1P2FA

Crystal structure analysis of response regulator drrb, a thermotoga maritima ompr/phob homolog
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
MMWKIAVVDDDKNILKKVSEKLQQLGRVKTFLTGEDFLNDEEAFHVVVLDVMLPDYSGYEICRMIKETRPETWVILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFLEREKKGLYDFGDLKIDATGFTVFLKGKRIHLPKKEFEILLFLAENAGKVVTREKLLETFWEDPVSPRVVDTVIKRIRKAIEDDPNRPRYIKTIWGVGYMFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response Regulator
publication title Structural analysis of the domain interface in DrrB, a response regulator of the OmpR/PhoB subfamily
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 69
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p2fA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p2fA01
1PDNC 4E70A 5HOOA 1NXOA 2F2EA 2BBYA 1BC8C 4Q6WA 3BP8A 3M9AA 1K6OA 1G3SA 1G6NA 1YS7A 3CG4A 1YVUA 4GNRA 3T8YA 3O1IC 4ASNA 4JOQA 1FSEA 1MAVA 4OOIA 1F4KA 1Z91A 1ZGJA 4Q7EA 3VNBA 5HLIA 1OPCA 4PGGA 4PE5B 2RVCA 2NT4A 5D2CA 4RZSA 5JS2A 2EA2A 4GCVA 4Z4HA 3V7RA 3EGCA 2VODA 2YX4A 5LEKA 4YFKF 3OQNA 3DV8A 2EV6A 3GBPA 4JP1A 2XUBA 3IP9A 1XWWA 2IJLA 1XGMA 4GXOA 1D5VA 4YRZA 4L9JA 3T95A 1WSUA 2OBPA 2HZTA 3KZZA 1TJYA 3N0WA 3KHTA 2MLGA 2STTA 1D1QA 4Y9TA 1ISRA 2JRLA 5FFXA 2HYFA 2ISZA 5IT9K 1WRJA 1SD4A 4AIJA 3QLVC 1BVHA 1TLFA 1BI2A 1D3YA 5E1ZB 3IP6A 1ON2A 3KCCA 1LEAA 2A3SA 3ZN1A 3DQVC 4XSXF 4RY8A 2PQ8A 2VUHB 1ISSA 5HS8A 2P5VA 3KEOA 4OIPF 4DNCA 1LBHA 2XIGA 3KLNA 4RXMA 1O57A 3HUGA 3U9GA 4YCSA 2ZKZA 5DDGA 3WGGA 4M73A 3RKWA 2FKAA 3EODA 2XAFA 1BN5A 2ZNYA 3S2WA 5D4SA 1E2XA 1UB9A 4LK1F 4ML3A 5HDNA 2BE5F 1USGA 2FMHA 2JVKA 2XAGA 3CUQB 4HX7A 4ZYEA 2PI0A 4F7ZA 3GYBA 3ZP5A 2A9RA 5IT3A 4Z9BA 1ZN2A 2LF8A 4RB0A 4U88A 6ABPA 2GXGA 4JB0A 1AB6A 3SG0A 3BOQA 2F8TA 3EAFA 3GFJA 2HKOA 2W84A 3NNNA 2QYOA 2O3FA 1HEYA 3H5VA 5BRAA 1IW7F 2BGCA 5EWJB 1BDIA 2MBFA 2VBZA 1P6RA 3TB6A 4MR7B 3W6KB 5D8KB 1W7PB 2ZO4A 5DCLA 2O03A 1DZ3A 1ONVA 5DCMA 2E4UA 1KRXA 3BROA 2HQOA 3LAJA 3QLUC 2YHBA 3HOTA 2E4YA 3LKVA 2IW5A 4OU0A 2R47A 3F6VA 5CVUA 1ZG5A 4M72A 3LUCA 3RIRA 1NTRA 4BXUA 2WY2D 3F6CA 5CVIA 1Z7UA 3QOPA 1J75A 1PEAA 5K5RA 2QBYA 3K0LA 1TW2A 5ED4A 3OMXA 4N0QA 3GL9A 3HIFA 1EHCA 3SXYA 3LWFA 2ETHA 4IRXA 4JBAA 3HO1A 2L17A 3TKYA 5TE9A 5E3JA 4CO8A 5FWXA 3UKJA 2WB4A 1XGNA 2P4WA 2UXXA 2JCGA 4W5TA 5TPWB 4KICA 7ABPA 3ZMTA 4HV6A 2ADUA 5AONA 4HNQA 4RGUA 3HXMA 3OLXA 4WUTA 1W25A 4EM0B 4RWEA 3QU3A 2D1VA 5ERIA 4IGAA 3RVKA 5IUJC 1JBEA 4GPAA 4Z2YA 1FQWA 2YR2A 1Z17A 2QZ8A 5DYMA 2HQBA 2X7XA 4L0ZB 2VK2A 1U5TC 1SXHA 1B6AA 2KIFA 2IDMA 5DD4A 2FU4A 3SY8A 4LX8A 2F5EA 4RGRA 3TDZC 4O5AA 4QWQA 2OD5A 2M1ZA 1ZAYA 5IEJA 5IUNC 2VE9A 3NBMA 5FBKA 3BJAA 1GLGA 4L0YB 3HSEA 3I09A 4LK0F 5JHUA 2JZYA 3G3ZA 2ZBKA 4OBBA 2H6BA 1F4VA 2Z3YA 1OMIA 3GWZA 1EWTA 1B59A 1VRVA 1R22A 2X0LA 3ERED 5E17F 3CO7C 3LUAA 1V4RA 3I59A 2JPCA 4EVRA 5CNJA 3HHHA 2FF4A 3BJ6A 2YSRA 3B73A 2VT3A 1PP7U 3QELB 1ZRDA 4IHTA 5J6XA 3P9IA 3MMNA 1KQ0A 3JSPA 3W9SA 1Z05A 1YLFA 1Z15A 4CYDA 1W9HA 3ILYA 1UFMA 1YS6A 4RAZA 3WTUC 3LUFA 4M6XA 3OLWA 1D2AA 3CG0A 3FMVA 3GYHX 3CUOA 5JNRA 2ID7A 3RVMA 2P5LC 1FP2A 1IAWA 1WETA 4IRIA 4JQFA 3FZVA 2A9OA 4G0XA 3HEBA 1MD0A 1QGPA 4L5IA 3TDUC 3I4PA 1AB5A 1J56A 2FQ3A 3ISPA 2K7LA 2FBIA 3HS3A 2CYYA 2VUIB 3O75A 3F6PA 3H1FA 2E4WA 1IN7A 3MQ0A 2LUOA 4MQEA 2V6CA 2VONA 3UUGA 1E6MA 4W5NA 1GCGA 3V7SA 1U2WA 3H5TA 4OTZA 3CFYA 2FMIA 1RPJA 2HTJA 1G3TA 2PAFA 2HSGA 3MFKA 3JW4A 5TPZA 1YIOA 5JVTA 4S05A 5ICFA 3AAFA 4XSZF 1HKQA 4YLEA 1SXGA 3RJPA 4RDCA 1FWZA 1U78A 5KC9A 5HLHA 4EJWA 3DP7A 3PQJA 5ILUA 2LDUA 1GXPA 3E5XA 2E7WA 2O8XA 2DU9A 2A9QA 2L19A 3O2JA 4RKRA 2HPHA 1HXDA 2LNBA 2J48A 2HQNA 1TQPA 3OV8A 2NUBA 4WT7A 2L3DA 3ZPLA 4LLLA 3O2SB 1LDKB 2J5OA 1D8KA 4G86A 3WTSC 4OMYA 5CNKA 1XMKA 2MYTA 2DT5A 3F21A 2JVJA 4D6XA 4KNYA 4GYGA 2E1CA 2FMYA 1R5HA 1HBXG 2YPRA 4ON0A 4H3HB 4MR8B 3FXUA 3BPVA 1SD7A 3WU1B 2QM3A 1YK0A 1PUXA 3GBVA 1UDRA 3L9FA 2A61A 3JVIA 3HZHA 2FNPA 1PNRA 1O3QA 1LQ1A 2IA0A 5BPDA 2XROA 4HX8A 2PL9A 4TLMB 4Z4EA 3HUTA 2A68F 1QNLA 2ZJ2A 4MLDA 1KQ8A 4G9YA 4RS8A 1P2FA 3QX8A 3V4GA 1SFUA 1LDJA 4RK5A 3LQRA 3HRSA 2K4BA 4G0QA 4HZFA 4H3KB 4A12A 2COMA 4OIOF 4NCBA 2D45A 2QW1A 3MWMA 4D0PA 1PUEE 2EB7A 4N9HA 1IF1A 5TQ2B 1APBA 2QVCA 1O7LA 3TGNA 1MGTA 5FD5A 1QQAA 4MR9B 4TN5A 3C3MA 4KIBA 1U5TB 2CD7A 4ZYLA 4DN6A 1G3YA 4I0BA 3EETA 1Z9CA 4LG0B 4Z0NA 1H9CA 1YK1A 3K1NA 5EWMA 1DUXC 1QO0A 1S29A 1YTYA 3KKEA 4XFKA 3O74A 1T6SA 3BDDA 2FXAA 3IC7A 3LUJA 3I5UA 4LB5A 3IWFA 2BGGA 1DRJA 3F8CA 4HA8A 2QUFA 2PMUA 1L5ZA 2EWNA 4Q6BA 4LGWA 3P7NA 4FX0A 3LA7A 2PBIA 4KT5C 2PLYA 1XN7A 2Q8KA 2EJRA 5DGCA 3E6MA 4EGZA 1LK0A 1ZGGA 4EJUA 5F64A 4UHJA 2QVOA 1IXCA 1ON1A 2IYNA 1KU7A 2P8TA 3BRSA 3HDGA 2E1NA 1FYLA 2IP2A 5HSGA 2V1DA 1LVAA 4HQMA 1XGSA 4KZKA 5ABPA 2PUEA 1R1UA 1KU2A 2M45A 3GO5A 2JRTA 3FXQA 2V9VA 3DKWA 3R0AA 1SXIA 3BJOA 1Z2DA 5KQGA 4KIGA 3G73A 2VOOA 3CLKA 1F1ZA 1ZHFA 2HGCA 2ELHA 4LLNA 9ABPA 3MEXA 2FQXA 3GLXA 3DBIA 3JY6A 1W4MA 2F5CA 2CWEA 2KKOA 4N0BA 1MDMB 1C4WA 4YO7A 4NB5A 5LHGA 1KGSA 3IHUA 2NNYA 1FBQA 4YWHA 5K5QA 4WXDA 4QICA 1BA2A 1MZBA 1I6XA 1I1GA 4EM2A 1TW3A 1T34A 1X3UA 4KDPA 4ETNA 4F06A 1YTUA 1NATA 2DO7A 4IVNA 5HS7A 1BAPA 4HQEA 2JSCA 4A5NA 3O6BB 1M2EA 1ZDMA 3SHFA 5D5VB 1LNWA 3K1MA 1R00A 2B4AA 2W57A 5L3CA 3EYYA 1TLHB 1DP4A 4KMUX 2KIMA 5CVRA 1YFHA 3R4KA 1KYWA 1C0WA 3WE2A 1ZH4A 2L4AA 3DPLC 3KE2A 5LGTA 2DAOA 3OLZA 4LZLA 1KU9A 2QQAA 3IDOA 3IL2A 4E7OA 5H6RA 4BHBA 3C7JA 1HSJA 4HF1A 3BWGA 3ELKA 2TMYA 1J5YA 2RNJA 4JASB 3M8FA 4Q47A 5GOTA 5DCFA 4G94A 4MRMB 3T6KA 3SQNA 1CYEA 3I0TA 2DPDA 1BIBA 3TOBA 1BI0A 1YMVA 2O6GE 1OR7A 4WWCA 1QNTA 4RV5A 3EUHA 1FSHA 2LSOA 3KLOA 3PQKA 1FY7A 2IA2A 2AYZA 5IEBA 2HWVA 2XAHA 4NHJA 3CZCA 5E1WA 5EWLB 1DC7A 3QX9A 4LB6B 4MEYF 4N9IA 3CTAA 2M87A 2V1XA 1E6KA 2G7UA 3O1HB 3HHGA 1J0RA 5EEGA 1JWLA 4WXEA 5CVVA 3C3KA 4PZ0A 2FTKE 4HF0A 4RK6A 1BC7C 4OLBA 1SMTA 3H3UA 5HQJA 3ML6A 3IPCA 2MSWA 3IPAA 1CGPA 1G4DA 3EDPA 1RUNA 1GUBA 1LEBA 5FO5A 4YFXF 1ZLJA 3DPTA 4KUMA 3L2CA 2NRAC 4OINF 1M5UA 3MIZA 1TMYA 4ZH4F 3KETA 2FMFA 4EMSA 4F11A 2RV8A 5TQ0B 2W85A 2D2WA 3SAJA 1IXRC 1HQCA 5B3JA 4RAYA 2OZUA 3BBLA 4OLAA 2WC2A 3JAMK 1DJMA 2CHFA 2EFQA 3L09A 5FB2A 3CNBA 4DADA 2PJUA 1RZRA 2HKXA 4AD9A 3M7GA 3J80Z 3CDHA 1LBIA 1HKSA 3KP3A 3C97A 3CUQA 1XSVA 2EV0A 1B00A 3FFWA 1XSDA 3K4HA 3E5UA 1VKRA 1TTYA 2K02A 2RJOA 3GWGA 2IOYA 3O2PE 2DRIA 3LUHA 1IUYA 1T98A 3P9CA 3URMA 1C0EA 1FFSA 5E8GA 2QU7A 5TPZD 3TMYA 5JNTA 1P8AA 4JA2A 2FSWA 5DV5A 3LQQA 5A2QZ 3RVOA 2PMHA 4AVPA 3H1EA 2RJNA 5EWJA 3J81K 1OXKB 3CRNA 4AIHA 5HVQC 5D6EA 3L7WA 3V8LA 2MYNA 1W7PA 1V3FA 4IILA 4B09A 3I45A 3HTSB 2Y0MA 3LKBA 5K5OA 2GI4A 4FE4A 2E4XA 2CG4A 3Q7TA 4A5MA 2HJ9A 3A0RB 1O3TA 3ROUA 4MGEA 3GFLA 3HSRA 5KQLA 3JPWA 3WE3A 3BREA 3E6BA 2Z99A 5BQ3A 3E6CC 1STZA 4D6YA 4U7DA 3KP4A 4P96A 1RNLA 2OQGA 2WV0A 3DGEC 4WXHA 3RPQA 2XAQA 4M9XA 4MS4B 1TVMA 2Q0OA 3WTZA 4U0VA 1VLZA 3IP5A 1O3SA 3J7AO 2FMLA 4IRHA 3N75A 1HSTA 3T8TA 3N4MA 3C6QA 3D02A 1FBSA 1U6GA 5LGUA 2DQRA 4HAMA 5TPWA 5L3FA 1URPA 3MF4A 3HYIA 6PAXA 1AOYA 2F5FA 5IX8A 3QU6A 1XD7A 2ZAYA 2GAUA 1WQ2A 1BIAA 1DPRA 2PEXA 4UHKA 5ICEA 2FLKA 4JK1X 1O3RA 2OA4A 2UZKA 1Z18A 3O3KA 1K78A 3LA2A 5L3BA 3WU0A 1JE8A 1ZREA 4LFUA 1U2PA 2GA2A 2PUDA 4LDAA 3HCWA 1Z26A 2CW0F 2MYUA 3U1DA 3PFIA 3ILHA 1IN8A 5DD8A 5LEJA 2O61A 3FM3A 2P9HA 3TO7A 1M5TA 2NAZA 1XB4A 4KYWA 4PICA 1FP1D 3O21A 4MNUA 2GXBA 2YX7A 1S8NA 2IPNA 4MS3A 2GQQA 3H6GA 1QO0D 2XKPA 3CU5A 1EH7A 4KK4A 4TV7A 4GYIA 1MKMA 3DLBA 3RH0A 2RQPA 4B8XA 2XVCA 4AIKA 1GHCA 3KSMA 1QP0A 3TO5A 1E6LA 1T0FA 5D5UB 1FOKA 1XDSA 5JNSA 2W25A 3EQ2A 4MLCA 1B9NA 3K9CA 1KU3A 3QELA 4EVSA 1Q1HA 3QP5A 2RGYA 1ZHHA 4F8JA 4XASA 3ECOA 1MJ9A 2RDMA 4LE2A 3DF8A 1RI7A 3IKVA 3GFMA 3QEKA 1KQ9A 3F8BA 2FSPA 4BYYA 2OU2A 3LSTA 4M74A 4OIQF 2L18A 1OYIA 3JTEA 2WMYA 3QLVA 1HW5A 2QQBA 3I42A 4G0OA 1ZVVA 5CVJA 1RZ4A 5JS1A 1ZITA 5KVRA 4WX9A 2RDPA 4UHTA 4KVFA 2M5WA 3CO6C 6CHYA 4EUKA 4L9TA 1LDDA 3N97A 2JK1A 1ZLKA 2H09A 2ZXJA 4XLPF 2L2QA 2PE5A 4HLYA 2ACJA 2DW4A 2NYXA 5HDKA 2FQYA 5FWYB 1Z2EA 1WI9A 2O20A 4NQWA 4N76A 2P7VB 3I64A 3F3XA 1T2KA 2KIUA 2WTEA 2HYGD 1JHFA 1H9GA 2R25B 3Q5FA 1MJBA 4I7HA 1FBUA 3H92A 5KC8A 2EA4A 1NHAA 4EJOA 5L3GA 1LJUA 2B1JA 2P5KA 5KQMA 4FHTA 3FGZA 1EFAA 3L6UA 3OM0A 1H9TA 5D5XB 2MA3A 1NY5A 1USTA 3WGHA 3IRRA 2FXIA 1Z13A 3RVQA 1OYYA 2CSOA 4ZYHA 4CZZA 4JAVC 5DUIA 5H6QA 4YG2F 1ZH2A 5ILVA 3HUUA 4RY0A 3D0SA 1DBQA 1IRGA 4I98B 5IBQA 3CS3A 1XHEA 2CQKA 3MM4A 2IA1A 4FT8A 1L3LA 1BOAA 4CDGA 4RK4A 2YHAA 3F22A 3JS5A 3QLUA 4EGYA 3I54A 4LMYA 1IRFA 2KYRA 4YR7A 3ABUA 2OENG 4EM1A 2FRHA 5D8LB 2HR3A 3E6DA 4LDZA 5FD6A 4EVIA 4MR8A 3VODA 1ZGAA 3DFGA 2H27A 3IWZA 1MB3A 1IXSB 3W6JB 3WTTC 3A10A 3GEZA 3T5XA 3E3VA 3KP2A 1GCAA 2I6FA 4GO1A 5TRDA 1F5TA 2IRFG 4A0ZA 1CF7A 3G1WA 3Q15C 4YGXB 8ABPA 3EQLF 3WTYC 3WTVC 1UHMA 2Q2EA 2CGPA 2RGVA 1R58A 5JNWA 2ZFWA 3HM9A 2QLZA 2H94A 4XXHA 4N41A 5KI6A 3H3ZA 3LUKA 3BY6A 3Q9SA 4S04A 4M9SA 1CHNA 4BHCA 1RUOA 2AYXA 4LRQA 3NEUA 1J9IA 3UK0A 4KMFA 4IPAA 1L5YA 5TQ2A 3HOSA 2IT0A 4RB1A 1JGSA 4EYGA 4EV0A 2PL1A 3RVPA 2M98A 4ETSA 3E5QA 5FGMA 2R7DA 4MR9A 3EDCA 2EV5A 2Y48A 2IPMA 3I58A 1U5TA 5JR3A 2V1UA 1LJLA 2HTSA 4LG0A 3RVRA 4IJAA 1ZY2A 1G3WA 1RZRD 1A04A 1JHZA 2ID9A 3LOPA 2P7CB 1OXBB 4HBLA 1ZESA 1AWCA 2MSKA 3M8EA 5D6FA 3COAC 4XARA 3HJFA 3IKTA 1JFSA 3N6VA 3LUGA 1FNNA 3U2RA 3JPYA 3E3MA 4O1IA 3BZ6A 4CBVA 4EGSA 3Q7RA 1KYZA 3DEUA 5CNMA 5C5CA 4CICA 1RXIA 4MPTA 5DEQA 4E7PA 2QR3A 3ZMSA 4RXUA 4KPYA 4EYOA 2A9PA 4P1ZA 1W7PD 1XHFA 1S7AA 4LJZF 2WWVD 1IIBA 1YG2A 2ZMEA 4EYKA 1BM9A 3HSFA 5IT9Z 3GZ5A 3O1JC 3KP7A 1I3CA 5BS6A 4BHPA 1XCBA 4I01A 3JAMZ 2XHKA 1U04A 1FYMA 1Z16A 4UVBA 1EH6A 3TO6A 4G0ZA 3SZPA 4MQFB 3KP6A 1DCFA 1MDMA 4O3MA 5BQTA 3WGIA 3RYPA 1XGOA 4HV5A 1YMUA 2GX6A 3TQNA 4WF2A 4O6JA 3EJWA 3QAHA 1U3EM 4HF2A 1J2XA 2IPQX 5CNIA 2FNAA 2FW0A 1ZG3A 3P9YA 2FA5A 5DKFA 3JSOA 3CLOA 5HLGA 4HDUA 3S99A 4I0AA 2CFXA 2VXZA 4L9NA 4MS1B 2JBAA 3RVLA 2D1HA 2L01A 2XRNA 3HRMA 3F8NA 3GT7A 1JHHA 1JDPA 3OQMA 1D8JA 4RK7A 4NICA 4WXCA 4YFNF 2A5YB 3L49A 4KQCA 2MH2A 3N8IA 4UVCA 3QEMB 3QLTA 3QK7A 3IRQA 2DQLA 1Z25A 4LD5A 4KMRA 3ABTA 4EYQA 1QBJA 5FLXK 1JLKA 1SRRA 2FQWA 1I1SA 1UCRA 2C6YA 1F51E 5D4RA 5T3YA 1Y0UA 3LUDA 2IPLA 4W5RA 4MTDA 3WG9A 3T0YA 2NS0A 5TQJA 1XDUA 1YQAA 4WCGA 1P6UA 4KN4X 3GF2A 5JNVA 4G7HF 3RVSA 3DZDA 5F1RA 4ZJPA 3SNKA 2GIVA 2UWMA 2PN6A 4MGRA 3RQIA 5KQPA 3M1EA 4R1HA 5BR1A 4P9UA 3OLVA 3F6OA 3RPUA 2Z9OA 4YIFA 2V79A 3DXJF 1ZH5A 4D74A 4HYEA 2HFHA 2VBXA 3ZMZA 3HDVA 3M9WA 3D8UA 3H75A 2EFPA 2PFBA 3ZQ7A 5FFZA 2AXLA 4KN7X 3CJNA 1S6LA 1HW2A 5EWLA 4G0MA 1R1VA 3WTWC 4O1HA 3T38A 1YW9A 2XDYA 2QZJA 3BRQA 1K79A 2PUCA 2DI3A 1FYKA 2PG4A 3ULQB 4F12A 2QQ9A 4F3TA 2MD5A 1MJAA 3GUDA 3ROFA 4OIRF 2NNNA 4U0YA 3I5AA 1KA8A 2RN7A 3KCNA 2QV0A 2V0NA 2P6TA 4YV7A 3FM5A 4IMIB 3DLHA 4LE1A 4QYMA 3FFXA 5AIQA 3VB2A 5T7BA 4RS3A 1BDHA 3HV2A 3GXOA 5HS9A 2L02A 2P6SA 1K7AA 4Z4FA 5LLQA 3HRTA 4RY9A 1QP4A 4Q5SF 1IN5A 3GZ6A 3F7NA 1JYEA 3T1BA 3WODF 5TQ0A 4ZMRA 3BILA 1R5GA 2L4MA 5LRRA 1T39A 2H0AA 2QVGA 1NXPA 3TX6A 3MA0A 2G7HA 4ZMSA 4XRFA 2E4VA 3EQZA 4WWHA 5IC5A 4TMYA 1MB0A 1ABEA 2EK5A 3CHYA 4HNRA 1PHRA 1EWVA 1SFXA 2WRZA 2PUGA 4IF4A 3OO1A 1DC8A 4RU1A 1R36A 3SZTA 3V7CA 4KREA 3LTEA 3NQOA 3KP5A 1DRKA 5KWSA 2QXYA 2W24A 2NZUG 4DQDA 2OZ6A 4PGHA 2JB9A 2FEKA 4A0YA 1J59A 3OMWA 2EFNA 4G6DA 4MTEA 2R7FA 2EFWA 3KYJB 5DUKA 5IULC 2NT3A 5I4CA 2YU3A 1QMPA 1RXEA 2WJWA 1S3JA 1JF8A 2MSLA 1P6QA 5CJ9A 4M6YA 4U7BA 4Y17A 4BNCA 3FFTA 5DLEA 1DBWA 3FMRA 5E8IA 1YW7A 3KZYA 4RB3C 4MAAA 4OG2A 3A3KA 3LFTA 2FN9A 3HTUA 4EQQA 3TD9A 4CHUA 1YW8A 4UVAA 4EY3A 2QWWA 2GZWA 1MVOA 4ZPJA 3LAPA 1B9MA 2DBBA 5E20A 4ZYDA 3TO9A 4LE0A 4MR7A 4KFCA 2QENA 1BDJA 4M71A 3B2NA 1W5SA 2FLWA 4RKQA 1ZYRF 4WZZA 4MS4A 2VYCA 4L4UA 3WTXC 3O2QB 5L3DA 1P4WA 2N9UA 4KIFA 4YP9A 1S7OA 1P4XA 3CZ5A 2F8SA 3MZHA 3K2ZA 3SFZA 1DCMA 4RGSA 1IN4A 5CLSA 4YS6A 3QPTA 2E4ZA 4HNSA 3DGFC 2OAZA 2DPUA 2F5DA 1FZPB 1FPQA 4PEVA 5ICGA 3GV0A 4Z99A 2FOKA 4UV8A 1A2OA 4G7ZF 3H5WA 2LF7A 2CWDA 1DDNA 1P92A 3GX4X 1D1PA 4IXAA 4L18B 2GA1A 2FVYA 2FEPA 2MH9A 3LFKA 3N0RA 1VPWA 2M30A 2XKOA 4HLXA 2R4QA 3CTPA 2XV4S 1EWKA 2BYVE 2HS5A 3E97A 4Q4ZF 1IZ1A 2ZNZA 4I09A 4KA4A 1DG9A 2IVMA 2R48A 2ISYA 1GUDA 1A0OA 3L00A 1B4AA 1IN6A 4OATA 2Z5UA 4ESFA 1FX7A 3GFIA 1W5TA 4P5OA 3D5LA 5DCMB 2PMCA 3KJXA 3R60A 5BMZA 1QZYA 1NXSA 3OO0A 4G0YA 1CEYA 1Z6RA 1ZGZA 3HRUA 1JL3A 3C1DA 3QP6A 3K1PA 1JH9A 2ESHA 1U2QA 4N03A 5BPIA 1QKKA 2QBYB 2G9WA 4Z4GA 4AWXB 1FLIA 3H5IA 5BOXA 4MEXF 5LHIA 3ZN0A 4FE7A 2XAJA 1SMYF 2E7XA 3KEQA 4RGXA 1FFGA 4O5VA 3KYIB 5FWXB 2J5PA 4FX4A 1PEYA 1K78B 1M2FA 4PYRA 1E2BA 4H60A 2UXNA 3FF5A 4Y15A 1NXXA 1BI1A 1DCKA 2VOPA 1TNSA 2VN2A 4KRFA 3GVAA 4A0XA 4HOBA 5E1XA 5CYVA 3VNAA 1VTNC 3I71A 4PZJA 4EVQA 1GXQA 3HSYA 4A2UA 2PUFA 2TDXA 3V8JA 1YO5C 4MS3B 2P4UA 5FWYA 1ABFA 4NV3A 1GVJA 4QLCU 4W5OA 3ROTA 3OQOA 3J80K 3KTOA 2DLLA 2A69F 3LMKA 3H6HA 1B1BA 1UHWA 2R3SA 3GA5A 2PLNA 2OQRA 4BH9A 3GRCA 1JDNA 4RK0A 1BBYA 3QRFF 1XMAA 3MQ4A 4L5JA 4ZZLA 1EAYA 4I02A 5CHYA 3G85A 2GKGA 1PP8F 3H1GA 4P9FA 4ETMA 3ZMUA 2H3HA 3R61A 3NNSA 5A2QK 4XLNF 1QPMA 1REPC 1FT9A 1R8JA 3I59B 4R79A 3C18A 1JFTA 2DFIA 3KG2A 4KK3A 5AIPA 2PUBA 5LBQA 1Y1LA 3OOPA 5HDGA 2VE8A 4IRGA 5JNUA 4P55A 3GW2A 4ENJA 3KS9A 1QZZA 5E18F 1KRWA 1WKMA 3RTRA 5LHHA 2FE3A 5IUKC 3OLYA 1YYVA 4N0PA 2X4HA 1R1TA 5D5WB 1P4AA 1ULYA 4QPJC 3F72A 4G97A 2A07F 3N0XA 3C3WA 5J8FA 1NXWA 2FEZA 3FMSA 1Z12A 2IPAB 5BRJA 1O7FA 2RKHA 1JXSA 4NQRA 2BEOA 5PNTA 2CO5A 4LLGF 5FBHA 2Q5CA 3ZMVA 4ETIA 4P98A 3RDIA 5FLXZ 5F6FA 5ICCA 3F23A 4JB2A 1FFWA 4RK1A 2VC0A 2PUAA 1H0MA 3ECHA 1EH8A 5HKOA 4EJTA 1D5WA 4PCQA 4MQEB 4U0WA 1DBPA 3M9XA 4PDKA 4Q48A 4G0PA 4ENNA 1OYWA 1K66A 3QPHA 5K1YA 3OM1A 1USKA 2WWYA 1NXTA 4CGZA 3RVNA 5DTEA 2HEOA 2KRFA 1USSA 1QPZA 2LBPA 3HVRA 1I5ZA 2M8EA 1SAXA 1LJ9A 1SD5A 3RKYA 4OMZA 2MC3A 2K86A 2HDCA 1SFEA 4ZYGA 3F8FA 1ZARA 1TNTA 3REOA 2LPMA 2XGXA 2VC1A 3A0UA 1T38A 1XSXA 2GBPA 3RI4A 1U0SY 2Z33A 5J8CA 3EYIA 3FDFA 2QSJA 4MHGA 4RXTA 2K4JA 4M9ZA 3R6SA 1CF7B 1DP7P 2DK8A 2ESNA 4R8HA 1FC3A 2A6EF 2ZCWA 3NHMA 4EJVA 2O0YA 1TQIA 4WXMA 4N47A 3I53A 3EULA 3MAJA 2KJCA 4UXNA 3K9TA 1E17A 5JI6A 2EFOA 3F73A 2ZWMA 2M1BA 3FX3A 5C5EA 1U8TA 5KK1A 3NNDA 3P9KA 4MQFA 1Z1DA 4HX4A 3FXRA 2VBYA 3MYYA 3H5OA 3FHZA 4XBFA 3MZYA 4K2EA 2RC4A 4Z4CA 1ODDA 5B3JC 1TQMA 4GGGA 1MIHA 1ZRCA 3F8MA 1K68A 4L85A 4MS1A 3IP7A 1R23A 1TBXA 4BAYA 2FMKA 2K27A 1U8RA 2JPBA 3CUQC 3KFWX 5EEHA 2IKSA 4ESJA 4UV9A 2BV6A 4I2OA 4MYRA 4TLLB 1QQBA 2MYPA 3QEMA 4UUVA 4ENKA 2FN8A 3N53A 4DQ2A 5EWMB 2DTRA 4H0EA 1JX6A 5LRSA 4ZZDA 2MLKA 1SD6A 5TJJA 3VOEA 2LIVA 5L3EA 2VT2A 3MCZA 3CKMA 4KV7A 3VEPA 2W42A 4UNOA 3RKXA 3VFZA 4BQAA 3Q41A 2JVIA 3J81Z 1J7KA 2ZMEB 1I27A 1F9NA 1DPUA 4XAQA 2B0LA 4Z9AA 1PNTA 1HW1A 4RSMA 2Y75A 4ENMA 2CHEA 1WWXA 3H5LA 5GQSA 2FBHA 2JTVA 2HOEA 3BPXA 1R7JA 4KQ9A 4HDVA 5LGNA 2JT1A 3JTGA 4ESBA 4IHSA 4RB2C 4NCAA 1BJAA 2STWA 1ZG1A 3Q7SA 2LKPA 2PJPA 4FB4A 1BI3A 3T8RA 5ILSA 1QP7A 4MQVA 1HKTA 3JTHA 2PKXA 4MRMA 3HK2A 2FBKA 4MQ9F 3SM9A 5HM6A 1NXVA 3LA3A 5JFRA 2JBAB 3ZMDA 2DK5A 3K69A 2HQRA 2XASA 1EV7A 3E61A 3NHZA 2VBWA 1XCVA 3TOAA 1L0OC 4G8XA 1ZRFA 2FEWB 4HW0A 2GWRA 3RVJA 3Q9VA 4XLTA 4A6EA 2H6CA 2L54A 4QYWA 4CXFA 3R0JA 4WK8F 1USIA 1OKRA 4L9VA 1QQIA 4Y13A 3JVDA 1JYFA 2AS5F 3FMQA 3FWEA 1TM2A 1Z6TA 4A6DA 2A6HF 1JFVA 4Z4IA 4G6QA 3M6MD 4IMJB 2KJBA 3V8KA 4M88A 2WJAA 4YIIA 1D4ZA 4G7OF 5H20A 2NZVG 1FSPA 3NRVA 3B02A 4W5QA 1ZAOA 3RYRA 1RIOH 2LP4Y 1LB2A 1KMIY
chains in the Genus database with same CATH superfamily
4B0PA 2I8LA 1TU3A 1EDBA 4PSUA 3CLUD 3T3DA 1FSEA 2R2AA 1MAVA 3O91A 4MV1A 5F1OA 1TZ2A 2K2WA 4XN0A 4MO7A 3LA6A 4ZJYA 4EJ0A 3OYNA 2C57A 5AMXA 3GUHA 4DQ0A 2RVCA 1IDYA 2B4TO 4HAWA 2IIVA 1LPPA 3NJ8A 4YRZA 3DMFA 5IH7A 1N2XA 4JI8B 1WRJA 2QLMA 5CK5A 4IFIA 3B8HA 2ODAA 1G8PA 1Z7GA 1OBVA 3BSSA 3KEOA 4DB4A 1K8ZB 1PT7A 2Z1NA 3GHYA 4IH4A 1OLTA 2ZKZA 1V6SA 4M9RA 2XAFA 4XPZA 4IGIA 1LRJA 3UY4A 1JG1A 2XT6A 3RYHA 4A6XA 4C3HJ 1FFEA 2H92A 4KMMA 1ZCAA 2PI0A 3CRW1 5IBPA 5EMJA 1YL5A 3KOXA 1MC5A 2QMHA 5AESA 4R5HA 4Q9AA 3SG0A 3LSMA 4V02A 4ZVTA 3TSAA 4FZ3A 3HGMA 4DS3A 4XVCA 1LBQA 1HEYA 3NBAA 2FOLA 3I37X 3UNGC 5ALHA 4K81B 5TF4A 4QDZA 4DCVA 4K6HA 3NVDA 3LMMA 1LDYA 4MIYA 5DCLA 1LFAA 5C4XJ 1CPYA 3QXCA 4FCTA 1CRLA 1R18A 1ZD4A 5DYTA 3VSKA 3MAGA 2K9QA 5HS4A 4KR6A 1UC9A 5MN6A 2WG1A 5FA6A 1ULHA 2HV8A 4JBAA 3FXKA 5E3JA 1D6MA 3PSHA 1ZONA 4W5TA 4JELA 4UATA 1HDCA 1Y3AA 1LJ8A 1YZVA 4CRWB 1LVKA 4BO5A 4OFZA 1VYHA 3OJLA 4WUTA 4UZEA 3T7TA 2ZLBA 2OD9A 4ARSA 4GPAA 4G8DA 1QNFA 4GI3A 1L7EA 1GEGA 4QNMA 3S1NJ 2VK2A 3SYTA 1UC4B 1MIJA 1M6WA 1F0KA 3KC2A 1HT0A 4Q3LA 1KDZA 2Q1YA 2XQVA 3MOIA 2FQ4A 5IP7J 2VE9A 5BQOA 4A8JC 3OPYI 4C0SA 3EC7A 3FOWA 5B7NA 2XQIA 1OI4A 4TV8A 3UJHA 4YELA 2YJ4A 4FJ0A 4X1IB 4WEQA 5E17F 3QKRB 5CNJA 3HHHA 4TS1A 4CKBA 1YDEA 3HGTA 1T8YA 3R3VA 2JFPA 4JGIA 3MGAA 4RIHA 3WYDA 3DBHA 4BU1A 4S2UA 4UHHA 4V0LA 1WF3A 5IBCA 3C6MA 4S12A 3KQYA 1KZGB 3EY4A 5IANA 1TIBA 3N07A 2H5EA 2LFBA 3U7GA 3KJZA 4M7RA 4G5GA 1RLOA 4HB2A 3FZVA 5FLKA 3TH5A 3I4PA 3D8RA 1AU7A 1GT0C 5BPFA 2DFEA 4MKHA 3FWPA 3FXOA 4V1CI 2GZRA 5JSFA 1D6SA 1U2WA 3WLLA 2I1WA 3CFYA 1W5BA 1G4HA 1VHQA 1H6BA 1XD2A 4PZEA 4TQGA 4QE3A 3KJFA 2RHOA 2RB5A 1L6IA 2I3DA 3SYRA 4PC7A 4DNXA 3R7FA 3QI2A 2XXBA 3RJPA 1EP3B 3N3BC 2RHJA 5A3SA 1GSOA 3RT9A 1CQIB 2EZIA 1HE8B 1UODA 2HBQA 1DADA 2YS9A 3N8KA 4ZFNA 3TFQA 4LLLA 2HLPA 2J5OA 5K4AA 4FCWA 1R6XA 2H5LA 2NLOA 1EP2B 3AZQA 4KNYA 1V6CA 2E1CA 5J3JA 2IEGA 4H3HB 1MO4A 4E6KG 5CFLA 4ABYA 1BH2A 4YJHA 5F0HA 2VZEA 5TLSA 3JVIA 8GPBA 3CNEA 1ZWLA 1QNLA 1KQ8A 1E2UA 4M3NA 5DZSA 3E9YA 3GJYA 4MUIA 1LDJA 3LQRA 4TT3D 4YJKA 3RCOA 1P1KA 3TE7A 1N9GA 1W4AA 1ZUD1 1OI2A 2GZMA 4OQMA 4NCBA 4TM8A 5A5FA 1VYVA 3U7QB 4R2KA 2FY8A 1V9LA 4URVR 1TC2A 1EVIA 4JHLA 1QQAA 1AKEA 2I66A 1R49A 2JJ7A 1WB6A 4EQ6B 4ZYLA 4A3MJ 5C7LO 1MOZA 3NV7A 4I8XA 3U4CA 4HPWA 5AVSA 4YI5A 3MBIA 1VSBA 2FOWA 2VJPA 3COJA 3CDIA 3K8QA 3U6KA 2Q45A 1ZAKA 3O73A 1T5LA 2MMCA 1QKJA 1UUFA 3AF2A 2VNAA 3DTEA 3T3MB 5ABPA 3IP1A 1W76A 1LF5A 3WK9A 1KU2A 2M45A 3FROA 1JKQC 5M3BA 2G82A 1G5RA 3DBIA 3V55A 1VI2A 1W4MA 1YKFA 2DKOA 1W36B 2IYYA 1ZUNB 5DX8A 4ER5A 2R7MA 4FC6A 1QVAA 1ODSA 1KS2A 4DCUA 4L57A 4ZOLF 5GJCA 3K96A 4QYIB 1YB4A 1GCUA 1X38A 2YIMA 2FPXA 3FPSA 2UAGA 2Y0SN 3S2EA 2C4HA 5D5VB 4NP6A 4ZOBA 3IKLA 3K92A 2BFFA 4KMUX 2WJHA 5JIBA 3HNOA 2JFYA 1BOBA 1MQ9A 3G23A 3PEFA 2QVZX 4XIIA 5A4DA 1B2LA 4G94A 4WOBA 3PLRA 1CYEA 2VDQB 2O6GE 1MIOB 5G53C 3PUZA 3A4YA 5EI5A 2WF9A 1U0FA 1VG9B 2DR3A 1IY0A 1F3OA 3EQ7A 2I0FA 4ANFA 2VBGA 3HHGA 3LHKA 4EF4A 1DKRA 4Z54A 3TR5A 4UBOA 4YJ3B 4RK6A 2B99A 2EX0A 1RAEA 1UPBA 2R00A 1K7XB 5IOYA 5JXHA 1K6IA 1B3RA 2WFAA 1WH7A 3EDPA 4ZWNA 4X93A 1JWAB 3Q9LA 3C7CB 5TQ0B 5JI2E 1HQCA 2F1JA 3NWJA 4WINA 1SRQA 1XQWA 3UBMA 1Z0UA 4BFLA 1MORA 2I34A 1XTAA 3WB0A 4LBVA 1OR8A 5HMMA 1W87A 3VPXA 3L01A 3PDIB 2K02A 4KL8S 5IN5A 4Q5IA 2P9QA 2XQFA 2BZ1A 4BLOA 1YQGA 2JSPA 2R7VA 2IC5A 4L0MA 2ZYVX 5CLHA 1VZ3A 1W93A 3LQQA 1UJ8A 4MP6A 3FHOA 1X0XA 1WD7A 4LN1A 2YN2A 3Q3SA 3OY2A 3PDJA 5IABA 4GOKA 2XCSB 1HE3A 3PX2A 4LF9B 3TRKA 5KNDH 4KTTE 4EGJA 5IOZA 1W85B 3HR7A 3I6MA 5E0OA 3HKBB 4D6YA 1VA4A 3M1CA 4DSAA 3VHQA 1TD1A 3BHMA 2O2IA 4E5NA 2YWRA 1Q20A 4DMCA 4OJMX 2HPIA 3IESA 3D0OA 1R66A 2DQRA 2DOEA 2QJFA 2VKVA 4UDOA 5KINB 1PQPA 1UG2A 1YB1A 1IZZA 2FAXA 2Z9DA 3CC2I 2H3EA 3CLVA 2OA4A 4KO1S 1L4LA 3OFJA 5KOYA 4I6JA 4R05A 3A1DA 4MKZA 3T5BA 4EPRA 1X42A 3FE2A 2FDRA 3RU2A 3KEGA 5J3LA 1U9IA 3AVYA 3DM9B 5LEJA 1IJEA 4DA0A 1JI0A 4J90A 4H18A 4KE6A 3NP9A 1JEAA 2UXCB 4MS3A 4PQEA 2FR0A 2IP4A 3LBFA 4X1IA 4I4TB 3QKRA 4Z53A 4LIPD 1FOKA 2N1MA 5JAQA 2P9TA 3STWA 1B9NA 4UVHA 1K08A 3SHVA 3ECOA 4I55B 4HDMB 4CCNA 1RJ9B 1L7NA 3C41J 5B4VA 2PSDA 3WGOA 3FMGA 1I4TD 5MGNA 2QQBA 3WWEA 4UBKA 2XJ4A 4DOZA 2QL6A 1W19A 2FPUA 5JVDF 5EZHA 2VS1A 2WFLA 3E8SA 3F6RA 2VPQA 2E1MC 3WKDA 5JI3E 3M5CA 2BN4A 4WKBA 4Q4HB 5EJ9A 1TCCA 4N76A 4AKEA 4CHGA 5K03A 2KIUA 2Z08A 2E5LB 2WTEA 2E2WA 2EA4A 4A0HA 3LDHA 2AX4A 3AF5A 4DRYA 1H9TA 3NBYC 3GRYA 4Y7NJ 5IG2A 1CQIA 4UKDA 4JFAA 2CUZA 4QOEA 5EKTA 3V9AA 2FPSA 2O7QA 3DNMA 3PNYA 1WPXA 3OPMA 1F6WA 1EVQA 2AUNA 2E4AA 3BD6A 4ZI7B 4NXNB 1OWLA 2IYAA 3DVQX 4EL5A 3H2BA 4RW0A 4RD3A 2XGDA 4E51A 3A10A 3KP2A 4O0LA 2V7EA 4CCLA 5GONF 3EQLF 4FIDA 4FFLA 1DQNA 3S17J 5ED0A 1NMEA 2J9ZB 4XXHA 2ECPA 3BY6A 1YDGA 4PHFA 2Z5VA 5A0FA 1FB5A 1J22A 2CFSA 3L0YA 3TOVA 1OGJA 3PGKA 2IT0A 3DWFA 2A30A 5DI9A 4DJ5X 2IPMA 4X45A 1XB2A 2JLUA 1CZKA 1CR1A 5IJZA 3V7FA 1P3JA 4XGRA 3JRIA 2PD4A 1HNXB 4PPQA 2IS2A 4RKEA 4NV0A 1G38A 4RMJA 1N6IA 1IHPA 3E3MA 1PN3A 5F73A 4ERNA 2R7LA 3TQOA 3V48A 3WMGA 2HI3A 5AVQA 2ZRGA 1MVNA 4IDAA 4DM7A 1S7AA 1EA7A 4YH1A 2V7XA 1IZ9A 3JD2A 2PAAA 3KJEA 4AIIA 2XHKA 4P5EA 1JSXA 4TTAA 3KP6A 5I7WA 1ZUNA 1MEOA 5K1ZA 1J2XA 2DE0X 3OX1A 2FA5A 3CLOA 4B3AA 2F9MA 1EPUA 2ZEJA 4QYIA 3U81A 4A3CJ 3F3YA 3WHPA 3O8BA 1Q7EA 2JJQA 2WHPA 5IDVA 1R5ID 4GQIA 3ZJ4A 1R0KA 1UCRA 4WQMA 4HMPA 4LPKA 4MTDA 2VUSA 4BIMA 1N2ZA 4GPBA 1J8YF 3BN3A 1I4EB 1OGIA 1FVXA 2DBRA 3AW9A 1EX7A 2X6XA 1CUZA 3L8FA 3OZSA 1QIIA 1PDWA 2XCIA 5HKLA 4QPOA 1T9AA 1MIOA 4D74A 1J8MF 4HYEA 3Q88A 3GJSA 4YWJA 2QRPA 1RYYA 1QQ6A 2AFVA 2ONYA 4TXJA 5H2FC 1GPMA 4F4DA 2DI3A 2W82A 4D4IA 3HEFA 2ZYIA 3GUDA 1MW9X 3V9PA 4YJ3A 3CO5A 2NNNA 1FX0B 1RYBA 2FX0A 3H5NA 1CJBA 4ENSA 4IMIB 3EBLA 4BECA 1VE7A 2QQ8A 2Z6QA 5F2EA 1IH8A 1W5AA 3EW9A 4BLVA 1C3OB 1NF8A 1TRHA 1XU7A 2WAEA 3BJMA 4N6NA 5TQ0A 3M1LA 2XQJA 4CXMA 3ROEA 3TX6A 4FSDA 1Z7BA 4XN3A 4D26A 2HJRA 3GD5A 4OOFA 2WSSA 2OGZA 2G83A 4KTVE 1TZCA 1MMGA 4UNPA 2JN6A 1CERA 4HRYA 3PGA1 4JP5A 5DSXA 1L4GA 2BM8A 5BNTA 2GXSA 2BGWA 1PQYA 1UBSB 3QU2A 1YW7A 2FN9A 2CE7A 3D8TA 3HKBA 2CJWA 1MVOA 3CX6A 1ZCZA 1FRZA 4GM0A 4FQGA 2BMEA 3R7AA 1WB4A 3DR5A 1KK3A 4IRUB 2IE8A 3F9IA 3NC0C 4HGPA 3W4KA 2CBXA 3C7DB 3LV8A 3UYKA 1IHUA 4CVNA 1M1YE 4Y9SA 2VHZA 1KI7A 2WD7B 4FP9A 1N3BA 1FJHA 1IN4A 3N2GB 3NAZA 3LCRA 4XE5A 2UXDB 1A4XA 1MH9A 4KYTA 1V37A 3GBGA 2GKSA 4FOTA 3DTIA 4ZA2A 1QGUB 3AUSA 5A4KA 2R4QA 2QN3A 3LQFA 5I45A 4MW9A 3AXTA 3IRUA 3QNWA 3I2YX 5TJ9A 1LXCA 2HDDA 4HLNA 3MJFA 4Q7JB 1W5TA 3C3BA 4RVOA 4YHBA 1FQKA 2PWYA 2RAEA 3R60A 1XMSA 3OO0A 3DT8A 4I4TA 2C2ZA 1OX4A 3PQ8A 3G2PA 4BX9A 1BG6A 4JLUA 3IAFA 3HJBA 3RC8A 4LQDA 3VYWA 5BQFA 4AYBA 4I55A 4HDMA 1RJ9A 2RGUA 3INYA 2KWIA 2XUFA 2VAPA 1EVLA 4LV5B 1NP3A 3RWMB 3PGMA 2OZEA 1IFXA 1HYEA 4ENUA 4MV5A 4XUDA 3HFRA 1PYGA 4K1XA 4PZJA 3GRZA 1GXQA 2EFEB 3ZQLA 4Q4HA 1GZVA 3TECE 4G63A 3FVTA 2JUCA 4JXJA 4PUSA 1AQYA 4NDAA 4NE7A 1GYRA 5FKLA 5LLTA 3RF7A 4A03A 2FP4B 3S2SA 3TBFA 4I02A 4DCCA 4CKCB 4MJXA 5M5YJ 1RM0A 1XEXB 3FIJA 1O97D 3VZCA 4XKJA 3FA2A 4KG7A 2XMBA 4R79A 1JFTA 3IBTA 4KK3A 1Y48E 3IOMA 1NVVR 3E2MA 4TL7A 1EFKA 2A59A 2OWEA 5HDGA 3K73O 1PBNA 2X0IA 1YA4A 5KJCA 2ZB8A 4BMDA 1R9GA 3I92A 1OXMA 1D03A 2GNOA 4B7UA 4ZI7A 1WKMA 3CPHA 4TTQA 2Z58A 1Q0UA 1IY8A 3ND6A 1YCHA 1U9YA 2I71A 5A1TA 2DT6A 1NXWA 2IPAB 5CLJA 1Z47A 1PKXA 4IL6C 3G8AA 1QE0A 4FLMA 3ZMVA 4ETIA 1WCV1 2CLSA 5TT0A 5J5AA 2IHNA 3EQ6A 4Z51A 5E4JA 1H0MA 1DZIA 2VPPA 1HR0B 1G2OA 4MQEB 2PIAA 3NM4A 4JMPA 1USVA 3ES9A 2HK8A 3FI9A 4G85A 1E7QA 1K66A 3DCIA 3OM1A 1USKA 2VLAA 4Q34A 4IYJA 2TMDA 2W2PA 5EJIA 4BEVA 2BGNA 3TW6A 3W05A 1QPZA 3SCZA 1N6RA 3DCJA 1MJNA 4CA0A 4MARA 1EXNA 2Z98A 2DFHA 2I78A 1OWPA 2H59A 1C2YA 3CGGA 4F5YA 3TZ6A 1ES9A 3IAXA 5ADVA 2AHOA 2VL8A 1HNNA 5JSHA 3LRXA 4NZOA 3VYVA 1TQIA 3I53A 3AHJA 3MAJA 1RW4A 1ETXA 2CCGA 5K05A 4XWWA 3K9TA 1TMKA 1T36B 2WAQA 2CLKB 3NNDA 1Z5WA 2PWAA 3FXRA 3IAEA 3FHZA 2FCRA 2BHRA 3GLVA 1D0YA 1GQYA 2FHSA 1RZUA 1JR6A 4ZCTA 3A3YA 4RVSA 3KYDA 1XVLA 2CNBA 3AY7A 3L8DA 4FEYA 1GLVA 1UMDA 1U8RA 5BUSA 1DXYA 2ZBVA 3UMYA 3JQFC 4R8MA 2JIRA 3DPSA 2DTRA 4DM3A 2W6OA 1C3XA 5F33A 5L3EA 3MCZA 1TC3C 1W47A 5KVAA 3UH1A 1BN6A 4HUQB 4HX9A 3D0KA 1MD9A 2ZMEB 2O7NA 2PSFA 2H0RA 4IZOA 3G9ZA 3AU9A 3H5LA 3P2MA 1OT3A 5CUQA 1IAVA 3S93A 5LGNA 1Y39A 3L7BA 3N3AC 4YLYA 3RUCA 1WVIA 3M34A 5BO5A 3TLGA 1NPTO 1QO7A 5I01A 2FA9A 2JJ8A 1QB7A 4YAOA 2OCLA 1E1QD 4G8XA 5FTKA 1BJRE 2ECFA 1F4LA 1Y8CA 4Q4JB 1WSAA 3I76A 1NDHA 3FWEA 2NU8B 1NVDA 1Z6TA 2IE0A 4Q1VA 2JEZA 5KTOA 1Y6GA 3ZBPA 1W30A 3C1OA 2FGJA 4JBHA 3BR2A 2K5UA 1K6EA 3DTYA 4EHIA 5C3MA 3H36A 2YHIA 2LP4Y 4UTRA 2ENUA 1MHTA 3M9AA 3C3EA 4DLVA 3DFZA 4FKBA 1NUTA 1MR3F 3LP8A 4HUTA 1IY9A 1CQJB 3OTGA 1LX7A 4RTPA 2WJ4A 3AY3A 1QV9A 3EAQA 2AKEA 1Q1VA 4U7FA 1TGYA 2FEXA 4IHJF 4NONA 1G3MA 1MAUA 1BDMA 1GL6A 3OQNA 2YWBA 2QX6A 2H7XA 2ODNA 1WQ3A 3C39A 5C4JJ 1TLFA 4KVGA 1JNXX 2V0GA 5HILA 4ZAVA 4BNXA 4TZ0A 4AS3A 2WD7A 2ZBGA 2GCPA 1J4AA 3N2GA 2EATA 3DEAA 3LIPA 1XAHA 1BZYA 1P74A 3DAHA 3GNQA 4DLRA 3X44A 4LRUA 2FMHA 4NTZA 4YMSA 4DDKA 3VHXA 3TVYA 4ZYEA 1I2MA 2EEZA 1QGUA 2X76A 1W52X 5BRNA 4NEQA 4DMKA 1NNSA 3MWYW 3R40A 1AB6A 3H2IA 3PRJA 3W8DA 5J43A 5BWMA 1LE8B 2Q9BA 5G0TA 5SY4A 3RANA 3T9DA 4REOA 1ZIPA 4B3HA 4UNQA 2A5JA 1N5JA 1YZNA 2CZCA 1L5FA 3DL4A 3L77A 4XB2A 4F7WA 2XVMA 4BOYA 4CLOB 3FF4A 4C1BA 1Z0XA 3LH5A 2XCOA 4AP5A 3STVA 1WXEA 3UT5B 3M4NA 1NTCA 1MRSA 3VYUB 3GEDA 1EHCA 2GSDA 2WQZA 3TR6A 3FJOA 3GRKA 3NTVA 2DFPA 3HXOA 3TKYA 3M0EA 1P7JA 1NL3A 3TR0A 3W8EA 3OEHA 1C4KA 4TUYB 3G49A 1EUYA 1AKHB 4QFMA 3K70B 5LQJA 2BDTA 2GNPA 2YQZA 1DOAA 1KYVA 2J8ZA 3E81A 2Y3IA 3KB6A 2YR2A 2DLNA 1W8DA 3B3QA 4O6VA 2E2IJ 1QS0B 4GXTA 4L0ZB 4H7EA 4AJHA 3OYDA 2WU3A 3JQ9A 5K0JA 3GTKJ 1OFGA 4L5EA 2FP4A 1PK7A 2CF6A 4GGPA 5TXGA 2JCBA 5FV7A 2E1OA 3GTQJ 3MIIA 4CKCA 2Q8NA 1H85A 5GZ3A 4GOLD 3ZEAA 2XRMA 5HKKA 4KR7A 1V8DA 2H6BA 2OO5A 1VSUA 2ETXA 3SMQA 2WABA 7YASA 4DSNA 2NADA 4HR7A 4FK8A 5KSZA 2ZSEA 5JHFA 2JAXA 1UDBA 1Z15A 1TF7A 4RAZA 4BGEA 3R4CA 2XUOA 2YIDA 1PVDA 2VA9A 3OPYB 3WR5A 3KQVA 3ZIAA 2CNKA 1N6OA 3GLFE 4CM3A 3O8HA 1W5CC 2PTGA 1QYIA 2B63J 3K9QO 1XK7A 1OZFA 3EBOA 2FFAA 1F60A 3I2IA 1EZZA 1J6UA 1XQ9A 3UUEA 3LPNA 4MQEA 3K0KA 4G1FA 4BGVA 2O6LA 2FMIA 2G0TA 3F0TA 4D44A 2HSGA 3EA4A 4B3CA 3NTUA 3F5SA 2DWUA 5AP9A 1SXGA 1P2TA 1PDOA 2XY4A 2A9QA 1XCGB 4RKRA 3V80A 2QN1A 4BV3A 5MDHA 3PUYA 2A58A 4V1CB 1EXMA 2W6MA 2A9JA 2QRQA 4OWRB 1XNGA 2FFHA 3RSLA 1Q7RA 4US0R 4URHA 3D5SC 1T3GA 2IX3A 2WM8A 1GNSA 1HE1C 3RG8A 5DSZA 1XO1A 2GFQA 2FMYA 1JEOA 1JFLA 4YCDA 3P9RA 1O5TA 3O4IA 1L3IA 3EMKA 5E95A 5JAMA 3D54D 2E82A 5T4FA 4PIVA 3LG2A 1T36A 3D6UA 2V8BA 2C1XA 2HGSA 4RTOA 4C6SA 2QLFA 3H4IA 4RK5A 1U8EA 1AY0A 5BPHA 4ZCPA 4MDHA 3EDYA 4CIAA 3IMFA 5CLFA 2R00C 4N9HA 4AYXA 2B7LA 2ZJ0A 3KZOA 1APBA 3OYLA 3DOJA 2WD8A 3MJTA 1TM3E 3EETA 2Z5FA 2DFFA 4Z0NA 5EXSA 2Z4TA 4EATA 3U39A 1QO0A 4RHEA 3U7FB 1DJQA 3FD8A 3E4DA 4DFDA 4EA8A 1T6SA 2C3PA 3KT6A 4MVJD 4LB5A 4K0KB 1DRJA 2XMZA 4HUQA 4RHUA 4GI2A 2BGUA 1ZGGA 2XTAA 4A3EJ 2F5VA 3TNDA 2JIBA 4JYPA 2P8TA 5EESA 5EMHA 3OCYA 2RHCA 2V1DA 4IWNA 2V4UA 4KZKA 4F85A 2W2TA 1QQ5A 4BN5A 2VOEA 1CNFA 4NBWA 5AJUA 3ZCOA 2JI7A 3BJOA 4R8LA 4A3FJ 3G73A 2V4MA 1F1ZA 2HGCA 3UMBA 1RETA 2ELHA 3OC6A 3WRYA 4XM3A 2I1VB 4BFVA 1XIVA 4R2LA 5JY1A 3X1MA 1RYZA 4BCBA 2NNYA 5FFMA 3KBBA 3OZIA 2Q1UA 2PRYA 3BK2A 3BXOA 4ETNA 4F06A 2IRWA 2NU8A 1QLHA 4QDUA 3FSEA 5ALNA 1QU2A 3SI7A 3UGTA 3M4YA 2MSEB 1SC4A 3KQUA 2VP9A 2V59A 3LC7O 1KEEA 2NSHA 4A26A 2FQQA 1LTKA 2L4AA 2WIGA 4G5OA 5B1SA 4L15A 1KU9A 2V7QD 1UEJA 2IVFA 3B20A 1P1JA 1S3SA 5ALWA 3QV1A 3WV4A 3M49A 2ZT6A 2AL7A 5CH3A 3U3DA 3OF2A 2ZP1A 4ND5A 1CQJA 1XLTC 3S1AA 1U9IC 2VXCA 5AW3A 4UHCA 3ZCSA 1J5PA 3CUEF 3C5WP 1QZEA 3HJUA 1SZDA 3DULA 2XC7A 2C5SA 2GEJA 1RQ2A 1F8YA 1PBTA 1EKEA 3QU7A 5REQB 1JWLA 3SJMA 5FOXA 4CR7A 2ISCA 4CL0A 3U1TA 3GFPA 1JDSA 3C87A 1SMTA 3DXZA 1IRXA 2I1QA 2VSFA 1HDIA 3MIZA 5C2JB 3MLBA 4LFBB 3S8YA 1JG3A 3C8UA 1D4OA 2GEDA 3EXG1 1T5TA 2PJUA 3W4IA 4E08A 3K31A 5GJBA 4PRYA 2I3ZA 1OI7A 3UAVA 2Z5GA 5JECA 2IYEA 5D7BA 2IOYA 1MDBA 1T0IA 2QD5A 1GGKA 3KR1A 4KXXA 1TGVA 1K4TA 3KOWA 2AO9A 2CVZA 5DV5A 3HA7A 4BS9A 3WAJA 4K9PA 3RVOA 1QC5B 2KZVA 3NDRA 4M6WB 2Q5HA 3WDLA 4L75A 1UJCA 3OAAA 5EKXA 1E5LA 1OX5A 4U02A 4E7KA 1B3BA 3AFNA 3GFLA 1NTOA 3JPWA 4L50A 3SE7A 1Z0IA 4P96A 4TTSA 3UT5A 3V8EA 1VFCA 1YRYE 4L1KA 1BOOA 4IH1A 2DMQA 2PXHA 3DXXA 4KZPA 1LSSA 4EG5A 4H4KC 3F4KA 4ZTUB 3D02A 1P75A 1KBOA 2XT0A 4TUYA 4RJKA 1S1MA 4AAYA 4NOKA 4US1R 5A7HA 3ABQB 2QZZA 4XH9B 2ZAYA 4PJMA 1BQEA 1BIAA 4OUDA 1XCJA 4FEAA 1CUAA 1FDWA 2QA4I 1ILWA 4V2FA 5AVJA 4I1PA 1QS0A 3FZQA 4OPMA 2Y0BA 3RT1A 1Z26A 4PAOA 3AF4A 5FD8A 4MK4A 3ILHA 1IN8A 5DD8A 3HCDA 4HWRA 3BIWA 1Y8RB 5FTMA 2O2CA 2P9ZA 3NAMA 3EMVA 2IPNA 4JR2A 4I0WB 1MAAA 3C3AA 4IDCA 2ZDQA 2R6GA 4ZEVA 3GMEA 1BGWA 5HIJA 1DO8A 4PRZA 1JQKA 2R7WA 1KC3A 1UMBB 2Y31A 4G9GA 5AW1A 1NQ5A 5BQXA 4EJFA 4XASA 3VR2D 1Z3IX 2ZRNA 1AQLA 1RI7A 3F8BA 4JSRA 4D4JA 1R37A 3QVGB 1AMOA 5DB4A 3L6RA 1V1MB 1Z8NA 3K0FB 1D1CA 4CG2A 4UEQA 3JCUC 1RBZA 3ETHA 3R41A 4UNRA 2CDNA 1KJNA 2YJZA 2RGBA 1HQKA 1W36C 4Q7QA 2O52A 2B5VA 4E7SA 3HYTA 3IH4A 4TMZA 2NPFA 1F3LA 1KDTA 1N1MA 4L72A 1AGRA 3OR1C 4MSUA 4C01A 1AV6A 4OXYA 4WXYB 2X1LA 5FEUA 2EG9A 3N8HA 4CZZA 4GMDA 2CMFA 2HN9A 3HUUA 3ZXXA 4XEHA 4FHZA 1SZCA 4V1CA 5BSHA 5IT0A 2I7TA 2YKGA 1J97A 2O8BA 2JC3A 4JJFA 1TF5A 3NVAA 4MA0A 1TK3A 3BG6A 5CT5A 1O6GA 3WIEA 3KTAB 2XEXA 2KYRA 4NFLA 4LDZA 4EVIA 5DM60 4EWLA 2HOSA 3L82B 3SPXA 4OB7A 3FTNA 2IXFA 1XD2B 3ZLBA 1OBOA 4EJ2A 2UUZA 4F3CA 3Q9SA 4M9SA 5BYKA 1XVTA 3NEUA 4WXPA 2IAIA 4EV0A 2JJ1D 5FGMA 4IOJA 1X87A 4IJAA 1SBYA 3F9CA 2MSNA 2B25A 4YUZA 4EOGA 3ACDA 1ZM7A 3SZOA 1UXIA 2FOIA 1HFEL 4X7RA 2VEOA 4YJHB 2HU9A 3Q87B 3OZUA 5BP7A 5JPDA 1WA5A 3KSZO 3LHFA 4XOIA 1DKNA 3PTZA 4ID9A 5M29A 4G0VA 4XWKA 3RSGA 5KNCH 4RY2A 1FXSA 2W0MA 2DBYA 5HRAA 4JXZA 2WWVD 5A7GA 2A1TS 4BHPA 3GNLA 4YNBA 5JAIA 1Z88A 1XYGA 3K2AA 4WBXC 5C4MA 3WGIA 3ND8A 4FPXA 3TQNA 2HTEA 4O6JA 4JBNA 4GKJB 4ZRNA 4OHYA 4NMHA 1CJKC 3HRKA 2VQSA 4GX2A 3L7OA 1T5OA 2A5YB 2Q7OE 4UVCA 2C5EA 3IEIA 1Z25A 4DA8A 4FGSA 1X15A 1X6VA 4EZBA 1XALA 2OFFA 4E1BA 2VSXA 1EU1A 2KDOA 4W5RA 1VRWA 4ZKEA 3H0GJ 5DOZA 1TOAA 1AMNA 4ZJPA 5BSKA 1B23P 2DQZA 3M1EA 1Y9AA 1RQLA 5LDGA 2PZMA 3JD4A 3IV6A 1VCMA 3IAS1 2HFHA 1B6TA 5CW1A 5D1HA 1X3ZB 1HX7A 3AB8A 3PCTA 4O1HA 1NPDA 2IKQA 4DDUA 5REQA 1JXQA 3C8ZA 1SG9A 1WUYA 4HNHA 3NBFA 1SOUA 1IDN1 3I9FA 1YCGA 2BWJA 1NUHA 5JRDS 2YMLA 2PYDA 4P4SB 3VB2A 3CLSC 4MO9A 1K7AA 2ASVA 2SICE 4YGYA 3PHIA 1VQPI 4AJEA 2D3TA 4FR5A 3W4JA 3IUBA 4K87A 3GJ5A 1YBAA 4Q3NA 2Q4TA 4ZMSA 3TWOA 1KKLA 1GTSA 5BSMA 4B0OA 2DPYA 3E5RA 1PHRA 2ID8A 3RNOA 2XMCA 4QO8A 2PKRA 4IJUA 1XJWA 1EWVA 3ZQUA 4LITA 1UZMA 2DWQA 1KYXA 1J70A 4RWZA 4KREA 1AKQA 2M34A 3IE0A 2CHVA 4LUCA 4Q0MA 4P58A 1SCUB 4MCIA 4PNEA 1QC5A 4M6WA 4TWJA 5SY9A 2EX1A 1TKCA 3WYBA 2O8CB 4M6YA 3N05A 4F6LA 4MAAA 3P4UA 3FJ1A 5JD5A 1KHHA 2WKWA 1M3SA 4GKKB 1USUA 1W88B 3K20A 4Q7MB 4M71A 1GPAA 4IWXA 4KQXA 4WZZA 2NUTA 1DG1G 2YZ7A 1ECJA 4TZ6A 2Y0CA 5HG0A 1K4KA 1GHTA 3MJRA 4RDIA 5DTMA 2E4ZA 3U7RA 4HNSA 3FY4A 4PG7A 2X8LA 5CT4A 4LZJA 4ZAGA 3U6BA 2Q99A 1P92A 4LKOA 4IXAA 3BMXA 1VPWA 1GOTA 3MN1A 4QBHA 1EJ9A 1SIOA 3DKKA 2Q0QA 2O57A 1YL7A 1GUAA 4TL9A 3V4PB 3GCZA 1DG9A 1Y8RA 1L8XA 2C29D 3W04A 5KYUB 2X6TA 3GPDG 3ZZMA 3GGOA 2LYCA 1OWNA 3PFNA 4Z9YA 1UMBA 3GQVA 3BC8A 2O0JA 1OTHA 1Q17A 2DUJA 2FJ1A 4YIHA 1DFGA 5JXGA 1FLIA 4TZTA 2EZ9A 3KYIB 3QVGA 1V1MA 2N0SA 3PXBA 3RHSA 3N5KA 3K0FA 3O1LA 3A1NA 2Y1EA 3OOUA 4XIFA 2IBTA 1KFJB 1FP7A 1P1HA 5FI1B 4DM4A 2O6HA 4K9MA 4MS3B 4Q03A 2H1LA 2R7KA 2VP0A 2WKSA 3PSIA 4RPLA 3ZU4A 2J9FB 5GINE 4X1YA 5LBUA 3TOZA 1B1BA 5K0ZA 3VXKA 1JDNA 3GDWA 3LU1A 4JLMA 4W1RA 1OZAA 3ZXYA 1F8GA 3S7TA 2NU6A 1TYCA 2A0FA 1JJ8C 2KPMA 4AUEA 1JFFB 3NNSA 4XLNF 3T7CA 2CLLB 1SUEA 3QBEA 1FT9A 4MQ4A 2WWXA 5C1BA 2ELKA 1M1XB 2NV0A 5EPUA 3V3TA 4MHOA 1DV2A 3CONA 1NRJB 1QG0A 3DPIA 1YQQA 3KTAA 2J0SA 2WFLB 4E1AA 5IKMA 1S72I 1UOEA 1VPLA 1VL1A 2PSJA 5CMLA 2XCUA 1SIWA 3X2SA 5J58A 2FX5A 2A07F 1OVMA 3PUIA 5IM5A 1JZTA 3HOZJ 3L6CA 4XSGA 4XDZA 1SCNE 3N28A 5FBHA 4HG2A 2KMUA 3L6DA 4P98A 1CF9A 1FFWA 1BR2A 1P4HA 1S4QA 2DUWA 5B6PA 5CIWA 1Z4JA 4FMDB 3HBLA 4FMCB 5C53B 3T7AA 3PNPA 4RQTA 2M7AA 1OU4A 1G20B 1MA3A 2YV4A 5IVDA 4CGZA 1PTJA 4DZRA 4TTPA 2BCJQ 1OWMA 4KWCA 4MVJF 2FEMA 3K0HA 2QMEA 2HJGA 3O4FA 2F3PA 1LJ9A 1FL9A 1XU9A 2HDCA 4MWDA 3F8FA 2VDVE 2LPMA 2QN9A 3A1SA 1OR7C 3EVFA 4D9IA 1FU7A 1YHZA 3ZW8A 1VKNA 4EI2A 1CV2A 1XPUA 3B9RA 2Z8XA 2JLZA 4WL0A 2DK8A 2ZE8A 1ETUA 2WVAA 2QIOA 3THXB 1ZMRA 2IEDA 2C8KA 3QFFA 4MEJA 4UUTA 4UJ3A 1GO2A 3DYVA 5DX0A 3VPAA 1Z8FA 3DTNA 2W11A 2ZRAA 1ONOA 4X71A 1EDDA 2BZSA 3OMLA 4C4RA 1LDMA 3NHJA 2CF5A 4HYTA 4QUGA 3RSOA 3KFWX 1IM8A 3YASA 1QQBA 2ZE7A 3FRIA 3FTEA 3UZUA 4UUVA 4ENKA 1RRGA 1O0CA 1EUCB 2C0PA 4NBRA 1GU0A 2WC1A 1HDZA 5ITZB 1M6NA 2CFOA 3O84A 3DZ8A 3TFOA 3QTTA 1LTQA 4DVGA 1CUGA 3KAKA 3SXPA 4IMPA 1PGOA 1ZK4A 4EHLA 3K5PA 2PJPA 4J3NA 3RC3A 2W6JA 3WE7A 1WBDA 5JOQA 4U39A 4TXNA 4ME6A 4LF6B 2P2ZA 4YAEA 2XLCA 4LWQA 3LA3A 4DJAA 1NW5A 4LOLA 3VO2A 1XCVA 4E09A 3ZHCA 1ZRFA 2WHPB 1DELA 3ND9A 2P4HX 5CW2A 4V3CA 4A6EA 1KSFX 2JBHA 4NSNA 4KRGA 4MWTA 4L9VA 4P4SA 3NU1A 4FOPA 2YV5A 4AMVA 1SG0A 1FVFA 3TIVA 2QAJA 4A6DA 1QGED 4RAGA 1H0SA 5GP1A 3EBPA 4FHDA 4ENQA 2CNLA 5I8PA 5EZYF 4YIIA 1WIWA 1J00A 3B02A 5EKDA 4X1KB 3GRFA 3GLSA 3JAWB 5LVAA 4ND7A 3OCXA 1OQAA 1N7JA 2EW8A 4Q6WA 1K6OA 3D7RA 4QREA 3HKEB 1B42A 1PNOA 2VNKA 5JC1A 4KQHA 1SCUA 5BORA 4J0HA 2NO9A 2FZEA 2OB2A 3LXRA 4IOMA 1C14A 1N5MA 2NT4A 1ZP6A 4I6ZA 3H87A 3KXPA 3TNFA 2O8CA 4GCVA 1ZRSA 4M55A 3RSCA 3LE8A 2JD0A 4JP1A 4D79A 2OBPA 3OCUA 1W88A 1VMDA 1SD4A 3NHBA 3D3EA 4XSXF 4EB6B 3QOEA 4DWWA 4HEA1 4R9VA 1C7IA 2EIHA 4R1SA 3OT5A 2C61A 2HDNB 4QRDA 3WGGA 4KLCA 5AUQA 5ALZA 1KEVA 4A3IJ 4Y2UA 4KGVA 5IVHA 4B3XA 3W9YA 2Y1XA 1AG9A 4UXIA 2JH3A 4Q4DA 3VH4A 3JYHA 3VU0A 1I24A 2OCXA 2F8TA 3CSSA 5AXBA 2BUAA 3LWNA 3AJAA 3D4NA 2FQ1A 1O5IA 2CL7X 2CJWB 1ZTRA 2OQIA 2B8EA 1XMVA 4XM2A 3ZD6A 5KYUA 4DILA 2HLDD 1FFDA 1IEVA 4MROA 1LFPA 2NACA 5AOBA 2R47A 3FKQA 1S7GA 2C5HA 5DTQA 3ZWMA 1Y5RA 3LUCA 1NSYA 1YDMA 1OZHA 1NKTA 3F6CA 4Y4RA 1ZOPA 3V2IA 3EVEA 3DHVA 3TLZA 1RIFA 4PWZA 3F78A 4PBTA 4BPBA 2OP0A 4CR6A 1AE1A 5DTDA 2P2YA 3D4LA 2X9NA 3B51X 4I1RA 3HV0A 4DHEA 2F64A 2BMDA 2BEWB 2OTJI 2QMQA 3V2HA 4I9GA 3ZNNA 2ID3A 2ZUDA 1K88A 2X1VA 3GVXA 4KRYA 5FQNA 2DFDA 3UHAA 1RPZA 2CC2A 1Z06A 4ARZB 1T2VA 4FNMA 3I34X 4Z8XA 1JIUA 1ZD3A 2E21A 2WY7Q 1O6CA 1IG7A 2HQBA 3DDNA 4Z8YA 3UPUA 1QSGA 3QE4A 1B6AA 2J9FA 4KP7A 4DIKA 4KXMA 2QVYX 4MWCA 1OX4B 5DNCA 5L51A 3ZTTA 2FFQA 3I09A 3ROKA 3ESRA 1Z5VA 1JFFA 3V4LA 1GU7A 3E5NA 1O1YA 1C5KA 2AN1A 5KAFC 4X8OA 4YXFA 4ALJA 4HNAB 3QMMA 3VU3A 1CIPA 1XK6A 3QI7A 1RHUA 1O6FA 1C29B 2ZMEC 4NULA 3CD6I 1W0JD 3MRSA 2HTFA 1MBJA 1OE0A 1QFSA 5C37A 2PKCA 3QWAA 5A1JA 5BMVB 2EPFA 4L5IA 5E1OA 1G18A 3K6RA 1YE9A 1J8DA 1X9HA 3H1TA 4RH0A 3PEYA 3A02A 1XC7A 5JDIA 3O75A 1OFTA 1G55A 3M6LA 2SBTA 2LUOA 2VONA 2LCQA 2OYSA 5DJ5A 1XWIA 2Z2SB 3VKHA 3IUPA 4XLZA 3CLTC 2QKMB 2G67A 3HBFA 1PFGA 3IQEA 1G20A 4KXLA 3FZYA 4PO8A 1IV6A 3ZI0A 3PQJA 3DO8A 2W37A 1UELB 3ECAA 1RQNA 3SEAA 5EXDA 5C18A 1FZTA 5J63A 1DC4A 5FL7D 3O3MB 1OISA 1NG6A 3KDPA 4M1MA 3RROA 1YFKA 3OTQA 4KW7A 3HOWJ 3M5WA 2Y0PA 3NYRA 1ECGA 2P75A 1C8KA 2ETVA 3LIIA 1LH0A 4FUQA 5B3AA 3THXA 3BPVA 4GP7A 1SD7A 2EF1A 4QXRA 2FDCA 3NT2A 2CQQA 5AR1A 1UDRA 1X7DA 3R20A 5BPDA 3UANA 1OTYA 1SUFA 5FYQA 4CQMB 5IYBJ 4KLNA 1R0YA 3ANLA 4QA9A 1SULA 3W2WA 1UKEA 3FPJA 4D1YA 5L4NA 1XEWY 3PQ5A 4B6JA 2QW1A 1SNYA 2PKQO 2HJSA 5DGTA 5BW6B 1VQOI 3EPLA 1A7KA 1E3SA 2F4MB 4MAFA 4A91A 2QSUA 3P1JA 4G4SP 4ZAFA 1ICIA 3TQSA 3Q3JB 3W6PA 3PVZA 1Q21A 3K1NA 5F3WB 1EUCA 1V7ZA 5AKJA 2ZCVA 2R65A 1YTYA 3KKEA 5ITZA 3FCUB 5MHTA 1LI7A 4W5HA 2QUBA 1GZ7A 4KT5C 2PBIA 2PLYA 5DXAA 3E6MA 4XKVA 1IXCA 4KQ2A 4XLEA 4N54A 4Z1MD 3QZUA 2E1NA 2ZJ4A 4UXJA 5B4UA 4UVGA 3W7AA 3FXLA 1ESCA 4XLLA 4EEXA 5KQGA 1DVRA 3I2JA 1NBAA 1KQNA 3DKPA 4QBIA 4LLNA 9ABPA 1JKIA 3R3JA 3KYDB 4RD0A 5J1RA 1FXWA 4N0BA 1UMDB 2VWQA 3ZWAA 1RE0A 3KPYA 1KGSA 3OZTA 3ZWOA 3G0BA 2O5RA 3UUFA 3LOUA 1R8XA 4IDPA 4LMAA 2Q4RA 1ZC4A 4TTJA 1LZKA 3K70C 2W57A 2Y2ZA 1Y1VJ 2ZYUX 2KIMA 1YFHA 4X1KA 3JAWA 1HE2A 1O8CA 2A5FA 1RLMA 2REBA 4NARA 4LZLA 2GCGA 1TECE 3HKEA 4ESOA 3DDOA 5FJ8J 3TLGB 4LKRA 3TNJA 3Q8WA 2TCTA 1H4TA 3TOBA 5EG0A 1CRWG 2D5AA 2KT0A 1XZLA 1QNTA 3EXIB 4D43A 1FLVA 2QD4A 3HB1A 1LFUP 2QX8A 3ASZA 1CUDA 5DNAA 4HYYA 2XMPA 5L3QA 1I14A 2KX7A 5FOVA 4BFZA 3ICQB 1P19A 2V1XA 1KO1A 4B83A 2P3OA 1U65A 1G1AA 2VNJA 1GYPA 4EB6A 1XMXA 1U6KA 3IPAA 2I6TA 1S2LA 1E7RA 3IUOA 4FN4A 1XDDA 2YHIB 5GVRA 3ZNOA 3L2CA 5ERGB 2CW7A 3DL7A 5JCJD 5ECGC 3Q0IA 2D2WA 3JAMK 1GZ6A 2YWGA 4XFDA 3WO1A 4DADA 1AOXA 1O9HA 2CB0A 4P7FA 3HVIA 1XJQA 3LW8A 4HBZA 1C9YA 4Y52J 1FLNA 3OZXA 4ID3A 4JCCA 3KT8A 3MVPA 3GFBA 2DBQA 4HGQA 4KAFA 5HVQC 3CC8A 5CXSA 3FOBA 3CVOA 2GI4A 4FE4A 1VLQA 3VSAA 3BRWD 2ZJQF 3DHYA 1G59A 1L7QA 2JNWA 1N4AA 1UFKA 3GJ4A 2J3IA 3LA8A 2O0KA 4IS2A 4J76A 3AV0B 4HQRA 4U0VA 1NBMA 3SJ7A 3VHXB 1U6GA 2F6CA 2BEWA 1URPA 5K7SA 4DWJA 1KJQA 3QYAA 1S1CA 3SYLA 1L5LA 4GD3Q 5CCXA 2VRCD 1SKQA 3V4OA 4ARZA 3EZ7A 3BEOA 5CGQB 1O95C 4P5DA 4CMKA 1NT4A 1K78A 5F7OA 1GA4A 1NBEA 3EIUA 2HRRA 5EIEA 1ZH8A 2WWIA 4R1MA 2Y69H 4DBRA 4KLAA 3WLPA 1L1EA 5BWBA 2ZE6A 3TM4A 1KJZA 3WOHA 3HBMA 4LXUA 2CXUA 2WSLA 1R9TJ 1XNJA 2DCMA 4WK6A 3HSKA 3U49A 1N0WA 2YQ4A 5CB4B 1U31A 2CXHA 2VHCA 3WLIA 1FMJA 4E5PA 4KITB 2VHUA 3HCEA 2XI4A 4HNAA 2B4RO 4G1CA 4YJ2F 4C43A 5DH9A 5G4KB 5L7YA 3OIGA 4BB5A 3E9NA 4JLDA 1QR2A 4WERA 1Y6RA 2VTDA 5COBA 2PGJA 1VSTA 3M5PA 1HW5A 1ESNA 1EQ2A 1M2KA 1TA9A 3RAJA 1GPUA 1Z5UA 5BMVA 1D2CA 3K9BA 3F90A 4CLRB 2NXNB 1X4OA 5DGXA 5KU7A 2PE5A 2ACJA 2NYXA 5IZCA 3GJZA 2A8YA 3TSWA 4JJAA 2ZR8A 3JAKB 4URZR 3WHIA 5LPNA 2F8MA 2WV1A 4J0KA 4EJOA 2F59A 2GVDC 3OM0A 4L73A 2VF5X 1T9DA 2DX7A 5FBQB 3IRRA 2FXIA 2P68A 1Z13A 1IUPA 1MG5A 3BCRA 1HMYA 4HFMA 4I98B 5IBQA 1DFHA 4FW8A 4E31A 2WT4A 1H65A 2BHZA 1WDKA 4BCCA 2X41A 4N01A 1B43A 4Y2RA 2HSJA 5GJWC 1W4RA 1PSWA 4CNBA 5IF3A 3AUKA 3W9BA 3A6PC 2ADMA 5ESWA 3R3ZA 1PR4A 1JT2A 5D8LB 4AYTA 4KDRA 1IZ7A 3H2ZA 2D1TA 3CT6A 2GJ9A 2IS1A 1IPEA 1KQFA 4GO1A 4QXOA 3M4OJ 1GTMA 1DIOB 2AXEA 4YGXB 4MW1A 4CQMA 1UCFA 2RGVA 2VLIA 1H2AS 2QLZA 2H94A 2GJ4A 5K3CA 2KISA 4JJZA 1Y4AE 1RUOA 4XICA 4WN3A 1VHTA 2EP7A 1NHGA 3FYHA 2HQ5A 1OB5A 2PL1A 4KLZA 2LV8A 3AU8A 3NGXA 3CF2A 5JR3A 2VA8A 1Y81A 2FSVA 1M2HA 4HS9A 3ROMA 3RVRA 3A1VA 3HLTA 2JAHA 3HNRA 5GP9A 3QSYA 3ASOH 3OE7D 3UAWA 3WMRA 1KZ1A 2P8SA 3AF0A 2IWHA 1IDOA 2RH4A 4M53A 3OT1A 2N42A 1DQSA 3Q11A 3JQBA 2DG2A 4IM7A 2GHTA 4TMTA 4KN6A 3OPQA 1KDOA 4EHAA 3LP5A 3HL0A 1JHVA 2UZIR 4E7PA 2PXAA 4WPGA 1E0SA 4EYOA 4QEKA 4JEHA 3G0HA 1IIBA 3AIIA 4H7PA 1WXGA 2PUHA 3NIWA 3KP7A 1Q84A 2GM4A 2ZJBA 1DRWA 2P9JA 2Z3VA 4D9NA 5JFGA 2CQ7A 4I01A 1U04A 4HXFB 1CIVA 3GUUA 4FZRA 1NMYA 5EXXA 1YMUA 2JIZA 5CM8B 3E22B 1Z0DA 5KAIC 1MBEA 5CNIA 3ONQA 1NMZA 2O7VA 4HDUA 1D3AA 1UZLA 3F8NA 3AKYA 4ZOQI 5ESXA 4RK7A 4WXCA 3W7BA 1KI3A 3CIFA 1BGVA 3CXRA 2DDAA 2C6YA 4AY6A 1JIIA 1AA9A 1WFXA 1RJWA 4B17A 3L02A 4NK5A 2PG3A 5JNVA 4BQIA 5F1RA 2GIVA 4WZBB 3OLVA 1K2VN 4FQ8A 2EJVA 2EBIA 3NTOA 1ISPA 1QIEA 4Q05A 3T5GA 1KO8A 3EXIA 2GN1A 5B6JA 4NF2A 3DQZA 4FGUA 3R77A 1Q0PA 1XFDA 1RWWA 4IDQA 4O2RA 1D7OA 1WZIA 2V0CA 5HGXA 4LNAA 2QZJA 1U1GA 2R6AA 3KT0A 2AMJA 2EWVA 5IDYA 1KA8A 1E79D 4QTTB 2XV1A 3S1SA 3EDMA 2VPZA 2MOKA 4DEYA 1BKYA 4YV7A 1KEEB 2ZT8A 1T0JB 4WKGA 3Q7PA 3AR4A 4NPCA 3C1UA 1U3TA 2OCYC 2QM8A 5U1PA 1A6QA 3F7NA 3TZLA 4ZMRA 3DBLB 2QL7A 3L6OO 2G7HA 2I76A 4V2GA 3S1AB 4G89A 4NC6A 1ORRA 1HE5A 2W83A 3F3MA 1TM4E 2QXYA 4ENWA 4A0YA 4MUBA 5TB5A 1U8UA 4HYQA 1IPHA 4O4HB 4F2GA 5FTLA 1SUPA 5UKDA 2W0SA 3IOBA 2MSLA 3SS8A 1Y6IA 3OHMA 3MJSA 4Y17A 3FFTA 4EMUA 4I1YA 2PN1A 4I5EA 4UHEA 4TLEA 4H0CA 5IRCD 4DQKA 4AXBA 3WTXC 1J23A 2CFCA 3G1OA 4WEOA 1JJIA 3PLNA 4OF4A 1TA0A 5CX1A 2PWBA 1GLNA 2NS8A 2ZJ3A 4X60A 5A71A 3OQJA 3VR0A 1R74A 3CX8A 4TWBA 1P5ZB 4FD3A 3LFKA 1SQ0A 5JSUA 1VBKA 2LKSA 2CMPA 2HOQA 3LDAA 5I7UA 1H2EA 4OYLA 3LAWA 2OUKA 4ZDKA 4U1RA 2ISYA 4L8YA 1LB1B 1MRNA 3ANTA 3GTOJ 5CB4A 4UEWA 4CG3A 3D8SA 4P5OA 3D5LA 3O82A 3KPHA 5GV7A 5SZKB 2PMCA 4BJTA 5KTRA 2HF2A 2P9YA 4YDQA 2O05A 5KVCA 2R96A 5G4KA 1LU9A 4HEHA 4OH7A 4IDEA 1U2QA 4Y6PA 1GFIA 4MAMA 4R71A 3C4JA 3KJGA 3PPVA 1PZFA 4DWOA 4OUDB 4D9FA 2ME6A 5ECDA 5FWXB 4A23A 5K7ZA 2VZ9A 3UQZA 1X8XA 4JT8A 1E2BA 3ORYA 2QUKA 2GYYA 5EQDA 2XUQA 4CLRA 3P9QA 4BB9A 3L2OB 1QRYA 2NXNA 1E1RA 1MBFA 3K2EA 2GA8A 2ZULA 1YO5C 2R5WA 4ZALA 5FPPA 3C48A 1XHLA 2V58A 3F5MA 2IGKA 3JAKA 3A3NA 2R3SA 3ITEA 1LKXA 4RK0A 3N1UA 1GZUA 1ZX1A 3TEDA 2DVMA 3OD5A 2G1PA 3CQ9A 1UDCA 4RMHA 1ZXLA 2JFQA 1BR4A 3E82A 1SVOA 3WMWA 2ONZA 1IMJA 4B48A 1WM1A 1JN0A 2PD3A 1R8JA 3B89A 3OECA 1ETKA 2R1ZA 1CNEA 4MGYR 3OOWA 3HCFA 2VE8A 3V2UA 2A5DA 3QMPA 3BKXA 5L45A 1J49A 2AE2A 2R5YA 1MSFC 1S6YA 1LV7A 5AK0A 2NQ2C 3C3YA 4ZEWA 4YAKA 4FR0A 3UH0A 1XUOA 1SEVA 4R0VA 4KNVA 1Z12A 2ATIA 2VBIA 3DD1A 2RKHA 3JQDA 1KJJA 2BOVA 4CU5A 5FLXZ 3PPYA 1V5GA 1UM8A 5HKOA 2AJ8A 2KHZA 4U0WA 5HOEA 1H42A 3QOWA 5J4HA 4OHWA 5CVTA 1XMJA 4AY5A 4PLYA 3I5YA 4K6KA 3ABRB 1YS2X 4MPJA 4GSYA 2O8BB 3WU2C 2I6GA 3R23A 1NYQA 4QJBA 3BE6A 1BWRA 3D1JA 3EASA 3DBOB 2C03A 1E0AA 3L8YA 2K86A 3RUAA 3Q1LA 1UK8A 4EW2A 1TNTA 1DC6A 1KZYC 4IBOA 4PIPA 3RI4A 4JCOA 1FIPA 3IVRA 3OI7A 4ZOCA 4BZXA 1O0BA 1K27A 1KYQA 3CEJA 3IEPA 1DPFA 1XKLA 1Z62A 3N2YA 3GFFA 2AI1A 1XG1A 2PV0A 5CJPA 4LCJA 4MOWA 3U17A 3LHIA 2Y1GA 3L46A 1T13A 2Z9BA 4U6QA 1F8XA 3DD5A 1SFRA 5KK1A 1Z39A 4RV9A 4OFWA 1VDMA 4QUBA 4BNLA 3LOCA 3V8BA 2WUEA 3IKJA 3E22A 1COWD 1HLPA 2OBNA 3KPUA 1WU7A 4DA6A 1T24A 3IP7A 1C9EA 4CT0A 3WVNA 3F1LA 2J87A 2IKSA 3M1AA 3OQ1A 4RHFA 1Z33A 2VJJA 4WNYA 4D92A 2QD2A 5EPEA 3CCVI 3OWTA 4HWPA 4ZAXA 1XTJA 3K15A 5TJJA 4HSE