1P2FA

Crystal structure analysis of response regulator drrb, a thermotoga maritima ompr/phob homolog
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
MMWKIAVVDDDKNILKKVSEKLQQLGRVKTFLTGEDFLNDEEAFHVVVLDVMLPDYSGYEICRMIKETRPETWVILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFLEREKKGLYDFGDLKIDATGFTVFLKGKRIHLPKKEFEILLFLAENAGKVVTREKLLETFWEDPVSPRVVDTVIKRIRKAIEDDPNRPRYIKTIWGVGYMFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Response Regulator
publication title Structural analysis of the domain interface in DrrB, a response regulator of the OmpR/PhoB subfamily
pubmed doi rcsb
source organism Thermotoga maritima
total genus 69
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p2fA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p2fA01
5LGUA 2PFBA 3EDPA 1U04A 5FLXZ 4F3TA 4PDKA 2EV5A 3CU5A 3N53A 5BRJA 2W84A 3LUFA 3I42A 2VUIB 1IUYA 5AIPA 2DW4A 5CVRA 3GEZA 3QK7A 3L9FA 1UHWA 3F22A 1B59A 4Q5SF 4L9TA 1Z26A 2WRZA 1W25A 4AIKA 5TPWB 2HGCA 3EETA 5HVQC 4W5NA 2QXYA 4MS1B 1QPMA 3OMXA 1HW1A 4UNOA 3UKJA 1K78A 2FMLA 3GYHX 5J6XA 1OR7A 2Z99A 2JTVA 8ABPA 1A04A 1SD7A 3HXMA 4N0BA 3BBLA 4WXDA 2ESNA 3CJNA 2PUEA 1WI9A 5LHGA 2IA2A 2KIMA 3N0XA 5IBQA 3HDGA 1XN7A 1F4KA 3J81Z 1IXSB 4G8XA 3PQJA 1FX7A 3TB6A 3CO6C 2EB7A 1XSVA 4MYRA 1PDNC 3FXUA 1FSEA 4EJOA 2WC2A 2K7LA 3CRNA 1NATA 1JHFA 1I3CA 1MIHA 5IULC 4A0YA 1BC8C 4LK0F 3DP7A 2PI0A 1YQAA 1USGA 5FO5A 1ZARA 4KUMA 4CDGA 5KQMA 3DPLC 1IN8A 3MMNA 3DGEC 1S7AA 4L4UA 1QQIA 5FWXA 2ZMEA 5EWMB 1DG9A 3KCNA 3U9GA 2R25B 3R4KA 4YR7A 2VONA 2FSPA 5B3JA 1U78A 3WTXC 4OLAA 3R61A 1D8JA 5EWJA 4WT7A 1LJ9A 1BDJA 2FU4A 3DKWA 3FDFA 5IEBA 1ISSA 1UDRA 2HQNA 3GW2A 3ZMDA 2ID7A 4B8XA 2FEPA 3C3MA 4FT8A 3RVOA 4QWQA 1Z6RA 5CJ9A 2HPHA 7ABPA 4EYGA 4R8HA 5L3GA 1R36A 1USTA 2VC1A 3MZHA 3ML6A 2V79A 3GBVA 1LDDA 2WY2D 1RXEA 4MR7A 1Z18A 1KU2A 4KDPA 3I0TA 1XDSA 4NQRA 5A2QK 1T6SA 4G86A 1HW5A 1OYIA 2L3DA 2KYRA 4PEVA 3V8LA 1TQIA 5L3FA 2H3HA 3ZPLA 2MD5A 3R60A 1P6UA 5EWLA 5KK1A 4R1HA 3KYIB 2FQYA 4KIGA 5JNWA 1ULYA 2F8TA 2LF8A 3HSYA 2WJAA 1P8AA 3F6PA 1ZGZA 4YLEA 2FSWA 2VXZA 2UZKA 3ZQ7A 1YW7A 4JK1X 1JFSA 1B00A 5FBKA 5TQ2A 5AIQA 2ZNYA 2FN8A 3B2NA 3ISPA 3O2QB 3NNSA 1DCFA 3M1EA 2QM3A 4G0QA 2F5EA 5E8GA 2H6CA 1LJLA 3JSPA 2KIUA 3O1HB 1XGSA 3HS3A 3NHZA 2OQRA 4HQEA 3CZ5A 2FKAA 1ZGGA 4W5TA 4RK6A 4BXUA 3QU3A 5DEQA 3OO1A 4UHJA 1TLHB 1HBXG 3WE3A 4DQ2A 4LDAA 3GXOA 1P4AA 1IN7A 3E5XA 4G0MA 3FX3A 2W25A 3V7RA 4MQEB 1FC3A 3ZMVA 3SZPA 2JVKA 3K2ZA 5F1RA 2AYXA 3WU0A 4Q6BA 3H92A 3O21A 5LLQA 4L85A 5CNMA 3CUOA 1SMYF 3E6CC 2JBAA 3VEPA 2WTEA 4AIHA 1MJBA 2Q2EA 1PEYA 2VBWA 2JVJA 4JA2A 1QKKA 3RYPA 3R6SA 3ECHA 4P96A 1BI2A 2ZKZA 1S8NA 4EGYA 1A2OA 3BWGA 1NXVA 3K69A 1DC7A 4MRMB 4E7OA 3FWEA 2FVYA 2PJPA 4KQ9A 2LF7A 3BILA 3F8CA 4IGAA 4Y9TA 1NTRA 2E4WA 3LKVA 4KPYA 3JTHA 3LSTA 2DRIA 2NZUG 4MTEA 1BDHA 5KQLA 4EVSA 3P7NA 4EGZA 4MR8B 3HCWA 3O3KA 4HLYA 1JHHA 3HRUA 4P98A 3F6OA 2IOYA 3JAMK 2YR2A 4JAVC 1JYEA 4MR9A 2FA5A 1TW3A 2K4BA 2EFQA 1O7FA 4RGXA 3D0SA 1XHEA 4UUVA 3HTUA 3DLHA 4XBFA 3G1WA 5C5CA 2LP4Y 4EJUA 2CWEA 3JS5A 1T2KA 2RDPA 4BAYA 2XASA 3M9XA 4RY9A 2LSOA 4KMFA 2W85A 1RUOA 3IPAA 3EJWA 2Y75A 3F8BA 2M1BA 2EFPA 1GXQA 1V3FA 4N9HA 1HSTA 1TQPA 1HSJA 2K27A 2PL1A 3H5OA 4A0ZA 3O1JC 4NCAA 3H6HA 1ZHFA 3KP3A 2A6EF 5DKFA 2LBPA 2HQOA 4MAAA 3GT7A 1D8KA 3JPWA 3DLBA 4G9YA 3C1DA 3I71A 2EWNA 2D1VA 3KLNA 5FD6A 4G7ZF 3NNNA 3Q15C 5E1XA 4U0WA 1ZRFA 1EAYA 3QP5A 3BOQA 4OU0A 4BHCA 3JAMZ 5D4RA 2E4UA 4HZFA 1YK1A 2GWRA 5IT9K 2VOOA 4RY0A 3F21A 4EV0A 1SRRA 1DBWA 2ZXJA 1IRGA 1Z2EA 4Z0NA 1EHCA 4I0BA 4H60A 5LHHA 2LIVA 3N0RA 2HZTA 2G9WA 4ZPJA 2YPRA 3MA0A 9ABPA 4RKRA 3TKYA 4O5VA 1NXTA 5PNTA 3GLXA 1VPWA 1XCVA 3MQ0A 1P4WA 1C0EA 4EVRA 1UCRA 2IP2A 3TGNA 1MDMB 2P7VB 1PP7U 3T0YA 1XGOA 3HVRA 1IW7F 1OYWA 1K79A 1ZN2A 3H5VA 5KQGA 1R1TA 2MYTA 5DLEA 4P55A 2HKXA 2JK1A 5EEGA 2E1NA 3MWMA 2CQKA 1HEYA 2FBHA 2J5PA 5JR3A 3I4PA 4D6XA 5J8FA 5D5UB 2RV8A 5DUIA 2ACJA 1DPRA 1JDPA 5CNIA 2MYPA 5K5RA 3MAJA 4IJAA 1I6XA 3EYYA 2R47A 2F8SA 1FYLA 1L5YA 3A10A 4OMZA 2MA3A 4D6YA 4RAZA 2KKOA 1U8RA 4LLNA 3RDIA 4CXFA 2R48A 4OMYA 1ZH2A 3HRMA 3T38A 3E61A 4MQEA 1SAXA 4KZKA 4UV8A 1K78B 2M8EA 2DPDA 4RK0A 3GYBA 1XMKA 1J2XA 1G3SA 4LZLA 4FX4A 5ICGA 1FQWA 4CYDA 2JZYA 1JXSA 1JBEA 2ZCWA 4JASB 2W57A 4A5MA 2F5FA 2FQXA 4Z2YA 4P9FA 1LEAA 3KHTA 5TQ0B 3T5XA 3QLUA 4EQQA 1PHRA 2EJRA 2XVCA 4XLNF 2MSKA 2F5DA 1BC7C 3F73A 3I09A 3DV8A 1J56A 2NT3A 1TBXA 4PYRA 3FM3A 4G0ZA 1BVHA 4LMYA 2G7UA 4CO8A 1ZGAA 4ZYLA 4L0ZB 4JB2A 2RNJA 4QYMA 1BOAA 1EH8A 1JWLA 3EDCA 4KYWA 4MGRA 2L54A 5HLGA 5FWXB 2ZMEB 3FXRA 3IP6A 4RB3C 4LB5A 1TTYA 4IMIB 2OU2A 1P2FA 4RB2C 3FZVA 1D1PA 3BJOA 2WWVD 3GF2A 3REOA 3IKVA 2Z9OA 4IRIA 3IP7A 1JH9A 2VYCA 2DQLA 1WWXA 2H94A 1K66A 3BROA 4HW0A 1Z25A 2PN6A 1FFGA 3Q7TA 3Q9SA 2A61A 3IHUA 3C97A 3WG9A 2PUDA 3KZYA 2QVCA 2JB9A 1NXOA 2HKOA 1LNWA 4HNRA 2FMIA 1GUBA 5TJJA 5D5VB 1LB2A 4N76A 3RVPA 4ENNA 4RDCA 3EQZA 2NNYA 5D4SA 3CUQA 4Y15A 1YLFA 4L9VA 3TMYA 3LFKA 3K4HA 3DZDA 4HYEA 3N75A 3NHMA 4O3MA 1H9TA 3SNKA 5FLXK 3QRFF 3D8UA 3ILHA 2JRTA 2IPMA 3OQMA 2OZUA 3IRRA 2ZNZA 3QPTA 4YCSA 5KC8A 3KP6A 2VT2A 1O3SA 1D3YA 3IWFA 1S29A 1ZVVA 2BE5F 4XLPF 2FMKA 3VB2A 3IRQA 2Y48A 3NEUA 3F8MA 4Z99A 3HV2A 4ZZDA 4G7HF 2VE9A 4YV7A 4LX8A 2RKHA 1EH6A 2IT0A 4OATA 2PE5A 5LGTA 2FBKA 2R7FA 3LAPA 5TQ2B 5I4CA 2QQAA 1Q1HA 4ESFA 3EYIA 3E6MA 5D6FA 5C5EA 4GGGA 5FD5A 2HFHA 3HYIA 1NY5A 3WTZA 2VBZA 2WJWA 2FMYA 4GYIA 2XIGA 3K1MA 1T98A 5E20A 3FMQA 5JNSA 3BPXA 2ZJ2A 1QZZA 1R00A 4HV5A 4Y17A 3CTPA 2P5LC 4OLBA 5JVTA 2GXGA 1ONVA 1UHMA 3B02A 1D2AA 3RJPA 4WK8F 5JHUA 3RI4A 3DQVC 4EYKA 3DBIA 2PUCA 2IA1A 2MH2A 4EJWA 3OM1A 4PE5B 3EQLF 3FFXA 4M88A 2HS5A 3I54A 2JBAB 4JP1A 3K9CA 3SZTA 2PQ8A 3O1IC 4AVPA 2FRHA 1B4AA 5K1YA 1CHNA 3OOPA 1TNTA 3GVAA 2XAJA 4ZZLA 3HTSB 3LUKA 3RVJA 3OMWA 1BJAA 4IILA 1Y1LA 4M74A 1U2PA 3P9YA 1CF7B 4MPTA 5LRRA 2XUBA 2PJUA 2FBIA 3WTVC 2L18A 1SXGA 1ZAOA 2DT5A 3GZ5A 1FFWA 1DCKA 3ROTA 1J59A 4LRQA 2CD7A 3E5UA 5D2CA 2O8XA 4NHJA 3ULQB 4RZSA 3DF8A 2H0AA 3H5WA 2ISYA 2R7DA 1DDNA 5HDKA 3WGGA 2P8TA 2JVIA 3I59A 4M6XA 2OQGA 1F1ZA 3H6GA 5HLIA 3S2WA 2RN7A 5E8IA 2GBPA 5LGNA 5DCLA 5TQ0A 4Z4IA 2VBYA 4MR9B 4LJZF 5HQJA 2QQ9A 3OLZA 2HEOA 4H3HB 1EFAA 1W7PD 5ICFA 2D45A 4N9IA 1ZITA 2RJOA 2JT1A 4RK7A 2KJCA 3IL2A 3AAFA 4UVBA 2EFWA 2K4JA 1DBQA 4YGXB 2H6BA 4FE7A 4LGWA 2FMFA 4KFCA 3RIRA 2AXLA 5BOXA 2MSWA 3PFIA 4O1HA 4AD9A 1KGSA 1U2WA 4KN7X 3HK2A 3L2CA 1UB9A 2NNNA 3Q5FA 3ZN1A 2PMCA 4XXHA 2PEXA 3KCCA 1XMAA 1FWZA 2KIFA 5ERIA 3T95A 1M2EA 1YVUA 4ML3A 4Q4ZF 3FHZA 2PUAA 1IXRC 4LFUA 2C6YA 2HQRA 1BA2A 4UVAA 1JFVA 3H5IA 4EYQA 3N4MA 3EGCA 4YP9A 2PUFA 2BGGA 5GQSA 3NRVA 4RK5A 3C6QA 2QVGA 4XSXF 3MCZA 3VOEA 1H9GA 2P4WA 3HSFA 4MNUA 4QPJC 1FYKA 4PCQA 5JS2A 3LQQA 3QEKA 5JNRA 1R7JA 4A2UA 2LNBA 3NBMA 2X7XA 5TPZD 3P9IA 1DBPA 2F2EA 1TJYA 1J0RA 1TM2A 3LUJA 2JPBA 3HRTA 5HDGA 2GX6A 3OLYA 2M5WA 1B9NA 2UXXA 2AS5F 3ELKA 3RPQA 2JPCA 2QBYA 3FMVA 2MSLA 3ROFA 3HHGA 3WGIA 1E17A 3H1GA 4O5AA 2V1XA 2WMYA 2WB4A 5FFZA 2FOKA 3LMKA 3F3XA 4A0XA 4LB6B 1BIBA 4M73A 5ILUA 3TDZC 4ETIA 5D6EA 4Z4FA 1E6KA 2GAUA 3LA2A 4H3KB 3ROUA 2YX7A 1SFXA 4K2EA 4ZH4F 3CDHA 3M7GA 4XFKA 3LUGA 1M5TA 1I1GA 3QP6A 4RGSA 1OKRA 3LAJA 3P9KA 2QZJA 1X3UA 2LPMA 2FLKA 3IC7A 1T39A 1PNTA 2HQBA 2R3SA 1C0WA 4D74A 1Z91A 3HUTA 4M9ZA 1KU9A 1DP4A 1GVJA 1HKQA 4OIPF 1T34A 1FSHA 4KA4A 3HUGA 3F7NA 1SFEA 1SXHA 3QELA 2XAHA 4DNCA 3T8RA 3LTEA 2A5YB 4WXEA 1MKMA 2FN9A 4HNSA 3LUHA 4PICA 3OLWA 5BMZA 3F6VA 4KRFA 5DD4A 3H5TA 2L4AA 3KS9A 2RJNA 4G0XA 1SFUA 4AIJA 3COAC 1YO5C 2OD5A 2RGYA 3H5LA 3KG2A 2IRFG 4DN6A 1CF7A 1HKTA 1K7AA 4LE2A 1BM9A 3JTEA 4HAMA 1Z15A 2J48A 1EWTA 1TLFA 3I5UA 1HW2A 3VFZA 1E6MA 4U7DA 4UHTA 3VNAA 4L18B 1Z7UA 1AB6A 1HKSA 3F23A 4LD5A 3D02A 1FFSA 4A5NA 3SAJA 3EUHA 4EM2A 2NZVG 5D5WB 3C3WA 2E7WA 1OXKB 1DRKA 1VTNC 2A3SA 3FF5A 1DZ3A 1F4VA 2STTA 4F8JA 5CVVA 3RQIA 3D5LA 1DUXC 3GZ6A 4KT5C 4ENKA 3LKBA 5TPZA 1MAVA 4F11A 3KEOA 4NV3A 4A6DA 2V6CA 3O2SB 1SMTA 3VODA 1BN5A 4ZMSA 3WGHA 5E17F 3H1EA 3OQNA 3CUQB 1KU3A 1JHZA 3JVIA 3TDUC 1ZG3A 2IJLA 2NRAC 1L3LA 3WTUC 2M87A 2QLZA 1H9CA 2TDXA 3IDOA 4WXCA 3GA5A 1F9NA 1FP2A 2Q5CA 3SHFA 2DLLA 1PEAA 4KK3A 4MEYF 2MBFA 3H3ZA 5E3JA 4EYOA 4FX0A 1EH7A 1I5ZA 2DU9A 3KP5A 1Z05A 4TLLB 1U6GA 3OM0A 4ETMA 1YMUA 3CNBA 2FEKA 3CG4A 3DXJF 1YW9A 3QAHA 2P4UA 1USSA 2TMYA 4EM0B 3BRQA 2B0LA 4JBAA 1DRJA 1Z1DA 4LDZA 4RGUA 4N0QA 2XAFA 1M5UA 2IDMA 3BRSA 4ZJPA 3LQRA 4MQ9F 4YS6A 1ZGJA 4HX8A 2O6GE 3KEQA 3CO7C 2FF4A 3QX9A 3QEMA 4KVFA 4F12A 1XGMA 2X4HA 1USKA 2RDMA 1MZBA 4WF2A 1E6LA 1M2FA 4M71A 2DI3A 5CNKA 2OAZA 1BIAA 4EUKA 3M8FA 2OENG 1ZRCA 3RYRA 4KK4A 4RK1A 4F06A 1XWWA 2IPAB 5DDGA 3ABUA 3U2RA 1ZDMA 3CTAA 2BYVE 4W5OA 2NYXA 4CBVA 5L3CA 2HSGA 2IKSA 4G0OA 5DGCA 3Q41A 5L3BA 4G0PA 2P5VA 4ENJA 3JPYA 1KA8A 2RGVA 2O03A 3VNBA 3SFZA 2BBYA 3FXQA 3GUDA 5D8LB 4HDUA 3MQ4A 4QICA 4G94A 4ZYHA 4TLMB 2YHBA 3IP5A 2HTJA 3ZMTA 3LUDA 1IZ1A 2P5KA 4EJVA 2YHAA 4HF1A 4OG2A 3WTWC 3QLVC 1O57A 1DC8A 3HZHA 2XHKA 4G97A 2H09A 4I98B 2P9HA 1BBYA 4KICA 1QO0D 4HDVA 5BRAA 2HJ9A 2EV6A 4YG2F 3QU6A 4RSMA 1J5YA 2GZWA 5HS8A 3I59B 6ABPA 5F64A 3V7CA 1BI3A 2Y0MA 5BPDA 1XB4A 2N9UA 5L3DA 4L0YB 4N03A 4OINF 1I27A 1IRFA 2H27A 1P92A 2EA2A 1REPC 4N47A 4YFKF 3F72A 1FY7A 2P7CB 1MB0A 4U7BA 1F51E 2ZFWA 4UV9A 4YWHA 1ABFA 3M6MD 1PUEE 1ABEA 2QQBA 1P6RA 2Z3YA 1YTUA 2RVCA 1FP1D 1Y0UA 5ICEA 2JRLA 4M6YA 1ZAYA 2HYGD 4MGEA 1MB3A 4Q6WA 2ETHA 2PL9A 5CYVA 3RKWA 3TO5A 1KRXA 3FMRA 3BJ6A 4Z9BA 2QR3A 2PLYA 1FLIA 4WXMA 5JNVA 2IVMA 1Z17A 5T3YA 2LKPA 3GWZA 2YSRA 3OO0A 2ADUA 2XV4S 2E1CA 3RVSA 3N6VA 1JF8A 2VODA 5FB2A 2ESHA 3UK0A 1LBHA 3H75A 3OV8A 5HOOA 3RVLA 5KVRA 3KP4A 4GYGA 1I1SA 1HXDA 4L5IA 1ON2A 1LBIA 1KYWA 2RQPA 1DP7P 4HBLA 1RXIA 4U0VA 3O74A 2IA0A 1IF1A 1VLZA 3M8EA 2FQWA 3ZMSA 4BHBA 1TVMA 3FFWA 1QP7A 1NXPA 4WZZA 4I01A 1RPJA 2PUBA 2ZO4A 5CLSA 4MLCA 2EFOA 2F5CA 1MVOA 4EM1A 3P9CA 2WV0A 2DTRA 3G73A 2FNPA 4Z4HA 4OIQF 2JCGA 4E70A 4O6JA 1FBQA 1LDKB 1W5TA 4RS8A 3KFWX 5GOTA 5JNTA 2GIVA 2QBYB 1KQ9A 1ZREA 3B73A 4Q48A 4E7PA 2XGXA 1D1QA 5BQTA 4BHPA 3LFTA 2J5OA 3HO1A 4QYWA 1W4MA 2HWVA 2GI4A 4DADA 3WU1B 1S7OA 3KYJB 3FGZA 3I45A 1XD7A 2PBIA 1EWVA 2L02A 1ON1A 2QZ8A 1KRWA 1U5TC 5BPIA 4LLLA 1ZG5A 2IPLA 1U3EM 3K1PA 1QO0A 4CHUA 4S05A 2L17A 4W5QA 1ZYRF 3DFGA 2O20A 4NCBA 2E4XA 3TO7A 2QENA 2QSJA 2E4VA 5KI6A 4U0YA 4KIFA 1D5VA 4U88A 1QQAA 1XHFA 4Z4EA 3CZCA 2W42A 3QX8A 1W7PB 3QELB 2DBBA 2MC3A 4Q7EA 2STWA 3RVQA 1YG2A 1NXXA 2DPUA 4WUTA 1RZRD 4HQMA 1A0OA 2COMA 1XSDA 4BYYA 3LUAA 1CYEA 4HX4A 2B4AA 3CKMA 2A07F 1R5HA 1TQMA 2CHEA 1SXIA 1QMPA 1Z6TA 2O61A 1LDJA 1U5TA 1NXSA 1PUXA 2M30A 1FSPA 1R22A 2VN2A 4EGSA 3HSRA 1QBJA 5IC5A 3OQOA 1L0OC 4R79A 4H0EA 1RUNA 1TMYA 5LHIA 1FPQA 2FXAA 2NUBA 2QW1A 3EULA 5CHYA 2A68F 3IKTA 4S04A 1FT9A 4A6EA 2OA4A 3TD9A 5DTEA 3HIFA 2QU7A 2UWMA 3ZN0A 5ABPA 2L4MA 4KV7A 5ILSA 5BR1A 3C18A 3I64A 4I02A 1U0SY 1FNNA 3TO6A 3A0RB 5CNJA 3WE2A 5JS1A 3GV0A 4HF0A 4O1IA 4OBBA 5ILVA 2ZBKA 1PP8F 2ISZA 2YU3A 5B3JC 2NAZA 3E6BA 2BV6A 4GXOA 4RB1A 3RVNA 4CZZA 5HLHA 1LK0A 3HHHA 4RXUA 3RVRA 4M72A 1B9MA 2M45A 1MGTA 4EVQA 1KMIY 5T7BA 5TRDA 1ZH4A 2O0YA 5BQ3A 5LEJA 1YYVA 5DCFA 3CS3A 3U1DA 3NNDA 3KKEA 5FWYB 3GFLA 1YS7A 3BJAA 5KQPA 5CVJA 2P6SA 3TO9A 3HRSA 2FW0A 3KP7A 2XROA 3JVDA 2OZ6A 3DPTA 3R0AA 3BY6A 3OLVA 3F6CA 5HDNA 3KJXA 4I09A 1IAWA 4IMJB 3I58A 2HOEA 3BPVA 1B1BA 2IYNA 4KIBA 6CHYA 4Q47A 2E4ZA 5IEJA 3GFMA 2FLWA 1BDIA 2D2WA 4N0PA 1RZ4A 2FQ3A 3TOAA 3TOBA 2A6HF 4PZJA 1D5WA 4LG0A 4TV7A 4XRFA 3MIZA 1YW8A 1FOKA 1R1VA 1S6LA 5L3EA 1O3TA 4IRHA 2V1UA 1CEYA 2B1JA 2CHFA 2QYOA 2VT3A 1GCAA 2A9OA 4GO1A 5CVIA 4MQFB 3SM9A 1NXWA 1YS6A 4RKQA 2D1HA 4BQAA 3I5AA 3QEMB 1XDUA 5K5OA 3F8FA 1LQ1A 3K9TA 1RZRA 1TNSA 1WKMA 1DPUA 3DGFC 1JX6A 1XCBA 1JYFA 3ECOA 2XAQA 3T8TA 1LEBA 4YIIA 2FMHA 2GA2A 2VBXA 3GL9A 4M9XA 2ELHA 2XKOA 5BS6A 3QOPA 4JOQA 1WETA 1XSXA 3KP2A 5E18F 1QPZA 4WWCA 4ESBA 4MS3A 1ZG1A 1FBUA 5ED4A 3M9AA 4AWXB 4ON0A 3GX4X 4G0YA 4KQCA 4NICA 5KC9A 4MQVA 3JY6A 5DYMA 4WX9A 2FTKE 5IX8A 1R5GA 3RVKA 1WSUA 1V4RA 4RWEA 4YFNF 4M9SA 1JDNA 1W5SA 2PUGA 3J7AO 2XAGA 3QPHA 4RV5A 3A0UA 4BNCA 5JNUA 3V7SA 4ETSA 3E6DA 4PZ0A 5DD8A 4G7OF 4XASA 1ZESA 4I7HA 1Z13A 3T1BA 2CSOA 1U2QA 2M1ZA 4CICA 5KWSA 3ZP5A 4RK4A 2XKPA 1W7PA 2NS0A 3LA3A 1OPCA 3L00A 3LA7A 1HQCA 4WWHA 3TX6A 4ZYGA 2GXBA 2Q8KA 3HJFA 3J80K 1EWKA 1T0FA 2MLGA 1QP4A 4FE4A 2RC4A 4P5OA 2K02A 5A2QZ 2DFIA 3DEUA 4OIRF 2R4QA 1L5ZA 3IWZA 4YO7A 3BZ6A 4F7ZA 2QWWA 2VUHB 4UHKA 5CVUA 1OMIA 2CG4A 1JGSA 3KE2A 1VRVA 1ZY2A 5IUKC 5HKOA 1GHCA 1TW2A 3WTSC 3E97A 4UVCA 4XLTA 4CGZA 1LVAA 3WTTC 3HOTA 5TPWA 3T8YA 3CHYA 3V8KA 1QNTA 1WRJA 4MS1A 2LUOA 1GCGA 1O7LA 4OIOF 5EEHA 5H20A 1JE8A 3KETA 1R23A 5FGMA 2YX4A 2DO7A 1DJMA 3K0LA 4LK1F 2WWYA 2A9RA 4RU1A 4N41A 4HF2A 3SXYA 4RXMA 1C4WA 4HOBA 2XDYA 1JLKA 2MH9A 3W6JB 1ODDA 3C3KA 3L09A 4ZYEA 3L49A 4FB4A 3J80Z 3E3MA 4I0AA 1MD0A 2AYZA 1RI7A 1UFMA 4DQDA 4G6DA 1QQBA 1QP0A 3F8NA 4KNYA 3N0WA 4GCVA 1K68A 4ASNA 2FE3A 4QLCU 3OLXA 3C7JA 1EV7A 2E7XA 4MS4B 3CLOA 3FM5A 3JTGA 3MEXA 5FWYA 4XARA 4GNRA 5HM6A 3GRCA 5DUKA 5JI6A 5J8CA 1IN4A 2Z33A 4D0PA 4HLXA 3E5QA 4MLDA 5E1ZB 5EWMA 2L01A 4L9NA 1K6OA 1G6NA 1E2XA 4EJTA 1FYMA 1YMVA 1APBA 2UXNA 1ZRDA 3LUCA 1GLGA 2BEOA 2CW0F 5D5XB 3TQNA 2LDUA 2V0NA 3BDDA 5E1WA 5DCMB 3KSMA 5IUNC 3L6UA 1GXPA 5H6QA 5HSGA 2HYFA 3N97A 1Z9CA 4OOIA 4EMSA 2CWDA 1NHAA 1H0MA 1ZHHA 3JW4A 4UXNA 1SD5A 4MQFA 2Q0OA 3ZMZA 2DK8A 5TE9A 3SY8A 3K1NA 3RVMA 4XAQA 2P6TA 3V4GA 1R8JA 5AONA 1U8TA 4LE0A 1YTYA 5TQJA 2PLNA 2PMHA 4FHTA 3O2PE 3O75A 4HV6A 1O3RA 4MEXF 3URMA 1RNLA 1G3TA 4YRZA 1SD4A 2QUFA 3G3ZA 4JQFA 3ZMUA 3NQOA 2IPQX 2VK2A 5LRSA 3SG0A 3EQ2A 1ZH5A 2PKXA 2CFXA 1E2BA 2G7HA 5FBHA 4IXAA 1YFHA 2I6FA 4NB5A 2ZAYA 3BREA 3Q9VA 2GA1A 4WXHA 1OXBB 3N8IA 3GFIA 4IF4A 2V1DA 3PQKA 4LLGF 1S3JA 2XRNA 3M9WA 2IW5A 4Y13A 3ERED 1U5TB 5LBQA 3O6BB 5ICCA 2QVOA 4HA8A 4PGGA 5JFRA 1J7KA 3MYYA 3CG0A 3ILYA 4HNQA 3S99A 3RTRA 3E3VA 4ENMA 4I2OA 2ID9A 3SQNA 3WTYC 1JL3A 2EA4A 3GO5A 2EFNA 2FEWB 3QLUC 5IT3A 3IPCA 4RGRA 2GKGA 1T38A 2EK5A 2MYUA 3W6KB 2Z5UA 5IT9Z 3KLOA 4RAYA 2HR3A 5HS9A 3Q7RA 3RH0A 1SD6A 1Z12A 2M98A 2PAFA 3CFYA 3H3UA 1LJUA 3HDVA 1KQ0A 1OYYA 1XGNA 2IPNA 1F5TA 2DQRA 4KMUX 1RIOH 4A12A 4KMRA 1URPA 1MJAA 1AWCA 1QGPA 5D8KB 2GQQA 2V9VA 1AOYA 3LOPA 2VOPA 5IUJC 4TMYA 5LEKA 3GBPA 4L9JA 3HM9A 1G4DA 3QLVA 4G6QA 3LWFA 3UUGA 4MRMA 1O3QA 4HX7A 4IHSA 4Z4GA 4XSZF 1IXCA 4IVNA 3JSOA 3GFJA 3I53A 5FFXA 4W5RA 1CGPA 3L7WA 4Z4CA 3O2JA 4RS3A 2A9PA 1ZLKA 1KYZA 4P9UA 3FFTA 1BAPA 3CUQC 3RKXA 4MR8A 3H1FA 2PMUA 2MLKA 1KU7A 4NQWA 1YIOA 3MF4A 2EV0A 2JSCA 4IRGA 3HOSA 1KQ8A 2L19A 1USIA 5EWJB 3A3KA 4Z9AA 3CLKA 2A9QA 4IHTA 2VC0A 1J75A 2DK5A 4YIFA 4RB0A 2ZWMA 6PAXA 3HUUA 2E4YA 3G85A 4LG0B 4MS4A 1G3WA 5HS7A 4IRXA 4B09A 2CGPA 2DAOA 2BGCA 4YFXF 3MZYA 3GWGA 2CO5A 1MJ9A 3EAFA 5H6RA 1BI1A 1BI0A 1J9IA 1G3YA 3Q7SA 2KJBA 2O3FA 3KTOA 4MR7B 2CYYA 3T6KA 1YK0A 1QZYA 1AB5A 4WCGA 1P6QA 4ESJA 4OTZA 1ISRA 3V8JA 3FMSA 4EY3A 2K86A 4BH9A 5DCMA 2PG4A 5EWLB 2HTSA 1B6AA 4IPAA 4RXTA 5DV5A 3ABTA 4P1ZA 4ZYDA 4MS3B 3HSEA 4PGHA 1Z2DA 3HEBA 4GPAA 3IP9A 3KZZA 1W9HA 1Z16A 2NT4A 1D4ZA 4EVIA 1IIBA 1P4XA 4JB0A 2L2QA 3BP8A 4TN5A 4KREA 1DCMA 3W9SA 2A69F 1R1UA 2KRFA 5F6FA 4MTDA 2FEZA 2MYNA 2OBPA 3R0JA 1FZPB 1IN6A 2VE8A 4MHGA 4RY8A 2FXIA 4ZMRA 2HDCA 2QV0A 4KN4X 1GUDA 1STZA 1ZLJA 4LE1A 3EODA 3MM4A 2X0LA 2W24A 3RPUA 1MDMA 1QNLA 1JFTA 1PNRA 3WODF 1VKRA 1WQ2A 2FNAA 3MFKA 3J81K 5K5QA 1IN5A 3RKYA 4ETNA 1FBSA 3QLTA 1R58A 4L5JA
chains in the Genus database with same CATH superfamily
5IW8A 1JTEA 2GSDA 3CSDA 4RZUA 1SJ9A 3K15A 2CJFA 2ENWA 4TYQA 5LXTB 2YYZA 5JJBA 2DMUA 4WBNA 2HMVA 3KYBA 5JCPA 2OV1A 3GFSA 1IOLA 1VLVA 5SY9A 3W1VA 1UIMA 1QDEA 2WQ6A 2ZG6A 3W8RA 1DVRA 5DHPA 3RIXA 2ZRAA 3CURA 1CUVA 1T5SA 4CCSA 3G2KA 1EDZA 3Q0UA 4AU1A 2XUIA 4LJ4A 3CJNA 3JU3A 3H2GA 2M6KA 3RODA 2QE6A 1BRTA 4GZ5A 5D3MB 2EQAA 4MRPA 3SZLA 4DCSA 3MMSA 1HH4A 2DA1A 3A1DA 3RAJA 2V7XA 4EYSA 3W2VA 3NOXA 3CQZJ 2HJSA 4MWEA 5LUBA 1L7OA 3DGEC 2WQ7A 3QZUA 1T8IA 1LE8B 1E2MA 3WGOA 2R25B 4PAOA 5I5GA 3TFQA 5B3JA 1LH0A 5DT9A 1ISGA 1JUPA 2Q4DA 1CNFA 3I3SR 2FEPA 3WE7A 5GOZA 3Q98A 2Z3VA 4QGFA 2J32A 1WABA 4QLOA 3GCXA 1ZKDA 3RU7A 2WTBA 4N6NA 1Z18A 3G0BA 1WUKS 4AG6A 5AJHA 2KI5A 5FCDA 5HYVA 1T2NA 4OYHA 2MD5A 1JS1X 4BHTA 3GK3A 2HFJA 1OFCX 4DMCA 3O84A 3HSYA 1LSOA 2DHEA 4FD2A 4QJ3A 3QE4A 3PNBA 4G6TB 4YLEA 2UZKA 4YP6A 3DTNA 5DXJA 3UHFA 1D6SA 3HB7A 2YJ5A 4OQLA 5COQA 2FLVA 2R00C 2Q9CA 3NNSA 2ONCA 2A1UB 4OX9Y 5BV7A 1L9KA 1CY4A 2P3QA 4UTOA 5IDYA 3D2AA 2C4VA 3EASA 2G06A 1N9GB 1TWAJ 1Q3KA 1RAFA 2R6GA 3LTNC 1VI6A 2HWYA 2YDYA 3U21A 2XTJA 2OKGA 3L1JA 2C96A 4DEVA 4Q15A 3NKFA 2VP4A 3JWPA 4L4RA 2HX1A 3K2ZA 1MMDA 3RS8A 3BEDA 2MT9A 3KALA 4JODA 2VDLB 5J47A 5CX1A 2JC3A 2O19A 3I28A 2ZKZA 2QS9A 5KWVA 2AFIE 2LP0A 1GVDA 4KQIA 1PYDA 1NTRA 3A3PA 3ORQA 3RROA 4YY3B 3JTHA 4OJNA 1DNPA 1Y4AE 3SLGA 2GFHA 5DYYA 4O2BF 2OQVA 1IPHA 4RVOA 4A0QA 1DOAA 2JUCA 1J22A 2BUBA 2QB5A 3TAXA 1GTMA 4AC9A 4KSCA 2HRCA 2DTDA 5FRMA 2JCVA 1JXQA 3PQ7A 5C5CA 4ZREA 3F1KA 1W36C 4YRLA 2CWEA 3PG5A 3BR6A 3RC7A 4L95C 3ASYA 1C7JA 3IKJA 3SOPA 4NCAA 3P97A 1F36A 3QWFA 3TQFA 4FINA 3DV9A 1AS0A 2D1VA 4G7ZF 4NCXA 1OC2A 5E1XA 2NAFA 5M3FJ 4U0WA 5KJCA 2D0IA 1YS2X 2Z6VA 3B7PA 4HZFA 4HNVA 1E0EA 1DSSG 2F9LA 4IHJB 3EQ8A 2ZYTX 2AFHE 1EHCA 5A9RA 4BYGA 4UB8C 2WNIA 3HRIA 2IDZA 3ZEAA 3L6RA 3C8DA 2FSVA 2NU8A 1IBSA 4C0WA 4R8SA 2P7VB 2HYIC 4AT1A 3HVRA 3TFWA 2EZHA 2CE7A 1OYWA 3MLBA 3KIPA 1I14A 3CYFA 2GCEA 5JR3A 5IOYA 4R2MA 2XPWA 1QLHA 5I6DA 5C8YF 3AI2A 1OT3A 2VRBA 3NTVA 4UXIA 4A2QA 4CCYB 3KEMA 1GSIA 3U48A 1GD1O 2VJJA 3WHBA 5C80A 4A3CJ 1YVDA 4ZZ2A 4OMYA 3EX7C 3QNUA 1Z2PX 1N9ZA 1AHIA 1A9RA 4H77A 1DXHA 5KSOA 3FPCA 3M6WA 3A9RA 4Y2XA 5CA1F 4PAQA 1H6CA 4OHZA 1YJNI 4M3BA 2MSKA 3KSUA 4MDYA 2B8JA 4A3LJ 3FM3A 3CV3A 1IM8A 2QGNA 4BUPA 1II8A 1P4RA 5CTAA 1NF8A 9ANTA 2XVMA 4YRBA 5BVGB 3FXRA 3P0FA 1YIDA 1MOQA 2XRZA 3W5CA 3REOA 1ZKGA 3KQKA 2QAJA 2WJIA 5BSRA 3Q9SA 1G0NA 3CZMA 3NZEA 1FY2A 4Q12A 3ZGZA 3C45A 3V8MA 4LRUA 3BJRA 4G5FA 3QQ5A 3RIGA 3RS9A 1H6DA 3E6AA 5EGSA 1MABB 1H9TA 5THKA 4KJXA 5CLJA 2GZMA 2IPMA 2I3GA 2ZNZA 3O95A 3VSCA 3IJRA 3KV1A 4R0VA 1JJAA 4BY7J 1JJ8C 4ZQIA 3QFCA 2WD7B 1SUSA 2ZBPA 1Z7EA 1HPLA 1V43A 2BEUA 1HE2A 1Y6IA 2DBQA 5DGIA 2B1IA 4CQLA 4K6CA 3ETNA 2BVMA 1XU7A 1ADBA 4W9MC 2PPVA 2DFDA 1QH1A 5GAGJ 4S2UA 4CEHA 3JRWA 3GVCA 1KEEA 1T98A 4U00A 3AW8A 5JNSA 3ZOBA 3GTJJ 2Q7XA 3PNKA 2P5LC 3QJ5A 3LOCA 4JSTA 1D8AA 5J9FA 1D2AA 4LW8A 2CD9A 2GK7A 2OPBA 1S72I 1TPZA 1G60A 4WA7A 2MH2A 4NF2A 3R5KA 4NK5A 4YUAA 3UKGA 5BN4B 1B4AA 1XVUA 2Q8NA 4B0OA 3FCAA 4GOND 4E11A 1BJAA 1RWMA 1RHMA 3C2HA 3LS2A 4MPTA 2QRLA 4ONEA 1DCKA 5DZSA 3DNPA 3E5UA 4NHJA 2RFLA 1RKBA 1DDNA 2ZM6B 5SYMA 4P3KA 3EZ9A 3G2QA 1V11A 2YW2A 4AJLA 1Q1QA 3DE1X 3NOVA 4ECEA 3E2IA 5FBZA 1V1RA 2HDDA 2D1YA 2RJOA 1DFHA 4UZSA 4BQRA 3OUUA 3H5AA 2ZXWH 3C3YA 4PS1A 2FRXA 4F93B 3OEHA 2VPTA 2PMCA 2G4CA 5HXAA 4Z6KA 1CUYA 4Y2SA 2IOFK 2WA0A 1E2UA 1Y6RA 2M3AA 2ZOSA 3UMBA 1BA2A 5GQSA 3S2ZA 1M7GA 3NRVA 2O2XA 2RH9B 2N42A 5LZ2A 3TIXB 3TDMA 5KTSA 5T4BA 2ZUWA 3X1YA 1Y8QA 4WN9A 5JS2A 5IWCA 4LXQA 4BNLA 5EMKA 4JVOA 2NQ2C 1ZSNA 2DA5A 3FUCA 1T1JA 2NU9A 4ME6A 2ZR7A 3H1GA 1R6UA 3BCAA 4A0XA 1X15A 1Q1GA 4OF4A 4MI3A 3KUXA 3EK2A 3PE3A 3TTSA 1TEXA 3WIOA 2DKFA 2BV3A 1JEQB 3H5RA 4K2EA 4URYR 4E33A 3LUGA 5BV1A 4HDOB 1WUHS 2JJMA 4UAGA 1C3OB 2C7GA 3S8EA 5D6OA 5KVVA 2FPMA 4P93A 1HKQA 5K3CA 4GOMD 2G04A 3IT3A 4ZCLA 1Z8DA 3A32A 2WAQA 2PX2A 4XNFA 1NRJB 4EARA 1NVKA 1KETA 5D01A 1M2VB 1YO5C 4FT2A 1R16A 3H5LA 2FG7C 3SJCA 5H3LA 1D2CA 1ORVA 5IT5A 2R7UA 1Z15A 1OWLA 2JN6A 4MQMA 1HW2A 1JR3D 1AY0A 5J2TB 2QG4A 4ZVUA 2HSZA 2M32A 4X9XA 1VP9A 2DMRA 2QEQA 2R8RA 2ZYVX 4HX5A 3PFWO 4ZC3A 2ZSAA 1DUXC 4ZYVA 4CIDA 4BNFA 3V8RA 3QBJA 2ECQA 4ENKA 4DIFA 1HMYA 3RU9A 3EFHA 2RC6A 3CRZA 4BN5A 1XZEA 2J9YB 2ZIWB 1U3GA 1L5RA 3JVIA 3TDUC 1ZG3A 1BVYF 1RLIA 1P18A 4B6SA 5K09A 1PK8A 2HUNA 4R1QA 3AF0A 3DDOA 4UARA 3WDSA 1I5ZA 2IHZA 3LLVA 5FOVA 1ADCA 1I24A 3DMGA 4FONA 4S1TA 3L8HA 4ASUD 2Z9DA 5AW4A 2G17A 4HLUA 4YN3A 2QRHA 4HQFA 2P4UA 4EM0B 3H1BA 3PENA 4XPIA 5C4XJ 1U2EA 2HVRA 1VQ5I 2ZJZA 3MTIA 1DU4A 4ZQBA 1HL3A 2AEMA 1MB4A 1N5IA 3WX0A 4P92A 1XGMA 2X4HA 2OBBA 4UEQA 3BSFA 2DX7A 4GUAA 1O8BA 1UXJA 5HZMA 2BONA 2QD3A 4ZGGA 3B1FA 2ZJAA 2QL6A 1KXJA 1T8YA 2BBYA 2JA2A 4HDUA 4V0RA 4GECA 4Y1FA 2JIQA 2FHSA 4FW8A 4OG2A 4YJHA 4MFEA 2KRCA 4ALIA 2XHKA 3HZOA 4RPHA 4RELA 3UWKA 5L7YA 3E22A 2J87A 1E69A 1T9BA 3V7CA 1E59A 2GPNA 1XG1A 3TXXA 1CP2A 5I9IA 6REQA 4N03A 2G3YA 1REPC 3AZQA 3O73A 4XWYA 2JLRA 4U7BA 4F72A 1U1EA 5E7MA 3ANXA 2DA3A 3UMMA 2PVPA 4G5YA 3C3CA 4MXDA 3SJZA 1YTUA 1Q7TA 4XTCS 1G8YA 3TDNA 5LZ7A 1A6IA 4K86A 1Y89A 4KGDA 1ISFA 2QYHA 5JH7B 4DBZA 2ANCA 4XGIA 1SVIA 3N6VA 3TD2A 3KP4A 1IDN1 3R24A 3P32A 4FD3A 2E1MC 5L3QA 2PSDA 2HH9A 2VOEA 1E98A 3B6JA 4X92A 1C8LA 4I6ZA 2FEOA 3PWZA 3TQRA 1WQ4A 1WEHA 4QBIA 1QP7A 2GTIA 1UXKA 2VZ9A 5CA0B 1Z6ZA 1XQWA 1Y39A 4MLCA 3ZV7A 3MJSA 3WHLA 2ZE5A 1JGTA 4GKBA 2BI4A 1LF0A 3AHIA 2I2BA 1LPPA 3QNWA 2PV7A 1Y3AA 3B3QA 5DLQC 4E0BA 3BORA 3E2PA 4YRCA 4IX1A 3ORFA 3LQ1A 1OBCA 3OZUA 1C41A 2BY2A 4GLJA 1SC3A 3KAPA 2JW5A 1KDVA 4ENQA 1IY9A 2DUUA 2FEMA 2GCOA 3RRZA 5LIPA 3KLPX 5L4SA 1CWUA 3IKLA 2KM1A 5B30A 2HNAA 1TA4A 5DYNA 4LFBB 3HUGB 2WZCA 4HI0E 3RVQA 1FDUA 3KYDB 4HQMA 4ZVNA 1XLVA 2A5WA 4XLAA 1GAWA 5FROA 1U5TA 3EGDA 4F97A 2W2OA 1Z4NA 4YEJA 1T5BA 1AKUA 2PVCA 1PLLA 2FPSA 4TTQA 2D0OB 3HJTA 4RC9A 5AJWA 5MGBA 4TV9B 1MQAA 3L5KA 3N1UA 3IXMA 3RREA 4FC6A 5DV9A 2AHQA 2D00A 4F21A 4POOA 2ZMEC 1SBCA 1PEKE 3ITNA 4WLOA 5AVRA 4DCGA 3I12A 2GN1A 2LKCA 5ED0A 2LBFB 3LHFA 4UZFA 1ORHA 3DLIA 2P90A 3TRKA 1EFHA 2HA6A 3R0AA 3BY6A 2GUGA 2VJMB 5HDNA 1PWZA 2WIDA 3OESA 4IMJB 4HGZA 1RKWA 1JFRA 5E6RA 3E8MA 1I94B 4NNJA 3LRTA 2Q9AA 4S1OA 4EEXA 2M8GX 2VASA 2F7SA 1FTNA 2JIMA 5J1UA 5CVIA 5HIKA 4EI8A 1NXWA 4GPIB 5KBYA 1LQ1A 3AZPA 1YUBA 4M38A 1TNSA 3WMWA 2LK2A 2JIOA 1JX6A 1XCBA 1N9KA 2E5FA 1CJBA 5AK0A 5E18F 2WTUA 5YASA 3UQZA 3T3DA 3G9TA 2IV2X 3Q5DA 1NMYA 3VU9A 5IT9A 4FYWA 3EAGA 4MW1A 4BJHB 4JVNA 4PZ0A 2QY6A 1ZESA 1AD2A 3VYSB 4ICIA 3R23A 1EE9A 4KH1A 2HLDD 5M5WJ 4LJAA 3G8YA 4IIVA 1SQSA 3FJ1A 3JRCA 3CEAA 4IHYA 2VZ8A 2E9SA 1ETXA 3UHAA 4YDQA 2B1QA 1ICIA 5AT1A 3OIUA 1CJTC 4A0RA 1ZY2A 5KYXA 3WTSC 1SQ6A 4G1CA 5G0TA 1YL5A 1TZKA 3ZDQA 1AQJA 4B33A 5EZYF 3IMEA 1AHHA 3ZHBA 4OIMA 1E3PA 2YUIA 1B23P 4HVLA 2OCEA 3INTA 1R0RE 4P4LA 5FDFA 5FGMA 2NZJA 2PS1A 1EUYA 4XWTA 2V4JC 1EM8B 5EKSA 5JD5A 4PO3X 3IAAA 3FYUA 1XVIA 1NJFA 4O4LB 4MIKA 1OOEA 4ZYEA 1AV7A 1YZ3A 3ZXYA 4LF5B 1VA5A 4AMBA 1QP0A 3F8NA 3ASOH 3HJNA 5H3HA 3HR4A 3JTGA 4FISA 1Y8CA 2D5LA 3KHSA 1QHFA 4HQLA 3I8OA 1NG7A 5ILQA 3SHWA 4MV6A 2Y9YA 1UK6A 2DU8A 1N2HA 5EYPA 4KITB 2IEZA 5EWMA 3UGKA 2W7NA 1E2XA 1II0A 3NDPA 3R6WA 1WKBA 5C3UA 1M9NA 1USVA 4QNMA 4WGGA 3EVAA 2BFNA 2BY0A 1B72A 2LDUA 4ZU1X 3VZSA 4Q93A 4FS3A 4FYMA 5JUWA 5HSGA 3BQZA 3MD0A 2SCUB 2C00A 3RVMA 1LF5A 3EXEB 3NM5A 1OFUX 5EGOB 1PE0A 4XZ3A 4BVBA 5F77A 4MEXF 3QPUA 2WC1A 1MT0A 5FLXA 5H1YA 1RE1A 4Q39A 3ERMA 1D0SA 1XC5A 2JASA 2CFOA 3GAAA 5LP6C 1Y8RB 4AKSA 3JR3A 2V1DA 2CFTA 5KAIC 3WQRA 2WLTA 2Y0EA 3V32A 1GGVA 4JJ6A 5DYTA 4XRSA 2PRZA 2QRVA 4I2OA 3CZ6A 1EVLA 5IT3A 1GGNA 5AKYA 3U3OA 3BMOA 1NPYA 4C9YA 3OCXA 1SD6A 3AHFA 2VR1A 1KQ0A 1TTPB 3KQUA 1DX9A 5F9FA 2GBLA 4B8ZA 2XHEA 1Y81A 3X1WA 1AOYA 1UFRA 4EGJA 3ST7A 2CC2A 4MLOA 1RM3A 1K83J 1GG5A 2E2WA 3U44A 4N3AA 1H3EA 3DE3X 4ZT5A 4I5DA 5I4IA 1IXKA 4A0GA 2EARA 4LMBA 4OKIA 2TYSB 4KPUA 3I5XA 3FMFA 1TT7A 3OQHA 4IJVA 3SIPA 3DQQA 1ZUIA 4W82A 1KDTA 3FN4A 1V25A 1YZVA 3D6FA 3W9YA 5G3ZA 2YHUA 3VX4A 1PRYA 5E3LA 3DDUA 4DT1A 3PUFA 3GWGA 4QUHA 3MJHA 1JAZA 5DLYA 1W7AA 3LH5A 2FWBA 3LL4A 1CFJA 3BIOA 4EMUA 4OTZA 1B42A 3ZWDA 1ZP6A 4L4ZA 1IUNA 1PAUA 4E4TA 1Z5OA 3HSSA 1W4AA 1JAXA 5EWLB 1OH6A 1XZKA 1XZHA 4IPAA 4LNUB 2FAXA 3IELA 1A9TA 1KP3A 3IAM6 2ZT6A 1VA4A 3E3NA 1EIWA 1M8PA 2J7KA 5GONB 3ABOB 5F6FA 3B3AA 5EIEA 4KN4X 2RSLA 3EODA 3CWZA 1YA4A 2BTOA 4NYIQ 1W0JA 2RI1A 3SF0A 4L8FA 3WO0A 3ZCXA 1R58A 2XMZA 1T35A 2ZJPF 4IOAF 2XECA 1U04A 3BGDA 4HUJA 1JQDA 1PGPA 3WLQA 4MGYR 2BJWA 1FEXA 4HAOA 4I0WB 1B59A 1EK0A 2GPSA 2WR8A 1ZWKA 2UYGA 1NF2A 2N46A 4MS1B 3R3SA 1UEXC 2YBDA 2XE4A 4Q3NA 3A7DA 1ZD2P 2FK8A 3ZD7A 5LDHA 4HOYA 4QDKA 1G3MA 2IW1A 2F8MA 5JS7A 4WGFA 1XWFA 4IH9A 3OQBA 1PJRA 4BVFA 1XJWA 2PXAA 4BLPA 1V96A 4NENA 5JZMA 4N5LA 2R4UA 3AGQA 3NHFA 1YKFA 2XMDA 5F4ZA 3DP7A 1C9YA 5ESXA 4DNXA 1UBHS 3DPLC 5KOIA 5ES4B 5FWXA 4WK2B 4OHRA 2SECE 4J7UA 1XDGA 3QV1A 2LTAA 1RPNA 3ZZ0A 1NAHA 3G3EA 1Y9ZA 3V4VB 4FT8A 4NG4A 1UJCA 2H5IA 3NJ4A 1WCYA 1RJWA 1HDRA 3HY6A 4J7AA 5JBQA 2EVWX 3SHOA 5DNAA 1II9A 4TRMA 2O0LA 4NQRA 2G63A 1YL7A 2OCDA 4QRDA 3VSBA 4Q37A 4ANJA 3W2EA 4OLFA 2X2FA 1FQJA 2XGOA 3ECSA 2DSTA 1Y63A 1P8AA 4LY6A 3RSZA 2ZE6A 4MQLA 1V4VA 4HWGA 4MVJA 1B00A 1VPVA 5DIZA 3S2EA 1HE3A 2BTQA 1A1SA 2F5EA 3FOBA 3HVKA 4RZHA 5E7JA 2C94A 2ZRPA 1RXUA 3KKQA 3GLVA 4FXOA 3CZ5A 3WHKA 3EWIA 4K5QA 4RK6A 3ENQA 2C3OA 1H22A 4H4EA 4ZCIA 4MYSA 3GMIA 4NC6A 1TRKA 3VYWA 5FPKA 5KKAA 2QKMB 2HXOA 2UYOA 3WLMA 3AL0C 1RC0A 3QEBZ 4JDPA 5H70A 2OHVA 3KDSE 1HTWA 4Y6SA 3EQ7A 1T3TA 5BY2A 1FBTA 2C54A 2PJPA 1T43A 5IP5A 1ETOA 4O4HB 4LBVA 1KDZA 1E1QA 1YJBA 2G25A 1HOMA 3AT1A 2PD3A 5CCBA 1GQQA 2HIAA 1NP6A 3F6OA 1FTZA 2IOYA 2HNKA 2HJGA 1JYEA 2P41A 3P2KA 1PV4A 1VHLA 1G3UA 4Y7CA 1ZOSA 4UBNA 1O54A 2O2EA 3ESQA 2R8YA 4Q21A 4HATA 4EJUA 3E8XA 1SVNA 3QOEA 2VPLA 3AKYA 4G65A 2QVYX 2ISQA 1A2KC 4MHOA 4RHUA 4NZPA 3ZBTA 5LQKA 4BVEA 4H0FA 4UBKA 2RGDA 3GLFB 1XTUA 3L7JA 4KSBA 2BGTA 1FW8A 3L4KA 3Q15C 1IRXA 5H80A 5C4GB 1TQ4A 2GN9A 2FFRA 3Q88A 3L43A 2A1TS 2HCBA 3OPYB 1SRRA 1CY6A 2FUEA 4ZOLA 2WMNB 4ZVRA 4H60A 2X9LA 1FTTA 1GA4A 1DJQA 4HRAA 4ZI2A 3EG9A 3UMCA 3QI7A 1Q1AA 1R1TA 5DLEA 3O3OB 2O57A 3ZY6A 3FUWA 3PWSA 2DP4E 3TWOA 4G1MB 1T4BA 4U02A 3SMVA 4CMCA 6PFKA 5GV7A 5AQ1A 5KPDA 2GCGA 3QUQA 3CPJB 1E9BA 1E3TA 2G09A 1SEVA 4S2EA 2JKZA 3I4NJ 3KOXA 1LVUA 4IOMA 2HA0A 4L75A 1SG0A 2DPDA 1E9DA 1THGA 4J6EA 1LRLA 2PN1A 3OYGA 4Q1DA 3LPCA 1VQLI 3QE2A 1NULA 2HRBA 4EELA 5HIAA 1Z4QA 2OFPA 3Q3CA 1MU0A 4QGHA 2Q0XA 1K27A 4GWGA 2C99A 1JWLA 1LTQA 2O8CA 3ZUPA 4MCAA 1WQ3A 3C8MA 4AQ7A 1T3GA 4FMDB 2ZJRF 1L4GA 3ZHZA 1U2DC 2A8YA 4UUBA 2VYCA 4C7OB 1WWXA 2HI3A 4I8IA 1MIOB 1VL8A 2WVHA 3PXUA 3GJ8A 4FZJA 3CW2A 5ANRB 3RR2A 1MH4A 1ZMXA 4Y98A 4OAZA 5AHKA 2H07A 4GDFA 3OU2A 4Y15A 1N0UA 4ZQGA 4DA7A 1Z77A 2KE5A 1T4CA 3SNKA 3HUFA 3H97A 2WUDA 2F3UA 4A8PA 1DU6A 5D7NA 3WGNA 4J0HA 1S29A 4XLPF 4ZZDA 4KMOA 5AJVB 1B16A 2R7TA 2W58A 2L0KA 2WZQA 2ZRCA 1BH6A 4OM7A 1DXOA 2FBKA 3G7NA 4MRNA 4OAOA 2JH9A 1UMBA 3HCPA 4DV0B 2H2FA 4CFSA 2X41A 2H4ZA 4GOJA 4EOGA 4TT3A 4ZJUA 1CX9B 2ZJ2A 1MB9A 2CDBA 3EWAA 2X6TA 1OFHA 3WRWA 2Z2JA 2AYYA 4JLKA 2REBA 3WTCA 4Z2AA 3FIUA 5CCEA 4RZXA 2QNRA 1U1CA 4EJWA 2Q1UA 3E05A 3ZWWA 3HA5A 3I01A 3OKPA 4B3SB 3DMTA 3VAYA 3OOPA 1MO6A 4RJLA 4YAOA 3QVWA 3G0HA 2JRMA 3LBFA 3LY8A 5FI3A 4EW6A 5KEIA 2J07A 3MLAA 2HDHA 3B38A 3D1VA 2IL1A 3WVNA 3ADPA 3HJGA 3ROTA 2I4LA 5IN4A 2VUMJ 1ORWA 1Y1VJ 3PHGA 2D13A 5F0HA 2Q8PA 4MMZB 2ISYA 4BEHB 3KUUA 4ZO7A 2P8TA 3VO8A 2BI7A 3JWGA 3HXQA 4AN1A 2CHUA 1HZJA 1SOWA 4W5HA 1ZH8A 4RCVA 3I5MA 5ITZB 2V3VA 3QY9A 1E7WA 4TUYB 4OJTA 1U81A 3P0RA 2R8OA 1I4TD 2EFWA 2X4IA 3F6RA 1ADYA 3IVGA 4QTZA 2A7XA 2E1RA 3R7DA 4DVJA 5DSXA 1H9BA 4O1HA 2PZBA 3PNVA 4XXHA 4GFBA 1NSTA 5IAKA 4JI7B 3FVQA 3TW4A 4UVAA 4I14A 3ZJTA 3F7OA 2JIBA 4H7PA 2VJNA 4JYKA 5ALIA 5B1IA 2HXSA 3DVQX 4AJOA 4YJ2F 1OH7A 5CPBA 3WLNA 4HS4A 1CK4A 2PG3A 4MNUA 2KP6A 4WOBA 3RJZA 3ACDA 4K9PA 3P9IA 2LD5A 4FOSA 3KZVA 1XZJA 3LDAA 4QBGB 2PNJA 2WHPB 5IXSA 3GUVA 3UKDA 1DT3A 2JGNA 4HAVA 4CIWA 4YI5A 1QV7A 2WB4A 2XUQA 1QIIA 5FFZA 3NWOA 5IJZA 1ND6A 5HF9A 3RADC 4YMLA 4K3VA 2GAUA 2PGLA 4H3KB 2I8DA 1G7CA 4C6TA 1M34A 2VK8A 3QP6A 1FYFA 1W4LA 3K53A 5TR9A 1OX5A 3CMAI 4ZEWA 3RFTA 2C59A 1OGYA 1HM5A 1E64A 4HTFB 1C9JA 2JL1A 4OIPF 1MFPA 4ZANA 1QQTA 3AM3A 4IJWA 2BFPA 1HUQA 1SXHA 1R5JA 1MC5A 4H7HA 4AL4A 2COKA 1BCSA 1JQJC 3N2NA 1CUXA 2JGIA 2CLDX 1ST3A 5JJKA 2G6BA 3T5PA 4FOLA 1FJ2A 4CM9D 2X77A 3BSYA 1G18A 4R3WA 1JDBB 2ZIVB 1RHJA 4NJMA 2DZDA 1PG2A 5LD2C 4TKUA 3BRWA 5BSFA 3E58A 5B58T 2IYTA 2ZUEA 1NBAA 2BGJA 3N76A 5GJVC 3SSMA 1PL7A 3QPSA 1YH3A 3H11B 1WL8A 5E17F 1UPXA 2BEJA 3EWSA 2FUG1 2X13A 2FX3A 1N2JA 4RETA 2TDXA 4FUQA 1SUPA 4WK4B 3TTTA 1RR7A 4CU2A 4C89A 1C9EA 1H2YA 3IEXA 1DIAA 1U6GA 3KJIA 5EJCA 4KXFB 5JBNA 4K3UA 1R4NA 2P6NA 2FE4A 1U2TA 5IAJA 4LQCA 4D02A 3D2CA 4YB8A 1RJDA 4D3XA 1YI8A 2PQMA 3O8HA 2I4IA 1D0IA 3F9RA 4RNDB 1FMJA 2I3DA 3L18A 1JDZA 4YS6A 3ZHRA 1RVDA 3OZIA 4OQFA 3OU6A 1NVEA 3RTGA 3QEMA 5CBPB 4BATA 4JY7A 3OJWA 4BLUA 2P6UA 1YE8A 1P4JA 4EUKA 3DOFA 1DTSA 4LNAA 1ZD4A 4PO8A 4F06A 4DPKA 3U2RA 1T1EA 3P45A 4CBVA 4QJIA 1IOVA 4BXOA 5C4IA 4G5GA 3DMHA 4M0KA 1QAMA 3GUDA 2C0PA 5DNVA 5LLDA 3H2BA 3INGA 4P0QB 3L1HA 3EMVA 3OZSA 1HLFA 4EJVA 3E7DA 5HCUA 1V45E 1Q0SA 2Q3CA 1QO0D 1GDHA 2XOEA 4LHEA 3EISA 5HF5A 2A78A 2GRUA 4TV8A 1EWRA 1FFHA 1ZGBA 5EJAA 3BQ9A 3D8TA 3M4YA 5B1EA 3I59B 1EP2B 5T57A 1Q0PA 2YWFA 3RYCB 2GAAA 4K87A 1QHHB 1TM4E 5A6SA 2BE9A 3OY7A 3L0ZA 1VIYA 5ULLA 1QU2A 5TV2A 1FNMA 3HR7A 4Q7MB 4UUSA 4H59A 4E1VA 1FTGA 1L5SA 2XV4S 1U1GA 2NTVA 4DG9A 4R1OA 5EIOA 2PX6A 4MV4A 4B85A 4XB1A 2H3EA 2GKSA 3LLCA 3VFDA 4PLZA 2CUFA 1OCRH 1NW7A 3H05A 1E9CA 2H0QA 4UVDA 4BHBA 3D6UA 4D8WA 4KR2A 1RPJA 3QU5A 2TMGA 4E07A 2VPXA 4ALKA 1V8PA 2IUSA 3VH2A 3G73A 4Q7KA 2JCGA 4BWFB 1WXWA 1W5TA 4XM0A 1V9LA 1XLTC 2XGCA 4B6OA 1UXOA 3PEVA 2H1RA 3HA2A 4AMGA 5K8VA 2JCBA 1A50B 4Y0VA 1SIUA 1ZXLA 4I4TB 4RZ3A 1TM7E 2WY8Q 5E1BA 3FH0A 1U5TC 1H93A 1O1YA 2PMDA 4S05A 1CQXA 2BR4A 5F7OA 4NCBA 5LOVB 3OZXA 2FCAA 5JHFA 4R05A 4KP7A 3UA4A 1A3CA 1CR4A 1CRQA 4IFEA 1Z0UA 4QG3A 4UUMA 4AX8A 1W93A 2WJ6A 4XSGA 2GN2A 2BYTA 1Q57A 4JKIA 4PFKA 1V5EA 2M30A 4V0ME 4EHKA 1ULUA 3PFFA 4TS9A 4RYDA 3AUSA 4S04A 1FXWF 5DTEA 1PD1A 1R0ZA 4TQ9A 3S3TA 3L2UA 1OQAA 4IEFB 1DC6A 4I99A 3UPDA 3ICVA 5K3DA 2ZETA 3U7IA 2DYSH 2ZBKA 2ISZA 4G4SP 1SPBS 4JJ4A 2IGOA 2AE2A 4JJ8A 3LBHA 2PTGA 5BNTA 3BCBA 4ND8A 4FJ0A 2PLRA 2QJWA 2VZ0A 3NNDA 1C0PA 2ECBA 3DEFA 3NATA 2WU4A 1G4UR 4D8TA 3FPGA 4D2IA 2CVHA 2P5UA 1XLWA 3QXXA 2BFEB 4KUEA 3EEFA 4WFJA 3NTOA 4NC8A 2ATXA 1UEJA 1D5WA 1QVVA 2XZLA 2ZI4A 3UWMA 1S6LA 2QYOA 1NN3A 3DOOA 1X7YA 1YI0A 1FPMA 3REQB 2XI4A 4YMSA 3FVTA 5A4JA 3CMCO 4AJ4A 2ZTUA 2AR7A 1WWKA 3KSRA 4UDNA 1Z0JA 1XU4A 4KE7A 4GVXA 5AVVA 3FNIA 1AKVA 4NFSA 1K5PA 1HFWA 5ILOA 4F4DA 4YFVA 3G9ZA 2BFBB 1WUIS 5JTUA 1PR6A 1TVKB 4QU8A 3ZBUA 1Y0BA 4LOCA 4XCXA 2CLMB 3WK7A 2OC4A 3MT0A 4DNQA 3RC3A 3ANTA 2ACEA 1T10A 4BPRA 3E6DA 4H3VA 2JLSA 4G7OF 5FRDA 4CLOA 5AKJA 2CSOA 2C4MA 4H2DA 3TOVA 3QVUA 5F1PA 3L00A 3OKCA 2LRDA 3OTOB 2Y1LA 5TLSA 1KF0A 5A2GA 1ULBA 4R7GA 5JDIC 4HNAB 1YZLA 3HZZA 4XKWA 3QE3A 2R4QA 1L5ZA 4NESA 1CTQA 1X3SA 2QL9A 2N8GA 4L3WA 2I7DA 2E7ZA 2XXAA 5GZ3A 1JGSA 1VRVA 1JEOA 1QP8A 3BWMA 4KN6A 3UKOA 3U26A 1ULTA 1J2UA 2QQGA 4TWIA 4MRVA 5LQAA 2BJVA 3SFIA 2BCJQ 2V54A 3BB4A 4ZMBA 5H0IA 3ZDCA 2DULA 1TYCA 3NM4A 2XKJE 2BGLA 4CZCA 1HQDA 3KZOA 3QIAA 1C4WA 2YRXA 1JLKA 3OQVA 3FBTA 2KS6A 3WL7A 1GAEO 4I55B 3EH1A 4UHEA 2WAAA 3I61A 5ALXA 2JAPA 1XZFA 2RGXA 3WB0A 3ZHOA 1YDWA 3DXYA 5DCUA 2Q4BA 4AY3A 5EMNA 4INAA 3COYA 4L9NA 4BB0A 4A2CA 1V9CA 2JMWA 2ZPTX 1VE5A 5HF6A 4BRZA 2DYRH 1KONA 3AHHA 3WS7A 2CSUA 1JHMA 4G1VA 1RI2A 2BDTA 4KNWA 5B5EC 3DF9A 4NZZA 3EG5A 1VLJA 1GAQA 3ZVNA 4YRFA 3K1NA 2HNBA 2P6TA 5D1HA 5DBGA 3GEGA 3TIIA 1CE8A 1J5PA 5EJIA 1ULSA 3F97A 2VBGA 4OFWA 4BO2A 1G3TA 4PF1A 3NQOA 3IAS6 3SG0A 3LSRA 2CFXA 4AUEA 1YFHA 2PBLA 1O5IA 3KOMA 7REQA 1OXBB 2A6TA 1A77A 1WVMA 4UPVA 4HRIA 3EVCA 4HZUA 3VYRB 1JR3A 5ECYA 5AKXA 2GBLC 1PUIA 1EUCA 5JFRA 3FXLA 4QPOA 1EVJA 1QG6A 5JMTA 3ASUA 1EEHA 1HO3A 2LR0A 4QC2A 3QLUC 2GHQA 3HZRA 4M55A 1XB2A 1CR1A 3A8TA 3FSEA 3OYAA 3W6KB 4PCLA 1Y6GA 1RLUA 5LA6B 3EIHA 3OT1A 4RESA 2Q3FA 1OPRA 3W78A 2YZGA 1MV5A 3LOPA 4RD6A 2I9KA 5ARCA 2QGFA 5AHXA 3IS3A 2EEPA 1XYYA 3QLVA 4ZRNA 3ZE9A 2D5CA 1M54A 3U0BA 4HZIA 2QJOA 1FMFA 4BEJA 3U16A 3D6VA 4FWTA 2HF7A 1OBFO 4EBBA 1UK9A 3JWJA 3GMEA 4ASUA 5LWQA 4DCCA 2O06A 1FU8A 4XIYA 3BK2A 1PTJC 2YKGA 1U8AA 1KQ8A 1T1SA 1FP7A 5KSWB 1QPBA 4Z9AA 2XRLA 1E1NA 4C3HJ 1O94D 4KTVE 4D1QA 4UAVA 3HPRA 2NSDA 3HUUA 1IHYA 3KQVA 4LGCA 4YCAA 2ZIAA 4RBNA 5JCJD 2Q50A 1TK9A 3GUUA 2IHYA 5K99A 4B45A 5H16A 1ZWLA 3DHVA 2C9MA 1KSFX 3S1RJ 1BI1A 1E5LA 1WMBA 4XWGA 1XD8A 1PR4A 5JZVA 1CT9A 3IE2A 1A5JA 5IKEA 1X2BA 1U4OA 2YWJA 4FFLA 2GAOA 1OE0A 3OJLA 4GKAA 3TBFA 1XZCA 3ABTA 1LVGA 2WM2A 3HSEA 3BBPA 1ELOA 1GDTA 2WFAA 2X8WA 1Z16A 1H23A 3CN7A 3N7UA 3NP7A 1U1FA 3PFKA 1MVNA 1UBFA 2WFLB 3OWOA 2BFAA 1S8OA 3RUDA 4BBJA 4C08A 4WHMA 3ZJVA 2O8EA 3P0EA 4G26A 3GG9A 1OI3A 1GZ3A 5EIBD 1GPMA 3JASB 3OZVA 4MA4A 1PJCA 1B3BA 5C3EJ 1MG5A 1D03A 2L7MP 2C3PA 4N4NB 1U3WA 4DEXA 1F8GA 4XW2A 1UK7A 3K9LA 3TSAA 5JAHA 3ZYZA 1XYVA 3GEZA 1UC8A 2ZB2A 4JP5A 4NBRA 2QZ9A 4MUMA 1PSDA 2QPLA 2W2XA 4W5NA 3TXYA 2GEKA 4MVJM 1XI2A 2B0JA 2JFZA 1I4EB 2IK8A 2FSHA 1L2TA 1P73A 3I2FA 2PY6A 2FW1A 4CJXA 2HO4A 5DHFA 3ZHVA 1EB9A 3HDGA 1F4KA 1IWPB 3W2FA 1GQRA 1XSVA 1Q1ZA 1MSEC 2BMFA 5IULC 2DT7B 4BEWA 3AFNA 2QD1A 1ZARA 3HI6A 1ZJZA 2DR0A 4G8JA 1R49A 3H2IA 4DRYA 2AXEA 2FRVA 1UMCA 5JSKA 1M1EB 4DR2B 1UKEA 4YRMA 3KPVA 3JAMA 3GTOJ 1QQ7A 2XAUA 3FDFA 4D9NA 3TLJA 4ZVTA 2AR9A 3R0VA 1Z5NA 4N12A 1MJNA 4RA9A 3TRDA 1NF3A 4M83A 1WOMA 4PBTA 1R36A 1NURA 5CG1A 2ZJ0A 2H0RA 4XKVA 2WY2D 3PHIA 3BH6A 3KLMX 3ETJA 4IDBA 2CB9A 1TUGA 3L7AA 4QXOA 2Y68A 4D6PA 4UEOA 2B4QA 3PL5A 3I05A 2NQ8A 2QSFX 3Q3SA 2VHXA 3KPHA 3JYNA 2LKDA 5L4NA 3KYIB 4FWIB 4G67A 3D6AA 1XE3A 2JFXA 2G8NA 1UFKA 2XPCA 4GRAA 4IXDA 1R1DA 1BHSA 2OFWA 3RS5A 3ZQ7A 3G2JA 1WDKA 1U7PA 5AIQA 1ECPA 4J29A 2NVOA 2A3NA 5JFTA 3DR5A 2KJQA 1NG6A 3BX1A 1MG0A 4MW6A 1DAIA 1JIKA 2GZSA 1CDDA 1T9ZA 1S01A 2QSUA 1QU3A 3VGPA 3C7DB 3NDRA 3JZAA 4Q03A 2AJBA 8AT1A 4I08A 3W5SA 1DV1A 1RLMA 2ZRDA 2W25A 2V97A 4F2WA 3UIEA 3RJ9A 4Q6BA 1IK6A 2ZDGA 5BWOA 2AO9A 3W8NA 2CLFB 3ZWXA 2ZTHA 3LGAA 3CUYA 3JXEA 3H0DA 1NHGA 1B8IA 2HV9A 4P3OA 3DTYA 4P96A 2EBWA 5KTTA 1CQJA 1GSOA 1ZCAA 4EKYA 2WB1N 1CDZA 1T24A 1QKIA 1TADA 1PNVA 1F0YA 1Z67A 3RM3A 1UT8A 1MX5A 1E3HA 3N6RA 2ODEA 4X8LA 1TOAA 3BTJA 4XN3A 3UV7A 4MR8B 3HCWA 2OV6A 2CUNA 4O4JA 4V0LA 1BRMA 1LFBA 3EVNA 3S81A 2CFSA 4XJSA 2GM9A 5H7XA 5BW6B 3PJFA 5FV7A 3M5WA 3D0SA 1UMDA 4NZOA 4X94A 4AMUA 2R1VB 1RXWA 3E9YA 2K3FA 3B1WA 2QGUA 1NQWA 4R9SA 1R0LA 1DAGA 1I1OA 3PQCA 3F8BA 2W71A 4E3WA 4ZK2A 3NV7A 1Y7HA 3VC7A 3PA6A 6YASA 3E0QA 2E1MB 1Y42X 3G0IA 3WSWA 2IU6A 4YJGA 4GPBA 4G9YA 4B3CA 3O9MA 3ZPXA 1MJFA 4G09A 5BQFA 1D04A 2Y4NA 3L5OA 1L4BA 1Z35A 2WDPA 4JX4A 1Z2EA 3SWWA 5D8DA 4F0JA 5JFGA 1NNI1 2RHLA 2WUFA 5EE1A 1F7VA 4W1PA 3GLXA 4EDHA 5A3SA 4NNPA 3SMQA 3JQBC 1DAMA 3OYBA 2EHDA 3CVYA 1PP7U 1XGOA 2G5GX 3BERA 1AXRA 1G291 3FYCA 1DWUA 3ZLBA 5ENVA 1K4KA 5GM2A 4MB2A 5IJXA 1QPIA 2XDQA 1SCJA 2F1KA 4MMYB 5DUIA 3TRFA 4A3KJ 1EX9A 1KZ9A 1GYPA 4M8IA 5HA5A 1XYGA 4ACAA 3UBMA 4OFXA 4EJ6A 4V1CB 1D4FA 4ZI7A 2B20A 3EE6A 4B83A 2CHVA 3K7EA 5AR1A 1SPXA 4DIUA 2FW9A 3CWCA 1NAIA 1E9AA 2TRTA 4LRTB 2UU9B 1Z63A 2Z3WA 3R3XA 4D4IA 5AJYA 3T1OA 2Z04A 3O2NA 5THXA 2F5DA 1P77A 2YOFA 3TW7A 2RHBA 2FN3A 4DC9A 4CM4B 1FYXA 4BC1A 3I01M 1O0CA 2ZSIA 5IAGA 2GZHA 2Q1YA 5JDCA 1HDZA 2ZMEB 4QFMA 5E2AA 2VSQA 2H5LA 2Z9OA 2FR1A 2O7QA 5GPAA 1K66A 4HW0A 3RSOA 2IZZA 4X00A 4UE2A 1GTJ1 3LK7A 5G4KB 3Q3IA 4M9CA 5HHTA 2EINH 5KNBH 1JKIA 4S1PA 2K2QB 2NNYA 1RW4A 1SOVA 4BFTA 1EP9A 4MWSA 3EBPA 3H1TA 2FW6A 4CYCA 3KYCA 4JB8A 4UU1A 3X1DA 4JS0A 3OQMA 2IGMA 4BKPA 1TQ2A 1VBKA 1NVTA 4FEEA 1NSFA 2FMKA 3O4IA 1ZMRA 4IKEA 4PYMA 4D5FA 2IZ6A 5AXBA 3ZV3A 3UH0A 2HK8A 5CUQA 4Z3KA 3MTBA 3K9WA 3E6MA 4K9QA 3HYIA 3WY9A 1QGYA 1XF1A 4I46A 2FB9A 1RIFA 3JRNA 1V7QA 1G8MA 1S2LA 4OV6B 4EW3A 5DW0A 4DV3B 1R6XA 1VCMA 2JWTA 4XA8A 5I4KA 1YBHA 3MOIA 4RQBA 2I34A 2XF7A 1LK7A 2YS7A 4BY1J 1AGNA 3HRHA 2JFQA 2FRHA 1GR0A 1TF7A 2XA1A 4E5NA 4KACA 1IZ9A 3I4LA 4TKVB 2J9GA 1I9GA 1PL8A 5KQSA 5D87A 3DQPA 3LAWA 2YMMA 2BFFB 3E3OA 1ZU4A 2L18A 4Y33A 4IDDA 3KR2A 1HEUA 3USCS 1YIAA 3JQAD 5EVCA 3A9SA 3PITA 1QF9A 2DTZA 2BGMA 3IT2A 3NM6B 5A4IS 4BLTA 4J1TA 2RAUA 3NU1A 4FOOA 4MJLA 5IKMA 1QV9A 1W7PD 3BMCB 4YCCA 2M1XA 2XWPA 1TPYA 4EHAA 4REOA 1DBQA 2ONJA 3TL4X 2H6BA 2E1PA 3FISA 3IEIA 4KIUA 2BW0A 1CUSA 3KVOA 1JMVA 1VC2A 1VPDA 1XTPA 1U2WA 2AR0A 3HK2A 3K05A 4L9RA 2GXAA 2GSWA 4LFUA 1ONBA 4BQPA 5I7RA 3D3KA 2PUFA 3C6YA 1P80A 2Y1CA 3EVEA 3ETEA 3VPSA 5DHUA 3UNGC 4YUYA 1W88B 1VJGA 5CAEA 1A9QA 3K4KA 1RRMA 1YRNB 3T0FA 3HJHA 2IU0A 4XD2A 3UICA 5EHZA 3HVUA 3L7DA 3RPQA 3UK6A 3FMVA 2JAUA 3WGIA 1T26A 4K9MA 2Z2IA 3K0KA 5B55A 5DEIA 4MYUA 4QELA 4BS9A 3FGPA 4KH0A 1O8CA 3K1YA 4K6KA 5FA6A 4FHEA 1WDMA 5EE5B 1MHPA 3LAJA 1X3UA 2V7FA 1SIWA 5JXHA 2Y6UA 2JLAA 2JFVA 1DP4A 3G89A 4N8EA 2RHTA 1K8QA 4G25A 4JP0A 2QTVB 4IIJA 5BR7A 2HT1A 1MV8A 4CIXA 1H5NA 3EPZA 3BDIA 1P0FA 2Y71A 3OFND 2ZYIA 3SYNA 3ORRA 4AZTA 1NVBA 3P9ZA 2A9KA 2FR8A 1MQ8B 3S1QJ 1M2JA 1RAHA 5A0TA 3LW7A 2VQ6A 2C9BA 4H0NA 1VYTA 4LE2A 1E77A 1R9JA 2IT1A 2Y8EA 5DT2A 5FPSA 1WY7A 1KY5A 3QGMA 2R4TA 2DWOA 4GYYA 3B5JA 1JIJA 3F1LA 3DF7A 3GNLA 2QYSA 3AHJA 3L6OO 3RU2A 3EIWA 5JEDA 1MBZA 2TS1A 1DRKA 4LZAA 1C0IA 3ZU2A 2BZGA 3QVSA 2JGMA 4JLJA 1N5DA 1I36A 1NHWA 1WZNA 2O3JA 4PJLA 2O2YA 1VCIA 5LQJA 1OX4B 1C30B 1QIKA 3GIDA 1FSFA 2QTMA 2QVLA 3H3ZA 2OZLA 3QWAA 3K70C 3VISA 1L5QA 5AK6A 1E6UA 2V7QA 4C14A 1SXPA 4G4GA 1AJEA 1IUPA 4U0KA 5IYZB 3GYGA 1F6BA 4B75A 5E9QA 2H9IA 3O4RA 2VKTA 1MAHA 5AUNB 3WLAA 2R1UA 1Z1DA 1IV6A 2I10A 5FNZA 2XAFA 2IDMA 1GRNA 3IBTA 4KO3S 4J90A 1MBKA 1NU8A 3H36A 1IZ0A 1CIJA 1PJ4A 3HDJA 5HKKD 1ZMBA 1M2FA 2DI3A 1U8YA 3VR5D 1XZQA 1G5TA 1TFUA 3SDSA 3B2EA 4Y3OA 1ETVA 1V8BA 3OYNA 4LQ4A 1XJCA 1ZN7A 1HFJA 3I0ZA 4RADA 4RGVA 2HGSA 4J03A 4MI6A 4DL9A 4MCHA 5KOHB 3KKPA 3NFRA 1LWOA 2D7CA 4I1VA 3CC8A 3CO0S 3AWDA 4HF1A 3PZRA 4UNNA 4XRGA 4LYFA 4X7MA 4YJFA 3IIIA 3GUHA 1OU4A 3PSAA 1J2JA 3H2ZA 4Z5XA 1EG2A 1DAPA 5JTTA 3I76A 3MXTA 4WJZA 4EF6A 1BI3A 2WW8A 1XB4A 3Q3JB 2D2EA 5L3DA 2FFJA 3LWZA 3WYDA 2E82A 4CF7A 3OY9A 1FY7A 4LV6A 1MB0A 1NYLA 2DEUA 3WGMA 3M6MD 1ABEA 1TC2A 2AFHB 1PGJA 4N8SA 4HGYA 3BS4A 2HYGD 1Y9DA 1ZC3A 2QLFA 2VSNA 1QQ5A 4WXMA 2X1HA 1MH1A 5B53A 2EJCA 2OTLI 5KOYA 5K7ZA 3H75A 5HOOA 3O93A 2ZJFA 5CH3A 2YJ6A 3IOCA 2JLUA 4FR5A 3ESBA 3HA7A 3DBHB 4QNRA 4M54A 3K4CA 4C4PA 1RXIA 5TARA 2GBFA 3R5HA 3A4VA 3QUAA 4OUDA 4K46A 1FFCA 2YYYA 4HWOA 4G24A 2JA5J 2AG8A 4U2KA 1TYEB 4E70A 5GOTA 4PUSA 3SSNA 1FP4B 2CLOB 1YOBA 1I5OA 1UQUA 5BOSA 1W87A 1YITI 2JHFA 4BCCA 2AOXA 1YCHA 3ZZUA 4C7JA 2H7YA 3DL7A 4CN9A 4P4TA 4EF5A 1GT0C 4N0MA 1ZUNB 3FLMA 4TN1A 4FYVA 3FDZB 3K1ZA 4UHHA 1YF3A 3A9WA 1DS6A 4OHMA 2W6MA 4BNWA 1RPZA 5KWEA 3PT9A 5A7GA 3QF7A 4L8WB 2GEUA 3T1QA 2MC3A 2F1OA 1DRWA 4D41A 4I99C 1SBZA 1LBTA 1KA9H 5GZ6A 3IAFA 3VM6A 2BDUA 1FSPA 1SZCA 2ZU6A 3VPRA 3HSRA 1K6XA 4IBOA 1OY1A 3C7TA 2Y1EA 2WYVA 2YQ4A 2GN0A 2VXCA 5FUVA 2B2NA 3I64A 3J80A 2DHRA 2BSQA 1HE4A 4P7BA 1G6Q1 3AX6A 1RP1A 3R7WA 5B3JC 2R8XA 2B8NA 3RVNA 3RVRA 4F3YA 1B9MA 2PSJA 3KEFA 3OYEA 5TRDA 4AN0A 2PQ2A 1WUYA 1QGAA 3TGLA 4YJDA 3NGXA 2VYFA 3KKEA 3VMMA 2EJVA 1XEXB 4B9AA 3GJQA 4PLCA 3LXUX 2GPJA 3ZGXA 1I1QB 4DIEA 4B6EA 1VHDA 2UYQA 6CHYA 3TKLA 3CCSI 1UXGA 2IBTA 2HTFA 3FZEA 1TCVA 4CKBB 2ZJ4A 3JALA 3RD5A 1FOKA 1LPOA 5F73A 1CEYA 3KHKA 3ZDXB 2CHFA 4YREA 1C7QA 4RZQA 3W8EA 2GKOA 2OWEA 1BEUB 3QVKA 4X6LA 3K5IA 3U7FB 5T5QA 4YIIA 3ROKA 3ZWAA 2GA2A 3WK6A 3ZR8X 1YBFA 1LBQA 1DDOA 4WWCA 2YWGA 3KQNA 3M9AA 1NUAA 3JY6A 4WX9A 1R5GA 3HU2A 4ZOAA 3HM2A 4YFNF 2PUGA 3GROA 3D3NA 1X2EA 4B84A 2JI4A 4XASA 4OHPA 2XKPA 4S35A 4P4SB 1OPCA 4LYGA 4C6RA 4FE4A 4HP8A 1Z7GA 3UFBA 2QLLA 3ZRGA 4NJEA 2AI2A 4UHKA 4M2LA 4MYCA 4BLRA 1UPTA 4PXYA 4Q9IA 4R1NA 3HYTA 1RRKA 2CHGA 2WIBA 3LZDA 3P94A 3L2VA 2ZRGA 4I81A 2JIZD 1BN7A 1O7LA 4MW7A 1DQNA 5IKPA 1KZGB 3A6LA 1QF7A 1NJ6A 2WWYA 1E4EB 1AMOA 1TNDA 4HOBA 2P9CA 2GNOA 4P3XA 2JLWA 1RI7A 2GPYA 1DUSA 4Q1FA 4OMUA 4CDRA 3ADKA 4QPNA 2AL7A 4QLCU 4NQZA 1EV7A 3OQ6A 5FWYA 4WESA 4MYHA 4G37A 3ELWA 2QMZA 2DQYA 5JI6A 1ZVMA 3TPCA 3GLIA 2JFOA 3OEED 2YXLA 3BT9A 3L7LA 2NXCA 3I8XA 1U0RA 1LPSA 2BGNA 3OEYA 2UXNA 1ZRDA 3DMPA 2FSVC 2WZBA 2BEOA 2BCEA 3K2EA 3JQGA 4M87A 4X7BA 1SC9A 4AMYA 2XKKA 1YBVA 5IUNC 3UT0A 2OO3A 2YC4C 1XZBA 4HS9A 4QUIA 3GNSA 2VCEA 2ZBVA 3GTQJ 2X23A 4TWBA 5FOTA 2HFKA 2FP4B 4XAQA 1FYDA 2DFEA 4U4AA 2EZLA 4PO1A 4WACA 3R8XA 2GASA 1DDIA 3A31A 3TB4A 4B73A 5DK4A 4BVJA 4RHYA 1V41E 4FHTA 2C42A 3BMXA 1ZELA 4YRZA 1LBSA 5TQVA 4OY3A 1SD4A 1XP8A 3G3ZA 3KKLA 1V4BA 4CM9A 1T5TA 1ESZA 2XNHA 5GZ1A 5H4GA 5FNVB 2R96A 3JYLA 5B4TA 3M9WA 1DRUA 4CQMD 4LYDA 1J7KA 2Q5OA 3IE0A 4RBOA 2ID9A 3AI1A 4QJ4A 3F2IA 4V3BA 4IVPA 1U2GA 2RCYA 4E5VA 1U0JA 2EK5A 4RVNA 1OLOA 2DPYA 5CEJA 3Q7RA 2PO5A 1B7GO 4KQEA 1VB5A 4LXGA 1OYYA 2WFZA 1UFQA 3QEOA 1FCJA 1RI3A 3PRKE 2D06A 4MVJE 2JIDA 3CZ9A 2O8DB 5LNK1 1ZEJA 1WG8A 4XIJA 1BFKA 3CVJA 3V4PB 4IHQA 2PNFA 1HA3A 1N5KA 1P2SA 2CQQA 5J2UB 2MJLA 2R9VA 3E7WA 1IFXA 3UY4A 1Z28A 1A82A 4IRGA 4PYKA 1XKTA 4HN4B 3NYQA 1SHZA 4RF5A 4ZI5A 1DXYA 1WHSA 3RYFA 3NTQA 3E9EA 2EFDB 4DXAA 2Z5FA 1C50A 1OWPA 4DLYA 3TEDA 3PNQA 4CL8A 4CEJB 2F4VB 1MO3A 5D5HA 3V5NA 2VJ5A 4B09A 4UE3S 4MJ7A 4US2R 5FQOA 3H2JA 5IDXA 3Q9NA 1BI0A 4V02A 4X24A 1MOPA 1DPFA 3UFXB 2E5LB 3PFNA 2CYYA 2PDAA 4BP8A 3VPCA 1W581 2EHJA 3VTFA 5DTQA 1O0SA 5DCMA 2PG4A 4DR4B 3CLUC 2WZDA 1B6AA 3KBBA 2VWPA 1KSHA 4UVEA 2XF8A 4MS3B 3EQ9A 3HMQA 2XMSA 3T34A 3KT6A 4B4UA 4PR0A 4BBPA 4ENVA