFNA 2X3NA 2WOVA 4TM0A 3DJJA 4A6NB 2Q0LA 1XDIA 1ZKQA 2FJBA 1OJDA 4YXDA 5J60A 1E1KA 1PJ6A 4U8KA 3QVRA 1L9CA 3LZXA 1OJ9A 3D1CA 2XLSA 4YT0A 3LADA 1BZLA 4BK1A 4JN9A 5KXJA 1GREA 2WQYA 4Y4LA 4CRTA 2BCGG 4GRTA 1PBEA 2AQJA 2BK3A 1D4CA 5U1OA 2ACZA 2TMDA 4LIIA 4YKFA 4U2SA 3ABVA 4H4RA 1MO9A 2R45A 5DBJA 5L46A 2GR0A 1Y56B 2YR4A 2B9YA 3H8IA 2C75A 1KDGA 3KA7A 4H50A 2Q6UA 1NEKA 3SXQA 1CJ4A 2HQMA 5M0ZA 2YAUA 4H7UA 2YG3A 1MOKA 4U8JA 2YWLA 2YLTA 1FS8A 3NGCX 4U8LA 4AP3A 1L9EA 2WHDA 3G5QA 4OPTA 1S2YA 3AYLA 2GF3A 2V3BA 3CNSA 4B66A 1BKWA 1ZX9A 1TYTA 1EL5A 1IJHA 3CIRA 4H4YA 3PO7A 1EBDA 5CKUA 3CGCA 4CBQA 4JY2A 1PJ5A 3PVCA 2APGA 4EIPA 1AOGA 1HYUA 4M52A 3UKLA 1FEBA 4JNQA 4TM3A 2WOIA 1CJCA 2XFUA 3CPIG 4K7ZA 4B68A 2EQ9A 3DA1A 3LOVA 1H7WA 4EM4A 3VRDB 2YVGA 3BNMA 2VR0A 3M12A 5FS7A 2E81A 2OA1A 4TLZA 3QSMA 4JDRA 4WCTA 3AEAA 2JB2A 5KVHA 2E80A 2BK4A 4MJWA 1KFYA 3CGDA 3ZYXA 4EQWA 3B3RA 4ICYA 5CQFA 4GCMA 2WPCA 1TYPA 4J57A 3JSKA 1GT8A 2X50A 3II4A 1H81A 3UOZA 3LJPA 1D4EA 1E1NA 3DGZA 4FK1C 1QJDA 3ATRA 1TDFA 2BABA 3P1WA 3IHMA 2WP5A 4U2TA 3GYXA 3BNUA 4J2WA 1B5QA 3QFBA 3DK9A 3ALLA 3Q9TA 4C3XA 3GM6A 1YKJA 2QA2A 2XCGA 4FDCB 4HB9A 4BJYA 4Z2RA 1DJNA 3NIXA 2RF7A 1H83A 2A87A 1H7XA 3NRNA 4Q17A 1JOAA 4Q0TA 1ZP0A 3NK1X 4A99A 4D03A 3SQPA 2B7SA 2WU5A 5EOWA 4Q4UA 5GRTA 5BVAA 5M10A 4BK2A 2BYBA 1OJCA 2YVJA 2BA9A 4GR1A 1CC4A 2VVLG 3VR8A 3KVEA 1BVBA 1D4DA 2H89A 3FIMB 3QVPA 5JCLA 2OLOA 1Q9IA 1PJ7A 1PBFA 2V3AA 1GETA 2XLRA 3AEDA 1JRXA 1FS7A 3T37A 2IVEA 4H2PA 4J31A 2NVKX 4H2NA 4APNA 2GAHB 3NT6A 1FECA 4UDRA 4DSHA 4NTCA 3NHOX 2V6OA 3AEFA 3RHAA 3GMBA 3F29A 5IPYA 1DODA 2YLWA 4YSZA 4B64A 3CN8A 3VRBA 1VG9A 2VRMA 4USQA 1LJ1A 4CCQA 2Y6RA 3TTBA 2PHHA 4Q1OA 2R46A 2XLUA 1M1QA 3GD3A 2ZO5A 4KX6A 4H4WA 2B9XA 2VQBA 3R9UA 3S5WA 5GSNA 1F8RA 4A6NA 4DGKA 3AB1A 1S3BA 4Z44A 1GTEA 5FS6A 1V59A 3AE8A 4TM4A 3ZDNA 3IF9A 4OPUA 3SGLA 4PABA 3C4NA 4CY8A 1COYA 2R9ZA 4BJZA 4XXGA 1RYIA 4FK1A 3OC4A 1F8WA 2RGHA 4I58A 4B69A 4EQXA 3D8XA 1JRZA 2GR1A 3E1TA 3RKHA 3G5SA 4UDPA 1JRYA 4A7AA 2B7RA 4X9NA 2GMJA 4UDQA 2R0GA 2YM2A 3UKAA 2BS3A 4L38A 2BXSA 3O0HA 5IQ4A 2VZ2A 3CPHG 3DH9A 3UKQA 3VRAA 1KNRA 3UP4A 1CC2A 4K8DA 1E7PA 4FX9A 4BURA 4J34A 1GXFA 2YLRA 2C70A 3DJEA 4GDEA 2XLTA 2VVLA 2WP9A 2A89A 5HXIA 4JY3A 2CFYA 5FS8A 3AD9B 2ZZ0A 2CDUA 1PN0A 3NN0X 3EANA 3SFDA 3UP5A 1PBBA 2BXRA 2E4GA 1LPFA 4UP3A 4Y4NA 2JK6A 3AE3A 3GRTA 1DOBA 4C77A 2E5VA 4O5UA 1GRHA 3I6DA 1BWCA 3LZWA 3NYEA 3LXDA 4ZN0A 2GH5A 1GTHA 2R0CA 1NPXA 3K7QX 5KWFA 1P2HA 1ZY8A 3IHGA 1O95A 1DJQA 5KVIA 1LV0A 1IUSA 1F8SA 1O94A 2EQ7A 3KD9A 2XFOA 1F6MA 2IVDA 2CVJA 4XWRA 3SM8A 3FBSA 3KKJA 2YG5A 1PHHA 3AYJA 3C4AA 4IA5A 1PDHA 1ZOYA 2DKHA 3UKPA 3ATQA 3ICRA 4A9WA 1LTXR 1DOCA 2V61A 1DNCA 2Z5XA 1NHSA 4RG4A 4B63A 1GPEA 1NDAA 2XYOA 2JB3A 1PBDA 4U8MA 2WBAA 4H2RA 3UTEA 1IUXA 1O5WA 4EMJA 1CHUA 1K0JA 1PS9A 4OCGA 3NN6X 4YWOA 2YR6A 1JU2A 1YQ4A 3F8RA 5U25A 3ADAB 3L8KA 2GQFA 2GMHA 1NG4A 1EL8A 2BC1A 2GAGB 4Z43A 2VQ7A 2FJDA 4I59A 4H4QA 1JNIA 3BI5A 3FMWA 1IUWA 1Y56A 1OJTA 5U63A 2K3VA 1S3EA 1YY5A 2XVJA 1BGJA 3EAOA 1QDBA 4KPRA 4X4JA 1N4VA 2EQ8A 3ITJA 1Z6LA 1H6VA 1NENA 4X9MA 4C5OA 3AE6A 2R0PA 4K2XA 3AEGA 5EB4A 3BNJA 3REDA 4A79A 1GRAA 4YTMA 3UKKA 4NZHA 2XFPA 1XANA 1GEUA 2FJEA 3UKHA 3HZLA 2YLSA 3BHKA 1PBCA 2WESA 4H2QA 4WJYA 3GMCA 1LQUA 3P4PA 4A5LA 4AOSA 2WDVA 1VRQB 1FT6A 1B4VA 2B76A 3UCLA 3KLJA 1ZOVA 2C64A 1N4UA 2RGOA 2JB1A 1NHPA 4EM3A 2XVFA 1K4QA 3RP6A 2RDZA 1KSSA 3CNDA 2WP6A 3L1TA 3UTGA 1GU6A 1EL9A 1TRBA 4B67A 3GDNA 2OALA 1D7LA 3AEEA 1IUVA 1H82A 1NHQA 1H84A 2AR8A 3K7MX 2JAEA 1ONFA 3L1RA 1M64A 2BS4A 1CJ2A 4OPCA 4TLXA 4RG3A 2AAQA 2XFQA 1GRGA 3MMOA 3GRSA 2C3DA 1TDOA 4EQRA 4CCRA 3GSIA 1VQWA 3DK4A 2Q7VA 3UKFA 1QLBA 3COXA 2X8HA 4YKGA 2XVEA 3TORA 1P2EA 2YQUA 3CGBA 4NEVA 2ZZCA 5EB5A 3P4SA 3P4RA 3EPTA 1ELIA 3CGEA 4TM1A 4J33A 2ARDA 1MXTA 1QO8A 1X31B 2O9ZA 1LQTA 3NG7X 4EMIA 3IWAA 4JQ9A 5JCNA 3AE2A 3UTHA 4Z24A 2WETA 2F5ZA 2Z5YA 2CULA 3G5RA 2H88A 2C72A 1IUUA 1PXAA 3EF6A 4P9SA 2YG4A 3NTAA 3ICTA 5HHFA 4B65A 1RP0A 1M1PA 3F8PA 3NKSA 3QFAA 4H4PA 4C3YA 1E1MA 2W0HA 4K5SA 2XDOA 2WPEA 3GWDA 4YTNA 1FL2A 3BI2A 2ZZBA 3V3NA 3AD8B 2GQWA 2JKCA 3ICSA 3F8DA 4IA6A 5ER0A 1KSUA 2VRLA 4H4ZA 4OPDA 2OT4A 5BUKA 1ZDLA 3BI4A 4ECHA 2UZZA 1GOSA 4ZCDA 2ZBWA 5JCMA 3NYFA 4DSGA 2YVFA 1GESA 2E1MA 3IC9A 4K5RA 1CF3A 1N1PA 2A8XA 3P9UA 1GRTA 3PS9A 4NEWA 3AE4A 2GEWA 3AD7B 3BNHA 3BNGA 1OJAA 1SEZA 4BV6A 3D1IA 3OZ2A 4JNAA 4AT0A 4ADWA 4D04A 2BS2A 3UOYA 1GSNA 1E39A 1ZK7A 2QA1A 5KRQA 2RGJA 1JEHA 1DXLA 2GVCA 3GYIA 4H4UA 5TR3A 4J36A 2GV8A 3S7WA 4AT2A 5J7XA 3SCEA 2C65A 1GRFA 2X99A 1FT5A 3ISHA 4U8OA 2WPFA 3RP7A 3NLCA 4XWZA 3UTFA 1M6IA 3GWFA 3H4KA 3QSEA 2QAEA 1FEAA 1PXCA 4USRA 5FMHA 2OAMA 4U8IA 3RP8A 2GR2A 3SFEA 2YM1A 3AE1A 2DKIA 4YTPA 4C74A 3CNTA 1S2QA 3FG2P 3H8LA 3NK2X 4IVMB 1CJ3A 3AXBA 3GYJA 4Q5CA 3DJGX 3S61A 4YSYA 4OVIA 2V60A 3DJDA 5BULA 4Q5BA 3B6DA 4A65A 4IVOB 2FBWA 3ALMA 3KU9A 4BK3A 5C3JA 4H4SA 2Y6QA 4U2LA 3ALJA 4PAAA 5JCIA 1GNDA 3P4QA 1UKVG 4DNAA 1TDEA 2VOUA 3AWIA 4H4VA 2YG7A 2BCPA 2QCUA 3OWMA 5HY5A 4E0VA 1K0IA 3FO3A 3AEBA 1JNRA 4GF7A 2C3CA 2WS3A 1YQZA 1W4XA 2RABA 2C66A 3GD4A 2X8CA 1SP3A 3V3OA 3WE0A 4L3XA 2Q0KA 5JCKA 1TDKA 1F3PA 1B8SA 4YSHA 3AECA 3K30A 3LB8A 1K0LA 1H86A 1KF6A 2BC0A 3NH3X 4HA6A 3KPFA 4O5QA 1JNZA 5FS9A 4EIQA 4U8NA 5C2TA 1BGNA 1Q1WA 2BK5A 3AE9A 1GALA 2YLXA 2EQ6A 5KOXA 3C96A 4J56A 1N4WA 4NTDA 4AP1A 1REOA 4EQSA 3BNFA 2NPXA 1E6EA 1L0VA 1GERA 4GUVA 2BACA 3FPZA 1VDCA 3DK8A 2GR3A 3RNMA 3UU9A 2YG6A 4U8PA 2LFCA 3K7TA 1B37A 1GRBA 3NYCA 4RSLA 2TPRA 4Z2UA 5KOWA 1NAAA 2GB0A 5IQ1A 3AYIA 4Z26A 5HYMA 1YQ3A 2C7GA 1XHCA 1CC6A
chains in the Genus database with same CATH superfamily
2WEUA 1ZMDA 2WOWA 4Z25A 4OPIA 3LG1A 3GDPA 4WX1A 1Y0PA 3CTYA 1FS9A 1E1LA 1Q1RA 2I0ZA 3UOXA 2IIDA 4REKA 4AOXA 2R4JA 4IV9A 1RSGA 3I3LA 4CY6A 3M13A 2XVIA 3NK0X 1NHRA 1IUTA 1PXBA 3VQRA 4OPLA 4CNKA 5BRTA 4N9XA 1M1RA 2R4EA 3UBRA 2V5ZA 3CNJA 2WU2A 3NNEA 1CBOA 1ZMCA 1EL7A 4LU6A 3QJ4A 4H4TA 4CNJA 2B9WA 4L3YA 4B1BA 1VG0A 4LA1A 1KNPA 3VR9A 1CL0A 1D7YA 4YSXA 4Y4MA 3CPJG 2YLZA 2XVHA 1L9DA 2C67A 4K22A 3V76A 4Z2TA 1DOEA 3NTDA 4L3ZA 1NG3A 4EMWA 3Q6JA 1BF3A 2GRTA 5EBKA 2VVMA 4GDPA 1OAHA 2FJAA 5LV9A 3SZ0A 3AE7A 3QSSA 2C76A 2JBVA 2J7AA 1D5TA 2WDQA 1TDNA 1GV4A 4H4XA 4ZCCA 1XPQA 4OPGA 2J3NA 2WDRA 3SZFA 3T2YA 3BHFA 1LVLA 3DGHA 1FCDA 3CNPA 2C73A 3DMEA 3M0OA 3AE5A 2PYXA 2X8GA 1FOHA 3URHA 3UOVA 2YR5A 2XLPA 3LGQA 4NTEA 2OLNA 2XFNA 2X3NA 2WOVA 4TM0A 3DJJA 4A6NB 2Q0LA 1XDIA 1ZKQA 2FJBA 1OJDA 4YXDA 5J60A 1E1KA 1PJ6A 4G9KA 4U8KA 3QVRA 1L9CA 3LZXA 1OJ9A 3D1CA 2XLSA 4YT0A 3LADA 1BZLA 4BK1A 4JN9A 5KXJA 1GREA 2WQYA 4Y4LA 4CRTA 2BCGG 4GRTA 1PBEA 2AQJA 2BK3A 1D4CA 5U1OA 2ACZA 2TMDA 4LIIA 4YKFA 4U2SA 3ABVA 4H4RA 1MO9A 5KMPA 2R45A 5DBJA 5L46A 2GR0A 1Y56B 2YR4A 2B9YA 3HYXA 3H8IA 4II2A 2C75A 1KDGA 3KA7A 4H50A 2Q6UA 1NEKA 3SXQA 1CJ4A 2HQMA 5M0ZA 2CZSA 2YAUA 4H7UA 2YG3A 1MOKA 4U8JA 3SXIA 2YWLA 2YLTA 1FS8A 3NGCX 4U8LA 4AP3A 1L9EA 2WHDA 3G5QA 4OPTA 1S2YA 3AYLA 2GF3A 2V3BA 3CNSA 4B66A 1BKWA 1ZX9A 1TYTA 1EL5A 1IJHA 3CIRA 4H4YA 3PO7A 1EBDA 5CKUA 3CGCA 4CBQA 4JY2A 1PJ5A 3PVCA 2APGA 4EIPA 1AOGA 1HYUA 4M52A 3UKLA 1FEBA 4JNQA 4TM3A 2WOIA 1CJCA 2XFUA 3CPIG 4K7ZA 4B68A 2EQ9A 4G73A 3DA1A 3LOVA 1H7WA 4EM4A 3VRDB 2YVGA 3BNMA 2C4CA 2VR0A 3M12A 5FS7A 2E81A 2OA1A 4TLZA 3QSMA 4JDRA 4WCTA 3AEAA 2JB2A 5KVHA 2E80A 2BK4A 4MJWA 1KFYA 3CGDA 3ZYXA 4EQWA 3B3RA 4ICYA 5CQFA 4GCMA 3T14A 2WPCA 1TYPA 4J57A 3JSKA 1GT8A 2X50A 3II4A 1H81A 3UOZA 3KPKA 3LJPA 1D4EA 1E1NA 3DGZA 4FK1C 1QJDA 3ATRA 1TDFA 2BABA 3P1WA 3IHMA 2WP5A 4U2TA 3GYXA 3BNUA 4J2WA 1B5QA 3QFBA 3DK9A 3ALLA 3Q9TA 4C3XA 3GM6A 1YKJA 2QA2A 2XCGA 4FDCB 4HB9A 4BJYA 4Z2RA 1DJNA 3NIXA 2RF7A 1H83A 2A87A 1H7XA 3NRNA 4Q17A 1JOAA 4Q0TA 1ZP0A 3NK1X 4A99A 4D03A 3SQPA 2B7SA 2WU5A 5EOWA 4Q4UA 5GRTA 5BVAA 5M10A 4BK2A 2BYBA 1OJCA 2YVJA 2BA9A 4GR1A 1CC4A 2VVLG 3VR8A 3KVEA 1BVBA 3HYVA 1D4DA 2H89A 3FIMB 3QVPA 5JCLA 2OLOA 1Q9IA 1PJ7A 1PBFA 2V3AA 1GETA 2XLRA 3AEDA 1JRXA 1FS7A 3T37A 2IVEA 4H2PA 4J31A 2NVKX 4H2NA 4APNA 2GAHB 3NT6A 1FECA 4UDRA 5KMSA 4DSHA 4NTCA 3NHOX 2V6OA 3AEFA 3RHAA 3GMBA 3F29A 5IPYA 1DODA 2YLWA 4YSZA 4B64A 3CN8A 3VRBA 4G6HA 1VG9A 2VRMA 4USQA 1LJ1A 4CCQA 2Y6RA 3TTBA 2PHHA 4Q1OA 2R46A 2XLUA 1M1QA 3GD3A 2ZO5A 4KX6A 4H4WA 2B9XA 2VQBA 3R9UA 3S5WA 5GSNA 1F8RA 4A6NA 4DGKA 3AB1A 1S3BA 4Z44A 1GTEA 3CMMA 5FS6A 1V59A 3AE8A 4TM4A 3ZDNA 3IF9A 4OPUA 3SGLA 4PABA 3C4NA 4CY8A 1COYA 2R9ZA 4BJZA 4XXGA 3SX6A 1RYIA 4FK1A 3OC4A 3T2ZA 1F8WA 2RGHA 4I58A 4B69A 4EQXA 3D8XA 1JRZA 2GR1A 3E1TA 3RKHA 3G5SA 4UDPA 1JRYA 4A7AA 2B7RA 4X9NA 2GMJA 3SYIA 4UDQA 2R0GA 2YM2A 3UKAA 2BS3A 4L38A 2BXSA 3O0HA 5IQ4A 2VZ2A 3CPHG 3DH9A 3UKQA 3VRAA 1KNRA 3UP4A 1CC2A 4K8DA 1E7PA 4FX9A 3SZCA 4BURA 4J34A 1GXFA 3T0KA 2YLRA 2C70A 3DJEA 4GDEA 2XLTA 2VVLA 2WP9A 2A89A 5HXIA 4JY3A 2CFYA 5FS8A 3AD9B 2ZZ0A 2CDUA 1PN0A 3NN0X 3EANA 3SFDA 3UP5A 1PBBA 2BXRA 2E4GA 1LPFA 4UP3A 4Y4NA 2JK6A 3AE3A 3GRTA 1DOBA 4C77A 2E5VA 4O5UA 1GRHA 3I6DA 1BWCA 3LZWA 3NYEA 3LXDA 4ZN0A 2GH5A 1GTHA 2R0CA 1NPXA 3K7QX 5KWFA 1P2HA 1ZY8A 3IHGA 1O95A 1DJQA 5KVIA 1LV0A 1IUSA 1F8SA 1O94A 2EQ7A 3KD9A 2XFOA 1F6MA 2IVDA 2CVJA 4XWRA 3SM8A 3FBSA 3KKJA 2YG5A 1PHHA 3AYJA 3C4AA 4IA5A 1PDHA 1ZOYA 2DKHA 3UKPA 3ATQA 3ICRA 4A9WA 1LTXR 1DOCA 2V61A 1DNCA 2Z5XA 1NHSA 3T31A 4RG4A 4B63A 1GPEA 1NDAA 2XYOA 2JB3A 1PBDA 4U8MA 2WBAA 4H2RA 3UTEA 1IUXA 1O5WA 4EMJA 1CHUA 1K0JA 1PS9A 4OCGA 3NN6X 4YWOA 2YR6A 1JU2A 1YQ4A 3F8RA 5U25A 3ADAB 3L8KA 2GQFA 2GMHA 1NG4A 1EL8A 2BC1A 2GAGB 4Z43A 2VQ7A 2FJDA 4I59A 4H4QA 1JNIA 3BI5A 3FMWA 1IUWA 1Y56A 1OJTA 5U63A 2K3VA 1S3EA 1YY5A 2XVJA 1BGJA 3EAOA 1QDBA 4KPRA 4X4JA 1N4VA 2EQ8A 3ITJA 1Z6LA 1H6VA 1NENA 4X9MA 4C5OA 3AE6A 2R0PA 4K2XA 3AEGA 5EB4A 3BNJA 3REDA 4A79A 1GRAA 4YTMA 3UKKA 4NZHA 2XFPA 3SY4A 1XANA 1GEUA 2FJEA 4NNJA 3UKHA 3HZLA 2YLSA 3BHKA 1PBCA 2WESA 4H2QA 4WJYA 3GMCA 1LQUA 3P4PA 4A5LA 4AOSA 2WDVA 1VRQB 1FT6A 1B4VA 2B76A 3UCLA 3KLJA 1ZOVA 2C64A 1N4UA 2RGOA 2JB1A 1NHPA 4EM3A 2XVFA 1K4QA 3RP6A 2RDZA 1KSSA 3CNDA 2WP6A 3L1TA 3UTGA 4NWZA 1GU6A 1EL9A 1TRBA 4B67A 3GDNA 2OALA 1D7LA 3AEEA 1IUVA 1H82A 1NHQA 1H84A 2AR8A 3K7MX 4GAPA 2JAEA 1ONFA 3L1RA 1M64A 2BS4A 1CJ2A 4OPCA 4TLXA 4RG3A 2AAQA 2XFQA 1GRGA 3MMOA 3GRSA 2C3DA 2BRYA 1TDOA 4EQRA 4CCRA 3GSIA 1VQWA 3DK4A 2Q7VA 3UKFA 1QLBA 3COXA 2X8HA 4YKGA 2XVEA 3TORA 1P2EA 2YQUA 3CGBA 4NEVA 2ZZCA 5EB5A 3P4SA 3P4RA 3EPTA 1ELIA 3CGEA 4TM1A 4J33A 2ARDA 1MXTA 1QO8A 1X31B 2O9ZA 1LQTA 3NG7X 4EMIA 3IWAA 4JQ9A 5JCNA 3AE2A 3UTHA 4Z24A 2WETA 2F5ZA 2Z5YA 2CULA 3G5RA 2H88A 2C72A 1IUUA 1PXAA 3EF6A 4P9SA 2YG4A 3NTAA 3ICTA 5HHFA 4B65A 1RP0A 1M1PA 3F8PA 3NKSA 3QFAA 4H4PA 4C3YA 1E1MA 2W0HA 4K5SA 2XDOA 2WPEA 3GWDA 4YTNA 1FL2A 3BI2A 2ZZBA 3V3NA 4GAVA 3AD8B 3HYWA 2GQWA 2JKCA 3ICSA 3F8DA 4IA6A 5ER0A 1KSUA 2VRLA 4H4ZA 4OPDA 2OT4A 5BUKA 5KMRA 1ZDLA 3BI4A 4ECHA 2UZZA 1GOSA 4ZCDA 5KNLA 2ZBWA 5JCMA 3NYFA 4DSGA 2YVFA 1GESA 4II3A 2E1MA 3IC9A 4K5RA 1CF3A 1N1PA 2A8XA 3P9UA 1GRTA 3PS9A 4NEWA 3AE4A 2GEWA 3AD7B 3BNHA 3BNGA 1OJAA 1SEZA 4BV6A 3D1IA 3OZ2A 4JNAA 4AT0A 4ADWA 4D04A 2BS2A 3UOYA 1GSNA 1E39A 1ZK7A 2QA1A 5KRQA 2RGJA 1JEHA 1DXLA 2GVCA 3GYIA 4H4UA 5TR3A 4J36A 2GV8A 3S7WA 4AT2A 5J7XA 3SCEA 2C65A 1GRFA 2X99A 1FT5A 3ISHA 4U8OA 2WPFA 3RP7A 3NLCA 4XWZA 3UTFA 1M6IA 3GWFA 3H4KA 3QSEA 2QAEA 1FEAA 1PXCA 4USRA 5FMHA 2OAMA 4U8IA 3RP8A 2GR2A 3SFEA 2YM1A 3AE1A 2DKIA 3SZWA 4YTPA 4C74A 3CNTA 1S2QA 3FG2P 3H8LA 3NK2X 4IVMB 1CJ3A 3AXBA 3GYJA 4Q5CA 3DJGX 3S61A 4YSYA 4OVIA 2V60A 3DJDA 5BULA 4Q5BA 3B6DA 4A65A 4IVOB 2FBWA 3ALMA 2BRAA 3KU9A 4BK3A 5C3JA 4H4SA 2Y6QA 4U2LA 3ALJA 4PAAA 5JCIA 1GNDA 3P4QA 1UKVG 4DNAA 1TDEA 2VOUA 3AWIA 3T2KA 5KMQA 4H4VA 2YG7A 2BCPA 2QCUA 3OWMA 5HY5A 4E0VA 1K0IA 3FO3A 3AEBA 1JNRA 4GF7A 2C3CA 2WS3A 1YQZA 1W4XA 2RABA 2C66A 3GD4A 2X8CA 1SP3A 3V3OA 3WE0A 4L3XA 2Q0KA 5JCKA 1TDKA 1F3PA 1B8SA 4YSHA 3AECA 3K30A 3LB8A 1K0LA 1H86A 1KF6A 2BC0A 3NH3X 4HA6A 3KPFA 4O5QA 1JNZA 5FS9A 4EIQA 4U8NA 5C2TA 1BGNA 1Q1WA 2BK5A 3AE9A 1GALA 2YLXA 2EQ6A 4G6GA 5KOXA 3C96A 4J56A 1N4WA 4NTDA 4AP1A 1REOA 4EQSA 3BNFA 2NPXA 4G74A 1E6EA 1L0VA 1GERA 4GUVA 2BACA 3FPZA 1VDCA 3DK8A 2GR3A 3RNMA 3UU9A 2YG6A 4U8PA 2LFCA 3K7TA 1B37A 1GRBA 3NYCA 4RSLA 2TPRA 4Z2UA 5KOWA 1NAAA 2GB0A 5IQ1A 3AYIA 4Z26A 5HYMA 1YQ3A 2C7GA 1XHCA 1CC6A
chains in the Genus database with same CATH topology
2WEUA 1ZMDA 2WOWA 4Z25A 4OPIA 3LG1A 3GDPA 4WX1A 1Y0PA 3CTYA 1FS9A 1E1LA 1Q1RA 2I0ZA 3UOXA 2IIDA 4REKA 4AOXA 2R4JA 4IV9A 1RSGA 3I3LA 4CY6A 3M13A 2XVIA 3NK0X 1NHRA 1IUTA 1PXBA 3VQRA 4OPLA 4CNKA 5BRTA 4N9XA 1M1RA 2R4EA 3UBRA 2V5ZA 3CNJA 2WU2A 3NNEA 1CBOA 1ZMCA 1EL7A 4LU6A 3QJ4A 4H4TA 4CNJA 2B9WA 4L3YA 4B1BA 1VG0A 4LA1A 1KNPA 3VR9A 1CL0A 1D7YA 4YSXA 4Y4MA 3CPJG 2YLZA 2XVHA 1L9DA 2C67A 4K22A 3V76A 4Z2TA 1DOEA 3NTDA 4L3ZA 1NG3A 4EMWA 3Q6JA 1BF3A 2GRTA 5EBKA 2VVMA 4GDPA 1OAHA 2FJAA 5LV9A 3SZ0A 3AE7A 3QSSA 2C76A 2JBVA 2J7AA 1D5TA 2WDQA 1TDNA 1GV4A 4H4XA 4ZCCA 1XPQA 4OPGA 2J3NA 2WDRA 3SZFA 3T2YA 3BHFA 1LVLA 3DGHA 1FCDA 3CNPA 2C73A 3DMEA 3M0OA 3AE5A 2PYXA 2X8GA 1FOHA 3URHA 3UOVA 2YR5A 2XLPA 3LGQA 4NTEA 2OLNA 2XFNA 2X3NA 2WOVA 4TM0A 3DJJA 4A6NB 2Q0LA 1XDIA 1ZKQA 2FJBA 1OJDA 4YXDA 5J60A 1E1KA 1PJ6A 4G9KA 4U8KA 3QVRA 1L9CA 3LZXA 1OJ9A 3D1CA 2XLSA 4YT0A 3LADA 1BZLA 4BK1A 4JN9A 5KXJA 1GREA 2WQYA 4Y4LA 4CRTA 2BCGG 4GRTA 1PBEA 2AQJA 2BK3A 1D4CA 5U1OA 2ACZA 2TMDA 4LIIA 4YKFA 4U2SA 3ABVA 4H4RA 1MO9A 5KMPA 2R45A 5DBJA 5L46A 2GR0A 1Y56B 2YR4A 2B9YA 3HYXA 3H8IA 4II2A 2C75A 1KDGA 3KA7A 4H50A 2Q6UA 1NEKA 3SXQA 1CJ4A 2HQMA 5M0ZA 2YAUA 4H7UA 2YG3A 1MOKA 4U8JA 3SXIA 2YWLA 2YLTA 1FS8A 3NGCX 4U8LA 4AP3A 1L9EA 2WHDA 3G5QA 4OPTA 1S2YA 3AYLA 2GF3A 2V3BA 3CNSA 4B66A 1BKWA 1ZX9A 1TYTA 1EL5A 1IJHA 3CIRA 4H4YA 3PO7A 1EBDA 5CKUA 3CGCA 4CBQA 4JY2A 1PJ5A 3PVCA 2APGA 4EIPA 1AOGA 1HYUA 4M52A 3UKLA 1FEBA 4JNQA 4TM3A 2WOIA 1CJCA 2XFUA 3CPIG 4K7ZA 4B68A 2EQ9A 4G73A 3DA1A 3LOVA 1H7WA 4EM4A 3VRDB 2YVGA 3BNMA 2C4CA 2VR0A 3M12A 5FS7A 2E81A 2OA1A 4TLZA 3QSMA 4JDRA 4WCTA 3AEAA 2JB2A 5KVHA 2E80A 2BK4A 4MJWA 1KFYA 3CGDA 3ZYXA 4EQWA 3B3RA 4ICYA 5CQFA 4GCMA 3T14A 2WPCA 1TYPA 4J57A 3JSKA 1GT8A 2X50A 3II4A 1H81A 3UOZA 3KPKA 3LJPA 1D4EA 1E1NA 3DGZA 4FK1C 1QJDA 3ATRA 1TDFA 2BABA 3P1WA 3IHMA 2WP5A 4U2TA 3GYXA 3BNUA 4J2WA 1B5QA 3QFBA 3DK9A 3ALLA 3Q9TA 4C3XA 3GM6A 1YKJA 2QA2A 2XCGA 4FDCB 4HB9A 4BJYA 4Z2RA 1DJNA 3NIXA 2RF7A 1H83A 2A87A 1H7XA 3NRNA 4Q17A 1JOAA 4Q0TA 1ZP0A 3NK1X 4A99A 4D03A 3SQPA 2B7SA 2WU5A 5EOWA 4Q4UA 5GRTA 5BVAA 5M10A 4BK2A 2BYBA 1OJCA 2YVJA 2BA9A 4GR1A 1CC4A 2VVLG 3VR8A 3KVEA 1BVBA 3HYVA 1D4DA 2H89A 3FIMB 3QVPA 5JCLA 2OLOA 1Q9IA 1PJ7A 1PBFA 2V3AA 1GETA 2XLRA 3AEDA 1JRXA 1FS7A 3T37A 2IVEA 4H2PA 4J31A 2NVKX 4H2NA 4APNA 2GAHB 3NT6A 1FECA 4UDRA 5KMSA 4DSHA 4NTCA 3NHOX 2V6OA 3AEFA 3RHAA 3GMBA 3F29A 5IPYA 1DODA 2YLWA 4YSZA 4B64A 3CN8A 3VRBA 4G6HA 1VG9A 2VRMA 4USQA 1LJ1A 4CCQA 2Y6RA 3TTBA 2PHHA 4Q1OA 2R46A 2XLUA 1M1QA 3GD3A 2ZO5A 4KX6A 4H4WA 2B9XA 2VQBA 3R9UA 3S5WA 5GSNA 1F8RA 4A6NA 4DGKA 3AB1A 1S3BA 4Z44A 1GTEA 3CMMA 5FS6A 1V59A 3AE8A 4TM4A 3ZDNA 3IF9A 4OPUA 3SGLA 4PABA 3C4NA 4CY8A 1COYA 2R9ZA 4BJZA 4XXGA 3SX6A 1RYIA 4FK1A 3OC4A 3T2ZA 1F8WA 2RGHA 4I58A 4B69A 4EQXA 3D8XA 1JRZA 2GR1A 3E1TA 3RKHA 3G5SA 4UDPA 1JRYA 4A7AA 2B7RA 4X9NA 2GMJA 3SYIA 4UDQA 2R0GA 2YM2A 3UKAA 2BS3A 4L38A 2BXSA 3O0HA 5IQ4A 2VZ2A 3CPHG 3DH9A 3UKQA 3VRAA 1KNRA 3UP4A 1CC2A 4K8DA 1E7PA 4FX9A 3SZCA 4BURA 4J34A 1GXFA 3T0KA 2YLRA 2C70A 3DJEA 4GDEA 2XLTA 2VVLA 2WP9A 2A89A 5HXIA 4JY3A 2CFYA 5FS8A 3AD9B 2ZZ0A 2CDUA 1PN0A 3NN0X 3EANA 3SFDA 3UP5A 1PBBA 2BXRA 2E4GA 1LPFA 4UP3A 4Y4NA 2JK6A 3AE3A 3GRTA 1DOBA 4C77A 2E5VA 4O5UA 1GRHA 3I6DA 1BWCA 3LZWA 3NYEA 3LXDA 4ZN0A 2GH5A 1GTHA 2R0CA 1NPXA 3K7QX 5KWFA 1P2HA 1ZY8A 3IHGA 1O95A 1DJQA 5KVIA 1LV0A 1IUSA 1F8SA 1O94A 2EQ7A 3KD9A 2XFOA 1F6MA 2IVDA 2CVJA 4XWRA 3SM8A 3FBSA 3KKJA 2YG5A 1PHHA 3AYJA 3C4AA 4IA5A 1PDHA 1ZOYA 2DKHA 3UKPA 3ATQA 3ICRA 4A9WA 1LTXR 1DOCA 2V61A 1DNCA 2Z5XA 1NHSA 3T31A 4RG4A 4B63A 1GPEA 1NDAA 2XYOA 2JB3A 1PBDA 4U8MA 2WBAA 4H2RA 3UTEA 1IUXA 1O5WA 4EMJA 1CHUA 1K0JA 1PS9A 4OCGA 3NN6X 4YWOA 2YR6A 1JU2A 1YQ4A 3F8RA 5U25A 3ADAB 3L8KA 2GQFA 2GMHA 1NG4A 1EL8A 2BC1A 2GAGB 4Z43A 2VQ7A 2FJDA 4I59A 4H4QA 1JNIA 3BI5A 3FMWA 1IUWA 1Y56A 1OJTA 5U63A 2K3VA 1S3EA 1YY5A 2XVJA 1BGJA 3EAOA 1QDBA 4KPRA 4X4JA 1N4VA 2EQ8A 3ITJA 1Z6LA 1H6VA 1NENA 4X9MA 4C5OA 3AE6A 2R0PA 4K2XA 3AEGA 5EB4A 3BNJA 3REDA 4A79A 1GRAA 4YTMA 3UKKA 4NZHA 2XFPA 3SY4A 1XANA 1GEUA 2FJEA 4NNJA 3UKHA 3HZLA 2YLSA 3BHKA 1PBCA 2WESA 4H2QA 4WJYA 3GMCA 1LQUA 3P4PA 4A5LA 4AOSA 2WDVA 1VRQB 1FT6A 1B4VA 2B76A 3UCLA 3KLJA 1ZOVA 2C64A 1N4UA 2RGOA 2JB1A 1NHPA 4EM3A 2XVFA 1K4QA 3RP6A 2RDZA 1KSSA 3CNDA 2WP6A 3L1TA 3UTGA 4NWZA 1GU6A 1EL9A 1TRBA 4B67A 3GDNA 2OALA 1D7LA 3AEEA 1IUVA 1H82A 1NHQA 1H84A 2AR8A 3K7MX 4GAPA 2JAEA 1ONFA 3L1RA 1M64A 2BS4A 1CJ2A 4OPCA 4TLXA 4RG3A 2AAQA 2XFQA 1GRGA 3MMOA 3GRSA 2C3DA 2BRYA 1TDOA 4EQRA 4CCRA 3GSIA 1VQWA 3DK4A 2Q7VA 3UKFA 1QLBA 3COXA 2X8HA 4YKGA 2XVEA 3TORA 1P2EA 2YQUA 3CGBA 4NEVA 2ZZCA 5EB5A 3P4SA 3P4RA 3EPTA 1ELIA 3CGEA 4TM1A 4J33A 2ARDA 1MXTA 1QO8A 1X31B 2O9ZA 1LQTA 3NG7X 4EMIA 3IWAA 4JQ9A 5JCNA 3AE2A 3UTHA 4Z24A 2WETA 2F5ZA 2Z5YA 2CULA 3G5RA 2H88A 2C72A 1IUUA 1PXAA 3EF6A 4P9SA 2YG4A 3NTAA 3ICTA 5HHFA 4B65A 1RP0A 1M1PA 3F8PA 3NKSA 3QFAA 4H4PA 4C3YA 1E1MA 2W0HA 4K5SA 2XDOA 2WPEA 3GWDA 4YTNA 1FL2A 3BI2A 2ZZBA 3V3NA 4GAVA 3AD8B 3HYWA 2GQWA 2JKCA 3ICSA 3F8DA 4IA6A 5ER0A 1KSUA 2VRLA 4H4ZA 4OPDA 2OT4A 5BUKA 5KMRA 1ZDLA 3BI4A 4ECHA 2UZZA 1GOSA 4ZCDA 5KNLA 2ZBWA 5JCMA 3NYFA 4DSGA 2YVFA 1GESA 4II3A 2E1MA 3IC9A 4K5RA 1CF3A 1N1PA 2A8XA 3P9UA 1GRTA 3PS9A 4NEWA 3AE4A 2GEWA 3AD7B 3BNHA 3BNGA 1OJAA 1SEZA 4BV6A 3D1IA 3OZ2A 4JNAA 4AT0A 4ADWA 4D04A 2BS2A 3UOYA 1GSNA 1E39A 1ZK7A 2QA1A 5KRQA 2RGJA 1JEHA 1DXLA 2GVCA 3GYIA 4H4UA 5TR3A 4J36A 2GV8A 3S7WA 4AT2A 5J7XA 3SCEA 2C65A 1GRFA 2X99A 1FT5A 3ISHA 4U8OA 2WPFA 3RP7A 3NLCA 4XWZA 3UTFA 1M6IA 3GWFA 3H4KA 3QSEA 2QAEA 1FEAA 1PXCA 4USRA 5FMHA 2OAMA 4U8IA 3RP8A 2GR2A 3SFEA 2YM1A 3AE1A 2DKIA 3SZWA 4YTPA 4C74A 3CNTA 1S2QA 3FG2P 3H8LA 3NK2X 4IVMB 1CJ3A 3AXBA 3GYJA 4Q5CA 3DJGX 3S61A 4YSYA 4OVIA 2V60A 3DJDA 5BULA 4Q5BA 3B6DA 4A65A 4IVOB 2FBWA 3ALMA 2BRAA 3KU9A 4BK3A 5C3JA 4H4SA 2Y6QA 4U2LA 3ALJA 4PAAA 5JCIA 1GNDA 3P4QA 1UKVG 4DNAA 1TDEA 2VOUA 3AWIA 3T2KA 5KMQA 4H4VA 2YG7A 2BCPA 2QCUA 3OWMA 5HY5A 4E0VA 1K0IA 3FO3A 3AEBA 1JNRA 4GF7A 2C3CA 2WS3A 1YQZA 1W4XA 2RABA 2C66A 3GD4A 2X8CA 1SP3A 3V3OA 3WE0A 4L3XA 2Q0KA 5JCKA 1TDKA 1F3PA 1B8SA 4YSHA 3AECA 3K30A 3LB8A 1K0LA 1H86A 1KF6A 2BC0A 3NH3X 4HA6A 3KPFA 4O5QA 1JNZA 5FS9A 4EIQA 4U8NA 5C2TA 1BGNA 1Q1WA 2BK5A 3AE9A 1GALA 2YLXA 2EQ6A 4G6GA 5KOXA 3C96A 4J56A 1N4WA 4NTDA 4AP1A 1REOA 4EQSA 3BNFA 2NPXA 4G74A 1E6EA 1L0VA 1GERA 4GUVA 2BACA 3FPZA 1VDCA 3DK8A 2GR3A 3RNMA 3UU9A 2YG6A 4U8PA 2LFCA 3K7TA 1B37A 1GRBA 3NYCA 4RSLA 2TPRA 4Z2UA 5KOWA 1NAAA 2GB0A 5IQ1A 3AYIA 4Z26A 5HYMA 1YQ3A 2C7GA 1XHCA 1CC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WEU A;  1ZMD A;  2WOW A;  4Z25 A;  4OPI A;  3LG1 A;  3GDP A;  4WX1 A;  1Y0P A;  3CTY A;  1FS9 A;  1E1L A;  1Q1R A;  2I0Z A;  3UOX A;  2IID A;  4REK A;  4AOX A;  2R4J A;  4IV9 A;  1RSG A;  3I3L A;  4CY6 A;  3M13 A;  2XVI A;  3NK0 X;  1NHR A;  1IUT A;  1PXB A;  3VQR A;  4OPL A;  4CNK A;  5BRT A;  4N9X A;  1M1R A;  2R4E A;  3UBR A;  2V5Z A;  3CNJ A;  2WU2 A;  3NNE A;  1CBO A;  1ZMC A;  1EL7 A;  4LU6 A;  3QJ4 A;  4H4T A;  4CNJ A;  2B9W A;  4L3Y A;  4B1B A;  1VG0 A;  4LA1 A;  1KNP A;  3VR9 A;  1CL0 A;  1D7Y A;  4YSX A;  4Y4M A;  3CPJ G;  2YLZ A;  2XVH A;  1L9D A;  2C67 A;  4K22 A;  3V76 A;  4Z2T A;  1DOE A;  3NTD A;  4L3Z A;  1NG3 A;  4EMW A;  3Q6J A;  1BF3 A;  2GRT A;  5EBK A;  2VVM A;  4GDP A;  1OAH A;  2FJA A;  5LV9 A;  3AE7 A;  3QSS A;  2C76 A;  2JBV A;  2J7A A;  1D5T A;  2WDQ A;  1TDN A;  1GV4 A;  4H4X A;  4ZCC A;  1XPQ A;  4OPG A;  2J3N A;  2WDR A;  3BHF A;  1LVL A;  3DGH A;  1FCD A;  3CNP A;  2C73 A;  3DME A;  3M0O A;  3AE5 A;  2PYX A;  2X8G A;  1FOH A;  3URH A;  3UOV A;  2YR5 A;  2XLP A;  3LGQ A;  4NTE A;  2OLN A;  2XFN A;  2X3N A;  2WOV A;  4TM0 A;  3DJJ A;  4A6N B;  2Q0L A;  1XDI A;  1ZKQ A;  2FJB A;  1OJD A;  4YXD A;  5J60 A;  1E1K A;  1PJ6 A;  4U8K A;  3QVR A;  1L9C A;  3LZX A;  1OJ9 A;  3D1C A;  2XLS A;  4YT0 A;  3LAD A;  1BZL A;  4BK1 A;  4JN9 A;  5KXJ A;  1GRE A;  2WQY A;  4Y4L A;  4CRT A;  2BCG G;  4GRT A;  1PBE A;  2AQJ A;  2BK3 A;  1D4C A;  5U1O A;  2ACZ A;  2TMD A;  4LII A;  4YKF A;  4U2S A;  3ABV A;  4H4R A;  1MO9 A;  2R45 A;  5DBJ A;  5L46 A;  2GR0 A;  1Y56 B;  2YR4 A;  2B9Y A;  3H8I A;  2C75 A;  1KDG A;  3KA7 A;  4H50 A;  2Q6U A;  1NEK A;  3SXQ A;  1CJ4 A;  2HQM A;  5M0Z A;  2YAU A;  4H7U A;  2YG3 A;  1MOK A;  4U8J A;  2YWL A;  2YLT A;  1FS8 A;  3NGC X;  4U8L A;  4AP3 A;  1L9E A;  2WHD A;  3G5Q A;  4OPT A;  1S2Y A;  3AYL A;  2GF3 A;  2V3B A;  3CNS A;  4B66 A;  1BKW A;  1ZX9 A;  1TYT A;  1EL5 A;  1IJH A;  3CIR A;  4H4Y A;  3PO7 A;  1EBD A;  5CKU A;  3CGC A;  4CBQ A;  4JY2 A;  1PJ5 A;  3PVC A;  2APG A;  4EIP A;  1AOG A;  1HYU A;  4M52 A;  3UKL A;  1FEB A;  4JNQ A;  4TM3 A;  2WOI A;  1CJC A;  2XFU A;  3CPI G;  4K7Z A;  4B68 A;  2EQ9 A;  3DA1 A;  3LOV A;  1H7W A;  4EM4 A;  3VRD B;  2YVG A;  3BNM A;  2VR0 A;  3M12 A;  5FS7 A;  2E81 A;  2OA1 A;  4TLZ A;  3QSM A;  4JDR A;  4WCT A;  3AEA A;  2JB2 A;  5KVH A;  2E80 A;  2BK4 A;  4MJW A;  1KFY A;  3CGD A;  3ZYX A;  4EQW A;  3B3R A;  4ICY A;  5CQF A;  4GCM A;  2WPC A;  1TYP A;  4J57 A;  3JSK A;  1GT8 A;  2X50 A;  3II4 A;  1H81 A;  3UOZ A;  3LJP A;  1D4E A;  1E1N A;  3DGZ A;  4FK1 C;  1QJD A;  3ATR A;  1TDF A;  2BAB A;  3P1W A;  3IHM A;  2WP5 A;  4U2T A;  3GYX A;  3BNU A;  4J2W A;  1B5Q A;  3QFB A;  3DK9 A;  3ALL A;  3Q9T A;  4C3X A;  3GM6 A;  1YKJ A;  2QA2 A;  2XCG A;  4FDC B;  4HB9 A;  4BJY A;  4Z2R A;  1DJN A;  3NIX A;  2RF7 A;  1H83 A;  2A87 A;  1H7X A;  3NRN A;  4Q17 A;  1JOA A;  4Q0T A;  1ZP0 A;  3NK1 X;  4A99 A;  4D03 A;  3SQP A;  2B7S A;  2WU5 A;  5EOW A;  4Q4U A;  5GRT A;  5BVA A;  5M10 A;  4BK2 A;  2BYB A;  1OJC A;  2YVJ A;  2BA9 A;  4GR1 A;  1CC4 A;  2VVL G;  3VR8 A;  3KVE A;  1BVB A;  1D4D A;  2H89 A;  3FIM B;  3QVP A;  5JCL A;  2OLO A;  1Q9I A;  1PJ7 A;  1PBF A;  2V3A A;  1GET A;  2XLR A;  3AED A;  1JRX A;  1FS7 A;  3T37 A;  2IVE A;  4H2P A;  4J31 A;  2NVK X;  4H2N A;  4APN A;  2GAH B;  3NT6 A;  1FEC A;  4UDR A;  4DSH A;  4NTC A;  3NHO X;  2V6O A;  3AEF A;  3RHA A;  3GMB A;  3F29 A;  5IPY A;  1DOD A;  2YLW A;  4YSZ A;  4B64 A;  3CN8 A;  3VRB A;  1VG9 A;  2VRM A;  4USQ A;  1LJ1 A;  4CCQ A;  2Y6R A;  3TTB A;  2PHH A;  4Q1O A;  2R46 A;  2XLU A;  1M1Q A;  3GD3 A;  2ZO5 A;  4KX6 A;  4H4W A;  2B9X A;  2VQB A;  3R9U A;  3S5W A;  5GSN A;  1F8R A;  4A6N A;  4DGK A;  3AB1 A;  1S3B A;  4Z44 A;  1GTE A;  5FS6 A;  1V59 A;  3AE8 A;  4TM4 A;  3ZDN A;  3IF9 A;  4OPU A;  3SGL A;  4PAB A;  3C4N A;  4CY8 A;  1COY A;  2R9Z A;  4BJZ A;  4XXG A;  1RYI A;  4FK1 A;  3OC4 A;  1F8W A;  2RGH A;  4I58 A;  4B69 A;  4EQX A;  3D8X A;  1JRZ A;  2GR1 A;  3E1T A;  3RKH A;  3G5S A;  4UDP A;  1JRY A;  4A7A A;  2B7R A;  4X9N A;  2GMJ A;  4UDQ A;  2R0G A;  2YM2 A;  3UKA A;  2BS3 A;  4L38 A;  2BXS A;  3O0H A;  5IQ4 A;  2VZ2 A;  3CPH G;  3DH9 A;  3UKQ A;  3VRA A;  1KNR A;  3UP4 A;  1CC2 A;  4K8D A;  1E7P A;  4FX9 A;  4BUR A;  4J34 A;  1GXF A;  2YLR A;  2C70 A;  3DJE A;  4GDE A;  2XLT A;  2VVL A;  2WP9 A;  2A89 A;  5HXI A;  4JY3 A;  2CFY A;  5FS8 A;  3AD9 B;  2ZZ0 A;  2CDU A;  1PN0 A;  3NN0 X;  3EAN A;  3SFD A;  3UP5 A;  1PBB A;  2BXR A;  2E4G A;  1LPF A;  4UP3 A;  4Y4N A;  2JK6 A;  3AE3 A;  3GRT A;  1DOB A;  4C77 A;  2E5V A;  4O5U A;  1GRH A;  3I6D A;  1BWC A;  3LZW A;  3NYE A;  3LXD A;  4ZN0 A;  2GH5 A;  1GTH A;  2R0C A;  1NPX A;  3K7Q X;  5KWF A;  1P2H A;  1ZY8 A;  3IHG A;  1O95 A;  1DJQ A;  5KVI A;  1LV0 A;  1IUS A;  1F8S A;  1O94 A;  2EQ7 A;  3KD9 A;  2XFO A;  1F6M A;  2IVD A;  2CVJ A;  4XWR A;  3SM8 A;  3FBS A;  3KKJ A;  2YG5 A;  1PHH A;  3AYJ A;  3C4A A;  4IA5 A;  1PDH A;  1ZOY A;  2DKH A;  3UKP A;  3ATQ A;  3ICR A;  4A9W A;  1LTX R;  1DOC A;  2V61 A;  1DNC A;  2Z5X A;  1NHS A;  4RG4 A;  4B63 A;  1GPE A;  1NDA A;  2XYO A;  2JB3 A;  1PBD A;  4U8M A;  2WBA A;  4H2R A;  3UTE A;  1IUX A;  1O5W A;  4EMJ A;  1CHU A;  1K0J A;  1PS9 A;  4OCG A;  3NN6 X;  4YWO A;  2YR6 A;  1JU2 A;  1YQ4 A;  3F8R A;  5U25 A;  3ADA B;  3L8K A;  2GQF A;  2GMH A;  1NG4 A;  1EL8 A;  2BC1 A;  2GAG B;  4Z43 A;  2VQ7 A;  2FJD A;  4I59 A;  4H4Q A;  1JNI A;  3BI5 A;  3FMW A;  1IUW A;  1Y56 A;  1OJT A;  5U63 A;  2K3V A;  1S3E A;  1YY5 A;  2XVJ A;  1BGJ A;  3EAO A;  1QDB A;  4KPR A;  4X4J A;  1N4V A;  2EQ8 A;  3ITJ A;  1Z6L A;  1H6V A;  1NEN A;  4X9M A;  4C5O A;  3AE6 A;  2R0P A;  4K2X A;  3AEG A;  5EB4 A;  3BNJ A;  3RED A;  4A79 A;  1GRA A;  4YTM A;  3UKK A;  4NZH A;  2XFP A;  1XAN A;  1GEU A;  2FJE A;  3UKH A;  3HZL A;  2YLS A;  3BHK A;  1PBC A;  2WES A;  4H2Q A;  4WJY A;  3GMC A;  1LQU A;  3P4P A;  4A5L A;  4AOS A;  2WDV A;  1VRQ B;  1FT6 A;  1B4V A;  2B76 A;  3UCL A;  3KLJ A;  1ZOV A;  2C64 A;  1N4U A;  2RGO A;  2JB1 A;  1NHP A;  4EM3 A;  2XVF A;  1K4Q A;  3RP6 A;  2RDZ A;  1KSS A;  3CND A;  2WP6 A;  3L1T A;  3UTG A;  1GU6 A;  1EL9 A;  1TRB A;  4B67 A;  3GDN A;  2OAL A;  1D7L A;  3AEE A;  1IUV A;  1H82 A;  1NHQ A;  1H84 A;  2AR8 A;  3K7M X;  2JAE A;  1ONF A;  3L1R A;  1M64 A;  2BS4 A;  1CJ2 A;  4OPC A;  4TLX A;  4RG3 A;  2AAQ A;  2XFQ A;  1GRG A;  3MMO A;  3GRS A;  2C3D A;  1TDO A;  4EQR A;  4CCR A;  3GSI A;  1VQW A;  3DK4 A;  2Q7V A;  3UKF A;  1QLB A;  3COX A;  2X8H A;  4YKG A;  2XVE A;  3TOR A;  1P2E A;  2YQU A;  3CGB A;  4NEV A;  2ZZC A;  5EB5 A;  3P4S A;  3P4R A;  3EPT A;  1ELI A;  3CGE A;  4TM1 A;  4J33 A;  2ARD A;  1MXT A;  1QO8 A;  1X31 B;  2O9Z A;  1LQT A;  3NG7 X;  4EMI A;  3IWA A;  4JQ9 A;  5JCN A;  3AE2 A;  3UTH A;  4Z24 A;  2WET A;  2F5Z A;  2Z5Y A;  2CUL A;  3G5R A;  2H88 A;  2C72 A;  1IUU A;  1PXA A;  3EF6 A;  4P9S A;  2YG4 A;  3NTA A;  3ICT A;  5HHF A;  4B65 A;  1RP0 A;  1M1P A;  3F8P A;  3NKS A;  3QFA A;  4H4P A;  4C3Y A;  1E1M A;  2W0H A;  4K5S A;  2XDO A;  2WPE A;  3GWD A;  4YTN A;  1FL2 A;  3BI2 A;  2ZZB A;  3V3N A;  3AD8 B;  2GQW A;  2JKC A;  3ICS A;  3F8D A;  4IA6 A;  5ER0 A;  1KSU A;  2VRL A;  4H4Z A;  4OPD A;  2OT4 A;  5BUK A;  1ZDL A;  3BI4 A;  4ECH A;  2UZZ A;  1GOS A;  4ZCD A;  2ZBW A;  5JCM A;  3NYF A;  4DSG A;  2YVF A;  1GES A;  2E1M A;  3IC9 A;  4K5R A;  1CF3 A;  1N1P A;  2A8X A;  3P9U A;  1GRT A;  3PS9 A;  4NEW A;  3AE4 A;  2GEW A;  3AD7 B;  3BNH A;  3BNG A;  1OJA A;  1SEZ A;  4BV6 A;  3D1I A;  3OZ2 A;  4JNA A;  4AT0 A;  4ADW A;  4D04 A;  2BS2 A;  3UOY A;  1GSN A;  1E39 A;  1ZK7 A;  2QA1 A;  5KRQ A;  2RGJ A;  1JEH A;  1DXL A;  2GVC A;  3GYI A;  4H4U A;  5TR3 A;  4J36 A;  2GV8 A;  3S7W A;  4AT2 A;  5J7X A;  3SCE A;  2C65 A;  1GRF A;  2X99 A;  1FT5 A;  3ISH A;  4U8O A;  2WPF A;  3RP7 A;  3NLC A;  4XWZ A;  3UTF A;  1M6I A;  3GWF A;  3H4K A;  3QSE A;  2QAE A;  1FEA A;  1PXC A;  4USR A;  5FMH A;  2OAM A;  4U8I A;  3RP8 A;  2GR2 A;  3SFE A;  2YM1 A;  3AE1 A;  2DKI A;  4YTP A;  4C74 A;  3CNT A;  1S2Q A;  3FG2 P;  3H8L A;  3NK2 X;  4IVM B;  1CJ3 A;  3AXB A;  3GYJ A;  4Q5C A;  3DJG X;  3S61 A;  4YSY A;  4OVI A;  2V60 A;  3DJD A;  5BUL A;  4Q5B A;  3B6D A;  4A65 A;  4IVO B;  2FBW A;  3ALM A;  3KU9 A;  4BK3 A;  5C3J A;  4H4S A;  2Y6Q A;  4U2L A;  3ALJ A;  4PAA A;  5JCI A;  1GND A;  3P4Q A;  1UKV G;  4DNA A;  1TDE A;  2VOU A;  3AWI A;  4H4V A;  2YG7 A;  2BCP A;  2QCU A;  3OWM A;  5HY5 A;  4E0V A;  1K0I A;  3FO3 A;  3AEB A;  1JNR A;  4GF7 A;  2C3C A;  2WS3 A;  1YQZ A;  1W4X A;  2RAB A;  2C66 A;  3GD4 A;  2X8C A;  1SP3 A;  3V3O A;  3WE0 A;  4L3X A;  2Q0K A;  5JCK A;  1TDK A;  1F3P A;  1B8S A;  4YSH A;  3AEC A;  3K30 A;  3LB8 A;  1K0L A;  1H86 A;  1KF6 A;  2BC0 A;  3NH3 X;  4HA6 A;  3KPF A;  4O5Q A;  1JNZ A;  5FS9 A;  4EIQ A;  4U8N A;  5C2T A;  1BGN A;  1Q1W A;  2BK5 A;  3AE9 A;  1GAL A;  2YLX A;  2EQ6 A;  5KOX A;  3C96 A;  4J56 A;  1N4W A;  4NTD A;  4AP1 A;  1REO A;  4EQS A;  3BNF A;  2NPX A;  1E6E A;  1L0V A;  1GER A;  4GUV A;  2BAC A;  3FPZ A;  1VDC A;  3DK8 A;  2GR3 A;  3RNM A;  3UU9 A;  2YG6 A;  4U8P A;  2LFC A;  3K7T A;  1B37 A;  1GRB A;  3NYC A;  4RSL A;  2TPR A;  4Z2U A;  5KOW A;  1NAA A;  2GB0 A;  5IQ1 A;  3AYI A;  4Z26 A;  5HYM A;  1YQ3 A;  2C7G A;  1XHC A;  1CC6 A; 
#chains in the Genus database with same CATH topology
 2WEU A;  1ZMD A;  2WOW A;  4Z25 A;  4OPI A;  3LG1 A;  3GDP A;  4WX1 A;  1Y0P A;  3CTY A;  1FS9 A;  1E1L A;  1Q1R A;  2I0Z A;  3UOX A;  2IID A;  4REK A;  4AOX A;  2R4J A;  4IV9 A;  1RSG A;  3I3L A;  4CY6 A;  3M13 A;  2XVI A;  3NK0 X;  1NHR A;  1IUT A;  1PXB A;  3VQR A;  4OPL A;  4CNK A;  5BRT A;  4N9X A;  1M1R A;  2R4E A;  3UBR A;  2V5Z A;  3CNJ A;  2WU2 A;  3NNE A;  1CBO A;  1ZMC A;  1EL7 A;  4LU6 A;  3QJ4 A;  4H4T A;  4CNJ A;  2B9W A;  4L3Y A;  4B1B A;  1VG0 A;  4LA1 A;  1KNP A;  3VR9 A;  1CL0 A;  1D7Y A;  4YSX A;  4Y4M A;  3CPJ G;  2YLZ A;  2XVH A;  1L9D A;  2C67 A;  4K22 A;  3V76 A;  4Z2T A;  1DOE A;  3NTD A;  4L3Z A;  1NG3 A;  4EMW A;  3Q6J A;  1BF3 A;  2GRT A;  5EBK A;  2VVM A;  4GDP A;  1OAH A;  2FJA A;  5LV9 A;  3SZ0 A;  3AE7 A;  3QSS A;  2C76 A;  2JBV A;  2J7A A;  1D5T A;  2WDQ A;  1TDN A;  1GV4 A;  4H4X A;  4ZCC A;  1XPQ A;  4OPG A;  2J3N A;  2WDR A;  3SZF A;  3T2Y A;  3BHF A;  1LVL A;  3DGH A;  1FCD A;  3CNP A;  2C73 A;  3DME A;  3M0O A;  3AE5 A;  2PYX A;  2X8G A;  1FOH A;  3URH A;  3UOV A;  2YR5 A;  2XLP A;  3LGQ A;  4NTE A;  2OLN A;  2XFN A;  2X3N A;  2WOV A;  4TM0 A;  3DJJ A;  4A6N B;  2Q0L A;  1XDI A;  1ZKQ A;  2FJB A;  1OJD A;  4YXD A;  5J60 A;  1E1K A;  1PJ6 A;  4G9K A;  4U8K A;  3QVR A;  1L9C A;  3LZX A;  1OJ9 A;  3D1C A;  2XLS A;  4YT0 A;  3LAD A;  1BZL A;  4BK1 A;  4JN9 A;  5KXJ A;  1GRE A;  2WQY A;  4Y4L A;  4CRT A;  2BCG G;  4GRT A;  1PBE A;  2AQJ A;  2BK3 A;  1D4C A;  5U1O A;  2ACZ A;  2TMD A;  4LII A;  4YKF A;  4U2S A;  3ABV A;  4H4R A;  1MO9 A;  5KMP A;  2R45 A;  5DBJ A;  5L46 A;  2GR0 A;  1Y56 B;  2YR4 A;  2B9Y A;  3HYX A;  3H8I A;  4II2 A;  2C75 A;  1KDG A;  3KA7 A;  4H50 A;  2Q6U A;  1NEK A;  3SXQ A;  1CJ4 A;  2HQM A;  5M0Z A;  2CZS A;  2YAU A;  4H7U A;  2YG3 A;  1MOK A;  4U8J A;  3SXI A;  2YWL A;  2YLT A;  1FS8 A;  3NGC X;  4U8L A;  4AP3 A;  1L9E A;  2WHD A;  3G5Q A;  4OPT A;  1S2Y A;  3AYL A;  2GF3 A;  2V3B A;  3CNS A;  4B66 A;  1BKW A;  1ZX9 A;  1TYT A;  1EL5 A;  1IJH A;  3CIR A;  4H4Y A;  3PO7 A;  1EBD A;  5CKU A;  3CGC A;  4CBQ A;  4JY2 A;  1PJ5 A;  3PVC A;  2APG A;  4EIP A;  1AOG A;  1HYU A;  4M52 A;  3UKL A;  1FEB A;  4JNQ A;  4TM3 A;  2WOI A;  1CJC A;  2XFU A;  3CPI G;  4K7Z A;  4B68 A;  2EQ9 A;  4G73 A;  3DA1 A;  3LOV A;  1H7W A;  4EM4 A;  3VRD B;  2YVG A;  3BNM A;  2C4C A;  2VR0 A;  3M12 A;  5FS7 A;  2E81 A;  2OA1 A;  4TLZ A;  3QSM A;  4JDR A;  4WCT A;  3AEA A;  2JB2 A;  5KVH A;  2E80 A;  2BK4 A;  4MJW A;  1KFY A;  3CGD A;  3ZYX A;  4EQW A;  3B3R A;  4ICY A;  5CQF A;  4GCM A;  3T14 A;  2WPC A;  1TYP A;  4J57 A;  3JSK A;  1GT8 A;  2X50 A;  3II4 A;  1H81 A;  3UOZ A;  3KPK A;  3LJP A;  1D4E A;  1E1N A;  3DGZ A;  4FK1 C;  1QJD A;  3ATR A;  1TDF A;  2BAB A;  3P1W A;  3IHM A;  2WP5 A;  4U2T A;  3GYX A;  3BNU A;  4J2W A;  1B5Q A;  3QFB A;  3DK9 A;  3ALL A;  3Q9T A;  4C3X A;  3GM6 A;  1YKJ A;  2QA2 A;  2XCG A;  4FDC B;  4HB9 A;  4BJY A;  4Z2R A;  1DJN A;  3NIX A;  2RF7 A;  1H83 A;  2A87 A;  1H7X A;  3NRN A;  4Q17 A;  1JOA A;  4Q0T A;  1ZP0 A;  3NK1 X;  4A99 A;  4D03 A;  3SQP A;  2B7S A;  2WU5 A;  5EOW A;  4Q4U A;  5GRT A;  5BVA A;  5M10 A;  4BK2 A;  2BYB A;  1OJC A;  2YVJ A;  2BA9 A;  4GR1 A;  1CC4 A;  2VVL G;  3VR8 A;  3KVE A;  1BVB A;  3HYV A;  1D4D A;  2H89 A;  3FIM B;  3QVP A;  5JCL A;  2OLO A;  1Q9I A;  1PJ7 A;  1PBF A;  2V3A A;  1GET A;  2XLR A;  3AED A;  1JRX A;  1FS7 A;  3T37 A;  2IVE A;  4H2P A;  4J31 A;  2NVK X;  4H2N A;  4APN A;  2GAH B;  3NT6 A;  1FEC A;  4UDR A;  5KMS A;  4DSH A;  4NTC A;  3NHO X;  2V6O A;  3AEF A;  3RHA A;  3GMB A;  3F29 A;  5IPY A;  1DOD A;  2YLW A;  4YSZ A;  4B64 A;  3CN8 A;  3VRB A;  4G6H A;  1VG9 A;  2VRM A;  4USQ A;  1LJ1 A;  4CCQ A;  2Y6R A;  3TTB A;  2PHH A;  4Q1O A;  2R46 A;  2XLU A;  1M1Q A;  3GD3 A;  2ZO5 A;  4KX6 A;  4H4W A;  2B9X A;  2VQB A;  3R9U A;  3S5W A;  5GSN A;  1F8R A;  4A6N A;  4DGK A;  3AB1 A;  1S3B A;  4Z44 A;  1GTE A;  3CMM A;  5FS6 A;  1V59 A;  3AE8 A;  4TM4 A;  3ZDN A;  3IF9 A;  4OPU A;  3SGL A;  4PAB A;  3C4N A;  4CY8 A;  1COY A;  2R9Z A;  4BJZ A;  4XXG A;  3SX6 A;  1RYI A;  4FK1 A;  3OC4 A;  3T2Z A;  1F8W A;  2RGH A;  4I58 A;  4B69 A;  4EQX A;  3D8X A;  1JRZ A;  2GR1 A;  3E1T A;  3RKH A;  3G5S A;  4UDP A;  1JRY A;  4A7A A;  2B7R A;  4X9N A;  2GMJ A;  3SYI A;  4UDQ A;  2R0G A;  2YM2 A;  3UKA A;  2BS3 A;  4L38 A;  2BXS A;  3O0H A;  5IQ4 A;  2VZ2 A;  3CPH G;  3DH9 A;  3UKQ A;  3VRA A;  1KNR A;  3UP4 A;  1CC2 A;  4K8D A;  1E7P A;  4FX9 A;  3SZC A;  4BUR A;  4J34 A;  1GXF A;  3T0K A;  2YLR A;  2C70 A;  3DJE A;  4GDE A;  2XLT A;  2VVL A;  2WP9 A;  2A89 A;  5HXI A;  4JY3 A;  2CFY A;  5FS8 A;  3AD9 B;  2ZZ0 A;  2CDU A;  1PN0 A;  3NN0 X;  3EAN A;  3SFD A;  3UP5 A;  1PBB A;  2BXR A;  2E4G A;  1LPF A;  4UP3 A;  4Y4N A;  2JK6 A;  3AE3 A;  3GRT A;  1DOB A;  4C77 A;  2E5V A;  4O5U A;  1GRH A;  3I6D A;  1BWC A;  3LZW A;  3NYE A;  3LXD A;  4ZN0 A;  2GH5 A;  1GTH A;  2R0C A;  1NPX A;  3K7Q X;  5KWF A;  1P2H A;  1ZY8 A;  3IHG A;  1O95 A;  1DJQ A;  5KVI A;  1LV0 A;  1IUS A;  1F8S A;  1O94 A;  2EQ7 A;  3KD9 A;  2XFO A;  1F6M A;  2IVD A;  2CVJ A;  4XWR A;  3SM8 A;  3FBS A;  3KKJ A;  2YG5 A;  1PHH A;  3AYJ A;  3C4A A;  4IA5 A;  1PDH A;  1ZOY A;  2DKH A;  3UKP A;  3ATQ A;  3ICR A;  4A9W A;  1LTX R;  1DOC A;  2V61 A;  1DNC A;  2Z5X A;  1NHS A;  3T31 A;  4RG4 A;  4B63 A;  1GPE A;  1NDA A;  2XYO A;  2JB3 A;  1PBD A;  4U8M A;  2WBA A;  4H2R A;  3UTE A;  1IUX A;  1O5W A;  4EMJ A;  1CHU A;  1K0J A;  1PS9 A;  4OCG A;  3NN6 X;  4YWO A;  2YR6 A;  1JU2 A;  1YQ4 A;  3F8R A;  5U25 A;  3ADA B;  3L8K A;  2GQF A;  2GMH A;  1NG4 A;  1EL8 A;  2BC1 A;  2GAG B;  4Z43 A;  2VQ7 A;  2FJD A;  4I59 A;  4H4Q A;  1JNI A;  3BI5 A;  3FMW A;  1IUW A;  1Y56 A;  1OJT A;  5U63 A;  2K3V A;  1S3E A;  1YY5 A;  2XVJ A;  1BGJ A;  3EAO A;  1QDB A;  4KPR A;  4X4J A;  1N4V A;  2EQ8 A;  3ITJ A;  1Z6L A;  1H6V A;  1NEN A;  4X9M A;  4C5O A;  3AE6 A;  2R0P A;  4K2X A;  3AEG A;  5EB4 A;  3BNJ A;  3RED A;  4A79 A;  1GRA A;  4YTM A;  3UKK A;  4NZH A;  2XFP A;  3SY4 A;  1XAN A;  1GEU A;  2FJE A;  4NNJ A;  3UKH A;  3HZL A;  2YLS A;  3BHK A;  1PBC A;  2WES A;  4H2Q A;  4WJY A;  3GMC A;  1LQU A;  3P4P A;  4A5L A;  4AOS A;  2WDV A;  1VRQ B;  1FT6 A;  1B4V A;  2B76 A;  3UCL A;  3KLJ A;  1ZOV A;  2C64 A;  1N4U A;  2RGO A;  2JB1 A;  1NHP A;  4EM3 A;  2XVF A;  1K4Q A;  3RP6 A;  2RDZ A;  1KSS A;  3CND A;  2WP6 A;  3L1T A;  3UTG A;  4NWZ A;  1GU6 A;  1EL9 A;  1TRB A;  4B67 A;  3GDN A;  2OAL A;  1D7L A;  3AEE A;  1IUV A;  1H82 A;  1NHQ A;  1H84 A;  2AR8 A;  3K7M X;  4GAP A;  2JAE A;  1ONF A;  3L1R A;  1M64 A;  2BS4 A;  1CJ2 A;  4OPC A;  4TLX A;  4RG3 A;  2AAQ A;  2XFQ A;  1GRG A;  3MMO A;  3GRS A;  2C3D A;  2BRY A;  1TDO A;  4EQR A;  4CCR A;  3GSI A;  1VQW A;  3DK4 A;  2Q7V A;  3UKF A;  1QLB A;  3COX A;  2X8H A;  4YKG A;  2XVE A;  3TOR A;  1P2E A;  2YQU A;  3CGB A;  4NEV A;  2ZZC A;  5EB5 A;  3P4S A;  3P4R A;  3EPT A;  1ELI A;  3CGE A;  4TM1 A;  4J33 A;  2ARD A;  1MXT A;  1QO8 A;  1X31 B;  2O9Z A;  1LQT A;  3NG7 X;  4EMI A;  3IWA A;  4JQ9 A;  5JCN A;  3AE2 A;  3UTH A;  4Z24 A;  2WET A;  2F5Z A;  2Z5Y A;  2CUL A;  3G5R A;  2H88 A;  2C72 A;  1IUU A;  1PXA A;  3EF6 A;  4P9S A;  2YG4 A;  3NTA A;  3ICT A;  5HHF A;  4B65 A;  1RP0 A;  1M1P A;  3F8P A;  3NKS A;  3QFA A;  4H4P A;  4C3Y A;  1E1M A;  2W0H A;  4K5S A;  2XDO A;  2WPE A;  3GWD A;  4YTN A;  1FL2 A;  3BI2 A;  2ZZB A;  3V3N A;  4GAV A;  3AD8 B;  3HYW A;  2GQW A;  2JKC A;  3ICS A;  3F8D A;  4IA6 A;  5ER0 A;  1KSU A;  2VRL A;  4H4Z A;  4OPD A;  2OT4 A;  5BUK A;  5KMR A;  1ZDL A;  3BI4 A;  4ECH A;  2UZZ A;  1GOS A;  4ZCD A;  5KNL A;  2ZBW A;  5JCM A;  3NYF A;  4DSG A;  2YVF A;  1GES A;  4II3 A;  2E1M A;  3IC9 A;  4K5R A;  1CF3 A;  1N1P A;  2A8X A;  3P9U A;  1GRT A;  3PS9 A;  4NEW A;  3AE4 A;  2GEW A;  3AD7 B;  3BNH A;  3BNG A;  1OJA A;  1SEZ A;  4BV6 A;  3D1I A;  3OZ2 A;  4JNA A;  4AT0 A;  4ADW A;  4D04 A;  2BS2 A;  3UOY A;  1GSN A;  1E39 A;  1ZK7 A;  2QA1 A;  5KRQ A;  2RGJ A;  1JEH A;  1DXL A;  2GVC A;  3GYI A;  4H4U A;  5TR3 A;  4J36 A;  2GV8 A;  3S7W A;  4AT2 A;  5J7X A;  3SCE A;  2C65 A;  1GRF A;  2X99 A;  1FT5 A;  3ISH A;  4U8O A;  2WPF A;  3RP7 A;  3NLC A;  4XWZ A;  3UTF A;  1M6I A;  3GWF A;  3H4K A;  3QSE A;  2QAE A;  1FEA A;  1PXC A;  4USR A;  5FMH A;  2OAM A;  4U8I A;  3RP8 A;  2GR2 A;  3SFE A;  2YM1 A;  3AE1 A;  2DKI A;  3SZW A;  4YTP A;  4C74 A;  3CNT A;  1S2Q A;  3FG2 P;  3H8L A;  3NK2 X;  4IVM B;  1CJ3 A;  3AXB A;  3GYJ A;  4Q5C A;  3DJG X;  3S61 A;  4YSY A;  4OVI A;  2V60 A;  3DJD A;  5BUL A;  4Q5B A;  3B6D A;  4A65 A;  4IVO B;  2FBW A;  3ALM A;  2BRA A;  3KU9 A;  4BK3 A;  5C3J A;  4H4S A;  2Y6Q A;  4U2L A;  3ALJ A;  4PAA A;  5JCI A;  1GND A;  3P4Q A;  1UKV G;  4DNA A;  1TDE A;  2VOU A;  3AWI A;  3T2K A;  5KMQ A;  4H4V A;  2YG7 A;  2BCP A;  2QCU A;  3OWM A;  5HY5 A;  4E0V A;  1K0I A;  3FO3 A;  3AEB A;  1JNR A;  4GF7 A;  2C3C A;  2WS3 A;  1YQZ A;  1W4X A;  2RAB A;  2C66 A;  3GD4 A;  2X8C A;  1SP3 A;  3V3O A;  3WE0 A;  4L3X A;  2Q0K A;  5JCK A;  1TDK A;  1F3P A;  1B8S A;  4YSH A;  3AEC A;  3K30 A;  3LB8 A;  1K0L A;  1H86 A;  1KF6 A;  2BC0 A;  3NH3 X;  4HA6 A;  3KPF A;  4O5Q A;  1JNZ A;  5FS9 A;  4EIQ A;  4U8N A;  5C2T A;  1BGN A;  1Q1W A;  2BK5 A;  3AE9 A;  1GAL A;  2YLX A;  2EQ6 A;  4G6G A;  5KOX A;  3C96 A;  4J56 A;  1N4W A;  4NTD A;  4AP1 A;  1REO A;  4EQS A;  3BNF A;  2NPX A;  4G74 A;  1E6E A;  1L0V A;  1GER A;  4GUV A;  2BAC A;  3FPZ A;  1VDC A;  3DK8 A;  2GR3 A;  3RNM A;  3UU9 A;  2YG6 A;  4U8P A;  2LFC A;  3K7T A;  1B37 A;  1GRB A;  3NYC A;  4RSL A;  2TPR A;  4Z2U A;  5KOW A;  1NAA A;  2GB0 A;  5IQ1 A;  3AYI A;  4Z26 A;  5HYM A;  1YQ3 A;  2C7G A;  1XHC A;  1CC6 A; 
#chains in the Genus database with same CATH homology
 2WEU A;  1ZMD A;  2WOW A;  4Z25 A;  4OPI A;  3LG1 A;  3GDP A;  4WX1 A;  1Y0P A;  3CTY A;  1FS9 A;  1E1L A;  1Q1R A;  2I0Z A;  3UOX A;  2IID A;  4REK A;  4AOX A;  2R4J A;  4IV9 A;  1RSG A;  3I3L A;  4CY6 A;  3M13 A;  2XVI A;  3NK0 X;  1NHR A;  1IUT A;  1PXB A;  3VQR A;  4OPL A;  4CNK A;  5BRT A;  4N9X A;  1M1R A;  2R4E A;  3UBR A;  2V5Z A;  3CNJ A;  2WU2 A;  3NNE A;  1CBO A;  1ZMC A;  1EL7 A;  4LU6 A;  3QJ4 A;  4H4T A;  4CNJ A;  2B9W A;  4L3Y A;  4B1B A;  1VG0 A;  4LA1 A;  1KNP A;  3VR9 A;  1CL0 A;  1D7Y A;  4YSX A;  4Y4M A;  3CPJ G;  2YLZ A;  2XVH A;  1L9D A;  2C67 A;  4K22 A;  3V76 A;  4Z2T A;  1DOE A;  3NTD A;  4L3Z A;  1NG3 A;  4EMW A;  3Q6J A;  1BF3 A;  2GRT A;  5EBK A;  2VVM A;  4GDP A;  1OAH A;  2FJA A;  5LV9 A;  3SZ0 A;  3AE7 A;  3QSS A;  2C76 A;  2JBV A;  2J7A A;  1D5T A;  2WDQ A;  1TDN A;  1GV4 A;  4H4X A;  4ZCC A;  1XPQ A;  4OPG A;  2J3N A;  2WDR A;  3SZF A;  3T2Y A;  3BHF A;  1LVL A;  3DGH A;  1FCD A;  3CNP A;  2C73 A;  3DME A;  3M0O A;  3AE5 A;  2PYX A;  2X8G A;  1FOH A;  3URH A;  3UOV A;  2YR5 A;  2XLP A;  3LGQ A;  4NTE A;  2OLN A;  2XFN A;  2X3N A;  2WOV A;  4TM0 A;  3DJJ A;  4A6N B;  2Q0L A;  1XDI A;  1ZKQ A;  2FJB A;  1OJD A;  4YXD A;  5J60 A;  1E1K A;  1PJ6 A;  4G9K A;  4U8K A;  3QVR A;  1L9C A;  3LZX A;  1OJ9 A;  3D1C A;  2XLS A;  4YT0 A;  3LAD A;  1BZL A;  4BK1 A;  4JN9 A;  5KXJ A;  1GRE A;  2WQY A;  4Y4L A;  4CRT A;  2BCG G;  4GRT A;  1PBE A;  2AQJ A;  2BK3 A;  1D4C A;  5U1O A;  2ACZ A;  2TMD A;  4LII A;  4YKF A;  4U2S A;  3ABV A;  4H4R A;  1MO9 A;  5KMP A;  2R45 A;  5DBJ A;  5L46 A;  2GR0 A;  1Y56 B;  2YR4 A;  2B9Y A;  3HYX A;  3H8I A;  4II2 A;  2C75 A;  1KDG A;  3KA7 A;  4H50 A;  2Q6U A;  1NEK A;  3SXQ A;  1CJ4 A;  2HQM A;  5M0Z A;  2YAU A;  4H7U A;  2YG3 A;  1MOK A;  4U8J A;  3SXI A;  2YWL A;  2YLT A;  1FS8 A;  3NGC X;  4U8L A;  4AP3 A;  1L9E A;  2WHD A;  3G5Q A;  4OPT A;  1S2Y A;  3AYL A;  2GF3 A;  2V3B A;  3CNS A;  4B66 A;  1BKW A;  1ZX9 A;  1TYT A;  1EL5 A;  1IJH A;  3CIR A;  4H4Y A;  3PO7 A;  1EBD A;  5CKU A;  3CGC A;  4CBQ A;  4JY2 A;  1PJ5 A;  3PVC A;  2APG A;  4EIP A;  1AOG A;  1HYU A;  4M52 A;  3UKL A;  1FEB A;  4JNQ A;  4TM3 A;  2WOI A;  1CJC A;  2XFU A;  3CPI G;  4K7Z A;  4B68 A;  2EQ9 A;  4G73 A;  3DA1 A;  3LOV A;  1H7W A;  4EM4 A;  3VRD B;  2YVG A;  3BNM A;  2C4C A;  2VR0 A;  3M12 A;  5FS7 A;  2E81 A;  2OA1 A;  4TLZ A;  3QSM A;  4JDR A;  4WCT A;  3AEA A;  2JB2 A;  5KVH A;  2E80 A;  2BK4 A;  4MJW A;  1KFY A;  3CGD A;  3ZYX A;  4EQW A;  3B3R A;  4ICY A;  5CQF A;  4GCM A;  3T14 A;  2WPC A;  1TYP A;  4J57 A;  3JSK A;  1GT8 A;  2X50 A;  3II4 A;  1H81 A;  3UOZ A;  3KPK A;  3LJP A;  1D4E A;  1E1N A;  3DGZ A;  4FK1 C;  1QJD A;  3ATR A;  1TDF A;  2BAB A;  3P1W A;  3IHM A;  2WP5 A;  4U2T A;  3GYX A;  3BNU A;  4J2W A;  1B5Q A;  3QFB A;  3DK9 A;  3ALL A;  3Q9T A;  4C3X A;  3GM6 A;  1YKJ A;  2QA2 A;  2XCG A;  4FDC B;  4HB9 A;  4BJY A;  4Z2R A;  1DJN A;  3NIX A;  2RF7 A;  1H83 A;  2A87 A;  1H7X A;  3NRN A;  4Q17 A;  1JOA A;  4Q0T A;  1ZP0 A;  3NK1 X;  4A99 A;  4D03 A;  3SQP A;  2B7S A;  2WU5 A;  5EOW A;  4Q4U A;  5GRT A;  5BVA A;  5M10 A;  4BK2 A;  2BYB A;  1OJC A;  2YVJ A;  2BA9 A;  4GR1 A;  1CC4 A;  2VVL G;  3VR8 A;  3KVE A;  1BVB A;  3HYV A;  1D4D A;  2H89 A;  3FIM B;  3QVP A;  5JCL A;  2OLO A;  1Q9I A;  1PJ7 A;  1PBF A;  2V3A A;  1GET A;  2XLR A;  3AED A;  1JRX A;  1FS7 A;  3T37 A;  2IVE A;  4H2P A;  4J31 A;  2NVK X;  4H2N A;  4APN A;  2GAH B;  3NT6 A;  1FEC A;  4UDR A;  5KMS A;  4DSH A;  4NTC A;  3NHO X;  2V6O A;  3AEF A;  3RHA A;  3GMB A;  3F29 A;  5IPY A;  1DOD A;  2YLW A;  4YSZ A;  4B64 A;  3CN8 A;  3VRB A;  4G6H A;  1VG9 A;  2VRM A;  4USQ A;  1LJ1 A;  4CCQ A;  2Y6R A;  3TTB A;  2PHH A;  4Q1O A;  2R46 A;  2XLU A;  1M1Q A;  3GD3 A;  2ZO5 A;  4KX6 A;  4H4W A;  2B9X A;  2VQB A;  3R9U A;  3S5W A;  5GSN A;  1F8R A;  4A6N A;  4DGK A;  3AB1 A;  1S3B A;  4Z44 A;  1GTE A;  3CMM A;  5FS6 A;  1V59 A;  3AE8 A;  4TM4 A;  3ZDN A;  3IF9 A;  4OPU A;  3SGL A;  4PAB A;  3C4N A;  4CY8 A;  1COY A;  2R9Z A;  4BJZ A;  4XXG A;  3SX6 A;  1RYI A;  4FK1 A;  3OC4 A;  3T2Z A;  1F8W A;  2RGH A;  4I58 A;  4B69 A;  4EQX A;  3D8X A;  1JRZ A;  2GR1 A;  3E1T A;  3RKH A;  3G5S A;  4UDP A;  1JRY A;  4A7A A;  2B7R A;  4X9N A;  2GMJ A;  3SYI A;  4UDQ A;  2R0G A;  2YM2 A;  3UKA A;  2BS3 A;  4L38 A;  2BXS A;  3O0H A;  5IQ4 A;  2VZ2 A;  3CPH G;  3DH9 A;  3UKQ A;  3VRA A;  1KNR A;  3UP4 A;  1CC2 A;  4K8D A;  1E7P A;  4FX9 A;  3SZC A;  4BUR A;  4J34 A;  1GXF A;  3T0K A;  2YLR A;  2C70 A;  3DJE A;  4GDE A;  2XLT A;  2VVL A;  2WP9 A;  2A89 A;  5HXI A;  4JY3 A;  2CFY A;  5FS8 A;  3AD9 B;  2ZZ0 A;  2CDU A;  1PN0 A;  3NN0 X;  3EAN A;  3SFD A;  3UP5 A;  1PBB A;  2BXR A;  2E4G A;  1LPF A;  4UP3 A;  4Y4N A;  2JK6 A;  3AE3 A;  3GRT A;  1DOB A;  4C77 A;  2E5V A;  4O5U A;  1GRH A;  3I6D A;  1BWC A;  3LZW A;  3NYE A;  3LXD A;  4ZN0 A;  2GH5 A;  1GTH A;  2R0C A;  1NPX A;  3K7Q X;  5KWF A;  1P2H A;  1ZY8 A;  3IHG A;  1O95 A;  1DJQ A;  5KVI A;  1LV0 A;  1IUS A;  1F8S A;  1O94 A;  2EQ7 A;  3KD9 A;  2XFO A;  1F6M A;  2IVD A;  2CVJ A;  4XWR A;  3SM8 A;  3FBS A;  3KKJ A;  2YG5 A;  1PHH A;  3AYJ A;  3C4A A;  4IA5 A;  1PDH A;  1ZOY A;  2DKH A;  3UKP A;  3ATQ A;  3ICR A;  4A9W A;  1LTX R;  1DOC A;  2V61 A;  1DNC A;  2Z5X A;  1NHS A;  3T31 A;  4RG4 A;  4B63 A;  1GPE A;  1NDA A;  2XYO A;  2JB3 A;  1PBD A;  4U8M A;  2WBA A;  4H2R A;  3UTE A;  1IUX A;  1O5W A;  4EMJ A;  1CHU A;  1K0J A;  1PS9 A;  4OCG A;  3NN6 X;  4YWO A;  2YR6 A;  1JU2 A;  1YQ4 A;  3F8R A;  5U25 A;  3ADA B;  3L8K A;  2GQF A;  2GMH A;  1NG4 A;  1EL8 A;  2BC1 A;  2GAG B;  4Z43 A;  2VQ7 A;  2FJD A;  4I59 A;  4H4Q A;  1JNI A;  3BI5 A;  3FMW A;  1IUW A;  1Y56 A;  1OJT A;  5U63 A;  2K3V A;  1S3E A;  1YY5 A;  2XVJ A;  1BGJ A;  3EAO A;  1QDB A;  4KPR A;  4X4J A;  1N4V A;  2EQ8 A;  3ITJ A;  1Z6L A;  1H6V A;  1NEN A;  4X9M A;  4C5O A;  3AE6 A;  2R0P A;  4K2X A;  3AEG A;  5EB4 A;  3BNJ A;  3RED A;  4A79 A;  1GRA A;  4YTM A;  3UKK A;  4NZH A;  2XFP A;  3SY4 A;  1XAN A;  1GEU A;  2FJE A;  4NNJ A;  3UKH A;  3HZL A;  2YLS A;  3BHK A;  1PBC A;  2WES A;  4H2Q A;  4WJY A;  3GMC A;  1LQU A;  3P4P A;  4A5L A;  4AOS A;  2WDV A;  1VRQ B;  1FT6 A;  1B4V A;  2B76 A;  3UCL A;  3KLJ A;  1ZOV A;  2C64 A;  1N4U A;  2RGO A;  2JB1 A;  1NHP A;  4EM3 A;  2XVF A;  1K4Q A;  3RP6 A;  2RDZ A;  1KSS A;  3CND A;  2WP6 A;  3L1T A;  3UTG A;  4NWZ A;  1GU6 A;  1EL9 A;  1TRB A;  4B67 A;  3GDN A;  2OAL A;  1D7L A;  3AEE A;  1IUV A;  1H82 A;  1NHQ A;  1H84 A;  2AR8 A;  3K7M X;  4GAP A;  2JAE A;  1ONF A;  3L1R A;  1M64 A;  2BS4 A;  1CJ2 A;  4OPC A;  4TLX A;  4RG3 A;  2AAQ A;  2XFQ A;  1GRG A;  3MMO A;  3GRS A;  2C3D A;  2BRY A;  1TDO A;  4EQR A;  4CCR A;  3GSI A;  1VQW A;  3DK4 A;  2Q7V A;  3UKF A;  1QLB A;  3COX A;  2X8H A;  4YKG A;  2XVE A;  3TOR A;  1P2E A;  2YQU A;  3CGB A;  4NEV A;  2ZZC A;  5EB5 A;  3P4S A;  3P4R A;  3EPT A;  1ELI A;  3CGE A;  4TM1 A;  4J33 A;  2ARD A;  1MXT A;  1QO8 A;  1X31 B;  2O9Z A;  1LQT A;  3NG7 X;  4EMI A;  3IWA A;  4JQ9 A;  5JCN A;  3AE2 A;  3UTH A;  4Z24 A;  2WET A;  2F5Z A;  2Z5Y A;  2CUL A;  3G5R A;  2H88 A;  2C72 A;  1IUU A;  1PXA A;  3EF6 A;  4P9S A;  2YG4 A;  3NTA A;  3ICT A;  5HHF A;  4B65 A;  1RP0 A;  1M1P A;  3F8P A;  3NKS A;  3QFA A;  4H4P A;  4C3Y A;  1E1M A;  2W0H A;  4K5S A;  2XDO A;  2WPE A;  3GWD A;  4YTN A;  1FL2 A;  3BI2 A;  2ZZB A;  3V3N A;  4GAV A;  3AD8 B;  3HYW A;  2GQW A;  2JKC A;  3ICS A;  3F8D A;  4IA6 A;  5ER0 A;  1KSU A;  2VRL A;  4H4Z A;  4OPD A;  2OT4 A;  5BUK A;  5KMR A;  1ZDL A;  3BI4 A;  4ECH A;  2UZZ A;  1GOS A;  4ZCD A;  5KNL A;  2ZBW A;  5JCM A;  3NYF A;  4DSG A;  2YVF A;  1GES A;  4II3 A;  2E1M A;  3IC9 A;  4K5R A;  1CF3 A;  1N1P A;  2A8X A;  3P9U A;  1GRT A;  3PS9 A;  4NEW A;  3AE4 A;  2GEW A;  3AD7 B;  3BNH A;  3BNG A;  1OJA A;  1SEZ A;  4BV6 A;  3D1I A;  3OZ2 A;  4JNA A;  4AT0 A;  4ADW A;  4D04 A;  2BS2 A;  3UOY A;  1GSN A;  1E39 A;  1ZK7 A;  2QA1 A;  5KRQ A;  2RGJ A;  1JEH A;  1DXL A;  2GVC A;  3GYI A;  4H4U A;  5TR3 A;  4J36 A;  2GV8 A;  3S7W A;  4AT2 A;  5J7X A;  3SCE A;  2C65 A;  1GRF A;  2X99 A;  1FT5 A;  3ISH A;  4U8O A;  2WPF A;  3RP7 A;  3NLC A;  4XWZ A;  3UTF A;  1M6I A;  3GWF A;  3H4K A;  3QSE A;  2QAE A;  1FEA A;  1PXC A;  4USR A;  5FMH A;  2OAM A;  4U8I A;  3RP8 A;  2GR2 A;  3SFE A;  2YM1 A;  3AE1 A;  2DKI A;  3SZW A;  4YTP A;  4C74 A;  3CNT A;  1S2Q A;  3FG2 P;  3H8L A;  3NK2 X;  4IVM B;  1CJ3 A;  3AXB A;  3GYJ A;  4Q5C A;  3DJG X;  3S61 A;  4YSY A;  4OVI A;  2V60 A;  3DJD A;  5BUL A;  4Q5B A;  3B6D A;  4A65 A;  4IVO B;  2FBW A;  3ALM A;  2BRA A;  3KU9 A;  4BK3 A;  5C3J A;  4H4S A;  2Y6Q A;  4U2L A;  3ALJ A;  4PAA A;  5JCI A;  1GND A;  3P4Q A;  1UKV G;  4DNA A;  1TDE A;  2VOU A;  3AWI A;  3T2K A;  5KMQ A;  4H4V A;  2YG7 A;  2BCP A;  2QCU A;  3OWM A;  5HY5 A;  4E0V A;  1K0I A;  3FO3 A;  3AEB A;  1JNR A;  4GF7 A;  2C3C A;  2WS3 A;  1YQZ A;  1W4X A;  2RAB A;  2C66 A;  3GD4 A;  2X8C A;  1SP3 A;  3V3O A;  3WE0 A;  4L3X A;  2Q0K A;  5JCK A;  1TDK A;  1F3P A;  1B8S A;  4YSH A;  3AEC A;  3K30 A;  3LB8 A;  1K0L A;  1H86 A;  1KF6 A;  2BC0 A;  3NH3 X;  4HA6 A;  3KPF A;  4O5Q A;  1JNZ A;  5FS9 A;  4EIQ A;  4U8N A;  5C2T A;  1BGN A;  1Q1W A;  2BK5 A;  3AE9 A;  1GAL A;  2YLX A;  2EQ6 A;  4G6G A;  5KOX A;  3C96 A;  4J56 A;  1N4W A;  4NTD A;  4AP1 A;  1REO A;  4EQS A;  3BNF A;  2NPX A;  4G74 A;  1E6E A;  1L0V A;  1GER A;  4GUV A;  2BAC A;  3FPZ A;  1VDC A;  3DK8 A;  2GR3 A;  3RNM A;  3UU9 A;  2YG6 A;  4U8P A;  2LFC A;  3K7T A;  1B37 A;  1GRB A;  3NYC A;  4RSL A;  2TPR A;  4Z2U A;  5KOW A;  1NAA A;  2GB0 A;  5IQ1 A;  3AYI A;  4Z26 A;  5HYM A;  1YQ3 A;  2C7G A;  1XHC A;  1CC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...