1P2EA

H61a mutant of flavocytochrome c3
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
568
structure length
568
Chain Sequence
b'ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASAFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords flavocytochrome c3
publication title Histidine 61: An Important Heme Ligand in the Soluble Fumarate Reductase from Shewanella frigidimarina
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
total genus 194
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1p2eA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1p2eA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1p2eA01
2VVMA 1CC2A 3II4A 3ICSA 3KKJA 3AE6A 1RP0A 2VQBA 1HYUA 1REOA 4I58A 4EMWA 2WOVA 5JCKA 5KOWA 4CNKA 2HQMA 2JAEA 2YWLA 2E81A 3GDNA 3M0OA 4K7ZA 3K7TA 2R0GA 2VZ2A 2DKIA 2H89A 1H81A 1L9CA 3AE4A 3BHKA 3V76A 4OPUA 3I6DA 3FPZA 5KVIA 1CJCA 3UKQA 2ZZ0A 2OA1A 3NK0X 3KVEA 2BACA 4U8LA 2E80A 3LJPA 3GRTA 4FDCB 1CHUA 1E39A 1H82A 2C3CA 2C72A 3AWIA 1GTHA 2VVLG 4TLZA 5U63A 4AT2A 4EQXA 3GSIA 1BZLA 4B68A 4JQ9A 1BGNA 1SEZA 3CPJG 1PBCA 4AT0A 1ZOYA 4Z43A 1D4CA 3UKAA 4IA6A 3FO3A 2VRLA 4U8JA 3GMCA 1GT8A 2JB3A 4B65A 2CVJA 4TM1A 2J7AA 4CNJA 3UKLA 1TDOA 2OAMA 3C4NA 3DK4A 1QO8A 1LVLA 1FEBA 2VVLA 4YKFA 1EL5A 4BK3A 4U8MA 1CJ2A 2FBWA 4WCTA 5FMHA 2UZZA 3UKHA 1MO9A 4GF7A 3IHGA 3UTFA 3FMWA 3B3RA 4EMIA 2I0ZA 4K5RA 1PXAA 1Q1WA 1FL2A 2YLWA 1GETA 1TDFA 1BVBA 5GRTA 4C77A 3VRBA 2YLXA 2ZZBA 1LJ1A 3DGHA 4YXDA 2X50A 1CC4A 2F5ZA 2PYXA 3CNTA 3O0HA 4CCQA 4REKA 1ELIA 2WQYA 3M13A 1E1LA 2YQUA 1P2EA 3CNJA 1GTEA 4J2WA 2IVEA 2YAUA 4XXGA 2BS2A 4H4RA 2JKCA 2AR8A 1KSUA 5U25A 1NHSA 1GV4A 1GXFA 4H4UA 2V3BA 1LQUA 5CQFA 1LPFA 1GEUA 2X99A 4AP3A 2XFOA 3NIXA 4YSYA 3NT6A 2PHHA 4BK2A 4YSZA 5GSNA 2Y6RA 3ABVA 3K7QX 3RHAA 4GDPA 1E1MA 1F6MA 4RSLA 1DOCA 3RP6A 4OPGA 5KVHA 1PJ6A 4Y4NA 3CNSA 1GOSA 3GRSA 3T37A 4GUVA 3OC4A 1FOHA 3K30A 4H4TA 2C70A 1K4QA 1TDKA 2V3AA 3AYLA 1GESA 2FJEA 1XANA 2WPCA 4IA5A 4CBQA 1TDEA 3DH9A 1GRAA 1OJDA 4NZHA 3L1TA 3L8KA 1TYTA 1LQTA 3P4SA 3C4AA 3NRNA 3OWMA 3AE9A 1FCDA 2YG7A 3AEEA 3M12A 4PABA 2XLSA 3P4RA 4KX6A 4Q1OA 3SFEA 3V3OA 3DK8A 5HXIA 4DNAA 3GM6A 2GQFA 2YG6A 3RKHA 1S3BA 4USQA 3COXA 1M1QA 1L0VA 4C5OA 1YY5A 4H4ZA 4C3XA 3ALLA 1SP3A 1BF3A 1GRFA 2V6OA 2ZBWA 2BA9A 4J31A 4U8NA 3ITJA 4BV6A 2WP9A 4JN9A 2XVJA 1L9DA 1PBDA 4UDPA 2GMJA 2GVCA 1ZP0A 2GR1A 4H4YA 2JB2A 2FJAA 4ICYA 4EIPA 1DODA 1OJTA 1H7XA 2GQWA 2RABA 2XLTA 1OJAA 3QFAA 5DBJA 4D03A 4OPTA 4XWZA 3ZDNA 1PHHA 1JRXA 5EB5A 3SM8A 4GCMA 1PBBA 2YR5A 3QFBA 2QA1A 3DJGX 1FECA 3NHOX 2R46A 5C2TA 1V59A 2C73A 3PS9A 4L3ZA 2XVFA 3NYEA 4K5SA 1JNIA 1H86A 2Q0KA 2WESA 2WS3A 4OPCA 4OPLA 1DNCA 4Q0TA 4U8IA 1M6IA 3VRAA 4LA1A 1GU6A 2X3NA 3NYCA 5JCIA 1N4VA 3AB1A 3H4KA 4L3XA 1JRZA 2E4GA 2EQ6A 2WDQA 5IQ1A 3S61A 1LTXR 3UTEA 2XFNA 3NTDA 1YQZA 2BXSA 1H6VA 3P9UA 3GD4A 4XWRA 2GAHB 3UOXA 2XLUA 1VG0A 3TTBA 2WP6A 1D7LA 3CNDA 1Z6LA 4L38A 3EANA 4TM3A 2OT4A 1W4XA 3BNGA 4A5LA 1Q1RA 1RYIA 3QVPA 4CY6A 1ZMCA 4B66A 3DGZA 1NPXA 1FS9A 1PJ5A 2RGHA 2YR6A 1IJHA 2DKHA 1YQ4A 5JCNA 4J34A 3D1IA 4Y4MA 3QJ4A 4YT0A 3AD9B 3UOZA 4YTPA 2WP5A 2B9YA 3ICTA 3QVRA 2YG3A 5M0ZA 3BI5A 1NG4A 2YG5A 1GREA 1DJQA 4J36A 2FJBA 2Q7VA 1PBFA 4EM4A 1CJ3A 1KFYA 2JB1A 2QCUA 2WDVA 2C64A 1H83A 1E6EA 3CN8A 3DMEA 3LB8A 3Q9TA 4H4VA 3UKFA 2XVIA 4OVIA 3D8XA 4YTNA 4HB9A 4RG4A 1EL8A 5KRQA 1VG9A 3BHFA 2R4JA 2V60A 2OLOA 2VOUA 2WETA 3BNJA 3CPIG 4C3YA 1Q9IA 2EQ7A 2QAEA 3EPTA 4U8KA 2APGA 3NGCX 5BULA 1CF3A 4YSXA 1KNPA 4CY8A 3AE5A 5JCMA 1LV0A 1X31B 1ZKQA 5L46A 3BNHA 3GDPA 4BJZA 2C67A 4CCRA 4Z44A 2XCGA 3G5SA 4ZCCA 1S3EA 2B7RA 5KWFA 4X9MA 3FIMB 1KF6A 2R4EA 1Y0PA 2WEUA 2XVHA 3AE1A 5M10A 3AYJA 4X9NA 4BJYA 2XFPA 1ZDLA 1DJNA 4H7UA 2W0HA 4LU6A 3SGLA 2GR3A 2BABA 4ZN0A 1N4UA 2BYBA 1BGJA 3B6DA 2IVDA 1IUVA 3K7MX 3L1RA 5EBKA 3REDA 2BCGG 3DA1A 4B69A 4U2SA 2ZZCA 1M1PA 3NLCA 3KU9A 1QJDA 4NEWA 3RP7A 3CGBA 3FBSA 3BI4A 4Z2RA 2Q6UA 3MMOA 4TM4A 2GAGB 4M52A 2X8GA 5C3JA 2Q0LA 4IVOB 5BVAA 2O9ZA 3GWFA 1K0IA 4GDEA 5BUKA 2BC1A 1KDGA 3ADAB 3UP5A 3ATQA 1PS9A 4YKGA 1NAAA 4U8PA 4FK1A 3GMBA 2R45A 2VR0A 1EL9A 4CRTA 1IUXA 4ZCDA 3SQPA 2IIDA 4K8DA 1S2QA 1AOGA 1CC6A 1ONFA 4A79A 4K22A 4APNA 4L3YA 1YKJA 4TM0A 3VR8A 3NYFA 3WE0A 2YM2A 3P1WA 2GV8A 1JOAA 1NENA 2VQ7A 2X8CA 5KXJA 3G5QA 1FS7A 1IUWA 2BC0A 2RGOA 4WX1A 1DOBA 5HHFA 1BWCA 2GF3A 2XVEA 2NVKX 4IV9A 3AE3A 3ALJA 4D04A 1PXBA 4JY2A 2LFCA 5LV9A 2R0PA 1H84A 2A8XA 3NNEA 4NTEA 5FS7A 4A65A 4EQWA 3F29A 4O5UA 2YVFA 4KPRA 3R9UA 3UOYA 3S7WA 2C66A 1K0LA 4H2NA 2V5ZA 2C3DA 2C7GA 2Z5YA 3GWDA 3DJJA 2GMHA 3AE2A 4GRTA 4NTDA 4MJWA 3UKPA 3IC9A 4NEVA 2WU2A 3AECA 3JSKA 1O95A 3SXQA 3DK9A 4DSHA 1KSSA 4P9SA 2VRMA 1PXCA 5JCLA 1OAHA 1N4WA 4A6NA 1PJ7A 2YLZA 2B9WA 4EQRA 4Q17A 1D4EA 3GD3A 1XHCA 5ER0A 1O5WA 3UTHA 3NG7X 3AE7A 1FT5A 1F3PA 4RG3A 4N9XA 4U8OA 1E7PA 1PN0A 3QSEA 1IUTA 4E0VA 2XLPA 4EMJA 2BS4A 2WPEA 3KPFA 2GR0A 3QSMA 2B7SA 4YTMA 4OPDA 3V3NA 3AE8A 4ECHA 3CGEA 2YG4A 2TPRA 4DSGA 1RSGA 2WOWA 3CGDA 2GR2A 1GERA 2C75A 2WDRA 4IVMB 3AXBA 4USRA 1P2HA 2YLSA 3NN6X 3NK2X 4EM3A 1F8WA 3CTYA 1NHPA 3UP4A 1ZMDA 3DJDA 2BS3A 3AYIA 4Z26A 2QA2A 1D4DA 1IUUA 1JNZA 1GALA 4JNQA 5CKUA 2NPXA 3F8PA 4EIQA 1VRQB 3ISHA 4I59A 4A6NB 4A7AA 2BCPA 1NG3A 2OALA 1O94A 2YLTA 3AEGA 2CULA 1GRTA 5J60A 2YLRA 3H8IA 3UTGA 3UOVA 2OLNA 1MXTA 3ATRA 4H4XA 4Q4UA 3G5RA 2GB0A 4YSHA 4HA6A 2AQJA 1EL7A 4A99A 2GRTA 1XPQA 2WHDA 2ARDA 1GRBA 1ZK7A 3VRDB 2XLRA 3P4PA 1ZX9A 3LADA 2Y6QA 3CGCA 1D5TA 4H2QA 1N1PA 1F8RA 3KA7A 5KOXA 3LGQA 1TDNA 2CFYA 2J3NA 2YR4A 1JRYA 4PAAA 1QLBA 1E1KA 1GSNA 2ZO5A 3HZLA 2Z5XA 5U1OA 4H2PA 1CJ4A 1GRHA 1DXLA 2WOIA 1COYA 4WJYA 2GH5A 4BK1A 2A87A 2WU5A 3BI2A 4H4QA 1JEHA 3URHA 4C74A 2X8HA 2E1MA 4Z24A 5EB4A 4YWOA 1B8SA 3F8DA 2YVGA 2R9ZA 1CL0A 3DJEA 3AD8B 5FS9A 3VQRA 1B5QA 3IHMA 5TR3A 5HY5A 3BNUA 4Y4LA 1NHRA 5HYMA 3P4QA 1D7YA 1NHQA 1ZOVA 1UKVG 1JNRA 1S2YA 5BRTA 1OJCA 1FEAA 2JBVA 3CPHG 3NK1X 3I3LA 5J7XA 3SFDA 3UCLA 4B63A 1ZY8A 2K3VA 3LZXA 1YQ3A 2B9XA 4B67A 1H7WA 1M1RA 1FT6A 1GPEA 1Y56A 2FJDA 1CBOA 1VDCA 3NH3X 3ZYXA 2H88A 3SCEA 1E1NA 2XDOA 4Z2UA 4K2XA 4ADWA 3LOVA 3C96A 2JK6A 1B4VA 1MOKA 3E1TA 2R0CA 4Z25A 3NTAA 3KLJA 5IQ4A 5FS8A 1KNRA 4U2TA 1IUSA 4H50A 3GYXA 4B1BA 2WPFA 3RP8A 3CIRA 2EQ8A 1BKWA 2BK5A 3AEAA 4J56A 3AD7B 5FS6A 3QSSA 4Q5BA 1GNDA 1GRGA 1PBEA 2CDUA 4EQSA 3F8RA 4A9WA 2AAQA 2RDZA 4OCGA 4TLXA 2BK4A 2RF7A 4FK1C 3LG1A 2RGJA 4H4PA 2XYOA 1NEKA 2A89A 3IWAA 4UDRA 3KD9A 4X4JA 2TMDA 4H4SA 4LIIA 1PDHA 4JNAA 2YVJA 4DGKA 3LXDA 4Q5CA 1Y56B 3EF6A 4JDRA 2XFQA 2GEWA 4AOSA 1B37A 3AEBA 2V61A 4GR1A 3ICRA 5EOWA 2WBAA 3AEDA 3NKSA 3BNFA 2E5VA 3H8LA 3Q6JA 4U2LA 4BURA 4J33A 2ACZA 1TRBA 4OPIA 3CNPA 3GYIA 1EBDA 4H4WA 3BNMA 3FG2P 4FX9A 3AEFA 2EQ9A 1F8SA 1VQWA 3ALMA 4O5QA 1TYPA 3D1CA 3IF9A 4J57A 3RNMA 4UP3A 3UU9A 3EAOA 4Z2TA 3TORA 4UDQA 1M64A 2XFUA 4B64A 1XDIA 3PO7A 4AOXA 2BXRA 3LZWA 3UBRA 1OJ9A 2B76A 2YM1A 4H2RA 1K0JA 3S5WA 1DOEA 3GYJA 4NTCA 2BK3A 1FS8A 1QDBA 3VR9A 2C76A 3NN0X 4AP1A 3PVCA 1JU2A 3OZ2A 3UKKA 4JY3A 5IPYA 1NDAA 1L9EA 2C65A
chains in the Genus database with same CATH superfamily
2VVMA 1CC2A 3II4A 3ICSA 3KKJA 3AE6A 1RP0A 2VQBA 1HYUA 1REOA 4I58A 4NWZA 2WOVA 4EMWA 5JCKA 3HYWA 5KOWA 4G74A 4CNKA 2HQMA 2JAEA 2YWLA 2E81A 3GDNA 3M0OA 4K7ZA 3K7TA 2R0GA 2VZ2A 2DKIA 2H89A 1H81A 1L9CA 3AE4A 3BHKA 3V76A 4OPUA 3I6DA 3FPZA 5KVIA 1CJCA 3UKQA 2ZZ0A 2OA1A 3NK0X 3KVEA 2BACA 4U8LA 2E80A 3LJPA 3GRTA 4FDCB 1CHUA 1E39A 1H82A 2C3CA 2C72A 3AWIA 1GTHA 2VVLG 4TLZA 5U63A 4AT2A 3SZWA 4EQXA 3GSIA 1BZLA 4B68A 4JQ9A 1BGNA 1SEZA 3CPJG 1PBCA 4II2A 4AT0A 1ZOYA 3SY4A 1D4CA 3UKAA 4Z43A 4IA6A 3FO3A 2VRLA 4U8JA 3GMCA 1GT8A 2JB3A 4B65A 2CVJA 4TM1A 2J7AA 4CNJA 3UKLA 1TDOA 2OAMA 3C4NA 3DK4A 1QO8A 1LVLA 1FEBA 2VVLA 4YKFA 1EL5A 4BK3A 4U8MA 1CJ2A 2FBWA 4WCTA 5FMHA 2UZZA 3UKHA 1MO9A 4GF7A 3IHGA 3UTFA 4G9KA 3FMWA 3B3RA 4EMIA 2I0ZA 4K5RA 1PXAA 1Q1WA 1FL2A 2YLWA 4G6HA 1GETA 1TDFA 1BVBA 5GRTA 4C77A 3VRBA 2YLXA 2ZZBA 1LJ1A 3DGHA 4YXDA 2X50A 1CC4A 2F5ZA 2PYXA 3CNTA 3O0HA 3T31A 4CCQA 4REKA 1ELIA 2WQYA 3M13A 1E1LA 2YQUA 2C4CA 1P2EA 3CNJA 1GTEA 4J2WA 2IVEA 2YAUA 4XXGA 2BS2A 4H4RA 2JKCA 2AR8A 1KSUA 5U25A 1NHSA 1GV4A 1GXFA 4H4UA 2V3BA 3SX6A 1LQUA 5CQFA 1LPFA 1GEUA 2X99A 4AP3A 2XFOA 3NIXA 4YSYA 3NT6A 2PHHA 4BK2A 4YSZA 5GSNA 2Y6RA 3ABVA 3K7QX 3RHAA 4GDPA 1E1MA 1F6MA 4RSLA 1DOCA 3RP6A 4OPGA 5KVHA 1PJ6A 4Y4NA 3CNSA 1GOSA 3GRSA 3T37A 4GUVA 3OC4A 1FOHA 3K30A 4H4TA 2C70A 1K4QA 1TDKA 2V3AA 3AYLA 1GESA 2FJEA 1XANA 2WPCA 4IA5A 4CBQA 1TDEA 3DH9A 1GRAA 1OJDA 4NZHA 3L1TA 3L8KA 1TYTA 1LQTA 3P4SA 3T2YA 3C4AA 3NRNA 3OWMA 3AE9A 1FCDA 2YG7A 3AEEA 3M12A 4PABA 2XLSA 3P4RA 4KX6A 4Q1OA 3SFEA 3V3OA 3DK8A 5HXIA 4DNAA 4GAPA 3GM6A 2GQFA 2YG6A 3RKHA 1S3BA 4USQA 3COXA 1M1QA 1L0VA 4C5OA 1YY5A 4H4ZA 4C3XA 3ALLA 1SP3A 1BF3A 1GRFA 2V6OA 2ZBWA 2BA9A 4J31A 4U8NA 3ITJA 4BV6A 2WP9A 4JN9A 2XVJA 1L9DA 1PBDA 4UDPA 3SYIA 2GMJA 2GVCA 1ZP0A 2GR1A 4H4YA 2JB2A 2FJAA 4ICYA 4EIPA 1DODA 1OJTA 1H7XA 2GQWA 2BRYA 2RABA 1OJAA 2XLTA 3QFAA 5DBJA 4OPTA 4XWZA 4D03A 3ZDNA 1PHHA 1JRXA 5EB5A 3SM8A 4GCMA 1PBBA 2YR5A 3QFBA 2QA1A 3DJGX 1FECA 3NHOX 2R46A 5C2TA 1V59A 2C73A 3PS9A 4L3ZA 2XVFA 3NYEA 4K5SA 1JNIA 1H86A 2Q0KA 2WESA 2WS3A 4OPCA 4OPLA 1DNCA 4Q0TA 4U8IA 1M6IA 3VRAA 4LA1A 1GU6A 2X3NA 3NYCA 5JCIA 1N4VA 3AB1A 3H4KA 4L3XA 1JRZA 2E4GA 2EQ6A 2WDQA 5IQ1A 3S61A 1LTXR 3UTEA 2XFNA 3NTDA 1YQZA 2BXSA 1H6VA 3P9UA 3GD4A 4XWRA 2GAHB 3UOXA 2XLUA 1VG0A 3TTBA 2WP6A 1D7LA 3CNDA 1Z6LA 4L38A 3EANA 4TM3A 2OT4A 1W4XA 3BNGA 4A5LA 3SZ0A 1Q1RA 1RYIA 3QVPA 4CY6A 1ZMCA 4B66A 3DGZA 1NPXA 1FS9A 1PJ5A 2RGHA 2YR6A 1IJHA 2DKHA 1YQ4A 5JCNA 4J34A 3D1IA 4Y4MA 3QJ4A 4YT0A 3AD9B 3UOZA 4YTPA 2WP5A 2B9YA 3ICTA 3QVRA 2YG3A 5M0ZA 3BI5A 1NG4A 2YG5A 1GREA 1DJQA 4J36A 2FJBA 2Q7VA 1PBFA 4EM4A 1CJ3A 1KFYA 2JB1A 2QCUA 2WDVA 2C64A 1H83A 1E6EA 3CN8A 3DMEA 3LB8A 3Q9TA 4H4VA 5KMSA 3UKFA 2XVIA 3HYXA 4OVIA 3D8XA 4YTNA 4HB9A 4RG4A 1EL8A 5KRQA 1VG9A 3BHFA 2R4JA 2V60A 2OLOA 2VOUA 2WETA 3BNJA 3CPIG 4C3YA 1Q9IA 2EQ7A 2QAEA 3EPTA 4U8KA 3CMMA 2APGA 3NGCX 5BULA 1CF3A 4YSXA 1KNPA 4CY8A 3AE5A 5JCMA 1LV0A 1X31B 1ZKQA 5L46A 3BNHA 3GDPA 4BJZA 2C67A 4CCRA 4Z44A 2XCGA 3G5SA 4ZCCA 1S3EA 2B7RA 5KWFA 4X9MA 3FIMB 1KF6A 2R4EA 1Y0PA 2WEUA 2XVHA 3AE1A 5M10A 3AYJA 4X9NA 4BJYA 2XFPA 1ZDLA 1DJNA 4H7UA 2W0HA 4LU6A 3SGLA 2GR3A 2BABA 3T2KA 4ZN0A 1N4UA 2BYBA 1BGJA 3B6DA 2IVDA 1IUVA 3K7MX 3L1RA 5EBKA 3REDA 2BCGG 3DA1A 4B69A 4U2SA 2ZZCA 1M1PA 3SXIA 3NLCA 3KU9A 1QJDA 4NEWA 3RP7A 3CGBA 3FBSA 3BI4A 4Z2RA 2Q6UA 3MMOA 4TM4A 2GAGB 4M52A 2X8GA 5C3JA 2Q0LA 3T14A 4IVOB 5BVAA 2O9ZA 3GWFA 1K0IA 4GDEA 5BUKA 2BC1A 1KDGA 3ADAB 3UP5A 3ATQA 1PS9A 4YKGA 1NAAA 4U8PA 4FK1A 3GMBA 2R45A 2VR0A 1EL9A 4CRTA 1IUXA 4ZCDA 3SQPA 2IIDA 4K8DA 1S2QA 1AOGA 1CC6A 1ONFA 4A79A 3SZFA 4K22A 4APNA 4L3YA 1YKJA 5KMPA 4TM0A 3VR8A 3NYFA 3WE0A 2YM2A 3P1WA 2GV8A 1JOAA 1NENA 2VQ7A 2X8CA 5KXJA 3G5QA 1FS7A 1IUWA 2BC0A 2RGOA 4WX1A 1DOBA 5HHFA 1BWCA 2GF3A 3KPKA 2XVEA 2NVKX 4IV9A 3AE3A 3ALJA 4D04A 1PXBA 4JY2A 2LFCA 5LV9A 2R0PA 1H84A 2A8XA 3NNEA 4NTEA 5FS7A 4A65A 4EQWA 3F29A 4O5UA 2YVFA 4KPRA 3R9UA 3UOYA 3S7WA 2C66A 1K0LA 4H2NA 2V5ZA 2C3DA 2C7GA 2Z5YA 3GWDA 3DJJA 2GMHA 3AE2A 4GRTA 4NTDA 4MJWA 3UKPA 3IC9A 4NEVA 2WU2A 3AECA 3JSKA 1O95A 3SXQA 3DK9A 4DSHA 1KSSA 4P9SA 2VRMA 1PXCA 5JCLA 1OAHA 1N4WA 4A6NA 1PJ7A 2YLZA 2B9WA 4EQRA 4Q17A 1D4EA 3GD3A 1XHCA 5ER0A 1O5WA 3UTHA 3NG7X 3AE7A 1FT5A 1F3PA 4G6GA 4NNJA 4RG3A 4N9XA 4U8OA 1E7PA 1PN0A 3QSEA 1IUTA 4E0VA 2XLPA 4EMJA 2BS4A 2WPEA 3KPFA 2GR0A 3QSMA 2B7SA 4YTMA 4OPDA 3V3NA 3AE8A 4ECHA 3CGEA 2BRAA 2TPRA 2YG4A 4DSGA 1RSGA 2WOWA 3CGDA 2GR2A 1GERA 2C75A 2WDRA 4IVMB 3AXBA 4USRA 1P2HA 2YLSA 3NN6X 3NK2X 4EM3A 1F8WA 3CTYA 1NHPA 3UP4A 1ZMDA 3DJDA 2BS3A 3AYIA 4Z26A 2QA2A 1D4DA 1IUUA 1JNZA 1GALA 4JNQA 5CKUA 2NPXA 3F8PA 4EIQA 1VRQB 3ISHA 4I59A 4A6NB 4A7AA 2BCPA 1NG3A 2OALA 1O94A 2YLTA 3AEGA 2CULA 1GRTA 5J60A 2YLRA 3H8IA 3UTGA 3T0KA 2OLNA 1MXTA 3UOVA 3ATRA 4H4XA 4Q4UA 3G5RA 2GB0A 4YSHA 4HA6A 2AQJA 1EL7A 4A99A 2GRTA 1XPQA 2WHDA 2ARDA 4G73A 2CZSA 1GRBA 1ZK7A 3VRDB 2XLRA 3P4PA 1ZX9A 3LADA 2Y6QA 3CGCA 1D5TA 4H2QA 1N1PA 1F8RA 3KA7A 5KOXA 3LGQA 1TDNA 2CFYA 2J3NA 2YR4A 1JRYA 4PAAA 1QLBA 1E1KA 1GSNA 2ZO5A 3HZLA 2Z5XA 5U1OA 4H2PA 1CJ4A 1GRHA 4GAVA 1DXLA 2WOIA 1COYA 4WJYA 5KMRA 2GH5A 4BK1A 2A87A 2WU5A 3BI2A 4H4QA 1JEHA 3URHA 4C74A 2X8HA 2E1MA 4Z24A 5EB4A 4YWOA 1B8SA 3F8DA 2YVGA 2R9ZA 1CL0A 3DJEA 3AD8B 5FS9A 3VQRA 4II3A 1B5QA 3IHMA 5TR3A 5HY5A 3SZCA 3BNUA 4Y4LA 1NHRA 5HYMA 3P4QA 1D7YA 1NHQA 1ZOVA 1UKVG 1JNRA 1S2YA 5BRTA 1OJCA 1FEAA 2JBVA 3CPHG 3NK1X 3I3LA 5J7XA 3SFDA 3UCLA 4B63A 1ZY8A 2K3VA 3LZXA 1YQ3A 2B9XA 4B67A 1H7WA 1M1RA 1FT6A 1GPEA 1Y56A 2FJDA 1CBOA 1VDCA 3NH3X 3ZYXA 2H88A 3SCEA 1E1NA 2XDOA 4Z2UA 4K2XA 4ADWA 3LOVA 3C96A 2JK6A 1B4VA 1MOKA 3E1TA 2R0CA 3T2ZA 4Z25A 3NTAA 3KLJA 5IQ4A 5FS8A 1KNRA 4U2TA 1IUSA 3GYXA 4H50A 4B1BA 2WPFA 3RP8A 3CIRA 2EQ8A 1BKWA 2BK5A 3AEAA 4J56A 3AD7B 5FS6A 3QSSA 4Q5BA 1GNDA 1GRGA 1PBEA 2CDUA 4EQSA 3F8RA 4A9WA 2AAQA 2RDZA 4OCGA 4TLXA 2BK4A 2RF7A 4FK1C 3LG1A 3HYVA 2RGJA 4H4PA 2XYOA 5KNLA 1NEKA 2A89A 3IWAA 4UDRA 3KD9A 4X4JA 2TMDA 4H4SA 4LIIA 1PDHA 4JNAA 2YVJA 4DGKA 3LXDA 4Q5CA 1Y56B 3EF6A 4JDRA 2XFQA 2GEWA 4AOSA 1B37A 3AEBA 2V61A 4GR1A 3ICRA 5EOWA 2WBAA 3AEDA 3NKSA 3BNFA 2E5VA 3H8LA 3Q6JA 4U2LA 4BURA 4J33A 2ACZA 1TRBA 4OPIA 3CNPA 3GYIA 1EBDA 4H4WA 3BNMA 3FG2P 4FX9A 3AEFA 2EQ9A 1F8SA 1VQWA 3ALMA 4O5QA 1TYPA 3D1CA 3IF9A 4J57A 3RNMA 4UP3A 3UU9A 3EAOA 4Z2TA 3TORA 4UDQA 1M64A 2XFUA 4B64A 1XDIA 3PO7A 4AOXA 2BXRA 3LZWA 5KMQA 3UBRA 1OJ9A 2B76A 2YM1A 4H2RA 1K0JA 3S5WA 1DOEA 3GYJA 4NTCA 2BK3A 1FS8A 1QDBA 3VR9A 2C76A 3NN0X 4AP1A 3PVCA 1JU2A 3OZ2A 3UKKA 4JY3A 5IPYA 1NDAA 1L9EA 2C65A
chains in the Genus database with same CATH topology
2VVMA 1CC2A 3II4A 3ICSA 3KKJA 3AE6A 1RP0A 2VQBA 1HYUA 1REOA 4I58A 4NWZA 2WOVA 4EMWA 5JCKA 3HYWA 5KOWA 4G74A 4CNKA 2HQMA 2JAEA 2YWLA 2E81A 3GDNA 3M0OA 4K7ZA 3K7TA 2R0GA 2VZ2A 2DKIA 2H89A 1H81A 1L9CA 3AE4A 3BHKA 3V76A 4OPUA 3I6DA 3FPZA 5KVIA 1CJCA 3UKQA 2ZZ0A 2OA1A 3NK0X 3KVEA 2BACA 4U8LA 2E80A 3LJPA 3GRTA 4FDCB 1CHUA 1E39A 1H82A 2C3CA 2C72A 3AWIA 1GTHA 2VVLG 4TLZA 5U63A 4AT2A 3SZWA 4EQXA 3GSIA 1BZLA 4B68A 4JQ9A 1BGNA 1SEZA 3CPJG 1PBCA 4II2A 4AT0A 1ZOYA 3SY4A 1D4CA 3UKAA 4Z43A 4IA6A 3FO3A 2VRLA 4U8JA 3GMCA 1GT8A 2JB3A 4B65A 2CVJA 4TM1A 2J7AA 4CNJA 3UKLA 1TDOA 2OAMA 3C4NA 3DK4A 1QO8A 1LVLA 1FEBA 2VVLA 4YKFA 1EL5A 4BK3A 4U8MA 1CJ2A 2FBWA 4WCTA 5FMHA 2UZZA 3UKHA 1MO9A 4GF7A 3IHGA 3UTFA 4G9KA 3FMWA 3B3RA 4EMIA 2I0ZA 4K5RA 1PXAA 1Q1WA 1FL2A 2YLWA 4G6HA 1GETA 1TDFA 1BVBA 5GRTA 4C77A 3VRBA 2YLXA 2ZZBA 1LJ1A 3DGHA 4YXDA 2X50A 1CC4A 2F5ZA 2PYXA 3CNTA 3O0HA 3T31A 4CCQA 4REKA 1ELIA 2WQYA 3M13A 1E1LA 2YQUA 2C4CA 1P2EA 3CNJA 1GTEA 4J2WA 2IVEA 2YAUA 4XXGA 2BS2A 4H4RA 2JKCA 2AR8A 1KSUA 5U25A 1NHSA 1GV4A 1GXFA 4H4UA 2V3BA 3SX6A 1LQUA 5CQFA 1LPFA 1GEUA 2X99A 4AP3A 2XFOA 3NIXA 4YSYA 3NT6A 2PHHA 4BK2A 4YSZA 5GSNA 2Y6RA 3ABVA 3K7QX 3RHAA 4GDPA 1E1MA 1F6MA 4RSLA 1DOCA 3RP6A 4OPGA 5KVHA 1PJ6A 4Y4NA 3CNSA 1GOSA 3GRSA 3T37A 4GUVA 3OC4A 1FOHA 3K30A 4H4TA 2C70A 1K4QA 1TDKA 2V3AA 3AYLA 1GESA 2FJEA 1XANA 2WPCA 4IA5A 4CBQA 1TDEA 3DH9A 1GRAA 1OJDA 4NZHA 3L1TA 3L8KA 1TYTA 1LQTA 3P4SA 3T2YA 3C4AA 3NRNA 3OWMA 3AE9A 1FCDA 2YG7A 3AEEA 3M12A 4PABA 2XLSA 3P4RA 4KX6A 4Q1OA 3SFEA 3V3OA 3DK8A 5HXIA 4DNAA 4GAPA 3GM6A 2GQFA 2YG6A 3RKHA 1S3BA 4USQA 3COXA 1M1QA 1L0VA 4C5OA 1YY5A 4H4ZA 4C3XA 3ALLA 1SP3A 1BF3A 1GRFA 2V6OA 2ZBWA 2BA9A 4J31A 4U8NA 3ITJA 4BV6A 2WP9A 4JN9A 2XVJA 1L9DA 1PBDA 4UDPA 3SYIA 2GMJA 2GVCA 1ZP0A 2GR1A 4H4YA 2JB2A 2FJAA 4ICYA 4EIPA 1DODA 1OJTA 1H7XA 2GQWA 2BRYA 2RABA 1OJAA 2XLTA 3QFAA 5DBJA 4OPTA 4XWZA 4D03A 3ZDNA 1PHHA 1JRXA 5EB5A 3SM8A 4GCMA 1PBBA 2YR5A 3QFBA 2QA1A 3DJGX 1FECA 3NHOX 2R46A 5C2TA 1V59A 2C73A 3PS9A 4L3ZA 2XVFA 3NYEA 4K5SA 1JNIA 1H86A 2Q0KA 2WESA 2WS3A 4OPCA 4OPLA 1DNCA 4Q0TA 4U8IA 1M6IA 3VRAA 4LA1A 1GU6A 2X3NA 3NYCA 5JCIA 1N4VA 3AB1A 3H4KA 4L3XA 1JRZA 2E4GA 2EQ6A 2WDQA 5IQ1A 3S61A 1LTXR 3UTEA 2XFNA 3NTDA 1YQZA 2BXSA 1H6VA 3P9UA 3GD4A 4XWRA 2GAHB 3UOXA 2XLUA 1VG0A 3TTBA 2WP6A 1D7LA 3CNDA 1Z6LA 4L38A 3EANA 4TM3A 2OT4A 1W4XA 3BNGA 4A5LA 3SZ0A 1Q1RA 1RYIA 3QVPA 4CY6A 1ZMCA 4B66A 3DGZA 1NPXA 1FS9A 1PJ5A 2RGHA 2YR6A 1IJHA 2DKHA 1YQ4A 5JCNA 4J34A 3D1IA 4Y4MA 3QJ4A 4YT0A 3AD9B 3UOZA 4YTPA 2WP5A 2B9YA 3ICTA 3QVRA 2YG3A 5M0ZA 3BI5A 1NG4A 2YG5A 1GREA 1DJQA 4J36A 2FJBA 2Q7VA 1PBFA 4EM4A 1CJ3A 1KFYA 2JB1A 2QCUA 2WDVA 2C64A 1H83A 1E6EA 3CN8A 3DMEA 3LB8A 3Q9TA 4H4VA 5KMSA 3UKFA 2XVIA 3HYXA 4OVIA 3D8XA 4YTNA 4HB9A 4RG4A 1EL8A 5KRQA 1VG9A 3BHFA 2R4JA 2V60A 2OLOA 2VOUA 2WETA 3BNJA 3CPIG 4C3YA 1Q9IA 2EQ7A 2QAEA 3EPTA 4U8KA 3CMMA 2APGA 3NGCX 5BULA 1CF3A 4YSXA 1KNPA 4CY8A 3AE5A 5JCMA 1LV0A 1X31B 1ZKQA 5L46A 3BNHA 3GDPA 4BJZA 2C67A 4CCRA 4Z44A 2XCGA 3G5SA 4ZCCA 1S3EA 2B7RA 5KWFA 4X9MA 3FIMB 1KF6A 2R4EA 1Y0PA 2WEUA 2XVHA 3AE1A 5M10A 3AYJA 4X9NA 4BJYA 2XFPA 1ZDLA 1DJNA 4H7UA 2W0HA 4LU6A 3SGLA 2GR3A 2BABA 3T2KA 4ZN0A 1N4UA 2BYBA 1BGJA 3B6DA 2IVDA 1IUVA 3K7MX 3L1RA 5EBKA 3REDA 2BCGG 3DA1A 4B69A 4U2SA 2ZZCA 1M1PA 3SXIA 3NLCA 3KU9A 1QJDA 4NEWA 3RP7A 3CGBA 3FBSA 3BI4A 4Z2RA 2Q6UA 3MMOA 4TM4A 2GAGB 4M52A 2X8GA 5C3JA 2Q0LA 3T14A 4IVOB 5BVAA 2O9ZA 3GWFA 1K0IA 4GDEA 5BUKA 2BC1A 1KDGA 3ADAB 3UP5A 3ATQA 1PS9A 4YKGA 1NAAA 4U8PA 4FK1A 3GMBA 2R45A 2VR0A 1EL9A 4CRTA 1IUXA 4ZCDA 3SQPA 2IIDA 4K8DA 1S2QA 1AOGA 1CC6A 1ONFA 4A79A 3SZFA 4K22A 4APNA 4L3YA 1YKJA 5KMPA 4TM0A 3VR8A 3NYFA 3WE0A 2YM2A 3P1WA 2GV8A 1JOAA 1NENA 2VQ7A 2X8CA 5KXJA 3G5QA 1FS7A 1IUWA 2BC0A 2RGOA 4WX1A 1DOBA 5HHFA 1BWCA 2GF3A 3KPKA 2XVEA 2NVKX 4IV9A 3AE3A 3ALJA 4D04A 1PXBA 4JY2A 2LFCA 5LV9A 2R0PA 1H84A 2A8XA 3NNEA 4NTEA 5FS7A 4A65A 4EQWA 3F29A 4O5UA 2YVFA 4KPRA 3R9UA 3UOYA 3S7WA 2C66A 1K0LA 4H2NA 2V5ZA 2C3DA 2C7GA 2Z5YA 3GWDA 3DJJA 2GMHA 3AE2A 4GRTA 4NTDA 4MJWA 3UKPA 3IC9A 4NEVA 2WU2A 3AECA 3JSKA 1O95A 3SXQA 3DK9A 4DSHA 1KSSA 4P9SA 2VRMA 1PXCA 5JCLA 1OAHA 1N4WA 4A6NA 1PJ7A 2YLZA 2B9WA 4EQRA 4Q17A 1D4EA 3GD3A 1XHCA 5ER0A 1O5WA 3UTHA 3NG7X 3AE7A 1FT5A 1F3PA 4G6GA 4NNJA 4RG3A 4N9XA 4U8OA 1E7PA 1PN0A 3QSEA 1IUTA 4E0VA 2XLPA 4EMJA 2BS4A 2WPEA 3KPFA 2GR0A 3QSMA 2B7SA 4YTMA 4OPDA 3V3NA 3AE8A 4ECHA 3CGEA 2BRAA 2TPRA 2YG4A 4DSGA 1RSGA 2WOWA 3CGDA 2GR2A 1GERA 2C75A 2WDRA 4IVMB 3AXBA 4USRA 1P2HA 2YLSA 3NN6X 3NK2X 4EM3A 1F8WA 3CTYA 1NHPA 3UP4A 1ZMDA 3DJDA 2BS3A 3AYIA 4Z26A 2QA2A 1D4DA 1IUUA 1JNZA 1GALA 4JNQA 5CKUA 2NPXA 3F8PA 4EIQA 1VRQB 3ISHA 4I59A 4A6NB 4A7AA 2BCPA 1NG3A 2OALA 1O94A 2YLTA 3AEGA 2CULA 1GRTA 5J60A 2YLRA 3H8IA 3UTGA 3T0KA 2OLNA 1MXTA 3UOVA 3ATRA 4H4XA 4Q4UA 3G5RA 2GB0A 4YSHA 4HA6A 2AQJA 1EL7A 4A99A 2GRTA 1XPQA 2WHDA 2ARDA 4G73A 1GRBA 1ZK7A 3VRDB 2XLRA 3P4PA 1ZX9A 3LADA 2Y6QA 3CGCA 1D5TA 4H2QA 1N1PA 1F8RA 3KA7A 5KOXA 3LGQA 1TDNA 2CFYA 2J3NA 2YR4A 1JRYA 4PAAA 1QLBA 1E1KA 1GSNA 2ZO5A 3HZLA 2Z5XA 5U1OA 4H2PA 1CJ4A 1GRHA 4GAVA 1DXLA 2WOIA 1COYA 4WJYA 5KMRA 2GH5A 4BK1A 2A87A 2WU5A 3BI2A 4H4QA 1JEHA 3URHA 4C74A 2X8HA 2E1MA 4Z24A 5EB4A 4YWOA 1B8SA 3F8DA 2YVGA 2R9ZA 1CL0A 3DJEA 3AD8B 5FS9A 3VQRA 4II3A 1B5QA 3IHMA 5TR3A 5HY5A 3SZCA 3BNUA 4Y4LA 1NHRA 5HYMA 3P4QA 1D7YA 1NHQA 1ZOVA 1UKVG 1JNRA 1S2YA 5BRTA 1OJCA 1FEAA 2JBVA 3CPHG 3NK1X 3I3LA 5J7XA 3SFDA 3UCLA 4B63A 1ZY8A 2K3VA 3LZXA 1YQ3A 2B9XA 4B67A 1H7WA 1M1RA 1FT6A 1GPEA 1Y56A 2FJDA 1CBOA 1VDCA 3NH3X 3ZYXA 2H88A 3SCEA 1E1NA 2XDOA 4Z2UA 4K2XA 4ADWA 3LOVA 3C96A 2JK6A 1B4VA 1MOKA 3E1TA 2R0CA 3T2ZA 4Z25A 3NTAA 3KLJA 5IQ4A 5FS8A 1KNRA 4U2TA 1IUSA 3GYXA 4H50A 4B1BA 2WPFA 3RP8A 3CIRA 2EQ8A 1BKWA 2BK5A 3AEAA 4J56A 3AD7B 5FS6A 3QSSA 4Q5BA 1GNDA 1GRGA 1PBEA 2CDUA 4EQSA 3F8RA 4A9WA 2AAQA 2RDZA 4OCGA 4TLXA 2BK4A 2RF7A 4FK1C 3LG1A 3HYVA 2RGJA 4H4PA 2XYOA 5KNLA 1NEKA 2A89A 3IWAA 4UDRA 3KD9A 4X4JA 2TMDA 4H4SA 4LIIA 1PDHA 4JNAA 2YVJA 4DGKA 3LXDA 4Q5CA 1Y56B 3EF6A 4JDRA 2XFQA 2GEWA 4AOSA 1B37A 3AEBA 2V61A 4GR1A 3ICRA 5EOWA 2WBAA 3AEDA 3NKSA 3BNFA 2E5VA 3H8LA 3Q6JA 4U2LA 4BURA 4J33A 2ACZA 1TRBA 4OPIA 3CNPA 3GYIA 1EBDA 4H4WA 3BNMA 3FG2P 4FX9A 3AEFA 2EQ9A 1F8SA 1VQWA 3ALMA 4O5QA 1TYPA 3D1CA 3IF9A 4J57A 3RNMA 4UP3A 3UU9A 3EAOA 4Z2TA 3TORA 4UDQA 1M64A 2XFUA 4B64A 1XDIA 3PO7A 4AOXA 2BXRA 3LZWA 5KMQA 3UBRA 1OJ9A 2B76A 2YM1A 4H2RA 1K0JA 3S5WA 1DOEA 3GYJA 4NTCA 2BK3A 1FS8A 1QDBA 3VR9A 2C76A 3NN0X 4AP1A 3PVCA 1JU2A 3OZ2A 3UKKA 4JY3A 5IPYA 1NDAA 1L9EA 2C65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VVM A;  1CC2 A;  3II4 A;  3ICS A;  3KKJ A;  3AE6 A;  1RP0 A;  2VQB A;  1HYU A;  1REO A;  4I58 A;  4EMW A;  2WOV A;  5JCK A;  5KOW A;  4CNK A;  2HQM A;  2JAE A;  2YWL A;  2E81 A;  3GDN A;  3M0O A;  4K7Z A;  3K7T A;  2R0G A;  2VZ2 A;  2DKI A;  2H89 A;  1H81 A;  1L9C A;  3AE4 A;  3BHK A;  3V76 A;  4OPU A;  3I6D A;  3FPZ A;  5KVI A;  1CJC A;  3UKQ A;  2ZZ0 A;  2OA1 A;  3NK0 X;  3KVE A;  2BAC A;  4U8L A;  2E80 A;  3LJP A;  3GRT A;  4FDC B;  1CHU A;  1E39 A;  1H82 A;  2C3C A;  2C72 A;  3AWI A;  1GTH A;  2VVL G;  4TLZ A;  5U63 A;  4AT2 A;  4EQX A;  3GSI A;  1BZL A;  4B68 A;  4JQ9 A;  1BGN A;  1SEZ A;  3CPJ G;  1PBC A;  4AT0 A;  1ZOY A;  4Z43 A;  1D4C A;  3UKA A;  4IA6 A;  3FO3 A;  2VRL A;  4U8J A;  3GMC A;  1GT8 A;  2JB3 A;  4B65 A;  2CVJ A;  4TM1 A;  2J7A A;  4CNJ A;  3UKL A;  1TDO A;  2OAM A;  3C4N A;  3DK4 A;  1QO8 A;  1LVL A;  1FEB A;  2VVL A;  4YKF A;  1EL5 A;  4BK3 A;  4U8M A;  1CJ2 A;  2FBW A;  4WCT A;  5FMH A;  2UZZ A;  3UKH A;  1MO9 A;  4GF7 A;  3IHG A;  3UTF A;  3FMW A;  3B3R A;  4EMI A;  2I0Z A;  4K5R A;  1PXA A;  1Q1W A;  1FL2 A;  2YLW A;  1GET A;  1TDF A;  1BVB A;  5GRT A;  4C77 A;  3VRB A;  2YLX A;  2ZZB A;  1LJ1 A;  3DGH A;  4YXD A;  2X50 A;  1CC4 A;  2F5Z A;  2PYX A;  3CNT A;  3O0H A;  4CCQ A;  4REK A;  1ELI A;  2WQY A;  3M13 A;  1E1L A;  2YQU A;  1P2E A;  3CNJ A;  1GTE A;  4J2W A;  2IVE A;  2YAU A;  4XXG A;  2BS2 A;  4H4R A;  2JKC A;  2AR8 A;  1KSU A;  5U25 A;  1NHS A;  1GV4 A;  1GXF A;  4H4U A;  2V3B A;  1LQU A;  5CQF A;  1LPF A;  1GEU A;  2X99 A;  4AP3 A;  2XFO A;  3NIX A;  4YSY A;  3NT6 A;  2PHH A;  4BK2 A;  4YSZ A;  5GSN A;  2Y6R A;  3ABV A;  3K7Q X;  3RHA A;  4GDP A;  1E1M A;  1F6M A;  4RSL A;  1DOC A;  3RP6 A;  4OPG A;  5KVH A;  1PJ6 A;  4Y4N A;  3CNS A;  1GOS A;  3GRS A;  3T37 A;  4GUV A;  3OC4 A;  1FOH A;  3K30 A;  4H4T A;  2C70 A;  1K4Q A;  1TDK A;  2V3A A;  3AYL A;  1GES A;  2FJE A;  1XAN A;  2WPC A;  4IA5 A;  4CBQ A;  1TDE A;  3DH9 A;  1GRA A;  1OJD A;  4NZH A;  3L1T A;  3L8K A;  1TYT A;  1LQT A;  3P4S A;  3C4A A;  3NRN A;  3OWM A;  3AE9 A;  1FCD A;  2YG7 A;  3AEE A;  3M12 A;  4PAB A;  2XLS A;  3P4R A;  4KX6 A;  4Q1O A;  3SFE A;  3V3O A;  3DK8 A;  5HXI A;  4DNA A;  3GM6 A;  2GQF A;  2YG6 A;  3RKH A;  1S3B A;  4USQ A;  3COX A;  1M1Q A;  1L0V A;  4C5O A;  1YY5 A;  4H4Z A;  4C3X A;  3ALL A;  1SP3 A;  1BF3 A;  1GRF A;  2V6O A;  2ZBW A;  2BA9 A;  4J31 A;  4U8N A;  3ITJ A;  4BV6 A;  2WP9 A;  4JN9 A;  2XVJ A;  1L9D A;  1PBD A;  4UDP A;  2GMJ A;  2GVC A;  1ZP0 A;  2GR1 A;  4H4Y A;  2JB2 A;  2FJA A;  4ICY A;  4EIP A;  1DOD A;  1OJT A;  1H7X A;  2GQW A;  2RAB A;  2XLT A;  1OJA A;  3QFA A;  5DBJ A;  4D03 A;  4OPT A;  4XWZ A;  3ZDN A;  1PHH A;  1JRX A;  5EB5 A;  3SM8 A;  4GCM A;  1PBB A;  2YR5 A;  3QFB A;  2QA1 A;  3DJG X;  1FEC A;  3NHO X;  2R46 A;  5C2T A;  1V59 A;  2C73 A;  3PS9 A;  4L3Z A;  2XVF A;  3NYE A;  4K5S A;  1JNI A;  1H86 A;  2Q0K A;  2WES A;  2WS3 A;  4OPC A;  4OPL A;  1DNC A;  4Q0T A;  4U8I A;  1M6I A;  3VRA A;  4LA1 A;  1GU6 A;  2X3N A;  3NYC A;  5JCI A;  1N4V A;  3AB1 A;  3H4K A;  4L3X A;  1JRZ A;  2E4G A;  2EQ6 A;  2WDQ A;  5IQ1 A;  3S61 A;  1LTX R;  3UTE A;  2XFN A;  3NTD A;  1YQZ A;  2BXS A;  1H6V A;  3P9U A;  3GD4 A;  4XWR A;  2GAH B;  3UOX A;  2XLU A;  1VG0 A;  3TTB A;  2WP6 A;  1D7L A;  3CND A;  1Z6L A;  4L38 A;  3EAN A;  4TM3 A;  2OT4 A;  1W4X A;  3BNG A;  4A5L A;  1Q1R A;  1RYI A;  3QVP A;  4CY6 A;  1ZMC A;  4B66 A;  3DGZ A;  1NPX A;  1FS9 A;  1PJ5 A;  2RGH A;  2YR6 A;  1IJH A;  2DKH A;  1YQ4 A;  5JCN A;  4J34 A;  3D1I A;  4Y4M A;  3QJ4 A;  4YT0 A;  3AD9 B;  3UOZ A;  4YTP A;  2WP5 A;  2B9Y A;  3ICT A;  3QVR A;  2YG3 A;  5M0Z A;  3BI5 A;  1NG4 A;  2YG5 A;  1GRE A;  1DJQ A;  4J36 A;  2FJB A;  2Q7V A;  1PBF A;  4EM4 A;  1CJ3 A;  1KFY A;  2JB1 A;  2QCU A;  2WDV A;  2C64 A;  1H83 A;  1E6E A;  3CN8 A;  3DME A;  3LB8 A;  3Q9T A;  4H4V A;  3UKF A;  2XVI A;  4OVI A;  3D8X A;  4YTN A;  4HB9 A;  4RG4 A;  1EL8 A;  5KRQ A;  1VG9 A;  3BHF A;  2R4J A;  2V60 A;  2OLO A;  2VOU A;  2WET A;  3BNJ A;  3CPI G;  4C3Y A;  1Q9I A;  2EQ7 A;  2QAE A;  3EPT A;  4U8K A;  2APG A;  3NGC X;  5BUL A;  1CF3 A;  4YSX A;  1KNP A;  4CY8 A;  3AE5 A;  5JCM A;  1LV0 A;  1X31 B;  1ZKQ A;  5L46 A;  3BNH A;  3GDP A;  4BJZ A;  2C67 A;  4CCR A;  4Z44 A;  2XCG A;  3G5S A;  4ZCC A;  1S3E A;  2B7R A;  5KWF A;  4X9M A;  3FIM B;  1KF6 A;  2R4E A;  1Y0P A;  2WEU A;  2XVH A;  3AE1 A;  5M10 A;  3AYJ A;  4X9N A;  4BJY A;  2XFP A;  1ZDL A;  1DJN A;  4H7U A;  2W0H A;  4LU6 A;  3SGL A;  2GR3 A;  2BAB A;  4ZN0 A;  1N4U A;  2BYB A;  1BGJ A;  3B6D A;  2IVD A;  1IUV A;  3K7M X;  3L1R A;  5EBK A;  3RED A;  2BCG G;  3DA1 A;  4B69 A;  4U2S A;  2ZZC A;  1M1P A;  3NLC A;  3KU9 A;  1QJD A;  4NEW A;  3RP7 A;  3CGB A;  3FBS A;  3BI4 A;  4Z2R A;  2Q6U A;  3MMO A;  4TM4 A;  2GAG B;  4M52 A;  2X8G A;  5C3J A;  2Q0L A;  4IVO B;  5BVA A;  2O9Z A;  3GWF A;  1K0I A;  4GDE A;  5BUK A;  2BC1 A;  1KDG A;  3ADA B;  3UP5 A;  3ATQ A;  1PS9 A;  4YKG A;  1NAA A;  4U8P A;  4FK1 A;  3GMB A;  2R45 A;  2VR0 A;  1EL9 A;  4CRT A;  1IUX A;  4ZCD A;  3SQP A;  2IID A;  4K8D A;  1S2Q A;  1AOG A;  1CC6 A;  1ONF A;  4A79 A;  4K22 A;  4APN A;  4L3Y A;  1YKJ A;  4TM0 A;  3VR8 A;  3NYF A;  3WE0 A;  2YM2 A;  3P1W A;  2GV8 A;  1JOA A;  1NEN A;  2VQ7 A;  2X8C A;  5KXJ A;  3G5Q A;  1FS7 A;  1IUW A;  2BC0 A;  2RGO A;  4WX1 A;  1DOB A;  5HHF A;  1BWC A;  2GF3 A;  2XVE A;  2NVK X;  4IV9 A;  3AE3 A;  3ALJ A;  4D04 A;  1PXB A;  4JY2 A;  2LFC A;  5LV9 A;  2R0P A;  1H84 A;  2A8X A;  3NNE A;  4NTE A;  5FS7 A;  4A65 A;  4EQW A;  3F29 A;  4O5U A;  2YVF A;  4KPR A;  3R9U A;  3UOY A;  3S7W A;  2C66 A;  1K0L A;  4H2N A;  2V5Z A;  2C3D A;  2C7G A;  2Z5Y A;  3GWD A;  3DJJ A;  2GMH A;  3AE2 A;  4GRT A;  4NTD A;  4MJW A;  3UKP A;  3IC9 A;  4NEV A;  2WU2 A;  3AEC A;  3JSK A;  1O95 A;  3SXQ A;  3DK9 A;  4DSH A;  1KSS A;  4P9S A;  2VRM A;  1PXC A;  5JCL A;  1OAH A;  1N4W A;  4A6N A;  1PJ7 A;  2YLZ A;  2B9W A;  4EQR A;  4Q17 A;  1D4E A;  3GD3 A;  1XHC A;  5ER0 A;  1O5W A;  3UTH A;  3NG7 X;  3AE7 A;  1FT5 A;  1F3P A;  4RG3 A;  4N9X A;  4U8O A;  1E7P A;  1PN0 A;  3QSE A;  1IUT A;  4E0V A;  2XLP A;  4EMJ A;  2BS4 A;  2WPE A;  3KPF A;  2GR0 A;  3QSM A;  2B7S A;  4YTM A;  4OPD A;  3V3N A;  3AE8 A;  4ECH A;  3CGE A;  2YG4 A;  2TPR A;  4DSG A;  1RSG A;  2WOW A;  3CGD A;  2GR2 A;  1GER A;  2C75 A;  2WDR A;  4IVM B;  3AXB A;  4USR A;  1P2H A;  2YLS A;  3NN6 X;  3NK2 X;  4EM3 A;  1F8W A;  3CTY A;  1NHP A;  3UP4 A;  1ZMD A;  3DJD A;  2BS3 A;  3AYI A;  4Z26 A;  2QA2 A;  1D4D A;  1IUU A;  1JNZ A;  1GAL A;  4JNQ A;  5CKU A;  2NPX A;  3F8P A;  4EIQ A;  1VRQ B;  3ISH A;  4I59 A;  4A6N B;  4A7A A;  2BCP A;  1NG3 A;  2OAL A;  1O94 A;  2YLT A;  3AEG A;  2CUL A;  1GRT A;  5J60 A;  2YLR A;  3H8I A;  3UTG A;  3UOV A;  2OLN A;  1MXT A;  3ATR A;  4H4X A;  4Q4U A;  3G5R A;  2GB0 A;  4YSH A;  4HA6 A;  2AQJ A;  1EL7 A;  4A99 A;  2GRT A;  1XPQ A;  2WHD A;  2ARD A;  1GRB A;  1ZK7 A;  3VRD B;  2XLR A;  3P4P A;  1ZX9 A;  3LAD A;  2Y6Q A;  3CGC A;  1D5T A;  4H2Q A;  1N1P A;  1F8R A;  3KA7 A;  5KOX A;  3LGQ A;  1TDN A;  2CFY A;  2J3N A;  2YR4 A;  1JRY A;  4PAA A;  1QLB A;  1E1K A;  1GSN A;  2ZO5 A;  3HZL A;  2Z5X A;  5U1O A;  4H2P A;  1CJ4 A;  1GRH A;  1DXL A;  2WOI A;  1COY A;  4WJY A;  2GH5 A;  4BK1 A;  2A87 A;  2WU5 A;  3BI2 A;  4H4Q A;  1JEH A;  3URH A;  4C74 A;  2X8H A;  2E1M A;  4Z24 A;  5EB4 A;  4YWO A;  1B8S A;  3F8D A;  2YVG A;  2R9Z A;  1CL0 A;  3DJE A;  3AD8 B;  5FS9 A;  3VQR A;  1B5Q A;  3IHM A;  5TR3 A;  5HY5 A;  3BNU A;  4Y4L A;  1NHR A;  5HYM A;  3P4Q A;  1D7Y A;  1NHQ A;  1ZOV A;  1UKV G;  1JNR A;  1S2Y A;  5BRT A;  1OJC A;  1FEA A;  2JBV A;  3CPH G;  3NK1 X;  3I3L A;  5J7X A;  3SFD A;  3UCL A;  4B63 A;  1ZY8 A;  2K3V A;  3LZX A;  1YQ3 A;  2B9X A;  4B67 A;  1H7W A;  1M1R A;  1FT6 A;  1GPE A;  1Y56 A;  2FJD A;  1CBO A;  1VDC A;  3NH3 X;  3ZYX A;  2H88 A;  3SCE A;  1E1N A;  2XDO A;  4Z2U A;  4K2X A;  4ADW A;  3LOV A;  3C96 A;  2JK6 A;  1B4V A;  1MOK A;  3E1T A;  2R0C A;  4Z25 A;  3NTA A;  3KLJ A;  5IQ4 A;  5FS8 A;  1KNR A;  4U2T A;  1IUS A;  4H50 A;  3GYX A;  4B1B A;  2WPF A;  3RP8 A;  3CIR A;  2EQ8 A;  1BKW A;  2BK5 A;  3AEA A;  4J56 A;  3AD7 B;  5FS6 A;  3QSS A;  4Q5B A;  1GND A;  1GRG A;  1PBE A;  2CDU A;  4EQS A;  3F8R A;  4A9W A;  2AAQ A;  2RDZ A;  4OCG A;  4TLX A;  2BK4 A;  2RF7 A;  4FK1 C;  3LG1 A;  2RGJ A;  4H4P A;  2XYO A;  1NEK A;  2A89 A;  3IWA A;  4UDR A;  3KD9 A;  4X4J A;  2TMD A;  4H4S A;  4LII A;  1PDH A;  4JNA A;  2YVJ A;  4DGK A;  3LXD A;  4Q5C A;  1Y56 B;  3EF6 A;  4JDR A;  2XFQ A;  2GEW A;  4AOS A;  1B37 A;  3AEB A;  2V61 A;  4GR1 A;  3ICR A;  5EOW A;  2WBA A;  3AED A;  3NKS A;  3BNF A;  2E5V A;  3H8L A;  3Q6J A;  4U2L A;  4BUR A;  4J33 A;  2ACZ A;  1TRB A;  4OPI A;  3CNP A;  3GYI A;  1EBD A;  4H4W A;  3BNM A;  3FG2 P;  4FX9 A;  3AEF A;  2EQ9 A;  1F8S A;  1VQW A;  3ALM A;  4O5Q A;  1TYP A;  3D1C A;  3IF9 A;  4J57 A;  3RNM A;  4UP3 A;  3UU9 A;  3EAO A;  4Z2T A;  3TOR A;  4UDQ A;  1M64 A;  2XFU A;  4B64 A;  1XDI A;  3PO7 A;  4AOX A;  2BXR A;  3LZW A;  3UBR A;  1OJ9 A;  2B76 A;  2YM1 A;  4H2R A;  1K0J A;  3S5W A;  1DOE A;  3GYJ A;  4NTC A;  2BK3 A;  1FS8 A;  1QDB A;  3VR9 A;  2C76 A;  3NN0 X;  4AP1 A;  3PVC A;  1JU2 A;  3OZ2 A;  3UKK A;  4JY3 A;  5IPY A;  1NDA A;  1L9E A;  2C65 A; 
#chains in the Genus database with same CATH topology
 2VVM A;  1CC2 A;  3II4 A;  3ICS A;  3KKJ A;  3AE6 A;  1RP0 A;  2VQB A;  1HYU A;  1REO A;  4I58 A;  4NWZ A;  2WOV A;  4EMW A;  5JCK A;  3HYW A;  5KOW A;  4G74 A;  4CNK A;  2HQM A;  2JAE A;  2YWL A;  2E81 A;  3GDN A;  3M0O A;  4K7Z A;  3K7T A;  2R0G A;  2VZ2 A;  2DKI A;  2H89 A;  1H81 A;  1L9C A;  3AE4 A;  3BHK A;  3V76 A;  4OPU A;  3I6D A;  3FPZ A;  5KVI A;  1CJC A;  3UKQ A;  2ZZ0 A;  2OA1 A;  3NK0 X;  3KVE A;  2BAC A;  4U8L A;  2E80 A;  3LJP A;  3GRT A;  4FDC B;  1CHU A;  1E39 A;  1H82 A;  2C3C A;  2C72 A;  3AWI A;  1GTH A;  2VVL G;  4TLZ A;  5U63 A;  4AT2 A;  3SZW A;  4EQX A;  3GSI A;  1BZL A;  4B68 A;  4JQ9 A;  1BGN A;  1SEZ A;  3CPJ G;  1PBC A;  4II2 A;  4AT0 A;  1ZOY A;  3SY4 A;  1D4C A;  3UKA A;  4Z43 A;  4IA6 A;  3FO3 A;  2VRL A;  4U8J A;  3GMC A;  1GT8 A;  2JB3 A;  4B65 A;  2CVJ A;  4TM1 A;  2J7A A;  4CNJ A;  3UKL A;  1TDO A;  2OAM A;  3C4N A;  3DK4 A;  1QO8 A;  1LVL A;  1FEB A;  2VVL A;  4YKF A;  1EL5 A;  4BK3 A;  4U8M A;  1CJ2 A;  2FBW A;  4WCT A;  5FMH A;  2UZZ A;  3UKH A;  1MO9 A;  4GF7 A;  3IHG A;  3UTF A;  4G9K A;  3FMW A;  3B3R A;  4EMI A;  2I0Z A;  4K5R A;  1PXA A;  1Q1W A;  1FL2 A;  2YLW A;  4G6H A;  1GET A;  1TDF A;  1BVB A;  5GRT A;  4C77 A;  3VRB A;  2YLX A;  2ZZB A;  1LJ1 A;  3DGH A;  4YXD A;  2X50 A;  1CC4 A;  2F5Z A;  2PYX A;  3CNT A;  3O0H A;  3T31 A;  4CCQ A;  4REK A;  1ELI A;  2WQY A;  3M13 A;  1E1L A;  2YQU A;  2C4C A;  1P2E A;  3CNJ A;  1GTE A;  4J2W A;  2IVE A;  2YAU A;  4XXG A;  2BS2 A;  4H4R A;  2JKC A;  2AR8 A;  1KSU A;  5U25 A;  1NHS A;  1GV4 A;  1GXF A;  4H4U A;  2V3B A;  3SX6 A;  1LQU A;  5CQF A;  1LPF A;  1GEU A;  2X99 A;  4AP3 A;  2XFO A;  3NIX A;  4YSY A;  3NT6 A;  2PHH A;  4BK2 A;  4YSZ A;  5GSN A;  2Y6R A;  3ABV A;  3K7Q X;  3RHA A;  4GDP A;  1E1M A;  1F6M A;  4RSL A;  1DOC A;  3RP6 A;  4OPG A;  5KVH A;  1PJ6 A;  4Y4N A;  3CNS A;  1GOS A;  3GRS A;  3T37 A;  4GUV A;  3OC4 A;  1FOH A;  3K30 A;  4H4T A;  2C70 A;  1K4Q A;  1TDK A;  2V3A A;  3AYL A;  1GES A;  2FJE A;  1XAN A;  2WPC A;  4IA5 A;  4CBQ A;  1TDE A;  3DH9 A;  1GRA A;  1OJD A;  4NZH A;  3L1T A;  3L8K A;  1TYT A;  1LQT A;  3P4S A;  3T2Y A;  3C4A A;  3NRN A;  3OWM A;  3AE9 A;  1FCD A;  2YG7 A;  3AEE A;  3M12 A;  4PAB A;  2XLS A;  3P4R A;  4KX6 A;  4Q1O A;  3SFE A;  3V3O A;  3DK8 A;  5HXI A;  4DNA A;  4GAP A;  3GM6 A;  2GQF A;  2YG6 A;  3RKH A;  1S3B A;  4USQ A;  3COX A;  1M1Q A;  1L0V A;  4C5O A;  1YY5 A;  4H4Z A;  4C3X A;  3ALL A;  1SP3 A;  1BF3 A;  1GRF A;  2V6O A;  2ZBW A;  2BA9 A;  4J31 A;  4U8N A;  3ITJ A;  4BV6 A;  2WP9 A;  4JN9 A;  2XVJ A;  1L9D A;  1PBD A;  4UDP A;  3SYI A;  2GMJ A;  2GVC A;  1ZP0 A;  2GR1 A;  4H4Y A;  2JB2 A;  2FJA A;  4ICY A;  4EIP A;  1DOD A;  1OJT A;  1H7X A;  2GQW A;  2BRY A;  2RAB A;  1OJA A;  2XLT A;  3QFA A;  5DBJ A;  4OPT A;  4XWZ A;  4D03 A;  3ZDN A;  1PHH A;  1JRX A;  5EB5 A;  3SM8 A;  4GCM A;  1PBB A;  2YR5 A;  3QFB A;  2QA1 A;  3DJG X;  1FEC A;  3NHO X;  2R46 A;  5C2T A;  1V59 A;  2C73 A;  3PS9 A;  4L3Z A;  2XVF A;  3NYE A;  4K5S A;  1JNI A;  1H86 A;  2Q0K A;  2WES A;  2WS3 A;  4OPC A;  4OPL A;  1DNC A;  4Q0T A;  4U8I A;  1M6I A;  3VRA A;  4LA1 A;  1GU6 A;  2X3N A;  3NYC A;  5JCI A;  1N4V A;  3AB1 A;  3H4K A;  4L3X A;  1JRZ A;  2E4G A;  2EQ6 A;  2WDQ A;  5IQ1 A;  3S61 A;  1LTX R;  3UTE A;  2XFN A;  3NTD A;  1YQZ A;  2BXS A;  1H6V A;  3P9U A;  3GD4 A;  4XWR A;  2GAH B;  3UOX A;  2XLU A;  1VG0 A;  3TTB A;  2WP6 A;  1D7L A;  3CND A;  1Z6L A;  4L38 A;  3EAN A;  4TM3 A;  2OT4 A;  1W4X A;  3BNG A;  4A5L A;  3SZ0 A;  1Q1R A;  1RYI A;  3QVP A;  4CY6 A;  1ZMC A;  4B66 A;  3DGZ A;  1NPX A;  1FS9 A;  1PJ5 A;  2RGH A;  2YR6 A;  1IJH A;  2DKH A;  1YQ4 A;  5JCN A;  4J34 A;  3D1I A;  4Y4M A;  3QJ4 A;  4YT0 A;  3AD9 B;  3UOZ A;  4YTP A;  2WP5 A;  2B9Y A;  3ICT A;  3QVR A;  2YG3 A;  5M0Z A;  3BI5 A;  1NG4 A;  2YG5 A;  1GRE A;  1DJQ A;  4J36 A;  2FJB A;  2Q7V A;  1PBF A;  4EM4 A;  1CJ3 A;  1KFY A;  2JB1 A;  2QCU A;  2WDV A;  2C64 A;  1H83 A;  1E6E A;  3CN8 A;  3DME A;  3LB8 A;  3Q9T A;  4H4V A;  5KMS A;  3UKF A;  2XVI A;  3HYX A;  4OVI A;  3D8X A;  4YTN A;  4HB9 A;  4RG4 A;  1EL8 A;  5KRQ A;  1VG9 A;  3BHF A;  2R4J A;  2V60 A;  2OLO A;  2VOU A;  2WET A;  3BNJ A;  3CPI G;  4C3Y A;  1Q9I A;  2EQ7 A;  2QAE A;  3EPT A;  4U8K A;  3CMM A;  2APG A;  3NGC X;  5BUL A;  1CF3 A;  4YSX A;  1KNP A;  4CY8 A;  3AE5 A;  5JCM A;  1LV0 A;  1X31 B;  1ZKQ A;  5L46 A;  3BNH A;  3GDP A;  4BJZ A;  2C67 A;  4CCR A;  4Z44 A;  2XCG A;  3G5S A;  4ZCC A;  1S3E A;  2B7R A;  5KWF A;  4X9M A;  3FIM B;  1KF6 A;  2R4E A;  1Y0P A;  2WEU A;  2XVH A;  3AE1 A;  5M10 A;  3AYJ A;  4X9N A;  4BJY A;  2XFP A;  1ZDL A;  1DJN A;  4H7U A;  2W0H A;  4LU6 A;  3SGL A;  2GR3 A;  2BAB A;  3T2K A;  4ZN0 A;  1N4U A;  2BYB A;  1BGJ A;  3B6D A;  2IVD A;  1IUV A;  3K7M X;  3L1R A;  5EBK A;  3RED A;  2BCG G;  3DA1 A;  4B69 A;  4U2S A;  2ZZC A;  1M1P A;  3SXI A;  3NLC A;  3KU9 A;  1QJD A;  4NEW A;  3RP7 A;  3CGB A;  3FBS A;  3BI4 A;  4Z2R A;  2Q6U A;  3MMO A;  4TM4 A;  2GAG B;  4M52 A;  2X8G A;  5C3J A;  2Q0L A;  3T14 A;  4IVO B;  5BVA A;  2O9Z A;  3GWF A;  1K0I A;  4GDE A;  5BUK A;  2BC1 A;  1KDG A;  3ADA B;  3UP5 A;  3ATQ A;  1PS9 A;  4YKG A;  1NAA A;  4U8P A;  4FK1 A;  3GMB A;  2R45 A;  2VR0 A;  1EL9 A;  4CRT A;  1IUX A;  4ZCD A;  3SQP A;  2IID A;  4K8D A;  1S2Q A;  1AOG A;  1CC6 A;  1ONF A;  4A79 A;  3SZF A;  4K22 A;  4APN A;  4L3Y A;  1YKJ A;  5KMP A;  4TM0 A;  3VR8 A;  3NYF A;  3WE0 A;  2YM2 A;  3P1W A;  2GV8 A;  1JOA A;  1NEN A;  2VQ7 A;  2X8C A;  5KXJ A;  3G5Q A;  1FS7 A;  1IUW A;  2BC0 A;  2RGO A;  4WX1 A;  1DOB A;  5HHF A;  1BWC A;  2GF3 A;  3KPK A;  2XVE A;  2NVK X;  4IV9 A;  3AE3 A;  3ALJ A;  4D04 A;  1PXB A;  4JY2 A;  2LFC A;  5LV9 A;  2R0P A;  1H84 A;  2A8X A;  3NNE A;  4NTE A;  5FS7 A;  4A65 A;  4EQW A;  3F29 A;  4O5U A;  2YVF A;  4KPR A;  3R9U A;  3UOY A;  3S7W A;  2C66 A;  1K0L A;  4H2N A;  2V5Z A;  2C3D A;  2C7G A;  2Z5Y A;  3GWD A;  3DJJ A;  2GMH A;  3AE2 A;  4GRT A;  4NTD A;  4MJW A;  3UKP A;  3IC9 A;  4NEV A;  2WU2 A;  3AEC A;  3JSK A;  1O95 A;  3SXQ A;  3DK9 A;  4DSH A;  1KSS A;  4P9S A;  2VRM A;  1PXC A;  5JCL A;  1OAH A;  1N4W A;  4A6N A;  1PJ7 A;  2YLZ A;  2B9W A;  4EQR A;  4Q17 A;  1D4E A;  3GD3 A;  1XHC A;  5ER0 A;  1O5W A;  3UTH A;  3NG7 X;  3AE7 A;  1FT5 A;  1F3P A;  4G6G A;  4NNJ A;  4RG3 A;  4N9X A;  4U8O A;  1E7P A;  1PN0 A;  3QSE A;  1IUT A;  4E0V A;  2XLP A;  4EMJ A;  2BS4 A;  2WPE A;  3KPF A;  2GR0 A;  3QSM A;  2B7S A;  4YTM A;  4OPD A;  3V3N A;  3AE8 A;  4ECH A;  3CGE A;  2BRA A;  2TPR A;  2YG4 A;  4DSG A;  1RSG A;  2WOW A;  3CGD A;  2GR2 A;  1GER A;  2C75 A;  2WDR A;  4IVM B;  3AXB A;  4USR A;  1P2H A;  2YLS A;  3NN6 X;  3NK2 X;  4EM3 A;  1F8W A;  3CTY A;  1NHP A;  3UP4 A;  1ZMD A;  3DJD A;  2BS3 A;  3AYI A;  4Z26 A;  2QA2 A;  1D4D A;  1IUU A;  1JNZ A;  1GAL A;  4JNQ A;  5CKU A;  2NPX A;  3F8P A;  4EIQ A;  1VRQ B;  3ISH A;  4I59 A;  4A6N B;  4A7A A;  2BCP A;  1NG3 A;  2OAL A;  1O94 A;  2YLT A;  3AEG A;  2CUL A;  1GRT A;  5J60 A;  2YLR A;  3H8I A;  3UTG A;  3T0K A;  2OLN A;  1MXT A;  3UOV A;  3ATR A;  4H4X A;  4Q4U A;  3G5R A;  2GB0 A;  4YSH A;  4HA6 A;  2AQJ A;  1EL7 A;  4A99 A;  2GRT A;  1XPQ A;  2WHD A;  2ARD A;  4G73 A;  2CZS A;  1GRB A;  1ZK7 A;  3VRD B;  2XLR A;  3P4P A;  1ZX9 A;  3LAD A;  2Y6Q A;  3CGC A;  1D5T A;  4H2Q A;  1N1P A;  1F8R A;  3KA7 A;  5KOX A;  3LGQ A;  1TDN A;  2CFY A;  2J3N A;  2YR4 A;  1JRY A;  4PAA A;  1QLB A;  1E1K A;  1GSN A;  2ZO5 A;  3HZL A;  2Z5X A;  5U1O A;  4H2P A;  1CJ4 A;  1GRH A;  4GAV A;  1DXL A;  2WOI A;  1COY A;  4WJY A;  5KMR A;  2GH5 A;  4BK1 A;  2A87 A;  2WU5 A;  3BI2 A;  4H4Q A;  1JEH A;  3URH A;  4C74 A;  2X8H A;  2E1M A;  4Z24 A;  5EB4 A;  4YWO A;  1B8S A;  3F8D A;  2YVG A;  2R9Z A;  1CL0 A;  3DJE A;  3AD8 B;  5FS9 A;  3VQR A;  4II3 A;  1B5Q A;  3IHM A;  5TR3 A;  5HY5 A;  3SZC A;  3BNU A;  4Y4L A;  1NHR A;  5HYM A;  3P4Q A;  1D7Y A;  1NHQ A;  1ZOV A;  1UKV G;  1JNR A;  1S2Y A;  5BRT A;  1OJC A;  1FEA A;  2JBV A;  3CPH G;  3NK1 X;  3I3L A;  5J7X A;  3SFD A;  3UCL A;  4B63 A;  1ZY8 A;  2K3V A;  3LZX A;  1YQ3 A;  2B9X A;  4B67 A;  1H7W A;  1M1R A;  1FT6 A;  1GPE A;  1Y56 A;  2FJD A;  1CBO A;  1VDC A;  3NH3 X;  3ZYX A;  2H88 A;  3SCE A;  1E1N A;  2XDO A;  4Z2U A;  4K2X A;  4ADW A;  3LOV A;  3C96 A;  2JK6 A;  1B4V A;  1MOK A;  3E1T A;  2R0C A;  3T2Z A;  4Z25 A;  3NTA A;  3KLJ A;  5IQ4 A;  5FS8 A;  1KNR A;  4U2T A;  1IUS A;  3GYX A;  4H50 A;  4B1B A;  2WPF A;  3RP8 A;  3CIR A;  2EQ8 A;  1BKW A;  2BK5 A;  3AEA A;  4J56 A;  3AD7 B;  5FS6 A;  3QSS A;  4Q5B A;  1GND A;  1GRG A;  1PBE A;  2CDU A;  4EQS A;  3F8R A;  4A9W A;  2AAQ A;  2RDZ A;  4OCG A;  4TLX A;  2BK4 A;  2RF7 A;  4FK1 C;  3LG1 A;  3HYV A;  2RGJ A;  4H4P A;  2XYO A;  5KNL A;  1NEK A;  2A89 A;  3IWA A;  4UDR A;  3KD9 A;  4X4J A;  2TMD A;  4H4S A;  4LII A;  1PDH A;  4JNA A;  2YVJ A;  4DGK A;  3LXD A;  4Q5C A;  1Y56 B;  3EF6 A;  4JDR A;  2XFQ A;  2GEW A;  4AOS A;  1B37 A;  3AEB A;  2V61 A;  4GR1 A;  3ICR A;  5EOW A;  2WBA A;  3AED A;  3NKS A;  3BNF A;  2E5V A;  3H8L A;  3Q6J A;  4U2L A;  4BUR A;  4J33 A;  2ACZ A;  1TRB A;  4OPI A;  3CNP A;  3GYI A;  1EBD A;  4H4W A;  3BNM A;  3FG2 P;  4FX9 A;  3AEF A;  2EQ9 A;  1F8S A;  1VQW A;  3ALM A;  4O5Q A;  1TYP A;  3D1C A;  3IF9 A;  4J57 A;  3RNM A;  4UP3 A;  3UU9 A;  3EAO A;  4Z2T A;  3TOR A;  4UDQ A;  1M64 A;  2XFU A;  4B64 A;  1XDI A;  3PO7 A;  4AOX A;  2BXR A;  3LZW A;  5KMQ A;  3UBR A;  1OJ9 A;  2B76 A;  2YM1 A;  4H2R A;  1K0J A;  3S5W A;  1DOE A;  3GYJ A;  4NTC A;  2BK3 A;  1FS8 A;  1QDB A;  3VR9 A;  2C76 A;  3NN0 X;  4AP1 A;  3PVC A;  1JU2 A;  3OZ2 A;  3UKK A;  4JY3 A;  5IPY A;  1NDA A;  1L9E A;  2C65 A; 
#chains in the Genus database with same CATH homology
 2VVM A;  1CC2 A;  3II4 A;  3ICS A;  3KKJ A;  3AE6 A;  1RP0 A;  2VQB A;  1HYU A;  1REO A;  4I58 A;  4NWZ A;  2WOV A;  4EMW A;  5JCK A;  3HYW A;  5KOW A;  4G74 A;  4CNK A;  2HQM A;  2JAE A;  2YWL A;  2E81 A;  3GDN A;  3M0O A;  4K7Z A;  3K7T A;  2R0G A;  2VZ2 A;  2DKI A;  2H89 A;  1H81 A;  1L9C A;  3AE4 A;  3BHK A;  3V76 A;  4OPU A;  3I6D A;  3FPZ A;  5KVI A;  1CJC A;  3UKQ A;  2ZZ0 A;  2OA1 A;  3NK0 X;  3KVE A;  2BAC A;  4U8L A;  2E80 A;  3LJP A;  3GRT A;  4FDC B;  1CHU A;  1E39 A;  1H82 A;  2C3C A;  2C72 A;  3AWI A;  1GTH A;  2VVL G;  4TLZ A;  5U63 A;  4AT2 A;  3SZW A;  4EQX A;  3GSI A;  1BZL A;  4B68 A;  4JQ9 A;  1BGN A;  1SEZ A;  3CPJ G;  1PBC A;  4II2 A;  4AT0 A;  1ZOY A;  3SY4 A;  1D4C A;  3UKA A;  4Z43 A;  4IA6 A;  3FO3 A;  2VRL A;  4U8J A;  3GMC A;  1GT8 A;  2JB3 A;  4B65 A;  2CVJ A;  4TM1 A;  2J7A A;  4CNJ A;  3UKL A;  1TDO A;  2OAM A;  3C4N A;  3DK4 A;  1QO8 A;  1LVL A;  1FEB A;  2VVL A;  4YKF A;  1EL5 A;  4BK3 A;  4U8M A;  1CJ2 A;  2FBW A;  4WCT A;  5FMH A;  2UZZ A;  3UKH A;  1MO9 A;  4GF7 A;  3IHG A;  3UTF A;  4G9K A;  3FMW A;  3B3R A;  4EMI A;  2I0Z A;  4K5R A;  1PXA A;  1Q1W A;  1FL2 A;  2YLW A;  4G6H A;  1GET A;  1TDF A;  1BVB A;  5GRT A;  4C77 A;  3VRB A;  2YLX A;  2ZZB A;  1LJ1 A;  3DGH A;  4YXD A;  2X50 A;  1CC4 A;  2F5Z A;  2PYX A;  3CNT A;  3O0H A;  3T31 A;  4CCQ A;  4REK A;  1ELI A;  2WQY A;  3M13 A;  1E1L A;  2YQU A;  2C4C A;  1P2E A;  3CNJ A;  1GTE A;  4J2W A;  2IVE A;  2YAU A;  4XXG A;  2BS2 A;  4H4R A;  2JKC A;  2AR8 A;  1KSU A;  5U25 A;  1NHS A;  1GV4 A;  1GXF A;  4H4U A;  2V3B A;  3SX6 A;  1LQU A;  5CQF A;  1LPF A;  1GEU A;  2X99 A;  4AP3 A;  2XFO A;  3NIX A;  4YSY A;  3NT6 A;  2PHH A;  4BK2 A;  4YSZ A;  5GSN A;  2Y6R A;  3ABV A;  3K7Q X;  3RHA A;  4GDP A;  1E1M A;  1F6M A;  4RSL A;  1DOC A;  3RP6 A;  4OPG A;  5KVH A;  1PJ6 A;  4Y4N A;  3CNS A;  1GOS A;  3GRS A;  3T37 A;  4GUV A;  3OC4 A;  1FOH A;  3K30 A;  4H4T A;  2C70 A;  1K4Q A;  1TDK A;  2V3A A;  3AYL A;  1GES A;  2FJE A;  1XAN A;  2WPC A;  4IA5 A;  4CBQ A;  1TDE A;  3DH9 A;  1GRA A;  1OJD A;  4NZH A;  3L1T A;  3L8K A;  1TYT A;  1LQT A;  3P4S A;  3T2Y A;  3C4A A;  3NRN A;  3OWM A;  3AE9 A;  1FCD A;  2YG7 A;  3AEE A;  3M12 A;  4PAB A;  2XLS A;  3P4R A;  4KX6 A;  4Q1O A;  3SFE A;  3V3O A;  3DK8 A;  5HXI A;  4DNA A;  4GAP A;  3GM6 A;  2GQF A;  2YG6 A;  3RKH A;  1S3B A;  4USQ A;  3COX A;  1M1Q A;  1L0V A;  4C5O A;  1YY5 A;  4H4Z A;  4C3X A;  3ALL A;  1SP3 A;  1BF3 A;  1GRF A;  2V6O A;  2ZBW A;  2BA9 A;  4J31 A;  4U8N A;  3ITJ A;  4BV6 A;  2WP9 A;  4JN9 A;  2XVJ A;  1L9D A;  1PBD A;  4UDP A;  3SYI A;  2GMJ A;  2GVC A;  1ZP0 A;  2GR1 A;  4H4Y A;  2JB2 A;  2FJA A;  4ICY A;  4EIP A;  1DOD A;  1OJT A;  1H7X A;  2GQW A;  2BRY A;  2RAB A;  1OJA A;  2XLT A;  3QFA A;  5DBJ A;  4OPT A;  4XWZ A;  4D03 A;  3ZDN A;  1PHH A;  1JRX A;  5EB5 A;  3SM8 A;  4GCM A;  1PBB A;  2YR5 A;  3QFB A;  2QA1 A;  3DJG X;  1FEC A;  3NHO X;  2R46 A;  5C2T A;  1V59 A;  2C73 A;  3PS9 A;  4L3Z A;  2XVF A;  3NYE A;  4K5S A;  1JNI A;  1H86 A;  2Q0K A;  2WES A;  2WS3 A;  4OPC A;  4OPL A;  1DNC A;  4Q0T A;  4U8I A;  1M6I A;  3VRA A;  4LA1 A;  1GU6 A;  2X3N A;  3NYC A;  5JCI A;  1N4V A;  3AB1 A;  3H4K A;  4L3X A;  1JRZ A;  2E4G A;  2EQ6 A;  2WDQ A;  5IQ1 A;  3S61 A;  1LTX R;  3UTE A;  2XFN A;  3NTD A;  1YQZ A;  2BXS A;  1H6V A;  3P9U A;  3GD4 A;  4XWR A;  2GAH B;  3UOX A;  2XLU A;  1VG0 A;  3TTB A;  2WP6 A;  1D7L A;  3CND A;  1Z6L A;  4L38 A;  3EAN A;  4TM3 A;  2OT4 A;  1W4X A;  3BNG A;  4A5L A;  3SZ0 A;  1Q1R A;  1RYI A;  3QVP A;  4CY6 A;  1ZMC A;  4B66 A;  3DGZ A;  1NPX A;  1FS9 A;  1PJ5 A;  2RGH A;  2YR6 A;  1IJH A;  2DKH A;  1YQ4 A;  5JCN A;  4J34 A;  3D1I A;  4Y4M A;  3QJ4 A;  4YT0 A;  3AD9 B;  3UOZ A;  4YTP A;  2WP5 A;  2B9Y A;  3ICT A;  3QVR A;  2YG3 A;  5M0Z A;  3BI5 A;  1NG4 A;  2YG5 A;  1GRE A;  1DJQ A;  4J36 A;  2FJB A;  2Q7V A;  1PBF A;  4EM4 A;  1CJ3 A;  1KFY A;  2JB1 A;  2QCU A;  2WDV A;  2C64 A;  1H83 A;  1E6E A;  3CN8 A;  3DME A;  3LB8 A;  3Q9T A;  4H4V A;  5KMS A;  3UKF A;  2XVI A;  3HYX A;  4OVI A;  3D8X A;  4YTN A;  4HB9 A;  4RG4 A;  1EL8 A;  5KRQ A;  1VG9 A;  3BHF A;  2R4J A;  2V60 A;  2OLO A;  2VOU A;  2WET A;  3BNJ A;  3CPI G;  4C3Y A;  1Q9I A;  2EQ7 A;  2QAE A;  3EPT A;  4U8K A;  3CMM A;  2APG A;  3NGC X;  5BUL A;  1CF3 A;  4YSX A;  1KNP A;  4CY8 A;  3AE5 A;  5JCM A;  1LV0 A;  1X31 B;  1ZKQ A;  5L46 A;  3BNH A;  3GDP A;  4BJZ A;  2C67 A;  4CCR A;  4Z44 A;  2XCG A;  3G5S A;  4ZCC A;  1S3E A;  2B7R A;  5KWF A;  4X9M A;  3FIM B;  1KF6 A;  2R4E A;  1Y0P A;  2WEU A;  2XVH A;  3AE1 A;  5M10 A;  3AYJ A;  4X9N A;  4BJY A;  2XFP A;  1ZDL A;  1DJN A;  4H7U A;  2W0H A;  4LU6 A;  3SGL A;  2GR3 A;  2BAB A;  3T2K A;  4ZN0 A;  1N4U A;  2BYB A;  1BGJ A;  3B6D A;  2IVD A;  1IUV A;  3K7M X;  3L1R A;  5EBK A;  3RED A;  2BCG G;  3DA1 A;  4B69 A;  4U2S A;  2ZZC A;  1M1P A;  3SXI A;  3NLC A;  3KU9 A;  1QJD A;  4NEW A;  3RP7 A;  3CGB A;  3FBS A;  3BI4 A;  4Z2R A;  2Q6U A;  3MMO A;  4TM4 A;  2GAG B;  4M52 A;  2X8G A;  5C3J A;  2Q0L A;  3T14 A;  4IVO B;  5BVA A;  2O9Z A;  3GWF A;  1K0I A;  4GDE A;  5BUK A;  2BC1 A;  1KDG A;  3ADA B;  3UP5 A;  3ATQ A;  1PS9 A;  4YKG A;  1NAA A;  4U8P A;  4FK1 A;  3GMB A;  2R45 A;  2VR0 A;  1EL9 A;  4CRT A;  1IUX A;  4ZCD A;  3SQP A;  2IID A;  4K8D A;  1S2Q A;  1AOG A;  1CC6 A;  1ONF A;  4A79 A;  3SZF A;  4K22 A;  4APN A;  4L3Y A;  1YKJ A;  5KMP A;  4TM0 A;  3VR8 A;  3NYF A;  3WE0 A;  2YM2 A;  3P1W A;  2GV8 A;  1JOA A;  1NEN A;  2VQ7 A;  2X8C A;  5KXJ A;  3G5Q A;  1FS7 A;  1IUW A;  2BC0 A;  2RGO A;  4WX1 A;  1DOB A;  5HHF A;  1BWC A;  2GF3 A;  3KPK A;  2XVE A;  2NVK X;  4IV9 A;  3AE3 A;  3ALJ A;  4D04 A;  1PXB A;  4JY2 A;  2LFC A;  5LV9 A;  2R0P A;  1H84 A;  2A8X A;  3NNE A;  4NTE A;  5FS7 A;  4A65 A;  4EQW A;  3F29 A;  4O5U A;  2YVF A;  4KPR A;  3R9U A;  3UOY A;  3S7W A;  2C66 A;  1K0L A;  4H2N A;  2V5Z A;  2C3D A;  2C7G A;  2Z5Y A;  3GWD A;  3DJJ A;  2GMH A;  3AE2 A;  4GRT A;  4NTD A;  4MJW A;  3UKP A;  3IC9 A;  4NEV A;  2WU2 A;  3AEC A;  3JSK A;  1O95 A;  3SXQ A;  3DK9 A;  4DSH A;  1KSS A;  4P9S A;  2VRM A;  1PXC A;  5JCL A;  1OAH A;  1N4W A;  4A6N A;  1PJ7 A;  2YLZ A;  2B9W A;  4EQR A;  4Q17 A;  1D4E A;  3GD3 A;  1XHC A;  5ER0 A;  1O5W A;  3UTH A;  3NG7 X;  3AE7 A;  1FT5 A;  1F3P A;  4G6G A;  4NNJ A;  4RG3 A;  4N9X A;  4U8O A;  1E7P A;  1PN0 A;  3QSE A;  1IUT A;  4E0V A;  2XLP A;  4EMJ A;  2BS4 A;  2WPE A;  3KPF A;  2GR0 A;  3QSM A;  2B7S A;  4YTM A;  4OPD A;  3V3N A;  3AE8 A;  4ECH A;  3CGE A;  2BRA A;  2TPR A;  2YG4 A;  4DSG A;  1RSG A;  2WOW A;  3CGD A;  2GR2 A;  1GER A;  2C75 A;  2WDR A;  4IVM B;  3AXB A;  4USR A;  1P2H A;  2YLS A;  3NN6 X;  3NK2 X;  4EM3 A;  1F8W A;  3CTY A;  1NHP A;  3UP4 A;  1ZMD A;  3DJD A;  2BS3 A;  3AYI A;  4Z26 A;  2QA2 A;  1D4D A;  1IUU A;  1JNZ A;  1GAL A;  4JNQ A;  5CKU A;  2NPX A;  3F8P A;  4EIQ A;  1VRQ B;  3ISH A;  4I59 A;  4A6N B;  4A7A A;  2BCP A;  1NG3 A;  2OAL A;  1O94 A;  2YLT A;  3AEG A;  2CUL A;  1GRT A;  5J60 A;  2YLR A;  3H8I A;  3UTG A;  3T0K A;  2OLN A;  1MXT A;  3UOV A;  3ATR A;  4H4X A;  4Q4U A;  3G5R A;  2GB0 A;  4YSH A;  4HA6 A;  2AQJ A;  1EL7 A;  4A99 A;  2GRT A;  1XPQ A;  2WHD A;  2ARD A;  4G73 A;  1GRB A;  1ZK7 A;  3VRD B;  2XLR A;  3P4P A;  1ZX9 A;  3LAD A;  2Y6Q A;  3CGC A;  1D5T A;  4H2Q A;  1N1P A;  1F8R A;  3KA7 A;  5KOX A;  3LGQ A;  1TDN A;  2CFY A;  2J3N A;  2YR4 A;  1JRY A;  4PAA A;  1QLB A;  1E1K A;  1GSN A;  2ZO5 A;  3HZL A;  2Z5X A;  5U1O A;  4H2P A;  1CJ4 A;  1GRH A;  4GAV A;  1DXL A;  2WOI A;  1COY A;  4WJY A;  5KMR A;  2GH5 A;  4BK1 A;  2A87 A;  2WU5 A;  3BI2 A;  4H4Q A;  1JEH A;  3URH A;  4C74 A;  2X8H A;  2E1M A;  4Z24 A;  5EB4 A;  4YWO A;  1B8S A;  3F8D A;  2YVG A;  2R9Z A;  1CL0 A;  3DJE A;  3AD8 B;  5FS9 A;  3VQR A;  4II3 A;  1B5Q A;  3IHM A;  5TR3 A;  5HY5 A;  3SZC A;  3BNU A;  4Y4L A;  1NHR A;  5HYM A;  3P4Q A;  1D7Y A;  1NHQ A;  1ZOV A;  1UKV G;  1JNR A;  1S2Y A;  5BRT A;  1OJC A;  1FEA A;  2JBV A;  3CPH G;  3NK1 X;  3I3L A;  5J7X A;  3SFD A;  3UCL A;  4B63 A;  1ZY8 A;  2K3V A;  3LZX A;  1YQ3 A;  2B9X A;  4B67 A;  1H7W A;  1M1R A;  1FT6 A;  1GPE A;  1Y56 A;  2FJD A;  1CBO A;  1VDC A;  3NH3 X;  3ZYX A;  2H88 A;  3SCE A;  1E1N A;  2XDO A;  4Z2U A;  4K2X A;  4ADW A;  3LOV A;  3C96 A;  2JK6 A;  1B4V A;  1MOK A;  3E1T A;  2R0C A;  3T2Z A;  4Z25 A;  3NTA A;  3KLJ A;  5IQ4 A;  5FS8 A;  1KNR A;  4U2T A;  1IUS A;  3GYX A;  4H50 A;  4B1B A;  2WPF A;  3RP8 A;  3CIR A;  2EQ8 A;  1BKW A;  2BK5 A;  3AEA A;  4J56 A;  3AD7 B;  5FS6 A;  3QSS A;  4Q5B A;  1GND A;  1GRG A;  1PBE A;  2CDU A;  4EQS A;  3F8R A;  4A9W A;  2AAQ A;  2RDZ A;  4OCG A;  4TLX A;  2BK4 A;  2RF7 A;  4FK1 C;  3LG1 A;  3HYV A;  2RGJ A;  4H4P A;  2XYO A;  5KNL A;  1NEK A;  2A89 A;  3IWA A;  4UDR A;  3KD9 A;  4X4J A;  2TMD A;  4H4S A;  4LII A;  1PDH A;  4JNA A;  2YVJ A;  4DGK A;  3LXD A;  4Q5C A;  1Y56 B;  3EF6 A;  4JDR A;  2XFQ A;  2GEW A;  4AOS A;  1B37 A;  3AEB A;  2V61 A;  4GR1 A;  3ICR A;  5EOW A;  2WBA A;  3AED A;  3NKS A;  3BNF A;  2E5V A;  3H8L A;  3Q6J A;  4U2L A;  4BUR A;  4J33 A;  2ACZ A;  1TRB A;  4OPI A;  3CNP A;  3GYI A;  1EBD A;  4H4W A;  3BNM A;  3FG2 P;  4FX9 A;  3AEF A;  2EQ9 A;  1F8S A;  1VQW A;  3ALM A;  4O5Q A;  1TYP A;  3D1C A;  3IF9 A;  4J57 A;  3RNM A;  4UP3 A;  3UU9 A;  3EAO A;  4Z2T A;  3TOR A;  4UDQ A;  1M64 A;  2XFU A;  4B64 A;  1XDI A;  3PO7 A;  4AOX A;  2BXR A;  3LZW A;  5KMQ A;  3UBR A;  1OJ9 A;  2B76 A;  2YM1 A;  4H2R A;  1K0J A;  3S5W A;  1DOE A;  3GYJ A;  4NTC A;  2BK3 A;  1FS8 A;  1QDB A;  3VR9 A;  2C76 A;  3NN0 X;  4AP1 A;  3PVC A;  1JU2 A;  3OZ2 A;  3UKK A;  4JY3 A;  5IPY A;  1NDA A;  1L9E A;  2C65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...