1P2FA

Crystal structure analysis of response regulator drrb, a thermotoga maritima ompr/phob homolog
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
MMWKIAVVDDDKNILKKVSEKLQQLGRVKTFLTGEDFLNDEEAFHVVVLDVMLPDYSGYEICRMIKETRPETWVILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFLEREKKGLYDFGDLKIDATGFTVFLKGKRIHLPKKEFEILLFLAENAGKVVTREKLLETFWEDPVSPRVVDTVIKRIRKAIEDDPNRPRYIKTIWGVGYMFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the domain interface in DrrB, a response regulator of the OmpR/PhoB subfamily
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
molecule keywords Response Regulator
total genus 69
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p2fA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p2fA01
1IN5A 5KQMA 1ZGGA 4IRXA 2H3HA 1ZITA 4UVBA 4YS6A 4KK4A 1ZG1A 3TO9A 3RI4A 3KETA 1ZDMA 1RNLA 4KQCA 1R1UA 3O1HB 1EH6A 3H1EA 4ESBA 3SHFA 2VE9A 2Y0MA 1L3LA 2RV8A 4YLEA 3QX9A 3V4GA 2XV4S 2FXIA 2HDCA 4EVIA 2A9PA 2DO7A 1Y0UA 1CEYA 1W7PD 4EM1A 5HKOA 2HYFA 4AWXB 2ZNYA 5TQ0B 1CF7A 1NXPA 3C3WA 3LUDA 4ESFA 1H9GA 1BDHA 3KP7A 1HBXG 2WMYA 3HUTA 2E4XA 3Q7RA 5IC5A 3CDHA 5JNTA 3SZTA 3T0YA 3HZHA 2JPCA 1WKMA 4G94A 1OXKB 3M9WA 5L3GA 1Z6TA 1LQ1A 4NCBA 1BJAA 4LE0A 1SXHA 1Z18A 3C97A 4Y13A 4L5JA 1ULYA 1K78B 2VT2A 1LVAA 4LLNA 1HSJA 1W25A 1NXVA 3GFLA 4PICA 3KE2A 3M8EA 4YCSA 2W84A 4G6QA 1JLKA 3ECHA 3JSOA 3GT7A 1QPMA 2O3FA 2MLGA 3EQLF 1LDKB 3LMKA 2QU7A 2G9WA 4R79A 4N47A 2D45A 1DJMA 3F73A 2YX4A 1SXGA 3CZ5A 5AIQA 1DP7P 3TGNA 3OM0A 1D8KA 4ENMA 4BNCA 1R00A 5D6FA 5ICEA 3UK0A 2FQ3A 4KRFA 1VKRA 3FMRA 2W57A 2STWA 3EJWA 5IUKC 1J2XA 4OLAA 8ABPA 2L54A 4L85A 3BP8A 4KV7A 4HBLA 3B73A 4ENKA 1AOYA 4KNYA 4RAZA 2BYVE 3NHZA 5HVQC 4H3HB 1J75A 4YIFA 2WY2D 1S6LA 4IF4A 2JBAA 2PG4A 5CNMA 2F5CA 2V1DA 1E2BA 2JK1A 1OYWA 3U1DA 3B02A 3I54A 4IPAA 4Z4CA 1H9CA 4A0ZA 4EVQA 4L9VA 2F8SA 2MLKA 2XVCA 2IJLA 4ETIA 2PL9A 1JDNA 3KEQA 3HEBA 4P1ZA 5TJJA 3N8IA 4EJVA 3F6PA 3WODF 3JSPA 1TLFA 4H0EA 2FKAA 3KYJB 3EDCA 4G86A 3P9KA 3RH0A 2F5FA 1E2XA 1P6RA 3I45A 5D8LB 4S05A 2P5KA 1B1BA 2WRZA 2QZJA 2UWMA 3H1FA 2HS5A 5BRAA 3E6CC 1LEBA 5FWYA 3V7SA 3ILHA 1S3JA 2ZKZA 3L7WA 3K1PA 4Y17A 3DBIA 3LUHA 4YFKF 4CBVA 2FW0A 4CHUA 2UXNA 1U5TA 3DEUA 4I2OA 1ZH4A 4LG0A 5TQJA 3I0TA 2NAZA 3FM5A 4JP1A 1FT9A 3MYYA 4KMRA 1LB2A 1TMYA 2FMFA 1ZYRF 3K1NA 3GZ5A 4EGSA 3ZN0A 1F51E 5KI6A 1KQ0A 3JW4A 3WGIA 5TQ0A 2PI0A 1NXXA 1SFEA 4MR7A 4OBBA 2DT5A 4ENNA 5ILSA 3MMNA 5D2CA 3F8CA 4LE1A 4QLCU 4Z9BA 3RPQA 1D3YA 3VFZA 2VODA 1R1VA 1U5TB 4ZJPA 2GX6A 5HLIA 1VTNC 2R47A 2KIMA 4RB3C 3GL9A 4A0XA 3ZMUA 2CHFA 3NNSA 4HW0A 3T5XA 4L5IA 5KQGA 3E61A 2JRLA 4ZYHA 5FLXK 2FLKA 4I0BA 2QZ8A 4EM2A 1D5VA 1ISSA 3FFWA 3DPLC 5ICFA 3SNKA 1RZ4A 4XASA 2IA2A 4L18B 1UB9A 1A0OA 2GBPA 2FLWA 3JAMZ 2QWWA 3Q9VA 1GXPA 3QEMB 4RY9A 3HOSA 2IA1A 2D1HA 2A68F 1MZBA 4H60A 3TO7A 1HKTA 4LDZA 6ABPA 3R4KA 2KJCA 4F3TA 5FBKA 3PQJA 2QV0A 4YV7A 1FC3A 2DTRA 3WE2A 1GXQA 2M1BA 2FVYA 1YTUA 3U9GA 1DRKA 3N4MA 2JVIA 3TDZC 3MQ0A 2RGVA 3KZZA 4UV9A 4N76A 2CW0F 5BS6A 3CLOA 5K5QA 3RDIA 2Y48A 1ZRCA 1FY7A 4HOBA 2RJOA 1QQBA 2W25A 3NNDA 1TM2A 1RZRA 5TQ2A 4QYMA 1KU2A 1PDNC 1ZH5A 3GRCA 1T2KA 1P4AA 1O3RA 3ZN1A 1DBQA 3OM1A 4GNRA 3SAJA 3RVQA 3NHMA 3LUKA 2KKOA 4OINF 1LJ9A 4E7OA 1IN7A 2GA1A 3LUFA 1DP4A 3M1EA 1SD7A 2MYNA 1Z91A 4OOIA 3Q7TA 4RU1A 3ZQ7A 3JPWA 1Z7UA 2F2EA 4CZZA 5AIPA 5JVTA 1FSPA 5HS8A 2FTKE 3JTHA 4JASB 4EJWA 1W4MA 4NQRA 3O21A 2IA0A 4RB2C 2BGCA 4ENJA 4RK5A 4YFXF 1S7AA 4PEVA 3RPUA 2VBXA 2PE5A 5LHGA 3F21A 4GXOA 3T8YA 5K1YA 4Q6BA 2QBYA 1TVMA 2NRAC 2JVJA 3T8RA 4OLBA 2Z3YA 5IT3A 2V1XA 4Z4FA 4WWHA 2ZCWA 4IXAA 2MA3A 1J9IA 2QW1A 4I7HA 2IPAB 3FMVA 1LDDA 4RY0A 4N0BA 4CDGA 1SXIA 2DBBA 1CYEA 2QUFA 4LK1F 4RK4A 1QMPA 2R48A 3F6VA 1FBQA 3GWZA 1GHCA 3FMSA 3QOPA 3C3KA 2P4WA 3F8NA 2X4HA 2VBWA 1HKQA 1R7JA 4RK6A 4RS3A 4MRMB 2KYRA 2O0YA 3GWGA 2VYCA 4Q6WA 1YK0A 2BEOA 3MZYA 2L4AA 1EWKA 3C1DA 2GQQA 3OQMA 5EWMA 2FMKA 2LBPA 2AYXA 3WU1B 4D6YA 5IX8A 2PUEA 2H27A 1ONVA 4KZKA 4XARA 5CVIA 1PHRA 3LAJA 4Z99A 1IXSB 5IBQA 1PNRA 1USGA 3T38A 2IYNA 1R5GA 3N0XA 4MQFA 4MTEA 5JNWA 2PLYA 3GUDA 3R0AA 1B00A 2K27A 4O1HA 2CSOA 2RQPA 1K79A 3DKWA 3HRUA 3HRTA 4A12A 3B2NA 1IN8A 4GPAA 1KU3A 2FNPA 5FWYB 3BPXA 2LF7A 1DDNA 2GWRA 2XUBA 6PAXA 5KWSA 1IF1A 5FD5A 1Z16A 2CHEA 1F9NA 3E5QA 3IP5A 3BBLA 1MGTA 3SXYA 3CG0A 3QU6A 3KJXA 3ROFA 4KN7X 2PMHA 1Z17A 4IGAA 1JL3A 3QU3A 4M73A 2XAHA 5LBQA 3I42A 2P9HA 2DLLA 2IT0A 1RXEA 1MDMB 4YRZA 5IULC 1ZVVA 1Z6RA 1RZRD 5TRDA 1BC7C 1YIOA 5AONA 1PEYA 5FFZA 1JHZA 2LDUA 5K5OA 4F06A 5GOTA 4IRHA 1O7LA 2OBPA 2O20A 1UHMA 4KT5C 2NZUG 1ZREA 1IUYA 1U8RA 4MEYF 4KN4X 1MAVA 1M2EA 3I58A 2FN9A 2M87A 2K7LA 2GI4A 3A3KA 3H5OA 1XGSA 5I4CA 3HSFA 4G7OF 1U6GA 1BBYA 1TQIA 5ERIA 5CNJA 3DXJF 4HAMA 1IIBA 5L3EA 4OATA 4KQ9A 1OMIA 4WUTA 2MH9A 1XDSA 4RDCA 1YW9A 4HA8A 4EJTA 5FB2A 1EAYA 1FFWA 3GYHX 1XGMA 4EGYA 5ILUA 4ZYEA 1G4DA 3KP4A 1U2QA 3A10A 4B09A 1YS7A 3IC7A 1HW2A 1B6AA 5TPZA 3I71A 5DD4A 3HO1A 5JFRA 2PL1A 1BIAA 1SFXA 1LNWA 3L2CA 4O3MA 1W7PB 4Z0NA 5LGUA 2ZFWA 3MEXA 3EUHA 4HV5A 2M5WA 2J5OA 5FFXA 2LPMA 1ODDA 3LA2A 5DUIA 1JH9A 1MJBA 4MLCA 1ZARA 1ZGJA 4P5OA 4HYEA 4WF2A 4HNRA 1K78A 3D8UA 2C6YA 1NXTA 4EJOA 4BHBA 5E1WA 1T38A 2E4WA 4UHKA 3CTAA 1K7AA 1IN4A 3R61A 3A0UA 3A0RB 4HX8A 3UKJA 2IP2A 4O6JA 3RKXA 3HTSB 2HQBA 1KRWA 2EV6A 1YMUA 3KKEA 2H6BA 2HQOA 4Q5SF 1D1PA 3VNAA 2PN6A 4EYGA 4KMFA 2PJUA 1IXCA 4YO7A 2HTJA 1XSDA 3C6QA 3F8BA 1XHFA 4RGXA 3O75A 2UZKA 1MB3A 2Q2EA 2YPRA 1OXBB 3HK2A 1XCVA 1YLFA 3M8FA 4ETNA 2X0LA 4MR7B 1EV7A 3H5IA 3HV2A 2QM3A 1KMIY 3J81Z 4YWHA 1FFGA 3HUGA 3COAC 3JPYA 1FPQA 2OZ6A 6CHYA 3HHHA 3BZ6A 4Z9AA 3FMQA 4HQMA 2PUCA 4NHJA 2CQKA 2VT3A 4XXHA 2EFWA 5BRJA 4MQ9F 3H5VA 3H5TA 2MD5A 5HOOA 4I0AA 4WXDA 1X3UA 4KYWA 4EJUA 5DEQA 4BHPA 3GFMA 5JI6A 4A6EA 3L6UA 3CJNA 1XSVA 4EUKA 3BJ6A 3EQZA 2E4YA 3M9XA 1OPCA 1W5SA 3OQNA 1D5WA 4I01A 2M1ZA 3F6OA 4G7HF 3LFKA 3OLZA 3QPTA 2O03A 1ZRDA 1DPRA 4P9FA 4YFNF 1FP1D 3I64A 2VONA 3RVJA 1M5TA 3KLNA 2PUFA 5KC9A 4M71A 2F5EA 4N9HA 3O3KA 4FX0A 1BA2A 1E6LA 1JF8A 4G0ZA 1IXRC 2P6SA 4XSXF 1JFVA 3M6MD 2RDMA 3DP7A 3Q9SA 3EYYA 3K9TA 3J80Z 5E1XA 4JBAA 1U2WA 5IUJC 1VLZA 2XAQA 2A9OA 1G6NA 4DN6A 1KYZA 5B3JC 4F12A 3CHYA 1MD0A 3NEUA 1RIOH 3WTWC 2VE8A 1NTRA 4A5NA 1ZRFA 4RKRA 2MYTA 2V9VA 3G1WA 4EYKA 1L0OC 4RB1A 1Z05A 5KC8A 5C5CA 2E1NA 2CWDA 2L02A 2OZUA 1OYYA 1D8JA 4CXFA 5LHHA 1YQAA 4HF0A 4YR7A 2TMYA 1A04A 4RGRA 3WTYC 1G3SA 1U78A 1YTYA 2M98A 3FXQA 1GVJA 4G6DA 1M5UA 2E4UA 4P55A 1WI9A 1BC8C 3TB6A 4EV0A 1GUDA 2FSWA 4HNSA 1H9TA 5EWLA 5TPZD 3ELKA 4UXNA 3KP6A 4KUMA 4YG2F 3MM4A 1P2FA 2ZXJA 4M74A 4YIIA 2RC4A 5CLSA 1USSA 4LRQA 3WU0A 1XCBA 4XBFA 1ZAOA 3BPVA 1ZESA 3EGCA 4N03A 3IPAA 3RQIA 3LSTA 5JNRA 7ABPA 3H6HA 3GFIA 1PEAA 2EJRA 1BN5A 2HOEA 3IPCA 2QXYA 4W5NA 1IW7F 3KP3A 2G7UA 5BR1A 4MR9A 2E7WA 5CNKA 4ZZDA 3E97A 1BAPA 3LUJA 2ZWMA 4PZJA 4M72A 3BRQA 4EVRA 2CWEA 1F4KA 2H09A 2RVCA 4HF2A 1Z15A 3IL2A 2MYPA 1XB4A 3K69A 2J5PA 3C18A 2VBZA 2A6HF 2CYYA 2PEXA 2GZWA 2KRFA 2AYZA 2P5LC 2K4JA 3KS9A 4ZMRA 5LGTA 4Z4EA 4KIGA 4LD5A 3IKTA 2ISZA 1O3QA 1I5ZA 4KIFA 5D4SA 3HDVA 2D2WA 4JK1X 4UNOA 4A0YA 3GBPA 4AD9A 2NT3A 2XROA 4W5TA 3FF5A 1L5ZA 4OIQF 3FFXA 3OOPA 4XAQA 2VN2A 3HUUA 3QEKA 3FX3A 4F8JA 4RK1A 4ZMSA 2FBHA 2NZVG 4IRGA 1J5YA 1T39A 2NS0A 3HRSA 3K9CA 3MZHA 3PFIA 3CUQA 1SFUA 2F5DA 3QPHA 1K6OA 4BYYA 1YYVA 2GXGA 2DK8A 4PZ0A 1ZN2A 2EB7A 4G0PA 3GEZA 4LJZF 3GZ6A 3PQKA 3E3VA 3QLVC 4NCAA 1PP8F 1RPJA 2MSKA 4UHTA 4TV7A 2CGPA 4MLDA 4RK7A 3R60A 1PUXA 5HS9A 3JVIA 3LA3A 3WE3A 3HJFA 5BQTA 1P6QA 4LMYA 1USIA 3G73A 2ZMEA 5DKFA 4KICA 3QP6A 4KDPA 4BHCA 5DGCA 1ZG3A 1Z2EA 1WETA 1G3YA 1QP4A 3MWMA 3EQ2A 2ESNA 2DQLA 1JYEA 1ZH2A 5CNIA 1T34A 2DPDA 5E20A 1FYMA 5J8FA 2PMCA 5JNUA 1TJYA 3BOQA 4MTDA 4RXMA 2D1VA 3QELA 5EWMB 3TO5A 3TQNA 3P9YA 5DLEA 3H92A 3M7GA 4UVAA 3F23A 2V79A 5IEBA 4UV8A 2FXAA 4O5AA 2IKSA 3SY8A 4G97A 1B9MA 4U0VA 3ZP5A 3SFZA 2B0LA 1DBWA 1B4AA 3ISPA 3FFTA 1FOKA 3QP5A 2IOYA 1UFMA 2FBKA 2OA4A 3L00A 1QNTA 1F4VA 1KGSA 5FD6A 2YHBA 4KVFA 4WXHA 3TKYA 3L9FA 3HXMA 4Q4ZF 2L01A 1QP0A 1TLHB 3HRMA 4ZYDA 2LIVA 3S2WA 1B9NA 1DBPA 1HW5A 4OIPF 3OMXA 4M9SA 1DRJA 1E17A 2JT1A 2IPNA 1ZLJA 2HWVA 1QO0A 4ML3A 3KP5A 1FSHA 2X7XA 4E7PA 2ETHA 4L0YB 2RJNA 1YG2A 2FF4A 5D8KB 4S04A 4OU0A 5L3BA 3ZMTA 4AIKA 2HR3A 4RZSA 1ZLKA 4MNUA 4G9YA 4CO8A 4XSZF 4LB6B 4OTZA 2L18A 3EULA 3CS3A 4IILA 3N0RA 2IDMA 2Z5UA 4JA2A 3RVKA 2PQ8A 4KPYA 5H20A 1HW1A 4ETMA 2FRHA 1LEAA 5KK1A 3GVAA 3N75A 3DFGA 3JAMK 4DQDA 1XMAA 3O1JC 3HCWA 1NY5A 1OKRA 2LSOA 3I59B 1FLIA 4MPTA 1TNSA 2W24A 2XKPA 1EH8A 2QR3A 3LWFA 2L4MA 1BM9A 1PP7U 4P98A 4NQWA 4NV3A 2OQGA 4PCQA 1W9HA 4WZZA 1JE8A 3MAJA 2QYOA 1Z2DA 2NT4A 1HKSA 5BPDA 1R23A 1ISRA 2I6FA 3NRVA 4M9ZA 4U7DA 4XLTA 3HOTA 2WTEA 2JZYA 2FN8A 3MCZA 1QGPA 3HSEA 4EGZA 4HX4A 2FEZA 1OYIA 3QX8A 3D0SA 3I4PA 2L19A 3OLWA 1RUNA 4MS3A 3EAFA 5E17F 1JBEA 2ELHA 2WV0A 4EYOA 4N0QA 1ON1A 4JOQA 5JR3A 2VOPA 1MVOA 3LAPA 3IWZA 2LNBA 5BOXA 3F22A 4Z4IA 3H1GA 3K2ZA 9ABPA 2FQWA 5ED4A 5L3DA 1SMYF 2ISYA 1BDJA 1E6KA 4NICA 3LKVA 3O2PE 2FEKA 4EM0B 4IVNA 4HQEA 3GF2A 4BQAA 2CD7A 2L3DA 3NBMA 5KQLA 3F8FA 5DDGA 5HDNA 1I1SA 2JVKA 1JXSA 5D5UB 2PLNA 4RB0A 4OMZA 2IPMA 1DC7A 1SRRA 2ACJA 4Q7EA 3RVLA 2XAJA 3LUGA 3BDDA 3F8MA 3OV8A 5EWJA 4Q47A 2MH2A 2P5VA 2HTSA 3GW2A 1Z25A 4RS8A 3JY6A 4BH9A 4MYRA 3GBVA 1DC8A 2XAFA 2FMHA 1MJAA 3J80K 3TX6A 1CHNA 4ZYGA 2HPHA 5E8GA 3L09A 1DG9A 2JSCA 2BBYA 3V8JA 1WWXA 4U0WA 1YW8A 1MKMA 2R3SA 3K4HA 2QVCA 4FB4A 4LG0B 4G0MA 4KIBA 3ABUA 1T0FA 5E8IA 1HXDA 3E5XA 1O57A 2WB4A 1VRVA 3FHZA 1JWLA 3BRSA 5A2QK 3C3MA 3HSYA 1XGOA 4MQEB 1FFSA 3R0JA 1HSTA 5ABPA 5FO5A 4GYIA 3RIRA 3KCNA 4FHTA 4N41A 3KTOA 1KU9A 1IZ1A 3JS5A 1C0EA 1J59A 1P8AA 3RVPA 3RTRA 2M30A 4ON0A 1YS6A 3TOAA 1FSEA 1Z9CA 2BGGA 1TNTA 5K5RA 2QQ9A 1JHHA 1I6XA 5TQ2B 3P9CA 3F72A 5JNVA 2V0NA 4OIOF 1TQPA 1IAWA 3TD9A 2W85A 2UXXA 3HHGA 3NNNA 3DLHA 5TPWB 1WRJA 1ZHHA 1V3FA 1F1ZA 3F3XA 4TLMB 3ZMZA 2KJBA 4HNQA 3BJAA 2VBYA 1XSXA 2PBIA 3O2JA 4R1HA 3FDFA 3MA0A 5F64A 2K4BA 2QVGA 1W5TA 5CVUA 4I98B 2Q5CA 1ZHFA 1DCFA 1APBA 4BAYA 5D4RA 4IMIB 2FMYA 2WC2A 5LEJA 5B3JA 2E4ZA 5HDGA 1SD4A 4MS1A 2IPLA 3KG2A 2H0AA 2HGCA 4LLLA 5TE9A 4AIHA 2Q0OA 2FU4A 4M9XA 4F7ZA 4WWCA 1FWZA 2DAOA 1O7FA 3KP2A 2GKGA 3QK7A 1XDUA 2MSWA 4I02A 2MSLA 4MRMA 1LK0A 5D6EA 4KA4A 1URPA 5BPIA 5H6QA 2R4QA 2GA2A 2NNNA 2PUBA 4JQFA 1QBJA 1JYFA 2HQNA 3RYRA 2XHKA 2O61A 1H0MA 3EETA 2Y75A 4LDAA 1ZY2A 4IJAA 1P92A 1QQAA 2EFQA 3FZVA 4U88A 4RWEA 1V4RA 4LLGF 5L3FA 5DTEA 2QBYB 1XHEA 5FLXZ 1W7PA 2BV6A 5DCLA 5HQJA 3D02A 5IEJA 3WTTC 3Q7SA 4TN5A 3MIZA 3ZMSA 4RK0A 5KQPA 1DUXC 4WT7A 2OU2A 4KMUX 3WTUC 3R6SA 3E6DA 3CZCA 4Y15A 3G3ZA 2IPQX 1YO5C 2ESHA 4CYDA 2QQAA 2QSJA 2F8TA 2QLZA 4LGWA 4HLXA 1G3WA 4R8HA 3WTSC 4UUVA 4LX8A 2A5YB 2DI3A 2V1UA 1YVUA 4K2EA 2FNAA 5LEKA 1O3TA 2XIGA 4HDUA 1TW3A 2XDYA 2OQRA 2HSGA 1S7OA 5D5WB 4MS3B 4EYQA 3RVNA 1XWWA 3N53A 5KVRA 4RKQA 3WGHA 4PYRA 1FYLA 3WTZA 1SD5A 3E5UA 5JS1A 3K1MA 3E3MA 2N9UA 4P9UA 2JBAB 3OMWA 4DNCA 2ID9A 3LQQA 1B59A 5CYVA 4O1IA 2XRNA 2HFHA 5HLHA 4IRIA 1J56A 3IDOA 1MB0A 2FMIA 3O1IC 1FBUA 1MJ9A 1BOAA 1USTA 3QEMA 3RVRA 2YX7A 4U7BA 1IN6A 2LP4Y 2A61A 3F6CA 1YFHA 1R36A 4PDKA 5IT9Z 4RAYA 1K68A 2NNYA 2QENA 2AXLA 1A2OA 3Q5FA 5LGNA 2YSRA 3CUQC 1R22A 4Z2YA 3BROA 4UVCA 1KQ8A 4QWQA 1U04A 4KREA 1GLGA 3DF8A 4DADA 3E6MA 1REPC 2XASA 1QZZA 3WG9A 2ZO4A 1S29A 4W5RA 3G85A 4B8XA 2BE5F 3FXRA 2RKHA 4G0YA 4LE2A 3DZDA 1PUEE 1IRGA 1R8JA 4Q48A 3LUCA 4FE7A 2DK5A 3VB2A 2H6CA 4HV6A 3V7CA 2LKPA 4UHJA 1UHWA 3H6GA 4GCVA 3KZYA 3HVRA 1QNLA 3IWFA 3HTUA 5CJ9A 1JX6A 3BJOA 2R7FA 4FX4A 1SAXA 1D1QA 2DW4A 1KA8A 4Y9TA 5JS2A 5F1RA 4EMSA 4ESJA 2JTVA 3TO6A 5LHIA 3ECOA 1GCGA 2Z99A 2DU9A 4A6DA 3WTVC 1FX7A 3JVDA 4OIRF 3IP9A 3WGGA 1LJUA 3QLUC 1R1TA 1YW7A 3LUAA 4MS4B 3BILA 1GCAA 4G0XA 1U0SY 3E6BA 4D0PA 2VUHB 5HM6A 2CO5A 2Q8KA 1QPZA 1XMKA 3CU5A 4KFCA 5DUKA 2E1CA 4XLPF 2R7DA 4PGHA 1KYWA 2CFXA 1NXWA 3QELB 2ZMEB 3TDUC 3O2SB 1XD7A 3H3UA 1EWTA 3ULQB 2LF8A 4GYGA 5EWJB 4M6YA 5JNSA 3FWEA 1R58A 5F6FA 1YK1A 4BXUA 4XLNF 1P6UA 2PUAA 1I27A 1BVHA 3P7NA 1GUBA 2QQBA 2HKXA 1G3TA 2EFPA 5D5XB 1TBXA 1P4XA 3FM3A 4HZFA 1USKA 4IMJB 3DQVC 4MS4A 2RDPA 2QVOA 4GO1A 5D5VB 4DQ2A 4EVSA 1L5YA 2PUGA 2JRTA 2MC3A 1C0WA 4IHTA 1LJLA 2FSPA 4MQVA 2PAFA 1IRFA 2L17A 5EEHA 3J81K 3GX4X 3RJPA 5DCMA 4P96A 4JB0A 3U2RA 3T95A 3F7NA 2DFIA 1BI1A 4EQQA 3ERED 2IRFG 3T6KA 2B4AA 2HQRA 3IRQA 3W9SA 2XAGA 5DCMB 1SD6A 3SG0A 1AB5A 4MQFB 2ZAYA 4JAVC 3O6BB 3ZMVA 3FGZA 2P6TA 2HJ9A 1Q1HA 4NB5A 4ZZLA 1HEYA 1XGNA 4WCGA 4H3KB 5T7BA 1EH7A 4MR9B 3BREA 3H5LA 3OO1A 1U2PA 3RYPA 1E6MA 2P7VB 3CTPA 2YR2A 2FA5A 1CF7B 4D6XA 1KU7A 1ABFA 1C4WA 2KIFA 5GQSA 2AS5F 1JFTA 4QPJC 4MHGA 3NQOA 3CLKA 3MFKA 3MF4A 3HSRA 2M45A 1Y1LA 1R5HA 1BDIA 3N6VA 1Z1DA 2EA2A 3H3ZA 3RKYA 3OO0A 3UUGA 5DYMA 2E7XA 3LOPA 2VOOA 4WK8F 2A07F 3CKMA 4RGSA 1WSUA 4HF1A 1BIBA 5ICCA 3QLVA 1U8TA 5IUNC 1QQIA 3DGFC 1YMVA 4ASNA 2E4VA 4MQEA 2P8TA 3IP7A 3VNBA 2PMUA 3I5AA 1JFSA 4YGXB 4JB2A 1EFAA 3DLBA 1J7KA 1HQCA 3QLUA 2VXZA 3C7JA 2HYGD 3TOBA 5FBHA 2RGYA 1CGPA 3ILYA 4ZH4F 2STTA 2RNJA 3V8KA 4WX9A 1NHAA 1I3CA 3LKBA 4M88A 3T1BA 1Z12A 3MQ4A 4MAAA 3URMA 1DZ3A 3CFYA 3REOA 2VC1A 1LBIA 3CG4A 2FEPA 4AVPA 1ZAYA 2VC0A 3JTEA 2IVMA 1XN7A 5JHUA 1ABEA 2WWYA 3DV8A 4G8XA 5EWLB 1LDJA 2GAUA 3IP6A 1RXIA 4G7ZF 3SZPA 3I5UA 4A2UA 2COMA 2GIVA 1QO0D 1P4WA 4MR8B 3EYIA 4ETSA 3V8LA 2IW5A 1D4ZA 1SMTA 1S8NA 4RGUA 2VK2A 4N0PA 4EY3A 2FQXA 3TMYA 4AIJA 2PFBA 2DPUA 3KFWX 2A69F 4F11A 5DD8A 3H5WA 3O2QB 3DPTA 1RUOA 1VPWA 1BI3A 1NXOA 4HLYA 5L3CA 1M2FA 3CO7C 4I09A 3KCCA 5E1ZB 4LFUA 1U3EM 2A3SA 5CHYA 3JTGA 2Z33A 2XGXA 2WWVD 4E70A 1UDRA 2O8XA 3P9IA 3OLXA 5FWXA 5CVVA 5ILVA 3T8TA 3GLXA 1TW2A 1WQ2A 5HLGA 1Z13A 4LK0F 5J8CA 4MGRA 4QYWA 4RSMA 1KQ9A 1T98A 1QZYA 4A5MA 1LBHA 1QKKA 2K86A 5FWXB 3HS3A 3S99A 5HS7A 2VUIB 4MEXF 2YHAA 3LFTA 1EWVA 4HDVA 4FT8A 4LB5A 4L9NA 4WXCA 2MYUA 2PJPA 4MR8A 3OLVA 3HM9A 4WXEA 1I1GA 1BI0A 1FQWA 4U0YA 2O6GE 3GYBA 5J6XA 1PNTA 2FMLA 5LRRA 1NATA 1K66A 4RXUA 3I53A 4RV5A 3RVSA 2A9QA 2KIUA 3ML6A 1DPUA 2XKOA 3QAHA 3VODA 5CVJA 3GA5A 1U5TC 1D2AA 2EWNA 2NYXA 4PGGA 1DCMA 2EFNA 4CGZA 2ZJ2A 2V6CA 5BMZA 4G0OA 1Z26A 3HYIA 2PKXA 3GO5A 3ZPLA 2EV5A 4WXMA 3VEPA 1TQMA 1NXSA 4HX7A 4RY8A 3RVMA 3IRRA 2ZBKA 3CO6C 1ZGZA 3L49A 1OR7A 2GXBA 2DRIA 2K02A 3W6KB 5HSGA 2HZTA 2ID7A 2A9RA 1FNNA 3H75A 4L0ZB 1ON2A 1FP2A 2FBIA 5DV5A 3GFJA 5EEGA 1STZA 1FZPB 2JCGA 5HDKA 4IHSA 4G0QA 2M8EA 2TDXA 2MBFA 5ICGA 5T3YA 3DGEC 5LRSA 5C5EA 1KRXA 3Q15C 3LTEA 2FQYA 4ZPJA 2A6EF 2J48A 5CVRA 2FOKA 3EDPA 1EHCA 3SM9A 4L4UA 5IT9K 3I09A 3ZMDA 2OD5A 3ABTA 3CNBA 4KK3A 4LZLA 4L9TA 2P7CB 1J0RA 3WTXC 3LA7A 4CICA 4PE5B 4MGEA 1FBSA 3N0WA 3FXUA 2L2QA 2WJAA 3HIFA 1TTYA 2OAZA 3KLOA 3HDGA 3VOEA 2EV0A 4RXTA 1BI2A 3W6JB 2Z9OA 2FE3A 5E18F 4YP9A 4MS1B 3O74A 5PNTA 1JHFA 3ROTA 5FGMA 2H94A 1F5TA 5LLQA 4D74A 4TLLB 1T6SA 4Z4HA 2RN7A 4OMYA 3N97A 1ZG5A 3M9AA 3CUOA 2B1JA 3KYIB 3ROUA 4XFKA 3IKVA 3QRFF 2P4UA 4M6XA 4O5VA 1AB6A 2LUOA 2EK5A 2PUDA 2EA4A 2R25B 3KEOA 2CG4A 3RKWA 1RI7A 2NUBA 1QP7A 3RVOA 3AAFA 3GV0A 2YU3A 5TPWA 1FYKA 4N9IA 3J7AO 2W42A 2FEWB 3D5LA 3Q41A 1DCKA 3QLTA 1MIHA 2HKOA 4FE4A 5A2QZ 2OENG 3KHTA 4OG2A 5DCFA 3K0LA 1JDPA 5H6RA 2G7HA 2WJWA 1UCRA 3IHUA 4TMYA 4L9JA 1AWCA 2EFOA 3CUQB 5E3JA 2ZNZA 3BY6A 4W5QA 4QICA 4Z4GA 1MDMA 3CRNA 2HEOA 3V7RA 4W5OA 5BQ3A 2JB9A 4ZYLA 3GXOA 3EODA 2DQRA 2ADUA 3LQRA 3KSMA 3I59A 1O3SA 2JPBA 4XRFA 1ZGAA 1JGSA 4GGGA 3SQNA 3BWGA 3OQOA 3OLYA
chains in the Genus database with same CATH superfamily
2DFLA 4F72A 3JRWA 3UJCA 4TXNA 4D9BA 1ZITA 3A4CA 4JLDA 1LD3A 2XI4A 1GUZA 3K1JA 2B7CA 3QBDA 4UAUA 4YS6A 2BBSA 4TWJA 1QFJA 1RC9A 3OYGA 1P3DA 1N4AA 1JDZA 3PC4A 3TO9A 4L6IA 4E4RA 5DBEX 3C7DB 4KQCA 3M4YA 2W0SA 3R5FA 2DPMA 4TQAA 2LR0A 2J0SA 1YU6A 3H1EA 1T1GA 1Z4OA 3A6LA 4HQFA 4IO1A 1AMOA 1SHTX 2H0RA 1VE9A 4HMQA 3LSRA 2RV8A 1HURA 2XXBA 3RKSA 1B23P 3UT5A 3UJBA 3ODPA 5DK6A 2DWQA 1EK6A 4L5BA 3TEFA 2XV4S 4K9PA 2FXIA 3SZGA 3AXTA 4IDNA 1XLVA 4R3NA 3OYAA 1M2WA 2DO7A 3GCMA 1SA0A 2BR4A 3IIIA 5MGNA 1CEYA 4K9NA 2PZAA 4BLPA 3A4LA 4QQ8A 4DCVA 5K05A 2B4TO 3VR5D 5HKOA 5JXIA 1V16A 2HYFA 4LYDA 1RJ9B 4PSVA 4EKYA 1E2FA 4ZN6A 5K0BA 3CEMA 1I32A 4RAFA 2QHXA 4UE6A 1YB5A 4EGCB 5CDHA 1OR8A 3IBCA 2DFHA 3LUDA 4MCIA 1UZLA 1HA3A 3KP7A 1BDHA 1A6IA 3C6YA 3OYCA 1HBXG 3Q9LA 4Q02A 3W6OA 3WADA 5LUBA 1UT5A 2EPFA 1G4AE 1SA0B 2IVZA 3EGDA 3F5FA 3B52X 3Q7RA 4LJAA 4HGYA 5EZ6B 1TVCA 5IC5A 5A3RA 1I9GA 3COWA 3SZTA 2XKJE 1F06A 2ZUUA 4KUHA 4LGCA 4PRLA 4QOHA 5INTA 2Q6OA 3T0YA 2OILA 3EPRA 2MG4A 4FYXA 1C2YA 2HLHA 2ZJZA 1WKMA 1OXKB 3R7AA 3W4JA 3KJFA 1QRTA 1VSVA 4MHSA 1NI5A 3I2FA 1Z6TA 4D4IA 4NCBA 4P0TA 4BJ6A 4X9XA 5DTIA 3CLUD 4KQGA 1ZJZA 1EUZA 2VF5X 3IOCA 4PRKA 4XW2A 2EKDA 1SXHA 4Q05A 3K09C 1JPUA 5LA6B 3ZH2A 4U39A 3M3PA 3QHQA 5B4UA 5DM60 3BZUA 4E07A 4P80A 4GS5A 1BL0A 4YJ2B 3RJTA 1JPNA 4C9BA 3T5PA 4IAOA 5G0UA 1PGNA 2IGOA 2VLAA 1VIYA 2D1YA 3M8EA 1HZJA 2XA2A 3EUEA 3V4FA 2B82A 1QHXA 3LHFA 4G6QA 4OA8A 3UJ9A 1U9JA 5F3DA 4IINA 1UWLA 5TT1A 3SHVA 3WLOA 4CLHA 3ECHA 3JSOA 5HA5A 4BEJA 4JU8A 4BVFA 3W5HA 3EWNA 3ULKA 5LQMA 3W6VA 2V65A 2G9WA 4AU7A 1YE5A 2HXSA 3H9BA 5EP2A 4N47A 3CXRA 4UOQA 2CKDA 4NXMB 2R6AA 3KYDA 3U4HA 1EZ1A 2D45A 3F73A 3MCTA 5K3SA 4OXXA 3VZQA 4E6PA 5AIQA 2DFEA 1BC5A 1YB2A 3BXPA 1SG9A 2ERYA 2VQFB 1MF7A 4TTIA 2OM2A 3OM0A 4CEJB 2ZB4A 1UMBA 1CJMA 4DQKA 4WBNA 1B26A 1SQ0A 4DRYA 4AY2A 5ICEA 4F38A 1MSEC 2FQ3A 1J2YA 1JH8A 1YL7A 3EOBI 3FH0A 1VKRA 3FMRA 4NLLA 4L0DA 4QJIA 1U81A 3MRSA 3B8EA 2P5SA 2JIZD 5D00A 3GLFB 3JRGA 4DMKA 4G5OA 2BMDA 3LCVB 3HLKA 4MV6A 4YREA 3CLSC 3JZAA 4OLAA 2KWIA 2ZR7A 1WVRA 1X2MA 1NQVA 4A0SA 4B1RA 2M6RA 3PYMA 1IZYA 4RAZA 5AJHA 2JAWA 1XTAA 4GXTA 5BWCA 2NACA 3OZGA 1V9SA 4HSGA 5B7PA 5FNVF 3ZC3A 1FB5A 2X6YA 1IL0A 2Z04A 2XSZA 3H84A 1G0OA 2JLYA 4X1KB 3W5VA 1Q0LA 1OCTC 4IF4A 1Y1VJ 1DAIA 2F6CA 1MVLA 1PRYA 2ORWA 2Y0CA 2C31A 2F5CA 2HIAA 1E2BA 1W35A 2SNIE 4HDKA 1SVLA 1ZNZA 2FUCA 1OYWA 2JK1A 3I54A 3K3PA 4MUYA 3AVPA 4XDZA 3T94A 3DO8A 4Z4CA 1EG2A 2AF3C 3MTEA 3JZMA 4BY9E 1BHO1 4L9VA 1W1WA 2AJCA 3IMKA 5AWFC 1JUPA 4JC0A 3G2KA 4EHHA 1NR1A 4FN4A 3ESXA 4EJFA 2XMSA 4FZVA 1IY9A 5LZ2A 3KEQA 3HEBA 3NWJA 3K6SB 1VE3A 2I87A 3HC7A 3PPIA 4I5GA 3FWZA 4HDSA 2DHQA 4GZ3A 3ZGLA 4DNOA 5CB0A 3LPLA 3VJRA 1W87A 2WJ6A 3B3AA 1VBFA 1TLFA 1TYZA 2FKAA 3B13B 4J6EA 3DMTA 3RAGA 2RGGA 4C88A 2NU9A 2XWSA 1LNQA 1WV1A 1WB6A 5T8KC 4AMZA 1ZKGA 1G3MA 4WNAA 1YUBA 2WP8J 1TM7E 1TJ5A 3PBKA 1E2XA 1P6RA 4NAUA 2OVFA 4BO4A 2PRKA 3GJ6A 3ICQB 4B7UA 1N5JA 5F0FA 4FOOA 2BSQA 1SC3A 2WRZA 2ZB3A 3TWOA 4RF3A 2QZJA 1I94B 1UXIA 4PCLA 4CE6A 5I5EA 1LEBA 2OCKA 1N2IA 1IRIA 3ILSA 5HQ3A 3CWQA 1X80B 3P0JA 4MOWA 3ITEA 4U6QA 1A9XB 3L7WA 2R62A 1NYRA 4YUYA 3G2HA 1QS0A 5BNTA 3LUHA 3Q3HA 3TUZC 2NX2A 1NUAA 1I3AA 1E77A 4C7OB 4XKCA 1U5TA 4I2OA 1TKRA 2MSCB 5AICA 1CRWG 2YMPA 3G2IA 2J0EA 3TXXA 3ZK8A 1GXSB 5TQJA 2ZI7A 4D42A 1D6SA 1GYRA 1VA4A 2NAZA 4JP1A 3GJYA 4YTEA 4ZDIA 1KZGB 1NMSA 2V8OA 1AZWA 1L4YA 3OP4A 3AT1A 4KO3S 4OBEA 4BLTA 5M2QA 2O2ZA 1QHNA 1LB2A 1XZQA 2WFMA 1K4TA 1X38A 3ABZA 1FYWA 3DTKA 1TCBA 3EC2A 3NASA 4KO8A 3VR3D 1KWGA 3WLJA 2ECCA 2O1WA 3MWJA 1PQYA 4WOJA 3STUA 5L3QB 3EHDA 3LC0A 3LDAA 2I99A 4M49A 3GZ5A 4W1SA 1XC5A 4EGSA 4YJ3A 5A6VA 4BQQA 1Y7TA 1JKIA 2ZVQX 3SJAA 3QQAA 5FYQA 4JR0A 5KI6A 3L1VA 2NP6A 3QUQA 3JW4A 2ZYSA 3MTJA 3QNUA 3DLIA 1TZCA 4JI3B 2C7GA 1TKBA 4GU5A 1HMPA 4TSKA 1NXXA 2WC1A 4CCNA 2DTEA 4JKYA 1V39A 3RB8A 4H7JA 1O94C 4F2PA 1MOZA 2FZ4A 2ATCA 4FISA 1V25A 2DT5A 1FDWA 2WD8A 3KC2A 4MR7A 1P81A 1KP2A 3DMYA 4OM7A 2JD2A 2RE8A 3QBVA 3V7WA 2ZT8A 2CLFB 4CA0A 1WBJB 5HOEA 5EEAA 1P2BA 3VTKA 2V7XA 3DS8A 3HY3A 2RAUA 3L8CA 2YNMC 3Q3VA 4RKEA 1UBUS 1U0NA 1KAGA 4HDNA 1CZKA 5CA1F 3JQ8A 3PXBA 3RM3A 5FI3A 2W6CX 2GX6A 4JHXA 2UU9B 5FWDA 5KX5B 3GMIA 1V2GA 4HJRA 1P4RA 2PRSA 4QOIA 4U8GA 3WRVA 3DT9A 4U4AA 1V5EA 2KIMA 1L5GB 4RB3C 3ZE6A 4D4LA 3ZMUA 2CHFA 4URWR 4Q9HA 4HW0A 2XBLA 4R0MA 2P4EA 4GOOD 3N9IA 3WGYA 4RTOA 4JLNA 5GVSA 4ZYHA 5FLXK 1ST2A 4ODIA 2HWKA 2DMPA 2VTEA 3W9BA 4BL0B 4I0BA 1DKRA 3R9XA 2R93J 3IH2A 4EM2A 1Y63A 2XPCA 2HCFA 3EXHA 1E4OA 2WF5A 1IHPA 1B15A 5IYCJ 3WYEA 4EFDA 1RLOA 1A8IA 5ICSA 2H48A 5ICFA 4TUYB 1G17A 2B36A 1GRNA 2JLRA 4LOCA 2WD9A 4PZZA 4Y67A 3OR1C 5I9SA 4IWXA 1DQNA 4JVNA 1VZ2A 4RH3A 5FTJA 3VJMA 3U9TA 2AR9A 1U3GA 2GBPA 4P4NA 3O8DA 2FLWA 1S3SA 1WOYA 3D7SA 5FBLB 3S0JA 5F1PA 3THWA 3Q9VA 3PSIA 2CFSA 2GN0A 4DMRA 4F4CA 2O1EA 5FH9A 3HVUA 3MMSA 3OPQA 5KTRA 3DQZA 5DHUA 4QT0A 4QFCA 2QZ4A 3LQKA 1WU8A 1WKCA 2P3LA 2JA1A 3MMXA 4PSUA 1CRQA 4CTJA 5H70A 4KN6A 1HL7A 2ASEA 5IKXA 4F1KA 3H1AA 1Q0RA 2TCTA 1RVDA 2QN9A 4NENB 2D3TA 3AF3A 4LDZA 3ZU6A 4BVGA 3O91A 4X8HA 2KJCA 1CQXA 4I76A 2A5FA 1MA0A 2XGJA 2V4MA 4L74A 4IOKA 1FOXA 3V33A 2F4VB 4YV7A 1SZJG 2OVBA 2UYQA 4GXNA 4PAOA 3WE2A 1UJ4A 3S2FA 3V4LA 5FKNA 1IK6A 2ECFA 4RPCA 3T3HA 3NUGA 4BO5A 2GZMA 2QNRA 3WLRA 5GTDA 1LPQA 1JEYB 2Z08A 1EBUA 2JVIA 2H4YA 1OH6A 3W4KA 3LA6A 2ERCA 2F67A 3NI2A 3E5NA 2Q4RA 4M3FA 4EFLA 4F2WA 4NHOA 5KNBH 1ULHA 1GGJA 3MQ0A 2G08A 1W30A 2ZR8A 1OLXB 3AR4A 4HCJA 4YRJA 2CFRA 3EVZA 2VK1A 1VL6A 1HE4A 1GFWA 5K5QA 3ZV7A 3VYTB 4A3FJ 5CFNA 4RTKA 3O73A 3VDXA 1OBHA 1X3LA 1ZRCA 2RJOA 4FVTA 1MHTA 1QQBA 5BQFA 4EFKA 2P8JA 3L04A 1YA6A 2NTNA 1KI8A 3JV7A 3G6WA 1Z5NA 3BL5A 1JLLA 4QYMA 4BNDB 4EHJA 4CR6A 1B8OA 1LX7A 1PDNC 2FXVA 2Q2NA 3H1TA 4LBYA 3GRCA 1E7RA 2WF8A 3I28A 1T5DX 3FPAA 1LQUA 3BK2A 1O3RA 4MQ5A 3RSZA 3FW1A 4ZU1X 1LXCA 2A8YA 1QH1A 1WRBA 3FSGA 1LK7A 4H9GA 3LYLA 5C8ZA 4GNRA 3RVQA 1EP1B 2X8LA 4AP9A 1B4DA 3CIFA 4YMUA 1IK4A 4MYDA 4WK4B 5F08A 2VP4A 4X90A 3TLAA 4JJEA 4N7RA 5FUVA 4CM7A 4YXWA 4IUYA 1EUQA 3LUFA 2Q3EA 3M1EA 1PJBA 1RMQA 3AUSA 1SD7A 2RGNC 5KVSA 3MCAA 4B4OA 2XKKA 1HR0B 4DLYA 4OOIA 4YC7A 4QPZA 1Z3CA 4CMHA 1LH0A 2F2EA 3MAGA 1NAIA 3BULA 4K3UA 3HA3A 1U28C 2SHKA 5J1UA 3ZVKA 5JVTA 1BVRA 1QHYA 1W8IA 2F62A 3IA2A 3NT2A 4PPGA 521PA 1SKQA 1FSPA 2Y4NA 2XTJA 3BMCA 3URKA 1C7IA 1KZ9A 3M5CA 4JASB 4EJWA 3MKZA 2WB1A 2J0UB 4NJEA 5IM5A 3RAJA 3ZE0B 3QE4A 4YFXF 1E9SA 2BJHA 3RPUA 3E2PA 5CLFA 1Z63A 4GBGA 2GILA 2IZZA 1R1DA 3VKVA 4O2AB 2QA5A 4PLYA 4GXOA 4GYKA 4QUAA 5EYPA 3OIQA 1MENA 1UPXA 3SIPA 4DC1A 3AFOA 2BFDA 5KX5A 5MFZA 2NRAC 4ZQFA 3T8RA 2B30A 2ZIXB 1QBKC 4JI6B 4QLAA 4EHFA 2ARKA 2QIPA 1WY7A 1EFKA 2WTXA 2H00A 3JALA 3LD9A 4URFA 2QLNA 3MWEB 4WWHA 5E7IA 5BMVA 4DMMA 1KMMA 3DPUA 3HCAA 4KPFC 2MA3A 3EZ9A 2WTMA 1ULBA 4TS1A 3GPLA 3WFIA 4FB5A 4WZAA 5AVOA 3KM0A 2AR0A 3D0OA 4MUKA 1Y7IA 4JEHA 4CDGA 1WG8A 1GGKA 5K4GA 4B4CA 4YPVA 2QLMA 2QUFA 2ZBEA 4LK1F 1Y8AA 2PSDA 3LIPA 4LXGA 1YHZA 3WKAA 5A5GA 2O2SA 1R6TA 2PCLA 1F48A 4RK4A 2AHQA 2XE7A 2D3WA 2LIPA 2FUG2 1O9BA 4KQXA 4WCDA 2Q3FA 4QX6A 2P79A 2R48A 4TLBA 1XELA 4BNTA 1L4HA 2AQEA 5F9HA 1SUFA 3CSUA 4D2IA 3KOUA 1GHCA 4QDKA 5C8DA 2HM7A 3R20A 4G37A 2PH5A 5BUZA 1I51A 3E23A 3VO1A 5CDYA 2VBWA 2ZCJA 1C7FA 3MT8A 1LZLA 4AKTA 2ORVA 3HM2A 2VPPA 5KWSA 4MRMB 2OP1A 4KFSA 3PEYA 1M1YA 5KJCA 2BFAA 3VPRA 2IYWA 4EUFA 1XHLA 4QG7A 1FLDA 5EIEA 3BZKA 3MKWB 1W36D 3MZYA 2L4AA 1CUCA 1WXDA 2OC9A 2AQKA 3GRKA 3LI2A 3N2EA 3NGLA 4QVIA 2FPIA 2H2AA 1F9AA 2V7EA 3CB4A 3A4TA 4WXPA 3UY4A 2ZB9A 1ETUA 3JVEA 4C04A 4PANA 2QPTA 2WHQA 1X14A 4JBYA 4XCXA 3BXOA 3L77A 1F0PA 4BMOB 2Q3BA 5HQ3B 1D0SA 1XAJA 3HO1A 1H9AA 4F9TA 3PDJA 1ONVA 3IX7A 4KZKA 1PHRA 4XARA 5BXQC 3F78A 3HDJA 5DNDA 2PAAA 5F7ZA 2EL7A 4K9QA 3K4CA 2R7MA 1TEVA 3I12A 3EMKA 2M4GA 1XL0A 2CBZA 1PR0A 3MTGA 3R76A 1IJEA 4RBOA 1JLRA 1ATIA 1RWXA 2V03A 4IKPA 4PQYA 3PU6A 4TV8B 3MTAA 4MUBA 3GUDA 4LXHA 3UV3A 4BCCA 4FR5A 4XLLA 5LXTA 1H42A 3RABA 4C6RA 4GPTA 4XPIA 3WK6A 3KFXA 5BRNA 5TS2A 1JMVA 4RLQA 4ZYXA 5M34A 1IBMB 4ZVPA 1ZMXA 1CJTC 4XDHA 1TE2A 1B00A 2K27A 4EB3A 3RYIB 2RQPA 1K79A 1A95A 2BKVA 3BMOB 2GO1A 5CTAA 3HRUA 4C7VA 3ONQA 2Q3CA 3HYRA 3R2JA 3V8BA 1IN8A 4EFMA 1J0BA 4US1R 4CM8B 1NQ5A 1WCV1 3VISA 5FWYB 3K31A 4BX9A 2CK3D 1PYGA 2XUBA 2A5LA 2GPSA 2OK7A 6PAXA 3AP1A 3HV0A 1RI1A 4MXDA 4ZT7A 4R05A 4WN9B 2PSHA 2CHEA 1ORKA 2M3AA 2W2MA 4FZ5A 4A10A 2O8NA 3FPGA 2E7ZA 3R3HA 3FE2A 3NWOA 2H4HA 2FFAA 3KWMA 1CZOA 4FFBA 3ZU2A 2XQGA 1XMSA 3MERA 3KJXA 1QX4A 4AJOA 3UNGC 2D7DA 3IKLA 3FI0A 3O84A 1A4XA 3ZHOA 4IGAA 1JL3A 2HYIC 3RCOA 3QU3A 3AFIA 4UE3S 1DU4A 1UMQA 2QRKA 3L8ZA 3VO9A 5LBQA 2V3WA 3WHPA 4PUSA 2P9HA 4J0IA 5CVTA 2DLLA 2JJMA 1RXEA 1MDMB 4IQ8A 5KZMB 2O8DA 2WZCA 3N7AA 5JRDS 2I2AA 2GPAA 5TRDA 5IW8A 1QVRA 4N4OB 4V0KA 3U4QA 1VCHA 4HMOA 3J80A 1EKEA 4U3JB 1JHZA 4P1WA 4GGOA 2HZ7A 2VF4X 1NRJB 1SVSA 2BFMA 4DHEA 5L7TA 3W9YA 3Q6NA 1H8ED 4JP0A 1ZINA 2V98A 1UG2A 5FRMA 4I4LA 1K0UA 3H0DA 2CJXA 2F90A 5JQWA 1YXMA 3S2HJ 4FDAA 4G1EB 3K1ZA 4BNUA 1UHMA 1XQYA 5ESXA 2WJVA 1ISIA 3C98A 2JCVA 2R1VB 4JYZA 4PG6A 4V24A 1PSDA 2X9NA 5LMZA 4DV3B 3D3KA 3DMTC 2OHXA 3MB8A 2DEUA 2H5LA 4KN4X 4DIKA 1PFVA 4ZMBA 3HG7A 5JO9A 1MZPA 1Q11A 1DC5A 1U6JA 1M2EA 3I58A 2FN9A 4IJKA 1PUFA 1I33A 2WNHA 2M87A 5FR2A 2E1PA 4OMDA 4E4HA 3HADA 1I13A 4RTPA 4O4HB 4EB8A 1WPQA 1ACJA 3UJ6A 3RSQA 5BQXA 3OYNA 3V7FA 4D82A 5I4CA 3FHJA 1M6NA 1X4PA 1IMJA 2VNJA 2XYRA 3HSFA 2XTNA 1A9ZA 3E22B 2GJ9A 4NCKA 4ND5A 5IJXA 1XRPA 2C9OA 1BBYA 1TQIA 5ERIA 4LHYA 3S15J 4NVRA 1JKQC 3DXJF 4HAMA 1ZUIA 2HTEA 5JD6A 2ZJ8A 3PO3J 5G4KA 3TSYA 2YN2A 3HR8A 1IN1A 5EZYF 2ZPUA 3GLFA 1U1CA 3G1OA 1FFXB 2GEDA 1Y8QB 2D74A 2ZETA 3A4VA 3GNSA 5CT6A 3STHA 2FR8A 5FB2A 1EAYA 2M6LA 1Y98A 1NW8A 1XGMA 1KQPA 3A36A 3UK1A 4DSNA 1KEKA 2Z5FA 3MN1A 5AW4A 4TLDA 1G4DA 2BFEA 1R8QA 2Y1EA 4N5NA 2ZBQA 4DF3A 3CWCA 3D2CA 1PW7A 3INRA 4X61A 5DLQC 4E14A 4BC0A 4X24A 5I4IA 5DD4A 5K0SA 5ILQA 5JFRA 1Y3HA 1ZKMA 2PL1A 3MWLA 4IIHA 3A1WA 4Y2VA 5E7MA 5EIBD 1WABA 4WFKA 3V4ZA 4NG4A 2CXSA 4J07A 2NO0A 1E9BA 4UB6C 1NBAA 1JXQA 1OA0A 1NYLA 1DRUA 2G5PA 4Z0NA 3ZI0A 5A2GA 3PVCA 2NYUA 3EUHA 3AEXA 4IX1A 2LTPA 3L7IA 3H4VA 2J5OA 4KDCA 4L16A 5FFXA 2PTGA 4MWSA 2D54A 4PWZA 4QHYA 4BB6A 1T8PA 5MDHA 5D51S 4DMFA 3AF1A 3Q9UA 1R8YA 1I3QJ 5HPYB 3NTRA 1QIHA 3KAPA 2G7ZA 2HSDA 1MV8A 3JZIA 3IRVA 1F4PA 1U7WA 2NV0A 1NXTA 4FMCB 1WE2A 3GH1A 2E4WA 1JQ5A 4E5NA 2VAVA 1K7AA 5BR8B 4JLMA 3GEDA 5HRCA 3Q87B 2IUSA 2NXNB 3UKJA 5CG2A 1EJBA 5JXWA 4UEKA 4MQUA 4HJXA 4EB0A 1ZH0A 2QYHA 5AI8A 4HUJA 2CFOA 1PG2A 5I8ZA 3TVYA 4UE2A 3PXCX 2EV6A 2J6CA 1RW4A 1PVOA 4EGAA 2Q2OA 1VXRA 1EDDA 2CCGA 1FVOA 5DHPA 3U3ZA 1ZEMA 4N65A 2YBEA 1Z4LA 1V2HE 1BCRB 3ROMA 2PN6A 2IEIA 1D04A 2RB4A 1KYXA 2XRZA 4KMFA 1C1YA 2F17A 3BCBA 1HGXA 3ABSB 5CG1A 3OL3A 2DQSA 4Z3KA 3O3OB 4RGXA 3HZJA 3M6VA 2DMUA 3BQ9A 5MHTA 2QLTA 3LLUA 4CEHB 2R1TB 2WMNB 3GA0A 4X6LA 2OCIA 3AOEA 3ESWB 2FUEA 4ETNA 3HVJA 3IXQA 2J3QA 4L0MA 5TVGA 2LD4A 3PIPF 2VYFA 1SUAA 3H5IA 4G07A 4KO2S 4WFJA 2UVQA 1KMIY 2CV0A 2HA3A 3LVRE 3I05A 1FEXA 4Q4HB 5CFOA 1N2CA 1OFTA 3HUGA 4R2XA 4LNUB 1XTJA 3OCWA 1DKNA 5DN6D 3DPSA 2WAQA 3IE0A 5K0JA 2IHNA 1MW9X 1DBIA 2XF2A 1TZ2A 1MGPA 3OKFA 6CHYA 5EUCA 5IDWA 2XNJA 3HHHA 1IZ8A 1G20B 4N1AA 1SUSA 5CIWA 3M3DA 3R7FA 2XUQA 1JKFA 3LGSA 4Z9AA 5EJ8A 2PUCA 4K05A 4NHJA 3VNVA 2VT3A 1RLJA 3JQBA 4FFNA 4EG6A 4B6EA 4FQ5A 2G1KA 2QQEA 2Y92A 3NDPA 4GX5A 4L0QA 4XXHA 4C3HJ 1T1JA 3COSA 3CX8A 5CFRA 2LKDA 2X8AA 4I0AA 1IIRA 2YQ5A 3IV9A 4Z54A 2LY2A 2EW2A 2J3MA 4WXDA 2QRMA 3PFFA 1X3UA 3QHPA 4CKZA 4PN3A 2XB2A 4YJDA 3ZQFA 1MC8A 2XIQA 1TC2A 4ZQGA 4CZCA 1AG9A 5JI6A 1SBHA 2ZI5A 4HAZA 2EP8A 4ZTZB 4EUKA 3G3EA 1BA3A 2HJSA 4FZRA 4Q3DA 4BXXJ 1J33A 1Y8CA 4BHTA 2E4YA 4ENTA 5J1YA 1W5SA 1D5WA 2HU9A 3QWBA 4LOIA 3A9UA 4HQOA 1YB1A 3UB2A 4B6GA 3QX3A 1PLJA 3LFKA 1CUZA 4UUSA 1ZELA 3TBIA 3E5MA 3HB0A 2WLSA 1ZRDA 1AGRA 1GV2A 2GVDC 4ENQA 4CMIB 1M74A 1QUEA 2PWPA 3T1NA 1WJDA 4P5EA 3BD8A 1DPRA 2IY8A 2VRWA 3ESZA 4P9FA 2DODA 4I3FA 2B8NA 2RD2A 2VONA 3T0IA 2H1OA 2X13A 1J2JA 2PUFA 1RPWA 4M4SA 1JIVA 4LGYA 4DLXA 3D2AA 3ITNA 5KC9A 4M71A 4ZEOA 1MXHA 1QZXA 4IEIA 5FBZA 2R8ZA 1RYDA 3QPUA 4I50A 5HZHA 5A02A 3HYSA 4XSXF 2X77A 1OMOA 3GYGA 2ZT6A 3KWJA 4PW0A 3GAZA 2GVZC 1JWAB 2RDMA 3VPBA 1XV5A 3Q9SA 1U3VA 1X86B 2IC5A 2ODPA 4BMYA 5E95A 5TS3A 1N4DA 1HX7A 4BXOB 3WLHA 1CUEA 2FQQA 1WCIB 3JWEA 4W7IA 4YJFA 2WSMA 1G8PA 4R5HA 4IICA 3KQWA 2YVQA 4TWAA 1CZNA 2A9OA 1G6NA 5I51A 1XP8A 1KYZA 3FOBA 1T24A 1T9BA 1VM6A 4IDDA 4RJTA 5B3JC 3SE0A 2P4HX 1N3IA 3H35A 3DAYA 4UVHA 3HPRA 5JAIA 5AJZA 4DREA 4DV1B 1OV6A 1T2NA 4JEUA 4K8OA 4MWGA 4QSMA 3WGNA 1HFKA 4XQ9A 4A5NA 5BN4B 1L4GA 2MYTA 1VOTA 1A8SA 3L7MA 4LIUA 4UHHA 4EYKA 4C89A 2Z2YA 1B43A 1V45E 3VDQA 1C7RA 1NG7A 2R6ZA 4OHPA 2DX7A 4RB1A 4MW1A 1KQ3A 5KKAA 4IJMA 4AJ2A 5DM7F 5IVIA 1P5RA 4JJAA 5I7HA 2XCSB 1Z05A 3LSIA 4YACA 3WICA 5ALTA 5KC8A 3U60B 5BUSA 2HF7A 3OR2C 1XRQA 2VPIA 1JMKC 2E1NA 2CWDA 2WWHA 3E3AA 3GEPA 3IXLA 1IO2A 3LHSA 3PHCA 4RBNA 3V8EA 3VKHA 4CL2A 4KN9S 1NULA 3HA7A 4M36A 4WFIA 3LO8A 1YQAA 4MTLA 3TNLA 4FLEA 4YR7A 5IY5H 1IPHA 2XGDA 4RORA 1E18A 1XEXB 4DLTA 5EFZA 4RGRA 3K20A 5A1TA 4IIDA 2DWUA 1A8QA 1J0AA 1ZNXA 3I2IA 1GVJA 1Q0UA 1T2FA 5IJ9B 1V11B 1M5UA 2G04A 1W47A 2NNWB 2Q07A 1F3OA 5CVEA 5F21A 1MQ9A 1WEKA 1BC8C 2DC1A 3OMYA 4Q9KA 5F5LA 2RKOA 2Y1DA 3FJOA 4CFZA 4TTRA 1L5QA 3AM1A 5EWLA 2AN3A 3IBYA 2ZXIA 4Q1AA 2FFHA 3HJRA 4HAWA 2GAIA 4I1VA 3JQQA 5IP6A 4FCWA 5KX5F 2JHGA 2VWQA 3A1VA 3BMNB 4FGZA 4TMXA 3WLSA 1VIDA 4LEIA 3PPWA 2XODA 4IV0A 2R7KA 5IJ9A 3QU2A 4JGBA 2OXCA 4M74A 4BFZA 1YZUA 3RD5A 4L5EA 2BEVA 2L9SA 2YJZA 5CLSA 1BO6A 1QVVA 3VR3A 1Q57A 2P2GA 1GSOA 1VPVA 4PFOA 2NM0A 4HDQB 2NO9A 3EXHB 3WX0A 4BBJA 1F0YA 4U02A 2M7BA 3TD2A 4BECA 3K9FC 1OZFA 1XCBA 1PQUA 4RS4A 1ZAOA 3SJMA 1ZLXA 2XNDA 2FHPA 7ABPA 4D4GA 5DHFA 4CIWA 3EGCA 4HS4A 5FLVA 1ZKDA 4N03A 1HYHA 4AS3A 4URXR 4LUCA 3BX1A 4BKOA 3T9BA 2XDAA 3BR1A 2IXDA 2WT9A 4AS1A 3T7TA 2V26A 1G2IA 1PX0A 3H6HA 4C1BA 3S3NA 2EJRA 3IPCA 3OCZA 3PGXA 4P83A 3UMVA 1EDOA 2GAFA 4MV5A 4OGKA 3V46A 3KP3A 3I3LA 1I6LA 4N5IX 5A3SA 4F5WA 1CDZA 1J23A 3L0PA 2G7UA 1VP3A 3FAKA 3Q85A 2FKNA 1V9CA 1ZRNA 2QAJA 4JENA 4MR9A 4EG0A 3OJFA 3SEZA 4ZZDA 5FRDA 4B35A 1BAPA 3A32A 3M4OJ 1KY3A 2D59A 2MCFA 4FGJA 4PBRA 5DHQA 3S44A 4Y1EA 4DXAA 5JASA 3CUUA 2XB5A 1E9CA 1ESMA 1B72A 1Q7EA 1TUIA 2JFQA 3D8HA 2HPIA 3GLLA 3USES 1F4KA 5E9QA 3DQQA 4BASA 4IL6C 3BQYA 1U1GA 3L6RA 3LY8A 4IOMA 2RVCA 1Z15A 2BGKA 1TFUA 1EFVA 1XB4A 1DAOA 3NOVA 3ZZTA 5CM9C 4HGOA 3M5WA 1PQWA 4K9OA 1XXHA 3JQFC 4D0RA 2BP7A 3W2FA 3U56A 4BV3A 1FU8A 4D3DA 1T10A 4QHSA 3SVLA 2Q8QA 3K7AJ 3AJRA 3WQQA 1RRCA 4XVRA 3AHEA 5CUQA 3YASA 5B4TA 4PX2A 3M1CA 1K98A 2P5LC 3JR7A 1QBGA 4H1TA 3AEQA 4WZ6A 4KRXA 5DHAA 5LMCA 3K0HA 3MTQA 4Z4EA 1NNUA 4LD5A 2VWHA 3HZZA 3ZVLA 1W0KD 1P72A 1Z0JA 2HOQA 3GGDA 4RQBA 3WP0A 1O3QA 5K0ZA 5KSZA 3LYAA 1WXGA 3BTUA 5HW0A 4HDCA 5C1OA 5K6AC 3HDVA 3PD7A 2O5CA 3CDLA 4V0RA 4DCUA 3GBPA 2ZE6A 1M76A 4CIAA 2HOAA 3FF5A 3OP1A 3GHHA 3U1TA 1ZW6A 3OOPA 3LDFA 3SDGA 1X3ZB 1I3NA 4EGQA 4JEMA 2AKYA 5EE5B 3JR9A 2B2XA 2WABA 4ENRA 3CEAA 3I4NJ 3NG1A 1GDHA 1JPVA 2HO4A 2CMPA 3FGPA 4YJ2A 4O4JF 5DWDA 2HHAA 4G8JA 3T7DA 3RYHA 3LX4A 5KVCA 3W6ZA 3JRAA 4FM9A 4Q1EA 4EEZA 1DZIA 3F5SA 1UP4A 4WY2A 1FXWA 3WLEA 2EILH 1SFUA 2F5DA 1AS0A 1FNCA 1V8DA 1K6OA 2Y9YA 3G5TA 3QF4B 1DOHA 4I5EA 5FOWA 2ONYA 2D2VA 4S1NA 2W6NA 3GJSA 5GV7A 3SIRA 3W8DA 1ZN2A 1QCCA 3JVUA 2EB7A 1EK1A 2FRDA 4PCUA 1Z4QA 4G0PA 1RHQA 3GEZA 4HFRA 4HN9A 3VNQA 1NBEA 4ITRC 3SEQA 1KVTA 5GY7A 3GZ6A 3PQKA 2F3UA 1QH9A 2ZRCA 1QYWA 5T6BA 4B3HA 5A5DA 1ECPA 3I6BA 4JJIA 1SURA 5CHEA 1RPJA 1W0JD 3NRCA 4TV7A 1OCEA 2YJGA 1LY1A 3KE8A 3TGPA 5LU9A 1ENHA 1NJ1A 4MLDA 1VMIA 3R60A 2HMWA 3KKZA 3D4OA 3L7KA 1DQZA 1NMZA 2YZGA 4HZIA 2LRHA 3ANSA 4J0FA 1SBTA 2WSSD 4GDMA 4E0BA 1OY1A 2QUAA 2G82A 3IDFA 1EFHA 2XPUA 1IWPB 3SFIA 3PHJA 4EJSC 2X6RA 5FKMA 2XZOA 2E1MB 1X8KA 1ORTA 1HL3A 4RD2A 1P6QA 5T4HA 1WR8A 3VPGA 4JP5A 3T9CA 4CKWA 3I9MA 3SQMA 2ZWVA 3K4QA 3PB3A 4F2HA 4G2NA 1JR6A 2LGJA 3MLAA 3ZOZA 1BJZA 3NDJA 2VP0A 5FV4A 5ADWA 4Z6YA 2LCFA 2UUZA 4RVCA 4KDPA 2YFYA 5BWOA 1EGQA 2EZUA 2PO7A 3TG8A 4JGGA 1WETA 4P3YA 5KYYA 1DRVA 2WSSA 2O1XA 4CG2A 3PD0A 1E0KA 4HLUA 2A0YA 3BCAA 2IOFK 1W0TA 3H0EA 4FQ8A 5CLHA 4E32A 4PSKA 3HKDA 1L0BA 1VQLI 3ELBA 2W98A 1FYMA 1YZVA 3NOXA 4FW9A 5DM4A 3FRIA 4ND7A 5H9VA 5J8FA 5JNUA 3LYHA 1HRKA 3C3CA 1NN0A 1LWNA 4MIMA 3KZ1E 4FXOA 3BOQA 1QOQB 4LCEA 3ZH9B 2V58A 2VOJA 1UBSB 4MTDA 5T4EA 2VZ0A 2D1VA 1CS4C 3G7UA 1W29A 4RZHA 1LLCA 5ERXA 3WMRA 2FUKA 1VLLA 1DB3A 2I3AA 3FR8A 1E1CA 4HYTA 1U4OA 4MA4A 3TQNA 4TPKA 3A1CA 1XTUA 3S1RJ 3P9YA 4EBFA 4REMA 1Y0BA 3LQ4A 3WGJA 5YASA 2IH2A 3QVKA 4YT5A 2C9CA 2YJTD 5B55A 1S4QA 4B85A 4B71A 2RHGB 2V7QA 5HKAA 2JH3A 1XMXA 1SHJA 2L0XA 4O5AA 5HNFA 4GH5A 2OFOA 2H57A 1MO3A 1P9OA 5DNCA 1P44A 1B0UA 2AN5A 1BGXT 4MPRA 4E5VA 1B9MA 1XMIA 3RC9A 2HRBA 2WM2A 4LFBB 3OZBA 2ZJOA 3KTFA 3GLRA 5ALSA 3JD2A 3CEPB 5AO9A 5CPRB 4ZYYA 4PHCA 4NFLA 3FTFA 3T7IA 4PGMA 3ISPA 4RLSA 1A5TA 3G8BA 3VSLA 4WEOA 2ODTX 1R71A 3EZ6A 3IHWA 1EVKA 3PPXA 4YX9A 2W6OA 2XLCA 4XD7A 2IOYA 4EX7A 2OA4A 3LWNA 3OUZA 4DA4A 4KXUA 3ZWNA 3U5TA 5FD6A 2YHBA 2X86A 3SS8A 4BQNA 1L7DA 3KVRA 3HXMA 4Q4ZF 2Q3LA 4LRWA 4TRMA 2D2IA 5IDYA 3RUIA 2PLRA 5EKTA 4BNNA 4C5CA 2PRIA 4BZXA 3HRMA 2WDZA 4RHYA 4RVOA 1WJGA 3MJVA 4ZYDA 2LIVA 1UEIA 1DBPA 1YZLA 1HW5A 2PX6A 2ZSIA 4M9SA 1VF9A 3P5SA 3Q3IA 5DBFA 5DOVA 5THXA 1Y8ZA 1E59A 2F43B 2Z95A 3QVWA 2CXQA 1L7MA 2X8JB 4FONA 3KP5A 2X7XA 5TVKA 4DCGA 2ETHA 1NBME 1NSTA 1Z8DA 2RJNA 1VIVA 2VNSA 4ZKDA 4V1CA 1HOTA 1NVEA 4B0PA 1ESCA 2GHTA 2WV1A 4B82A 4EHIA 2HBRA 4JDPA 3WU2C 5L3BA 3WLFA 5C1PA 2EZTA 3RRFA 4PBTA 3N8GA 4C78A 1OAKA 1T2VA 4AIKA 1WUHS 1Z5GA 2HR3A 2ONZA 3K35A 4QO7A 4XB1A 3QBJA 1UBOS 3TZ6A 1FXWF 4CXMA 2WTAA 1XA4A 4OYLA 2NU8A 4BX8A 4MNUA 1XZIA 5L3SA 3KSRA 2P2SA 3LXUX 5DIFA 3UAVA 3ZWDA 1UBNA 4YMTA 5JSZA 1T8WA 5LMUB 4OTZA 1U9CA 4ARAA 4XKBA 4IILA 1TM4E 1JSLA 1ZPDA 2VXCA 2IDMA 2EIHA 3GCGA 5AK3A 3VR4D 2FW1A 2FR0A 3GFPA 2Z5UA 4HL6A 1RKVA 4CMJA 1ZIXA 4TKLA 3P4XA 1VCMA 4KPYA 3GTLJ 2H4JA 2VP2A 1MABA 2PKRA 2ZSJA 1KQFA 1E99A 4D4HA 4JYAB 3BJIC 4BX3A 1ZN7A 1VPDA 3TJMA 3LFUA 3W90A 3PCXA 2PIAA 5KK1A 3KZVA 5DTDA 1MX1A 3R4CA 4IIGA 5ALJA 5HTOA 2KBFA 5HIKA 1S0UA 2HHCA 2MIIA 1RHUA 2PGOA 4FR0A 1LVGA 4I99A 4OQFA 4N5DA 4FGSA 2WWGA 1HLFA 4L50A 3LWFA 4YMGA 5EVJA 3DFFA 1BM9A 1OLSA 2VTVA 3PQDA 5CX4A 4HGRA 5FUMA 1P80A 3FDYA 1EHYA 2Q3MA 4CKCA 4O4IA 4P33A 2ZJPF 1K97A 4NQWA 2PWBA 4MKGA 3V6MA 2OQGA 4BWGA 1GPLA 1A4UA 1RQXA 1W9HA 4WZZA 3PITA 2FP4B 4MJLA 2BGWA 3BGWA 5H4GA 4NESA 3LU1A 4ER7A 2GESA 4BWFB 5C4XJ 2ON6A 4LITA 4BKXA 1G8JA 2NT4A 1V3UA 2ZE5A 2GYWA 1N33B 3BG6A 1PWYE 1LDMA 2GM5A 3LBNA 3NIWA 3PWZA 4Y2QA 1WVIA 1GKLA 3P7MA 4ZU6X 3HSEA 2HMAA 1T26A 5E6RA 4EGZA 3A3NA 3ETHA 3GUZA 4X3PA 2TSYB 1U7PA 3AJ9A 3E7FA 1ML3A 3H6KA 1QIDA 2FEZA 1OYIA 3MVPA 2CMFA 2GHIA 3P45A 3Q1LA 3QZUA 4Z9FA 3W7BA 2OCCH 3ZR8X 2GN9A 3A4MA 4ZAZA 2E2WA 4NCXA 3PNQA 2W82A 3F0TA 2H7CA 4MV8A 2DLDA 3RIEA 5E17F 1G6Q1 4XNFA 4DRXB 1WXFA 1WZNA 4IOJA 2ELHA 2P0YA 3FBIB 1OH5A 3KSUA 2OYSA 4JJZA 2O7SA 1QA6A 2BYTA 1HXHA 4N0QA 2AC4A 3L7YA 4PJMA 1ON1A 4MYSA 4JOQA 3E9ZA 2DA6A 1YJAA 3VM6A 3VBEA 4BFXA 4CFSA 4B3MB 1MVOA 1ORIA 4KVGA 3SE7A 1L1RA 3GRFA 5BOXA 4B47A 3F22A 1DFIA 1FFXA 2CHQA 1WUYA 3H1GA 3ONFA 5AR1A 4F1JA 3VKGA 1UQRA 1U0EA 5ENZA 1BQ3A 1LDNA 3CGGA 3PQEA 4ESEA 4P4TA 4E2WA 2ISYA 2ZT7A 3C6MA 3PRKE 5FLEX 3HBMA 2AS0A 3O7MA 3EGIA 3OIUA 1GQYA 2JZOA 1ILEA 4F0JA 5HYVA 1PV4A 1HNXB 3MCVA 1DWUA 3I1FA 3KK0A 3QKRA 4NICA 1S2MA 2J6HA 1E2JA 4UU1A 3S55A 1AT1A 1S5PA 1GVHA 3BIWA 3BWDD 4RVGA 3W8NA 5JD5A 3RADC 1TZKA 2AG0A 5AOAA 2WPDA 4I55B 4WOKA 3GF2A 1KPIA 2IHUA 3S1AB 5J2UF 5HDNA 2QTHA 1I1SA 1OX4B 1YH3A 5AW8A 2M2EA 2AXTC 1X1EA 3D5QA 3KZMA 1H23A 2ZYTX 2JAHA 3MD9A 3QPWA 1JXSA 2HT6A 4G5RA 2Y1KA 1PYOA 4I36A 2D1TA 1GXSA 5IK2A 2W2LA 1OXSC 1Y1PA 1KC3A 2WUFA 3Q1KA 3PQ7A 5EZQA 1VFNA 2NUTB 1LI4A 5FA6A 5A0TA 1SRRA 2JF0A 4WMLA 2ACJA 1X7WB 1JAXA 1M6WA 4COOA 1XPRA 1SKBA 4P38A 5KNBD 2DF8A 1IMOA 1RAFA 2EX1A 1ES9A 4OMCA 4EW1A 2I7XA 3LUGA 4GMHA 3ZWCA 3OEHA 1L3BA 4DJTA 1HYGA 1NQAO 4PR3A 1V7QA 2R84A 4BEHB 1R9TJ 5EWJA 2FEMA 4IIJB 3DTNA 3QHAA 2VA9A 4YMSA 2VJDA 1J9EA 3GW2A 5JSFA 4BS9A 3H18A 4I6GA 1HZZC 1QG4A 5F0HA 2CCJA 1JBKA 3GPIA 3TNJA 1DEHA 1T9GR 1XRRA 5I4BA 2SBTA 2XAFA 4CF4A 1MJAA 2Z4RA 1JKJB 3BCHA 1EWQA 1W4BA 1E96A 3MBKA 2GRAA 3BR3A 2ATIA 3W4IA 1PW5A 1PL7A 4ZYGA 2PX9A 2QTFA 3QY0A 1B3BA 1IE3A 1QYXA 2OKCA 4PYIA 2Q29A 3HCRA 1BA5A 2CYBA 2Q28A 1QIFA 4K46A 1FRVA 4LWQA 3C5HA 1Q84A 3ORRA 3CUKA 2RAPA 5B1HA 4IPTA 4D9CA 3Q0WA 2XUKA 3BQZA 1JHVA 4JQSA 1D03A 2QMHA 5AIBA 2YWHA 3JQ8B 4JUDX 4DIMA 4JBGA 3F67A 4KIBA 5SYNA 1N0WA 2PJZA 1KI6B 4HF7A 3WVNA 5BY2A 2QN6A 1HDXA 1KI9A 1KJ9A 4JBHA 4FS3A 3BIXA 1N1MA 3OKCA 1Z45A 2I8CA 1HTWA 2GK4A 2P77A 2GM9A 3FRJA 2GCOA 3CPJB 5LLSA 3UMGA 4EO9A 3T1YB 1HXDA 1KXJA 5JCOA 3S3TA 1BOFA 1KEPA 2ZIFA 1SNYA 1VRVA 3FPFA 4ZV9A 3T12A 3PHIA 4RQTA 3X1KA 1E2GA 1KK1A 4GYYA 5A2QK 4IOLA 3MCWA 1HLGA 4CM3A 5IK2D 4CV3A 1FUEA 1XGOA 3S32A 1DP3A 1I4EB 4X20A 1ZM4A 5J1TB 3EE6A 1FFSA 4CMKA 1BS2A 1A72A 1HSTA 1MZVA 1XQVA 2BZ0A 4I46A 1AZTA 4RO0A 2Q6LA 3RIRA 3CWZA 4GMFA 4QVGA 4CMEC 4ESOA 1A5SB 2ODQA 3DHVA 1KU9A 2EKPA 3KTOA 4N41A 1LLFA 1O2DA 1OCOH 1JFFA 2CLDX 2GTHA 1C0EA 1XZBA 2PLWA 1P8AA 2A57A 1V8FA 3CNQS 4PNHA 4QASA 1QV7A 4UHCA 4U7GA 3SYRA 5J43A 1P9RA 3N8KA 2PBFA 4L9WA 3V4PB 2GPTA 2WKRA 3KQPA 1FU4A 4MLPA 1N77A 2MR6A 4DDUA 3K2AA 2O2XA 4IBOA 1YDWA 1EFUA 2YASA 1Z9CA 3IBTA 3KCQA 3W2HA 4AO6A 2ZJ7A 3PE4A 5GZ3A 1KJYA 5C31A 3U7FB 2AUTA 4HPWA 3TTXA 4F6CA 5F33A 3P9CA 2PJDA 1NMEA 2XOXA 3MOGA 3O47A 1BU8A 3F97A 2JLAA 3AKEA 1GN9A 4QRHA 3NWPA 3REQB 4YYEA 4KE8A 1JJ6C 3G0GA 5G0SA 2YWCA 4YLYA 2W2TA 2PXAA 3I4MJ 3PIRA 1XTTA 2JFNA 2FPOA 5L8VA 4MRPA 1RR8C 2X3FA 3KPJA 1G5IA 1GNSA 4CHTA 2ZWIA 5K8TA 2IXAA 3T0GA 4ZJZA 3HJEA 5A9TA 1D2MA 2C04A 2BDTA 1Y1WJ 4WLOA 4KV9A 1BEZA 3ZCXA 3BJAA 2VBYA 3FDIA 2QB5A 2VRCA 5C7IO 2ZUCA 3F5DA 3TTUA 1G63A 3ZJVA 1LSSA 1QRRA 3O8QA 4PC7A 5CVUA 2OORC 1CR1A 1DPGA 1HG1A 4RA6B 4HVLA 2IEYA 2KDZA 3L6CA 4AZ3A 4BAYA 2RAFA 3L2OB 2IV3A 4W8OA 1BR2A 4L3VA 4W4TA 4MA5A 1EKXA 2QU8A 2VDLB 4LOHA 3ORHA 4B3CA 4OQLA 2FMYA 3G1TA 3AJEA 1WZEA 2OGZA 3A1EA 4A0QA 5B3JA 1U11A 2E4ZA 4X1YA 1CJVC 2R68A 2VYVA 2ZZKA 1SD4A 4M3DA 2IPLA 3KB8A 4RW0A 1FP6A 3B1YA 5AHXA 1E20A 1W4RA 4N12A 4AMUA 5ES4B 3CNHA 4XLHA 2LZ0A 4XDYA 5KS2A 1VLQA 4EGFA 2Y0DA 4F7ZA 4WWCA 3CZAA 1RJ9A 4CETA 2CXPA 1KS2A 1U8AA 2B4RO 4U9UA 3UPUA 2QX6A 1RU3A 5T57A 4YUZA 1XDUA 9ATCA 4Q39A 3ZCOA 2CDNA 4BDSA 4O8CA 5EHIA 2JI8A 1SR8A 1DUSA 2BELA 3OLQA 1LK0A 3A11A 2HL6A 4JYBA 2RKWA 5CB4A 4KA4A 3RRZA 3S70A 3VTFA 5M04A 1ST3A 2DMRA 4W1UA 2DY1A 2FPWA 2C58A 2OV7A 2ELJA 2J3KA 1K6JA 2R4QA 3VPAA 4ESVA 2PMKA 1PZNA 1JYFA 4M1QA 3IELA 2O7RA 1HYQA 3KZNA 3RYTC 3ZKWB 3L84A 4QULA 3BK1A 3EETA 2IYYA 4N9WA 1Y6ZA 4BNJA 4EMBA 1KMQA 2EF0A 1GKUB 2VAWA 5CB4B 3EUAA 3HUGB 2EQAA 4HB2A 5CD9A 1E3MA 1Z6PA 5KAFC 4S3MA 3IVMA 1ORHA 4IIXA 3MWEA 4KR0A 3BRWD 1V11A 3M0EA 1UXJA 3AWDA 1T5TA 2QE7D 1ODCA 2PXHA 3A6HA 3ZPXA 4DFDA 2XUZA 3FK7A 1UWKA 2O2IA 3AUYA 3MT0A 1C2TA 2BFDB 2Z16A 2HBZA 1Y6QA 3D1VA 3MWKA 3HBAA 4L72A 4RVNA 2QNBA 2N0SA 4B3XA 2OCGA 3I9LA 1M1UA 5FLXZ 4S1VA 1W7PA 1Z4JA 4O25A 5HQJA 4HSTA 1YS9A 2XVYA 3H1PA 3B6AA 5TLSA 1B3RA 1VCNA 5J2UB 5HRAA 2OV4A 3PDIB 2ZE8A 4G1MB 4GBJA 3O8LA 4HX2A 1D0YA 2C95A 2HH9A 4M22A 3SC2B 3ZMSA 3CNOA 2RB5A 3DKRA 4Z1MD 5KQPA 3L1PA 1ODLA 4AZTA 5J5VA 4QD3A 4X1IA 5KAPA 2QORA 3ZDDA 2Q1YA 1U2DA 1AF7A 1RZUA 4Y15A 4L4RA 1NJFA 4TT3D 2PX2A 3HE3A 3RF7A 2IPQX 3VI4B 2AT1A 4S12A 2VA8A 1W36B 2IXBA 2HNAA 5ELXA 5B1BH 3WBKA 2QSJA 3LVQE 3PA6A 1L4LA 5EIHA 4IOAF 3D6FA 4IRUB 3OQIB 2DYKA 3A9RA 2AJDA 4KWCA 4BE9A 1XPOA 1VBNA 3CJTB 4UTRA 3B1FA 2DHDA 4HLXA 4JH0A 2R96A 1WSWA 5LQJA 2BN4A 3Q3EA 2A5YB 1VE1A 1XWIA 2JDID 5JPCA 2PMDA 5JBNA 2IX9A 3PTAA 4WINA 2GARA 3TIGA 2WIJA 4IZZA 1OBCA 4G67A 3NC4A 5DN9A 5C53B 4D0SA 2DT7B 1KOGA 2Q0SA 3EXFB 4I4IA 2LNDA 3U7HB 2LC2A 1TW3A 3ESAA 2XDYA 1U2GA 1YDEA 2QI9F 1PJCA 3V6LA 1DQSA 1FA9A 3E8SA 5D5WB 1VMEA 3KTDA 4YI5A 4AKSA 2E21A 4EYQA 1T43A 4PFKA 3FTPA 3RWBA 1XWWA 5HZGA 1DV2A 2EL9A 5KVRA 4PYMA 2QKLB 1E3WB 3F8SA 4RKQA 3T34A 4JJ6A 4MIYA 5G4LA 1POWA 3G0CA 4PYRA 1U5AA 2WHEA 3WLMA 1T5HX 4B9EA 3DKVA 3S8EA 1CRPA 1NJGA 1R5BA 3E5UA 4BE1A 3K1MA 3ZBTA 4X65B 1NLZA 5JS1A 2VJPA 3EPPA 4F3CA 4RA6A 1T1SA 2OB2A 4P9UA 2JBAB 2Y2ZA 4DNCA 1CUFA 3I9V6 4IH1A 4B2IA 1BN7A 4IGFA 3FXAA 1DNPA 2YV1A 3LJKA 5M29A 4O1IA 4LV8B 2BVMA 1PWEA 2HFHA 1IYZA 2BFPA 2OO3A 3BCUA 5C5IA 2X2PA 3PRYA 1VL0A 1VBMA 4TV8A 3SYNA 1S4MA 3DUFA 2NTJA 3DBHA 4D3ZA 1MJ9A 1QGED 1UKZA 3Q3CA 1BOAA 1C4KA 3RVRA 1DELA 4JYPA 5KTNA 4QU0A 2UUBB 4LVOA 4IHWA 1A4RA 4OGFA 1IN6A 4EATA 4E5UA 3AFGA 1U9NA 1N3LA 1M0WA 3F6CA 1A50B 3LP6A 2M1XA 3CZ9A 4MPPA 3RREA 2ZIEA 2B20A 2I4OA 5IAEA 5EXEA 1JJIA 1YFHA 2Z57A 3PS9A 4WHMA 3DM5A 3PTLA 4RAYA 5K7ZA 3VFDA 5KUTA 2XSJC 4J0QA 3FTQA 3QPCA 1FDVA 3CONA 4UHFA 4ES6A 3P2YA 3H2ZA 2AXLA 1A2OA 5IT5A 1SCUB 1FQOA 1IDOA 3B5IA 4YRMA 3ADCA 3WWYA 1VL8A 3EZNA 1M34B 1PBNA 3THOA 2YOGA 4Z2YA 3KLMX 2GZRA 3PYLA 4LNHA 1QFYA 5AOBA 4URVR 4J3JA 5IAAA 3EMVA 1DVRA 2EEPA 1DX9A 1GLGA 4NC9A 3QODA 2X8JA 4MZXA 3E6MA 4Y6PA 4RC9A 4PC3A 1OWLA 5M5XJ 3AJDA 4MVJP 3S2IA 1SPXA 1QZZA 1DIAA 4EA7A 5KCMA 1BE1A 1GKIA 2WJYA 3ABRB 4O0MA 2IZOA 3M3YJ 3DBLA 1HE2A 3MKLA 4EEXA 4W9MC 3D6NB 4W5RA 1YFLA 5LUAA 2REXB 5DF1A 3ZXUB 2C1ZA 2GPYA 3KELA 1SFRA 5KTOA 2YVLA 4LE2A 2IYTA 4KR6A 3DZDA 2QD5A 4ZVLA 4CM1A 1K3FA 1BHQ1 4I1UA 1X1DA 1BX1A 1VQ8I 3UW1A 4XPZA 1F4LA 4QT4A 4BNLA 2IEKA 3BB1A 3N07A 5DYWA 3VB2A 3FSJX 4ZJYA 4CEIA 1C81A 4HV6A 4UHJA 1AK9A 1UL1X 2IU4A 3K4NA 3AESB 3DD1A 5AHOA 4IO9F 3A9WA 2AX3A 4OHRA 1AQUA 3KZYA 1AXEA 1PJSA 5HBRA 3PZRA 2VDJA 4MW0A 4YRQA 5JHGB 4ARIA 3V1LA 3BJOA 5ADVA