1P2FA

Crystal structure analysis of response regulator drrb, a thermotoga maritima ompr/phob homolog
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
MMWKIAVVDDDKNILKKVSEKLQQLGRVKTFLTGEDFLNDEEAFHVVVLDVMLPDYSGYEICRMIKETRPETWVILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFLEREKKGLYDFGDLKIDATGFTVFLKGKRIHLPKKEFEILLFLAENAGKVVTREKLLETFWEDPVSPRVVDTVIKRIRKAIEDDPNRPRYIKTIWGVGYMFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the domain interface in DrrB, a response regulator of the OmpR/PhoB subfamily
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
molecule keywords Response Regulator
total genus 69
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p2fA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p2fA01
1FNNA 1FFSA 3LUHA 1W7PB 3MA0A 1NY5A 3OQOA 4Z2YA 3IL2A 5EEHA 1OYWA 2D2WA 5IT3A 4RV5A 1H9CA 3KZZA 5CNKA 4RKRA 1BOAA 1H9GA 3L49A 5LHGA 4WXCA 5FGMA 1W4MA 1RUOA 1QP0A 4RAYA 3WGGA 4G7HF 3FXUA 1PDNC 1QP7A 3H6GA 2A6HF 2QSJA 4P98A 4A6EA 3K0LA 4M72A 1RNLA 1H0MA 3HYIA 2AXLA 4A5NA 4Z4IA 1R1UA 3BJOA 4JOQA 4MS1A 2QZJA 2EK5A 4ETNA 3ZN1A 3RIRA 4ZH4F 4GO1A 2L2QA 4YRZA 4WUTA 2VK2A 3QU3A 4Z4HA 2M98A 1D8JA 4HW0A 5J8CA 3ISPA 4MYRA 1DJMA 5KQPA 4HQMA 3HXMA 2B4AA 3RYRA 4D0PA 2A6EF 3BWGA 4S04A 1S7AA 4HA8A 3M8FA 3OMXA 4EYKA 2Y48A 2PUDA 4M9XA 4BH9A 2H09A 1PNRA 3QEMA 3RDIA 1XDSA 1NXWA 4M88A 4BAYA 1IN4A 1DRJA 3BBLA 1IN6A 3LFKA 1DPRA 3A10A 2ZMEA 5EWLA 1P6RA 1ON2A 3F3XA 2EFNA 4P55A 4YO7A 5E1WA 4Q5SF 3ILYA 1ZLKA 5FWYB 4LX8A 4R8HA 1MD0A 2FQ3A 2QVOA 4DQDA 2NYXA 1PUXA 5E1ZB 2L19A 4LE0A 3FM5A 3U1DA 4RKQA 2ZNZA 4OU0A 5ABPA 3MM4A 3TO7A 2QVGA 2CFXA 1BI0A 2FEPA 2P5KA 5E8IA 1H9TA 1BN5A 1P4XA 1G6NA 1K78B 4KYWA 3HM9A 1Y0UA 1A0OA 3R0AA 3H75A 2ADUA 3M9WA 5H20A 3N0RA 4WXEA 3LUKA 1LJ9A 1J59A 3B02A 5LRSA 1ZGJA 1SD5A 3CHYA 3BRSA 1E6KA 1QNLA 2LKPA 4AD9A 3V7RA 3KCCA 2WWVD 4Z9BA 4D74A 4G97A 4PDKA 1OXKB 2CWEA 4YS6A 2K27A 1HW2A 4ENMA 1I3CA 2IDMA 2LBPA 1DDNA 2KIMA 3U9GA 4LJZF 1JBEA 3O1JC 1XB4A 1C0WA 3E5UA 4IMJB 3GX4X 3CZ5A 3URMA 3O2PE 3T6KA 5JNSA 3GBPA 1E6LA 3LTEA 3F6VA 2IPMA 5FFZA 5BR1A 3FFTA 3T95A 3KS9A 1B1BA 3VOEA 2MYPA 3M6MD 4XARA 4RK0A 1JHFA 4XLPF 4RY0A 2FRHA 4G0QA 2Z33A 5CVVA 2FQXA 5JNWA 3LAJA 5JHUA 1LEAA 4LLNA 3SAJA 3QEKA 3RYPA 1BA2A 1E17A 1ISRA 2O0YA 4HAMA 3H5VA 5HS8A 2A9PA 1IAWA 1LDKB 2E7XA 3A0UA 4CGZA 5K5OA 4YR7A 1SD4A 3DQVC 5L3DA 4E70A 3C1DA 3IRRA 2QV0A 4ETSA 4FHTA 2M1ZA 5HOOA 3RVSA 4MEYF 2E4VA 1KMIY 1S7OA 4XBFA 4CXFA 2JB9A 3V8KA 1LB2A 2VUHB 4G0YA 2HZTA 2L18A 2R3SA 1GHCA 1KYZA 3IC7A 2D45A 3EJWA 5HVQC 4ZYLA 4BHCA 1YMUA 5DGCA 3WE3A 1MZBA 3I4PA 3QK7A 4S05A 5FO5A 2TDXA 3F8NA 4OOIA 1CF7B 1FSHA 1ZH2A 2PL1A 3JY6A 2V1UA 5A2QZ 2Q2EA 5ICEA 3ROFA 4YG2F 5C5CA 2VBYA 1YQAA 1U5TB 5TPZA 2XGXA 4F11A 1CGPA 1KQ0A 1T6SA 2PUEA 4NCAA 3RJPA 2EV6A 3DPLC 4EY3A 1FPQA 3SZPA 4EYGA 1PEAA 2IJLA 3HSFA 3NNSA 4MS4B 4A0YA 3NQOA 2E4XA 4LK1F 2JPBA 2RNJA 4L9NA 4HF2A 3KP7A 1IRGA 4PZJA 3BILA 4KIFA 3OV8A 1F4VA 1SMYF 1O7LA 2J48A 2WV0A 4LE2A 2VXZA 3GZ6A 1J2XA 5HLHA 2YU3A 3EQLF 2X7XA 4QLCU 4GPAA 3M9XA 4U7BA 3LA7A 5LHHA 1JLKA 4MQ9F 3LFTA 2E1NA 1W7PD 2HWVA 1BI1A 4YGXB 1D2AA 3TD9A 4KK4A 2G7UA 3RVKA 3FMVA 4G0MA 1U3EM 2P9HA 2B1JA 5LGUA 4BNCA 2MSWA 7ABPA 4OIOF 1LDJA 4RSMA 2C6YA 1EH8A 3SM9A 1I1GA 3O2JA 3OLVA 4IHTA 3NNNA 2IW5A 1FFWA 2V9VA 1VTNC 4U0VA 1XWWA 3QX9A 5EWMB 2GA2A 2PEXA 3HK2A 5BRAA 5DCMA 4YIFA 1EFAA 1BIAA 5KVRA 5LLQA 3K2ZA 2IPAB 2JBAB 4WWHA 3EYYA 4N41A 1BDJA 4W5RA 4L9VA 3C3WA 2UXXA 1U6GA 2ESHA 3GA5A 3RKWA 4UNOA 3GFMA 2W42A 1IIBA 2VONA 1J0RA 4RGRA 1FP2A 3EQZA 4MTEA 3OM0A 1P6UA 3O1HB 3OQNA 4F06A 1LBIA 3OMWA 2WJWA 2R7DA 3ELKA 4L5IA 1QGPA 2BYVE 4ZYGA 3GLXA 3FWEA 5L3FA 3D0SA 2NS0A 4XSZF 3LOPA 3RVRA 2JBAA 2V1DA 4IPAA 3TGNA 4OG2A 5TPWB 2VBZA 2M5WA 5EWJB 4ZYHA 1D4ZA 1UHMA 3TQNA 2L01A 2XVCA 4JK1X 5D5VB 3U2RA 2RKHA 3HTSB 1C0EA 2CYYA 4MR9A 1O7FA 2DAOA 2QWWA 2MBFA 4M9ZA 1TQIA 4EGYA 1FSEA 3KZYA 3VFZA 3FZVA 1ZHHA 2PKXA 2DFIA 3I64A 3MQ0A 1SXIA 4IRXA 3OLYA 1HW1A 1EHCA 1SFUA 1HKTA 1TW2A 3F6CA 5CHYA 1B9NA 5D5UB 4LG0B 4HNRA 3W9SA 3RKYA 4TN5A 3ZMTA 1RIOH 2VODA 4N76A 1F9NA 4N9IA 1ON1A 2D1HA 1Z12A 4A5MA 5L3EA 3DZDA 4EYQA 5J6XA 2FA5A 1EWKA 1O3QA 2HQOA 3EGCA 3T5XA 3NNDA 2HOEA 3DP7A 5HLGA 2ZWMA 4EM2A 4U0YA 3D8UA 4NV3A 1ZRCA 1D3YA 3W6JB 4WK8F 1LJUA 3MCZA 4UUVA 1OR7A 4ZZLA 2QM3A 6ABPA 3H5TA 2GI4A 5D8KB 1FYLA 1TMYA 3H5IA 3RVQA 4NQWA 4YWHA 4FE4A 2CGPA 3LWFA 1U8RA 5EWJA 1XGMA 1WWXA 2AS5F 1J5YA 2XAQA 4JAVC 4K2EA 4L9JA 5JR3A 2NRAC 1CHNA 1U2QA 4UV9A 4PEVA 5CNMA 1LBHA 3OLZA 4MR7A 3M8EA 3GT7A 4I01A 1R8JA 3JS5A 1M5TA 3BY6A 1V3FA 1P4AA 1USIA 4OATA 4W5NA 1Z25A 2XHKA 2WRZA 2F5DA 3O75A 4KIBA 4Q7EA 4KPYA 4OINF 1HKQA 5KI6A 2CQKA 2XIGA 3WG9A 4JB2A 2MC3A 5BPIA 3FX3A 1UHWA 3ZPLA 4TLLB 1IN5A 3F8FA 1OYYA 4H3HB 2O03A 2FNAA 3EODA 1ZAYA 3HOSA 1JE8A 1CF7A 3QLVC 4IRHA 1FX7A 1TW3A 2KRFA 4IXAA 1FYKA 3BJ6A 3KFWX 3WODF 1G3SA 2JT1A 2RJOA 3E6DA 2E4WA 1ZESA 2H6BA 3F8BA 3EETA 4KIGA 2PG4A 3KJXA 3IP7A 2R48A 2EA4A 3BDDA 1TJYA 5FLXK 5AIQA 1ZRDA 2HDCA 2RVCA 3FMSA 3GRCA 4G6DA 4ENKA 1B4AA 3KP6A 2FKAA 3N8IA 2Z3YA 5KWSA 4NQRA 2GWRA 3G73A 4KVFA 3GFJA 3S2WA 4WWCA 1G3YA 4G7ZF 3DLHA 3HO1A 3F6OA 1FBUA 3RPUA 4KMFA 3N0WA 3GXOA 1BDHA 4RXUA 4G94A 2HS5A 1Z26A 4BXUA 2HSGA 3ZMDA 2G7HA 3F72A 3DBIA 1J75A 1HW5A 3RVLA 3LA3A 3ROTA 3GW2A 4F12A 1Z91A 1QQAA 4IHSA 2GX6A 1OYIA 4KA4A 1U04A 3IP9A 2IPLA 5TQJA 5IT9Z 1QPZA 3A0RB 4LK0F 3EYIA 1Z16A 3DLBA 1F51E 1DBWA 2FXAA 2J5PA 4G8XA 5JFRA 3CZCA 3E6MA 5DLEA 1FY7A 1JFTA 2IVMA 4HDVA 4EJUA 3BZ6A 1TBXA 3B73A 3LSTA 5HM6A 1K66A 1MDMB 2LF8A 3SNKA 2K02A 3IPCA 2P6TA 1Z05A 5KC9A 4P9FA 2YX4A 4A12A 2QW1A 4FB4A 1IW7F 1O57A 2R7FA 4RK1A 2Z5UA 2JVKA 4L5JA 2ID9A 4ZZDA 1ZARA 2BE5F 5D6FA 4L9TA 4LFUA 3FMQA 2PUFA 1EWTA 4XASA 2ISYA 2PBIA 2QQBA 1NXVA 3I5AA 2MD5A 4KQ9A 5JVTA 1G4DA 1ZYRF 3SXYA 4KMRA 3I54A 4A6DA 3TMYA 1JWLA 4IMIB 2JTVA 4EJTA 1LQ1A 2OA4A 5IUJC 4OLBA 3CFYA 2CG4A 5CJ9A 2FOKA 3Q9VA 3Q5FA 4NHJA 5J8FA 3IRQA 1XSVA 3F73A 2FTKE 3HS3A 3F8CA 1NHAA 1T38A 4ENJA 5TPWA 2J5OA 2VE9A 3JVDA 4MQVA 3RPQA 1IUYA 1JYFA 1G3WA 5IEJA 2XUBA 3H6HA 2CHEA 3O2QB 4UV8A 2Y75A 4KN7X 4HX7A 3GO5A 5IULC 4UVCA 1SFEA 4BHPA 5BRJA 1MIHA 3ML6A 3T8RA 2QR3A 4Y17A 2P5LC 4M73A 2WY2D 2BEOA 3E6BA 1NXPA 4FX4A 3EDCA 2UXNA 5H6RA 4MLCA 3IWFA 4R79A 2MYNA 2WJAA 3P9YA 3M7GA 4MQEA 1QZYA 6PAXA 2HFHA 1YW8A 3JSPA 2EA2A 3B2NA 1IN8A 1ZH4A 3MIZA 1BM9A 1ZH5A 1TQPA 1KQ9A 1F1ZA 2MLGA 2FN8A 3HUTA 2BGCA 5B3JA 3JTEA 1MB3A 3QELA 5LEJA 1SFXA 4Q4ZF 2IOYA 4ETMA 2JVJA 3ROUA 4H60A 1YG2A 2IPNA 4TMYA 1QNTA 2RGYA 1YW9A 1R1VA 1HXDA 2L3DA 4HV6A 1JXSA 3KYJB 2MSLA 2XAGA 5D8LB 3HSEA 1R36A 4Z9AA 2NUBA 3MMNA 1QZZA 5AONA 3C7JA 1O3TA 4RGUA 1ZITA 1WI9A 1JDNA 4G0ZA 2YPRA 1Z18A 4I0BA 3T38A 1Z17A 1BJAA 1T34A 4Z4GA 1ZN2A 2OENG 3SFZA 2UZKA 1FFGA 5KQGA 1FQWA 2GAUA 2RC4A 3KP2A 3MWMA 1FZPB 1OXBB 1YVUA 4BYYA 1IXSB 2JVIA 2FEKA 4HOBA 1JX6A 2ACJA 2A07F 1BAPA 2ESNA 1U78A 5ILSA 1WKMA 3GYHX 4EGZA 1URPA 1WSUA 3T8TA 4PYRA 1VKRA 2ZBKA 4PICA 1T2KA 1Z6RA 5HS9A 4B8XA 1FWZA 1DCMA 4MNUA 4I2OA 3VEPA 1EWVA 4ZYEA 2VT2A 5FLXZ 5IX8A 3O1IC 2PUGA 3OM1A 4RXMA 1RUNA 2GXBA 3WTSC 3MF4A 5HDNA 3QRFF 4WX9A 2RN7A 3KCNA 5ICGA 3QELB 4N0PA 3I09A 1DG9A 2EWNA 3CS3A 4JBAA 3OO1A 1DRKA 4H3KB 2W25A 3M1EA 1XGNA 3NRVA 1JYEA 1STZA 2FQWA 3DXJF 5TRDA 3GVAA 3HSYA 3QPTA 4MS3B 2QQ9A 2I6FA 3GL9A 3FM3A 2E1CA 5E8GA 2Q8KA 3MZHA 4CYDA 2PE5A 1UFMA 5F6FA 2DRIA 3HRSA 4O6JA 2GKGA 1PEYA 3WTZA 4CHUA 3Q15C 5DDGA 2WB4A 1NXOA 4WT7A 4ZMSA 3H1FA 3R61A 4XLNF 5T3YA 1SD6A 4QWQA 3I53A 2QVCA 3GFLA 2R47A 1ZAOA 2NZVG 3JPWA 2OZ6A 5TE9A 1RXIA 1AB5A 2V6CA 1YIOA 1Q1HA 2P4UA 2WC2A 2PJPA 3O2SB 1P4WA 3V4GA 4PZ0A 1ZG1A 2V0NA 3RVOA 3HSRA 3SQNA 5FD6A 1A04A 3ABTA 2MSKA 2WWYA 4YFNF 3E97A 1R00A 2H27A 3NHZA 2P7VB 1TLFA 3F8MA 4UVBA 3OO0A 1RZ4A 3OLWA 4H0EA 3IDOA 5CVRA 2OD5A 2IA0A 1YO5C 2DW4A 4GYGA 2D1VA 5L3BA 1U0SY 1BVHA 2W84A 1Z7UA 3HUUA 3CDHA 4TV7A 4G0XA 1NXTA 1KU2A 1REPC 1MJBA 2EB7A 2RDPA 4KN4X 3EUHA 5GQSA 5JNRA 5A2QK 2PJUA 2A9OA 4OIRF 1USGA 2Q0OA 1SXGA 5C5EA 2ID7A 4Z0NA 2IT0A 3GFIA 5DKFA 5GOTA 3RVMA 3WTXC 4Z4FA 4WXHA 2DBBA 1ABFA 1TVMA 3TB6A 4G0OA 4HNSA 4OBBA 2XAHA 4MGRA 3T8YA 2EJRA 3CTAA 5ICFA 4OIPF 4YV7A 2OQGA 1ZRFA 5ILUA 2MA3A 2DO7A 1MJ9A 2IA2A 3CKMA 3MFKA 1NATA 3R6SA 4NB5A 1B59A 3BROA 5K5RA 2ETHA 1ONVA 4UHTA 2ZCWA 3F21A 4MR8B 1S29A 4OIQF 3L09A 3HEBA 2F2EA 3E6CC 1RZRD 1B6AA 3O74A 2EFOA 4IVNA 5DD4A 1D8KA 1TNTA 1GUDA 2AYXA 2E4UA 5K5QA 1NXSA 3MQ4A 3CUQB 4LE1A 4RB2C 3HDVA 5CVIA 4HBLA 3TO6A 1L0OC 1T98A 3H92A 2WMYA 2FN9A 3WGIA 3KTOA 5FWYA 3V8LA 2O8XA 1FLIA 1K79A 1WQ2A 3I0TA 2OU2A 4PGGA 5TQ0B 4LGWA 3BPXA 1Z1DA 3QX8A 3N53A 1U5TA 1HQCA 1YTUA 2XRNA 3GZ5A 4IRGA 2HQRA 5ICCA 2M45A 2PLNA 1PP8F 4IRIA 4WXMA 1GXQA 4JP1A 4EUKA 1E2BA 4CZZA 2NT3A 3GWZA 1NXXA 1HBXG 4IF4A 2MYUA 4WF2A 4ON0A 5LGNA 4M6YA 5E17F 1XHEA 5EWMA 2GIVA 2ZMEB 2A9QA 2VC1A 5EWLB 4RS8A 3CO6C 2A9RA 5LEKA 5FFXA 1I6XA 1ZGGA 1K7AA 5BMZA 1YYVA 2P4WA 2DK8A 3DEUA 1QPMA 1FP1D 3P9CA 3PFIA 3L7WA 2VC0A 3BPVA 2FEZA 1QP4A 2N9UA 1U8TA 4W5QA 2LDUA 1SXHA 2CHFA 2E7WA 5JNTA 2W24A 3DF8A 3LKBA 5JNVA 4HF1A 2WTEA 2QBYB 3I45A 2DQRA 4PGHA 3WTVC 4MTDA 2M8EA 3FMRA 5IUKC 1B9MA 1GVJA 2RQPA 1WETA 3WGHA 4Z4EA 4A0ZA 1XCBA 4LB6B 3E61A 5L3GA 4DN6A 4QPJC 1W5TA 2PL9A 1YK0A 3BREA 3QP6A 5TQ0A 3HJFA 4M71A 4N0BA 4L0ZB 2O3FA 4OTZA 4NICA 4I02A 1P8AA 1APBA 3WU0A 3KEOA 4IJAA 2UWMA 4EMSA 2PN6A 3E5XA 3JPYA 1LDDA 4L85A 3CTPA 1UB9A 1USSA 2PUCA 3COAC 1TM2A 3HIFA 5D5WB 1DUXC 2FMFA 2MLKA 3OOPA 1JHZA 4KRFA 3G85A 2F5CA 5FWXA 3DGEC 2DPDA 3UKJA 3ZMZA 1XSDA 2Z99A 3RQIA 1XCVA 1KGSA 1LK0A 3PQKA 2HPHA 3DFGA 4W5TA 1KRXA 1YK1A 4YFXF 4KV7A 2MH2A 3JTHA 4I0AA 1AB6A 1M2FA 1RZRA 3RTRA 4O5AA 3C6QA 1YS6A 3VNAA 5E3JA 5AIPA 2BV6A 4UHKA 4XFKA 3S99A 4FX0A 1G3TA 3L9FA 4EVIA 5F64A 4L0YB 3LUAA 4Z99A 3RVJA 2X0LA 2BGGA 2LF7A 2DI3A 2RV8A 1GLGA 3I58A 4WCGA 2FMLA 3MEXA 1USTA 2YR2A 3DPTA 2YHAA 2AYZA 5EEGA 4CO8A 3E3MA 2QUFA 3DGFC 2E4ZA 1T0FA 1AOYA 5TJJA 3HHGA 3D02A 2K4JA 4YP9A 1R1TA 3IPAA 3QPHA 3HV2A 3V7SA 3FXQA 3KYIB 5HQJA 5ILVA 5D4SA 4EYOA 1Z13A 3HRMA 5D2CA 5D4RA 2IKSA 3J80K 5DV5A 1VPWA 2R4QA 3F7NA 3KHTA 1ABEA 3R0JA 1U5TC 2PLYA 4MPTA 5LHIA 4G86A 1R5GA 2HTSA 1GCAA 3DKWA 3ULQB 3CU5A 6CHYA 4FT8A 3O21A 4CBVA 4EM1A 4IGAA 1X3UA 1XGSA 2QZ8A 5LBQA 2FLKA 1I5ZA 5FWXB 3N6VA 5DUIA 2IA1A 3ZP5A 2M87A 2ELHA 3FGZA 3HZHA 4N0QA 4TLMB 5DCFA 2G9WA 4R1HA 2QYOA 2PAFA 4G0PA 3CO7C 1VRVA 3K1MA 2VN2A 2P5VA 4GNRA 2JCGA 9ABPA 2JRTA 2RGVA 1XMKA 1MKMA 1PNTA 1TTYA 1ISSA 2FBHA 4EQQA 2F8TA 4RB1A 3E3VA 4CICA 2K86A 3LUCA 5FBHA 2VBXA 1DBQA 3FFXA 4D6XA 5LRRA 1Z9CA 2VOOA 3UUGA 3VNBA 3AAFA 4OMYA 3J7AO 2B0LA 1KU7A 4N47A 4N03A 3CNBA 3MYYA 1BI2A 1EV7A 5K1YA 4I09A 1IXRC 4ASNA 4QYWA 4HQEA 2Z9OA 4E7PA 5I4CA 3L2CA 1JFSA 1BIBA 3MZYA 1JDPA 2DLLA 4KT5C 4RB0A 2KIUA 3TO9A 2FMHA 1YLFA 3BP8A 1DCFA 1KU3A 5HDKA 2COMA 5ERIA 2OBPA 5H6QA 1FT9A 2CO5A 5TPZD 1BI3A 3P9IA 3LAPA 2CWDA 3NBMA 5E18F 1ZG3A 1I27A 2FBIA 2YX7A 4BHBA 5B3JC 1D1PA 1FBQA 1ZGZA 2FEWB 1M2EA 1DCKA 3ABUA 2KJCA 1D1QA 2FNPA 4MS3A 1TQMA 3K9TA 1L5ZA 1FBSA 4U0WA 4EJVA 5CVJA 4KDPA 1R5HA 3KLNA 1BC8C 3LUGA 4LLGF 5BPDA 2IPQX 5BS6A 4LLLA 5E20A 1K68A 1MGTA 3KKEA 3KLOA 4WZZA 2LIVA 2BBYA 2ZFWA 2EV0A 1F5TA 5CYVA 1LVAA 4HLYA 4RS3A 5DD8A 1J7KA 2ZAYA 3BJAA 3LQQA 4UVAA 2XASA 3CLKA 2GA1A 1LNWA 1J9IA 4LB5A 1JF8A 3QAHA 2NAZA 3F22A 1MJAA 4EVRA 4GXOA 3IP5A 2HKXA 2GBPA 5CLSA 5DEQA 4MLDA 3KP3A 5DTEA 3KEQA 1E2XA 1KYWA 5E1XA 3N4MA 1QBJA 4RK7A 2R25B 1HEYA 4RK4A 3D5LA 1QMPA 1R23A 2ZJ2A 4HX8A 1YTYA 1SD7A 3GUDA 1IF1A 2HQBA 1KA8A 5DYMA 3K1PA 3CRNA 3HHHA 2DT5A 3G3ZA 3HVRA 3K4HA 5FD5A 4PCQA 4O3MA 4LD5A 3H5WA 5T7BA 3T0YA 3R4KA 2A69F 2X4HA 3CUOA 4MR9B 3A3KA 1FYMA 3HDGA 4RY8A 1TLHB 3VODA 4JQFA 1D5WA 1JGSA 1EAYA 4ZMRA 3I59A 2VYCA 3N75A 4JA2A 5TQ2B 1W9HA 4ZYDA 3JSOA 2EFWA 1T39A 2P6SA 3RKXA 2YSRA 3GEZA 2HKOA 3C18A 4DADA 4KICA 2NNNA 2LUOA 5KQMA 2CW0F 5IC5A 5HS7A 1GUBA 1FSPA 4Y13A 2JSCA 2A61A 3QP5A 5BQ3A 4ENNA 1P2FA 2VT3A 3ERED 1U2WA 1GCGA 4MQFA 1HKSA 2H6CA 2HYFA 3P9KA 3BOQA 1EH6A 2ISZA 4XLTA 4ETIA 4EV0A 4ESBA 5DCLA 4BQAA 4YCSA 3T1BA 4EVQA 1U2PA 3DV8A 4MHGA 5JNUA 4EM0B 1WRJA 2QQAA 1O3SA 1ZDMA 3JAMK 4NCBA 5KC8A 2QU7A 3KP5A 4XAQA 1P6QA 3TDZC 4FE7A 1I1SA 3ZMUA 1DC8A 2W85A 4HV5A 2XV4S 1DBPA 5BOXA 3TOBA 4JB0A 4O1HA 3RVPA 4MQFB 2DU9A 1D5VA 1V4RA 3H5LA 1CYEA 3O3KA 1K6OA 4MR7B 2HQNA 5L3CA 1R7JA 4MQEB 3SG0A 1QO0A 2FE3A 4RK5A 2K7LA 4ZJPA 1VLZA 5PNTA 1JHHA 1IZ1A 2A3SA 4F3TA 3C3KA 5KK1A 3I5UA 3KE2A 4ZPJA 2FSWA 3LA2A 4A0XA 3TDUC 1YMVA 3I42A 1W7PA 5CNJA 2V79A 1OPCA 3K69A 3CUQA 3ZMSA 2GZWA 3CJNA 3HRTA 3GV0A 1HSTA 3GWGA 4HLXA 1BC7C 5JI6A 3HOTA 2H3HA 2JZYA 3K9CA 3QLTA 2ZXJA 3QLUC 4M6XA 4ML3A 3E5QA 3WE2A 1MB0A 4QYMA 4MGEA 5IBQA 1A2OA 4MRMA 1RPJA 2XKOA 4KUMA 1OMIA 4IILA 3JAMZ 2FVYA 3IKVA 3LMKA 3LUJA 1JH9A 1XHFA 1KQ8A 3IWZA 2H94A 1S3JA 3IP6A 4Q6WA 2W57A 1ZVVA 3J81Z 1ZG5A 1XDUA 3TKYA 3CUQC 4KFCA 4RDCA 2FXIA 4EJWA 4F7ZA 2NT4A 3EQ2A 4AVPA 4P96A 3FDFA 1JFVA 4LMYA 2PUAA 5BQTA 4HZFA 3H1GA 1MDMA 1M5UA 4B09A 2O6GE 3I71A 3K1NA 5D6EA 2FF4A 2LP4Y 2XAFA 4YIIA 4RZSA 2ZKZA 3NEUA 1ULYA 3UK0A 2E4YA 5D5XB 3BRQA 1C4WA 3HUGA 3H1EA 4HNQA 1S8NA 3SHFA 2QXYA 2XKPA 1LJLA 4GCVA 4ESFA 3KP4A 4Q6BA 1DPUA 1Z2DA 2YHBA 4UHJA 8ABPA 4G7OF 3H3UA 4M74A 3ZN0A 1MVOA 4HX4A 1YS7A 1QO0D 2OQRA 3IKTA 1RXEA 1ODDA 3PQJA 3W6KB 2GXGA 2Y0MA 1E6MA 1XD7A 1XN7A 3LQRA 2OAZA 4Y15A 4DQ2A 1UCRA 3EULA 3CG0A 4MRMB 1EH7A 4KREA 4RWEA 1J56A 1Z6TA 3IHUA 2VE8A 1PUEE 2PI0A 2L4AA 2K4BA 3SY8A 1KU9A 4EGSA 1K78A 4AIKA 2DPUA 5IT9K 3TO5A 3QU6A 2P8TA 4CDGA 3HTUA 2JRLA 4RU1A 3H3ZA 4XRFA 3QEMB 4LZLA 1R58A 4OLAA 4F8JA 1Y1LA 4MS1B 4A2UA 3ECOA 4I7HA 4OMZA 1QKKA 1W25A 4XXHA 4LDZA 4P5OA 1QQIA 1SAXA 2ZO4A 3ZQ7A 2KYRA 3KG2A 3MAJA 1W5SA 2H0AA 2PMUA 1B00A 3RVNA 2FMKA 2FQYA 4O5VA 1XGOA 3F23A 3H5OA 3WTUC 2PMCA 2EFQA 2OZUA 4N9HA 3RI4A 1BBYA 4RAZA 5FB2A 3Q9SA 4GYIA 1LEBA 1IN7A 2VOPA 2L02A 1Z15A 3TX6A 2XAJA 3LUFA 1YFHA 4EJOA 4L18B 3WTWC 2L54A 1ZLJA 3GBVA 3QLVA 3NHMA 4RY9A 5HDGA 3F6PA 2NNYA 2PUBA 3N0XA 2CD7A 4Z4CA 2FBKA 3ZMVA 2NZUG 2ZNYA 2IP2A 2PFBA 2FMYA 2HJ9A 5FBKA 4Q47A 1TNSA 3KSMA 1KRWA 4ESJA 1FOKA 4Q48A 5DCMB 4Y9TA 1FC3A 2RJNA 1Z2EA 2XDYA 2CSOA 1L3LA 4UXNA 1MAVA 4HYEA 3QLUA 2O20A 3EAFA 4P1ZA 4L4UA 3SZTA 1ZREA 4P9UA 1HSJA 2TMYA 4RK6A 2HTJA 4AIHA 3HCWA 1DZ3A 3GF2A 3TOAA 3V8JA 2FLWA 3JTGA 3WTTC 2PQ8A 3VB2A 4LDAA 4EVSA 4MR8A 2QENA 3EDPA 4XSXF 2FMIA 1QQBA 4U7DA 3QOPA 4RXTA 5F1RA 4E7OA 3CLOA 1GXPA 1YW7A 5LGTA 2M30A 5JS2A 4AIJA 1JL3A 1PP7U 4KQCA 2L4MA 2Q5CA 3FHZA 2VBWA 4MEXF 3HRUA 4O1IA 2LSOA 2EFPA 2XROA 3OLXA 4KNYA 2L17A 2LPMA 1R22A 4U88A 2GQQA 4M9SA 3Q7SA 2FSPA 1BDIA 1AWCA 4W5OA 5JS1A 4KMUX 3L6UA 4I98B 2JK1A 1S6LA 4YFKF 2M1BA 5HLIA 1PHRA 3WTYC 2JPCA 3L00A 4HF0A 2F5FA 3Q7RA 2QBYA 4QICA 4JASB 1IRFA 3WU1B 3V7CA 2STTA 3N97A 3Q7TA 4LRQA 2MH9A 1L5YA 2QLZA 4AWXB 3J81K 2IYNA 3R60A 3FFWA 4KZKA 2A5YB 2HYGD 4G9YA 4KK3A 2DK5A 1P92A 1DC7A 3RH0A 3LKVA 2DQLA 1ZY2A 3G1WA 4HDUA 1USKA 2KKOA 2IRFG 1ZHFA 3KETA 2F8SA 5IEBA 4MS4A 4YLEA 3FXRA 4D6YA 2P7CB 1XSXA 2FU4A 1IXCA 2VUIB 3JW4A 3C3MA 1DP4A 2F5EA 2A68F 3ECHA 5CVUA 2HEOA 1O3RA 2PMHA 1UDRA 3J80Z 3REOA 4GGGA 4G6QA 5HKOA 3CG4A 5DUKA 4LG0A 1SMTA 2O61A 1OKRA 1NTRA 2EV5A 1DP7P 2RDMA 2HGCA 4WXDA 3ILHA 1SRRA 3FF5A 5HSGA 2KIFA 3OQMA 3Q41A 2LNBA 4MAAA 2DTRA 2HR3A 2V1XA 3JVIA 3I59B 1CEYA 1RI7A 4RGXA 5CNIA 1F4KA 3M9AA 5IUNC 5TQ2A 1ZGAA 3C97A 2STWA 5ED4A 3LUDA 4RGSA 2FW0A 4PE5B 1XMAA 4RB3C 5KQLA 4DNCA 3O6BB 3P7NA 3GYBA 2MYTA 2KJBA
chains in the Genus database with same CATH superfamily
1VJDA 3JV7A 3OHSX 4NG5A 2BXZA 2FWJA 1W7PB 1L7QA 3LUHA 1IRXA 3IIJA 1NY5A 2G07A 5BQPA 4ZREA 1M34B 1MP0A 2L7MP 1EDEA 2VP0A 5GOTA 1TKCA 2N47A 3O83A 3DMDA 1G20E 1JR2A 3IL2A 4ZZ2A 3AF2A 4BXOA 2Z1DA 2B8TA 3Q3EA 4RV5A 5EZYB 3F7MA 1G2PA 3CR3C 1H9GA 3GCWA 1O4VA 5MGNA 4DR1B 1XU7A 2EP5A 4I4IA 4XQGA 4ZXFA 2P69A 4QOEA 5IP7J 2VDLB 3E3AA 3FXUA 4UQPA 4KPEC 4OOEA 3GQVA 3H6GA 4X8OA 4AJJA 1VL5A 3IIKA 4DYQA 4NFYA 5L53A 2QSGX 1WV0A 2ZBVA 5E6SB 2PZAA 2QSJA 2EAUA 2ZUBA 4IDEA 4EYSA 4QLBA 2BE7A 4ZAZA 1YSCA 4P98A 2O3JA 1CK4A 1NP3A 4HMPA 2V1NA 1EU1A 2R60A 2BGRA 1X7YB 4A6EA 3K0FA 4IKPA 4EY4A 2AMVA 2JGRA 3UYKA 2A5LA 1OV6A 1EFTA 5FLYA 2A6TA 1C0KA 5CBPB 3NWSA 5FIUA 1ZJ6A 2C2GA 5KTKA 2OCCH 1Q0UA 4JOQA 5FKNA 1V1MA 2VLIA 4MS1A 2EK5A 4TL6A 4ENVA 2C92A 3BWBA 1G0OA 3H9QA 1E9SA 2PWAA 2C9DA 3QITA 2VUMJ 5JAMA 4X1KA 1KFKB 3WSVA 1T0IA 3DAOA 4A69C 3OCUA 4UASA 1O7JA 4E6KG 3QENA 1YFZA 2DT7B 3H1AA 1RYYA 1SB9A 2J0VA 1QCYA 3KKZA 4ZQEA 2VK2A 4KJZA 1H3EA 5JCOC 2J85A 3EMVA 1TA4A 3G5UA 3OX2A 3FRJA 3W2IA 4XB2A 4HW0A 3CCUI 5J8CA 2IGKA 3S70A 5H9WA 1ZIXA 2JH9A 4S1PA 4ENTA 5KQPA 1DJMA 2ZSIA 3GG9A 2VHXA 4HQMA 3DWGA 2JIRA 4HBZA 4L57A 2XY4A 4D4GA 1BU8A 2AK3A 2BUCA 1CE8B 3AV0B 3GARA 4JJZA 5DYGA 3U61B 3HOYJ 4JOCA 3HLTA 4PG6A 4HLNA 2PANA 4AX8A 3I4CA 3ZCTA 2LBFB 3N8HA 2ZTLA 3PHLA 4UTXA 1EUCA 4S1WA 1F2TB 4M3NA 4E7JA 4UEWA 3SYLA 4ILKA 4M9XA 1PHPA 4BH9A 5IJWA 4NH0A 1NLUA 3SLKA 1K8QA 2NGRA 2P2LA 2E5ZA 3QQPA 2WKRA 5AHOA 5L3SA 1NXWA 4JUCA 5A1TA 2PDAA 1DRJA 1KSFX 4C88A 5BSGA 1HOXA 2GLTA 2RCNA 2ZWVA 1FDTA 3Q1KA 4YMWA 1A9XB 4Z7QB 5LDHA 3A10A 2ORIA 1YULA 1XQ6A 2J45A 4JGIA 3CB2A 3TDKA 3LFHA 1E79D 4MYTA 4IUCS 4UBLA 2ONCA 2JFZA 1N3LA 1LNQA 1RZVA 2X41A 2ATCA 2PUTA 2RC6A 1P6RA 3F3XA 2H1KA 3ETCA 4R4JA 1LVKA 4G8JA 4GGPA 4Q5SF 3DNPA 4UCQA 4C0XA 5TJHA 5LSAA 1LLUA 5FWYB 2BN4A 2VPXA 3M83A 1XZMA 3MWEB 1KEEA 4XWWA 2O8KA 2Z6VA 1O94D 1QH8B 4W1PA 1MD0A 2FQ3A 2NXEA 2YMLA 4JQOA 4OHBA 3M34A 3S81A 1ZBQA 2R79A 3MUFA 1PFYA 5E1ZB 4KDCA 1Q57A 2R5ZB 4HN2A 4UNPA 3W7AA 3IAFA 5EJCA 4KIUA 1XPXA 4M0LA 2P5SA 2OV3A 4KH0A 1WUIS 4KXYA 3TO7A 5EFZA 3VAAA 2CFXA 1MNQA 4B0PA 2QI9F 4TXNA 2II6A 4RPGA 2NP7A 3SS9X 3GY0A 3A3OA 3N07A 3QFFA 1BO6A 1D2MA 4D4LA 5E8IA 3LSMA 4YACA 1R9NA 1Z0JA 3L4BA 3ZJ4A 1H9TA 1VMKA 4KYWA 4E09A 3OG9A 3ETLA 3A4CA 1XZDA 3O8OA 3PCRB 2WHQA 5KOJB 2ADUA 4MUFA 2Q29A 4J43A 1DWPA 2HOSA 1I39A 3F6YA 1V11A 1P5HA 3N0RA 3BG9A 4FFVA 4CV1A 2GCGA 1DAPA 3G49A 5HJ5A 1J59A 2OM2A 1ZOPA 1ETKA 1ZGJA 1BMTA 2ZKLA 1SD5A 3STHA 3PGJA 1C14A 5JRDS 4HSTA 4DDVA 1QNLA 3OZGA 2Q62A 4MUKA 4ZCPA 2HT1A 7ADHA 2C2ZA 1R6VA 1UBOS 4Q4CA 1M1ZA 3FPFA 2EJUA 2QD1A 3RREA 4G97A 1WI3A 4A3EJ 1SK8A 3TCXB 4DUGA 3KZKA 2O9JA 5JWRA 1WGXA 3EVFA 4YS6A 3ECAA 1JDTA 3TF5A 2NVWA 3FF4A 3DF9A 3GLKA 5CGZA 5BYKA 4CQNA 4PX9A 2HPIA 2IDMA 5C7YA 1NNEA 1ZM2A 4RZUA 3PO3J 1QG0A 3DCNA 3PHGA 4QAJA 4IWYA 2E19A 1MOQA 1WLSA 1ZVKA 3EUEA 4X3OA 3K32A 4OP1A 4BJHB 2JJQA 1C0WA 2VQDA 2ZXEA 3OQ6A 4MTLA 5JDIC 1F7VA 3U9LA 1GTRA 3IO3A 1ZVMA 3UAZA 1E6LA 2JH8A 3KZXA 1Q6YA 4HRIA 3AF4A 3I9NA 3Q7QA 4DSUA 1WBBA 1Z08A 3D7RA 3K6SA 4JJGA 5IJ9B 2XJ9A 3DDHA 1Z4IA 2AQFA 3H0GJ 3E7WA 4JYPA 4XCXA 3UXEA 3T95A 5BR1A 1EB8A 1W8IA 1H94A 3KS9A 5DWQA 1K6JA 2C2BA 4HDSB 4UATA 4F7WA 3VOEA 4MQ5A 4XARA 2E71A 3GPLA 4XLAA 2P2SA 4RK0A 2Z4TA 3I6ZA 4XFDA 2VF8A 1DWUA 2FRHA 1KJQA 2R62A 5LP6B 4G0QA 1DO8A 1TPYA 3DZGA 2YZKA 3K5IA 1VBNA 2CQQA 3RAPR 4D41A 2DERA 1K27A 2FQXA 1D4OA 2R96A 2XAUA 1LEAA 3C8DA 3CX4A 3G2IA 1BA2A 1E17A 2PX8A 3R0XA 2QZSA 3HJEA 1IEXA 1WSAA 3B51X 5HS8A 1IWOA 1JFFB 3IFSA 3QRWA 3HB0A 3N76A 4G25A 3VJLA 1UPXA 1TKAA 2VI5A 1Y82A 3KOOA 4FMCF 4CGZA 3GU3A 1MNDA 2D5VA 4OYHA 4YYEA 4YR7A 4CCNA 4E70A 4EO9A 1Z0FA 2AYYA 2X8LA 4J4HA 2QX7A 4K81B 3IBSA 1SC9A 2OEPA 2VWPA 2JFYA 4J0DA 3TQHA 2VSYA 4BO5A 3KE9A 4EFKA 4G07A 2MYSA 2B8JA 4LDQA 1R6TA 4RJ2A 3CCQI 4R05A 3SHVA 3VVMA 4BO0A 1NVEA 2WAXA 3G88A 4FI3F 4OHKA 1S7OA 5A0VA 3JQBA 2KBEA 4CXFA 3AYXB 1GG8A 3I8SA 3QNUA 5FL3A 1PV4A 2PS1A 4PO9A 1I4OA 1X9GA 1N6OA 1GHCA 2XVMA 4E1BA 5DTQA 4XLFA 2BCGY 1YRQA 5K8VA 3TTVA 3R5JA 4P08A 5LBIA 3U6KA 3WNVA 1KZGB 3MXOA 5JC8A 3ZGZA 2I7CA 1KYYA 5CYOA 3HJRA 3DQQA 1SRQA 4TLEA 4I9UA 3I4PA 2R8PA 3ZD9A 3KQHA 2TDXA 3IAUA 3OCXA 2C0QA 3QP9A 2WPDD 1XYYA 1B14A 1FSHA 1HT1E 4PG5A 1IJWC 3PXGA 2Y67A 1X6VA 4LMPA 5A2QZ 2Q2EA 5ICEA 1TFRA 1NA5A 3D3JA 4NBKA 5EWLA 4EMBA 4QVIA 3TZCA 5THKA 3GD5A 3OIPA 3HPQA 4YG2F 2ZYGA 4KI0A 4IIFA 1JU9A 1LV7A 2Q4TA 1JSXA 3TQTA 5BORA 1SIWA 1WVMA 3GLQA 1Y3AA 1I9GA 4IHJF 2ID4A 1WZUA 3TSAA 4PSKA 2NPOA 2MSDB 4ZTZB 1I7DA 2Y69H 2NVOA 4R2LA 5DNWA 3UJ7A 6ADHA 3F8SA 5JLJA 3LDUA 2NSHA 4LC1A 4F2GA 5E9WA 1KIAA 1PUIA 4AXBA 4NCAA 4F3QA 3BD7A 3DPLC 1FPQA 3SZPA 1DPFA 1W46A 1DEXA 4A0QA 2HVRA 3GELA 3RSLA 3VHLB 4EYGA 2Z6UA 3U4IA 4J94A 3T3NA 1Z83A 4OAQA 4FHGA 4XUGB 1JAZA 1Z4JA 3LPDA 3EEFA 3GJ6A 4RFSA 3MKWB 1DOHA 4FFWA 1H23A 3WWEA 3D8SA 2ZVDA 4GEGA 3DM9B 3WA6A 3RC9A 4C0JA 4DXHA 3ZUGA 4F4JA 1QONA 1WNTA 3DW1X 2A5DA 2IELA 2JFQA 2O3QA 3H17A 1ZM3A 1BSVA 2JPBA 4KQXA 4WCFB 5ARCA 1P7WA 4CQMA 1V1RA 4F1WA 5K3EA 2VQEB 2WP0A 2K7FA 1WB5A 1KNXA 2BRUC 1OFTA 1UHSA 1NUTA 1UJ5A 5TS3A 1ORWA 5A02A 5C5DA 5J43A 1V7PC 3AHHA 3F1LA 4HAYA 5G53C 5BT8A 1SMYF 4P4NA 5HRCA 3G4SI 3PPYA 3IBYA 1AUPA 1JA9A 1TA9A 2XGCA 2Y0SA 3GLHA 3GZ6A 1J2XA 4MGZR 5HLHA 4QELA 2YU3A 5G2OA 5CHEA 2TECE 5GMOA 3KQSA 3JD4A 4A5SA 4GI5A 3MUEA 1QX3A 3DM5A 1U7HA 4NC6A 2DMPA 3LA7A 2CLIB 5C1IA 5J2UA 1RJGA 1BN7A 3LFTA 1Z63A 1OF1A 1E59A 2DQZA 2BSQA 5EMNA 4A8TA 5LYJF 3DEHA 1T4CB 4ZOQI 1JVSA 1QHXA 4MO7A 1U8XX 1MORA 1V47A 1HFJA 1R6DA 4MLOA 2CLEB 3CQ9A 3Q9UA 3TD9A 4DSZA 2P0YA 1HBJA 1SAUA 1STOA 3OY2A 2YXNA 4W1QA 4KK4A 3T61A 1T4GA 3FR7A 3RRFA 3PCXA 1I2DA 3D2LA 4MV1A 4YJFB 5KS2A 1J4AA 3UWPA 1OA0A 3C6MA 4KWIA 3FMVA 4GPD1 3SK0A 3IUQA 2EX0A 2NS7A 1JQDA 2P9HA 4G0MA 1L5LA 2RGNA 4IKOA 1V45E 1M1YB 2EW1A 4V0OA 4OIOF 1LDJA 2R8BA 4XH9B 5C8DA 7ABPA 4LRTB 8AT1A 4A15A 1W76A 4Y3UA 4X45A 4LVCA 2ZIUB 2XMPA 1FDWA 4LRSB 1I1GA 1KPIA 3O31A 5AYVA 3GLFB 1SKUA 3KOYA 1SR8A 2SCUA 4IPTA 4AS1A 3A9TA 1VHLA 3FUUA 2UUAB 1KAHA 2W6MA 4NCKA 1YITI 3QBVA 2JGMA 2W9XA 3PGMA 4JT4A 2BHZA 1KO4A 2I99A 3DTIA 4NLLA 1HFEL 5FFNA 3UWMA 4U0VA 3SDBA 4Z7OB 1Y6GA 4BUJA 2WWRA 4B4OA 2GA2A 3HK2A 3VA7A 5BRAA 2C59A 2Q8QA 2H5JA 2GJKA 2PO7A 3PPVA 4BCCA 5KVRA 1UANA 2C5BA 3C41J 5ESDA 1DIHA 1SBYA 3HBMA 2IPAB 2FOIA 1WCWA 1JDBC 2JBAB 1E3QA 1YJBA 4FZVA 1P7VA 4N41A 4B6FA 3ME5A 1GTSA 4E15A 5K3BA 3CO0S 4OM8A 3TW6A 2UXXA 1U8CB 5ADVA 2JGDA 4F84A 2ESHA 4CKWA 2EBUA 3RKWA 3UB2A 5IDQA 3K6GA 2YOGA 4GVXA 4WLVA 3ZLVA 1V48A 4MSUA 1P9NA 2QL9A 2VNJA 3WLSA 6PFKA 1GZ4A 2K9QA 2CB9A 4XEHA 3PITA 1R27A 1H8HD 3CNHA 3OZVA 2P79A 3PXBA 4YY3B 4Z1MD 2OD9A 4BKXA 4UFNA 5LMNB 3EQZA 4MTEA 3DHNA 1ONOA 3NOVA 5H81A 5H83A 2QD3A 1WUHS 2UUBB 4HNTA 3GHYA 5C8YA 1DJNA 1QM5A 2J9FB 3UT5B 4AJKA 5T4BA 4OQEA 1SBIA 2XRFA 1C9MA 4E7ZA 1LBIA 4I1RA 4RTOA 5FTKA 4YP1A 3C2GA 1SFOJ 1DFHA 3W2FA 4L5IA 5F08A 3S3OA 3SSNA 2FDCA 3NHAA 3OQIB 1RYMA 1XD2B 1XCOA 1XUOA 2CMHA 4UJ3A 2ERXA 1SOMA 4QOGA 3WK7A 4BP8A 3TL4X 2GEKA 3TQSA 3WHLA 4WNAB 1DO2A 2JBAA 4NQWB 2V1DA 4IPAA 2BEVB 2I8CA 2K85A 1A7UA 3ENNA 5AVUA 2F90A 4OX9Y 1DUIA 1U1CA 1O2DA 3EISA 3CH4B 4X54A 3V2HA 4AULA 3V80A 1PK8A 1UHMA 1CUZA 5H5JA 3MWYW 3P27A 1QH8A 4K0KB 1DJPA 1N33B 3TQNA 3Q3SA 3DKIA 2XVCA 1KKMA 4D4JA 1RP1A 4XL9A 3UJDA 3WLIA 3SS7X 3PE6A 1VSQA 3VI3B 2F64A 1UZUA 3LC0A 3LXUX 3OU2A 3S7ZA 4NYIR 1K5PA 4LVNA 5L7YA 2QZPA 4U2BA 2XZOA 4EGYA 1BS9A 3KZYA 5JNLA 2CW7A 3PEWA 3FZVA 1GQSA 1CQWA 3I05A 3RUCA 3VHXB 1GUZA 3I64A 4CMEC 4D57A 3MTGA 3DS8A 4B3MB 2EQRA 1SXIA 3ACBA 5BOSB 1N3BA 1RLOA 1C7FA 2G5GX 2PEZA 2XXJA 3GIDA 2GPBA 2D0PB 3HNPA 1EHCA 1R5OA 1R74A 1SBTA 1LVHA 4BKOA 2JUCA 1HKTA 2VYQA 3AQIA 3IP8A 3NYIA 4DBVO 4LJ9A 1ZJWA 4J1SA 4X24A 2RH8A 2ZBUA 5AHRA 4H0FA 1W1IA 1FFHA 2R1ZA 4AMVA 5FOSA 1KWGA 1R71A 4PO3X 3EGXA 1SIOA 1R88A 4WY2A 5IKOA 4N76A 2QNRA 4TS9A 3TPZA 2I6QA 5E3MA 1F9NA 2H1CA 3KOXA 5ECDA 4V1CI 1MQ9A 1ON1A 2CBXA 1TLLA 5F51A 4TKVA 1SVWA 3LPAA 3RBVA 2ZVJA 1F8FA 5ALTA 1AJEA 1T8WA 2WMNB 2IYVA 2X3YA 3IAHA 2FZGA 1XG5A 3JQFA 4FZJA 4K9OA 3GVHA 1QK3A 1IE3A 3BR0A 1Q0SA 1IVSA 2MR5A 4NBSA 4JGBA 2WTUA 3F9KA 4MPDA 2FFRA 5ANRB 2KE5A 2HOEA 3DP7A 2NU6A 3INTA 4H31A 4R7TA 5DTIA 2RB4A 5C18A 1BMFA 4NBNA 1IAVA 4URZR 4OU4A 2X8JA 1U0JA 5E3HA 1RI1A 1NAIA 4GKBA 4MCIA 3W8DA 1WW2A 4DLTA 3BQMB 1OXVA 1GT6A 3A28A 2BM9A 3MD2A 3VZQA 2B9SA 3GEMA 3WDMA 2DUMA 2KZGA 4UUVA 5LZ4A 3CMEI 2I8DA 3PIDA 1OR7A 4F2PA 3RZDJ 4CEJA 3S8EA 2H11A 3Q0WA 3KLPX 1H9BA 1TJ4A 4BMNA 5JMOA 3H5TA 4AJ9A 4A3KJ 2GI4A 2R6R1 3V8MA 5D8KB 3CW2A 4CKEB 4WNCA 3VR0A 3WLEA 4M3GA 2Y66A 4Q1BA 4PC7A 3SGLA 1N9GA 1AGPA 4P36A 1B93A 2CGPA 2ZSJA 4X3CA 4KCGA 3WTCA 3FJ1A 1E92A 4ESHA 4FINA 1FU7A 3KWMA 2XCLA 4OD0A 4ZOCA 3RKRA 2AS5F 1J5YA 3I23A 3N2GA 1IBSA 4C4OA 1RD4A 3PFGA 3PDJA 4J7CA 4LF8B 4L9JA 2NRAC 5DM0A 3UH0A 5M5WJ 1U2QA 3I55I 1U81A 1ECPA 1C1YA 1GRNA 2CDCA 2E48A 5F2EA 1JRLA 3AERB 4I19A 3HXLA 3PXAA 1Y3CE 1YRLA 3DT8A 1LBHA 3OLZA 4MR7A 5ARBA 1U7OA 2X3FA 3BAFA 1R8JA 3SJZA 2AKYA 3JS5A 3ND7A 4J9UE 1M5TA 3CLHA 3BY6A 3CZ6A 4BO9A 3EQ6A 5AKGA 1TIPA 2XCQA 4Z6YA 1UZAA 4W5NA 1LLDA 4CF4A 3FCOA 2F5DA 1CTQA 3BH7A 4J3FA 4Q7EA 1IXYA 4KPYA 1QZ3A 5HZGA 3NATA 2NO6A 2VXOA 2H2AA 4O2BB 4MA0A 2QG4A 4GBJA 4RPCA 5KREA 4G0VA 1RS0A 4Z4IA 1BA5A 4WKBA 5KI6A 2ZI7A 3WQBA 3CRRA 4BDSA 1JIJA 3IQZA 1T5IA 1VPDA 2XIGA 3UOGA 1EUYA 3A4VA 2OCXA 3AHDA 4KVZA 3EXIB 1RACA 4WFIA 4P33A 2XTNA 2AFIE 2LW7A 2ZCJA 4W1SA 2EZUA 3D4BA 2JIZD 1D2GA 5IWCA 2NVUA 4ZAYA 5ECGC 4B87A 2IX3A 1Y89A 2W70A 4MV4A 1CX9B 3NAZA 4OI0A 1J0DA 3F8FA 3K0CC 5T67A 1OYYA 2E89A 1XEAA 1Z9BA 2CUFA 1C2YA 2PFKA 3AB3A 5T64A 1S3FA 1WRBA 1ZH6A 1YUMA 2WOOA 4DCNA 3MFQA 4Q05A 5I8WA 3C16C 1A9PA 1CF7A 3F6BX 4MKRA 3JR9A 4ENRA 1YS9A 4DCJA 1E6WA 4ASUD 5DXAA 5CDYA 5L3QA 1YL5A 2GK7A 1G1MA 1RWVA 2CDAA 1IWBB 3OSZA 4EJ2A 4JYAB 5EHXA 2BY3A 2W8BB 4IXAA 4Z9XA 3MTJA 1GQRA 2VNAA 3KFWX 4AY2A 2W7NA 3NXKA 4MA5A 1QF6A 2Q3LA 3KAKA 1NN3A 2I2FA 2IIQA 2XUHA 4HYYA 3MOGA 4LSWA 5EE5B 1RWKA 3GAZA 3AEUA 1FFXA 4AWAA 1N2CA 2DPLA 4QUJA 2IV2X 4JV5B 2EIXA 2ZANA 2C0CA 5IAJA 5HOQA 3B70A 3PWZA 4KRXA 4NOMA 1ISJA 2P6PA 3I2GA 1N9GB 5HVNA 2R4GA 2GDJA 3HHEA 4AU1A 1EFKA 4F9FA 2DFNA 1GLNA 5KYKA 1U63A 3BDDA 3MCTA 3M5PA 4CUKA 5ALJA 5BPFA 2VHTA 3GEIA 4BLVA 1YH3A 4KISA 3KV3O 3IIMA 3FMSA 2R8XA 3GRCA 1VFCA 5FJ8J 1WMEA 4N3NA 4J1TC 4XZ3A 4HGZA 3K71B 5HE8A 1M6YA 4H17A 2FKAA 4YAGA 3UC5A 1TQDA 1DQZA 1EDOA 2RHJA 2Z3YA 3TS1A 1VJRA 4MW7A 3HU5A 5TMBA 3VSAA 5KWSA 2GWRA 3STXA 1OFIA 2HNBA 3GTOJ 1XNGA 3IERA 2YNMD 2WG0A 2H1RA 3L9WA 2PUHA 5JVDA 1A9SA 2VJQA 4OV6B 4WGFA 1N6NA 5HODA 4AF7A 4S2UA 4KMFA 4CV3A 1CD5A 3NUZA 3SIRA 1JQ5A 1IIRA 4GUAA 1KY5A 4ARUA 1VE5A 2BOLA 3H05A 4DV5B 1UP4A 1DPGA 3CLTD 3SKXA 4L15A 1GPYA 5EYPB 1AZTA 2IE8A 2V0CA 1SQGA 2XWPA 2HS5A 3TQRA 2PYDA 2Q0SA 4J91A 1KOFA 2G09A 2HSGA 1QSGA 2XNDA 3NCHA 3R0QA 5C81A 1W5BA 4TQ9A 5ALHA 1PS9A 2XZPA 2YRWA 1X1QA 1YKGA 3K1ZA 2QTVA 1RHMA 5COBA 4EA9A 1Q1EA 4DIBA 1UXJA 3ROTA 4KW7A 4MNTA 1N6KA 1J2EA 4AQ7A 2CQ7A 1NVVQ 1PYOA 3BD6A 1QQAA 3QU2A 1VE1A 4XKWA 2IPLA 1EH5A 3LPCA 4LDNA 1EF4A 1QPZA 4M1OA 5AJTA 4QODA 1J97A 2YXPX 3W78A 3HCOA 1G6OA 4LK0F 1PYGA 1WMFA 2NO5A 3O90A 1PT9A 4MW4A 1QVVA 4PHHA 3CIOA 3IT2A 2Q4OA 5A5GA 3QKSB 3DE0X 1NYQA 3J7AC 3USES 1DBWA 3N0VA 1V7CA 4YMSA 2P30A 3Q6IA 5KQSA 2AO9A 4RE6A 2PFGA 1CRZA 4XA8A 4JLWA 4CW7A 3PNBA 2M9HA 4XR9A 2GBIA 3AB7A 4MUNA 2OBMA 2PKQP 3AESA 4EJUA 1KEUA 4ZAXA 3L04A 1TBXA 4IIYA 5J4LA 3S8YA 2NTVA 1EX7A 3HCCA 2BHSA 1EAMA 3LXMA 3T1NA 4PQEA 2E5NA 2JA2A 3DUFB 4WSOA 2C7GA 1MC8A 3IAAA 1HLVA 4QPNA 4AJIA 4ARSA 4DQKA 1MB2A 3L0PA 5IFKA 3SNKA 3O93A 3W9BA 1KH1A 3SSOA 4QKQA 1JZSA 3MMPA 5KC9A 4O2AA 1V35A 4Q4DA 4P9FA 4A12A 3BB4A 2CZCA 1IW7F 1PYVA 3WIVA 2P62A 3LTNC 1IC8A 2G82A 1Y3BE 2JVKA 3DVSX 3P96A 2CVFA 1FTGA 3H1TA 1XMXA 1Y8QB 2D13A 2H8KA 4XLLA 4GGOA 3WNBA 3DCIA 3F0CA 4PNPA 3EUAA 1BHJA 2POCA 3GEPA 4XASA 3OZSA 4PG4A 4H1HA 2ISYA 2GN9A 4WBNF 2O8BB 3LIPA 3OX3A 2W2TA 4WCFC 3V7WA 3U3XA 1NXVA 4UUNA 4HEJA 2ZBGA 4A91A 4KQ9A 5EIEA 5FPKA 1VKNA 4JH0A 3I9FA 2Q4EA 3OIQA 3OPYA 4UBOA 4G5SA 1C1DA 5ENZA 3RSCA 2XGDA 1C7EA 1C8BA 1W4BA 4KMRA 2F62A 2XUGA 3EIOA 4P3PA 4B2PA 1CQIB 1BQEA 4URXR 1JWLA 4IMIB 3NKVA 1BOOA 1JJVA 4F56A 1LQ1A 4ILEA 2JGAA 1CZNA 1LQTA 2EGHA 3SJAA 4DQUA 2R68A 3ET4A 3CFYA 5LZ8A 3UMMA 1ACIA 2FOKA 3Q5FA 2HK7A 3ZE8A 2PSDA 2VTKA 1XSVA 4DGWB 3L6DA 2CU7A 1RJDA 1RSZA 1RWPA 2FTKE 3HS3A 3LWNA 3UAOA 2QF7A 4ZEVA 2ZATA 2DBZA 1XNHA 4OA8A 1ZTRA 1T38A 3NTXA 1QZXA 1U11A 4O4JF 4X92A 4BGEA 2HZBA 4IFEA 1TAQA 3QXXA 4JL5A 4Y0AA 2V65A 1WPRA 2GA9A 1JYFA 1EEHA 1SUBA 2CFCA 2V8OA 3QPWA 4G5FA 2QQEA 1Y8CA 1QU2A 2HQSA 3EY4A 3JAKB 3BG5A 5C3MA 1EZ1A 1RKTA 4EPRA 1OBCA 4D6PA 1BDBA 1NOJA 4WN9A 2FQQA 5EHNA 1FTYA 5AM5A 3CCFA 5JEDA 2ZJ1A 3MJVA 1US8B 3NP7A 4UVDA 1XTSA 1WUKS 2PS3A 2B4KA 3BWYA 4CCSA 4E7KA 3K1AA 3VTZA 4HZUA 3WLQA 4DRXA 5IULC 4RTNA 1SFEA 2HK6A 2Q4RA 4BHPA 5GJWC 4BCDA 2OCAA 1MIHA 3T8RA 2HLNA 1L7XA 3WO1A 2B21A 3ADPA 2H7CA 4NCXA 2P5LC 2PCLA 4NJEB 2FZCA 3RR2A 4M73A 3VC2A 4IUDS 4JUIA 2V96A 2FYTA 3ANLA 4BFWA 2Q21A 3BJMA 3EDCA 1SNYA 3WQHA 4B3SB 3JQQA 2RQQA 1JJIA 3L43A 4M36A 1LDMA 3SMVA 1CUHA 5H6RA 4MLCA 1YZTA 4HS4A 4AO7A 4F8EA 4Y2XA 1POWA 1KIFA 1UPUA 2P3LA 4BLUA 5G3ZA 2FWNA 5FKKA 3AKYA 3AY6A 4G5QA 1GTJ1 2QN2A 2HRBA 3C8ZA 3P9YA 1QZYA 4J0KA 1CUGA 3L5KA 2HFHA 1YW8A 4GYKA 3U3JA 1XG1A 4LHVA 3CSDA 3CUKA 1N4DA 1U6KA 5TVKA 4K05A 1P1KA 1L5QA 3MIZA 2W4QA 3CB4A 3VHQA 1K5HA 5CG2A 3B3AA 3MEQA 2JCSA 2P0EA 5SICE 4OHPA 3D0KA 4KZPA 1KQ9A 1OQYA 2VAWA 2FN8A 1ZL2A 2X19A 1B43A 4K9LA 4M1ZA 2QEQA 1PZEA 4Q4AA 2RARA 5LPNA 1MB3A 4YCNA 2FQ4A 4RGQA 4HRVA 3WHPA 2QEXI 3PI7A 1L5MA 4OWRB 1VGVA 1LX7A 3LQKA 5JAQA 3T9AA 2V4ZA 4C05A 4IR7A 1PWEA 4NYIQ 4ZAGA 4QXMA 4ED9A 2R86A 2SKEA 2BJHA 4BKQA 1OASA 2BC9A 2IPNA 2ZJ3A 1J22A 3KT0A 3FYUB 3OM8A 1PSZA 2ZXHA 1LFUP 5IAOA 4JVOA 1RYFA 2P9JA 2AJCA 1YQWA 3DH0A 3LJKA 3OOUA 1V3QE 1R1VA 5CLGA 3AQ4A 1QR6A 4OP2A 2V9CA 3NO4A 1U8AA 4NDAA 2P35A 5D8LB 2RGAA 4M0MA 2C4HA 3HN6A 4RVSA 3LQYA 5AONA 3G6EI 4NDNE 5DTMA 3SIWA 4TSKA 1J1ZA 3RJTA 2FVXA 1KKLA 2JBHA 4RGUA 1XTPA 1VTKA 3RYTC 1WI9A 3TXXA 1Y9JA 2HDDA 3M4ZA 4G0ZA 1VMEA 3F3YA 3OZXA 4DIUA 2CKDA 3GUCA 2YPRA 3OCZA 1AKQA 1UM9B 3DA8A 3OLQA 5JLXA 2XMDA 1Z17A 5AKIA 1FP4A 2FRXA 4H2DA 1IM5A 3VR4A 2JPDA 2NVYJ 4N6OA 2OFFA 2OENG 3G82C 3SFZA 3AI2A 2UZKA 3GFQA 3L84A 3DMYA 2VI6A 1CPYA 2ZRAA 1MF7A 4N3GA 1KFCB 1YS1X 1DX6A 2CMGA 3W34A 4C3HJ 1NQXA 2GAUA 3AEKB 4NECA 3NG1A 1LSOA 5IXSA 5KWVA 3MWMA 3FI9A 4LISA 5B7GA 1OXBB 3V42A 4Z6KA 1YVUA 4BYYA 1QIMA 1VE3A 2J59A 2FEKA 1NKTA 2QQGA 4FHDA 4NOKA 4HOBA 2XDQB 1CR1A 4PSUA 4Q7LA 3R3SA 4P4SA 5D8DA 3VV3A 1BAPA 4RD2A 1LZLA 1YE5A 4AURA 3AKZA 2R11A 3BH6A 4AC9A 5DGHA 3EF1A 4L5BA 4M9RA 4N8DA 4HGPA 1HYGA 1URPA 2OBNA 3BSWA 4RZ2A 5A5FA 4RM3A 2A1TR 1X8KA 3BR5A 3HUEA 2QN6A 4RMIA 5G0VA 4BJ1A 2L0KA 2X6OA 3D1VA 4LY9A 1FWZA 4DAOA 3IT1A 4DQLA 2O3RA 3C7AA 2MSEB 1A5JA 4RMGA 1G4AE 1N6IA 2P6UA 2QRLA 4ND8B 3WK9A 1OWPA 3VEPA 5A4KA 1WDLA 1V3UA 2VT2A 5TT1A 5FLXZ 1FFAA 3ZC3A 3AFMA 2UVPB 3KXLA 4X6XA 3ZXXA 1MN6A 2OZVA 3WWCA 4RO0A 2WKSA 2PUGA 3PC6A 4N0EA 3NBQA 4ZOAA 4BVHA 4YMIA 4E4HA 1OZFA 1M2VB 2EKQA 1RUNA 2GXBA 4JJ4A 5FFMA 5HDNA 3QRFF 1YZKA 2B25A 2DP4E 2PU7A 2DYRH 1G4HA 3M3HA 3I9V1 3D3WA 3VJRA 3KCNA 5ICGA 4YLYA 2L0XA 1ZOOA 3GT4A 5HCIA 1WVIA 4BVKA 2LV8A 3Q72A 3LY9A 4HB0A 4N5MA 4QO8A 4ZDKA 2P4SA 2GBYA 4TTTS 2HQ1A 4KGXA 4B2IA 1VP3A 3KKLA 4H3KB 1HDZA 3RWBA 5JMWA 1EMDA 1JYEA 2VKQA 3PPWA 4HDKA 5CX4A 1WVRA 5TRDA 2OQ2A 4HAWA 3GVAA 1B1CA 1E7WA 2AQ8A 2EG5A 3QIVA 4J0GA 2G0EA 4LGMA 3REGA 2D6FA 4ND2A 4REOA 1AZWA 1FQKA 1S96A 2I6FA 3GL9A 4CL0A 1T6BY 2E1CA 2GNOA 2QHXA 2FJUA 5T6MA 4UUBA 5BOVA 1UFMA 5F6FA 4WCFA 3TW4A 3VOAA 1JR3E 2W2OA 1IG3A 3HRSA 3GJ5A 5KYWA 2G8LA 4H7DA 4CHUA 1LPPA 4OQNA 2HQ5A 1YL6A 4UU0A 4D43A 4DLLA 2NP6A 1I2AA 1ZKMA 3BSSA 1MKYA 3AUYA 1WZIA 4B76A 4AS3A 2IE0A 2XRZA 4IIEA 3R61A 1J2TA 5CH5A 3ZTWA 4M55A 1VB3A 3HQ4O 4F0JA 3HPRA 4ZVKA 2DHEA 2QSYA 3I3SR 5AW7A 3V7UA 1YU9A 3H36A 1QANA 1Y3HA 2I2BA 4CLEA 5JAZA 2IYXA 2XNSA 3JPWA 3PIRA 3OSUA 5CLLA 5DV9A 4AWXA 4YRKA 2HJWA 1DEHA 2V7FA 1RQGA 4J9VA 3NBFA 2C57A 2P4UA 2WC2A 4CCOA 3TGPA 1JUDA 5K8IA 1UC5B 2WSIA 4I1UA 5L4SA 1RABA 3CONA 3CLSC 3HJUA 5ITZB 3LW8A 2PAAA 1BW6A 1E6EA 4P2GA 3LSKA 1ISGA 2P8JA 3QYAA 2PXCA 4HQRA 1AQYA 4U6SA 4AICA 5JPIA 2EHJA 5EZ6B 3ZZNA 4BNDA 2CLDX 4WD3A 1IYZA 4CXMA 4M38A 4E46A 3HGYA 3A03A 1UBFA 2HF8A 4J6EA 4O2BF 1BKSB 2H27A 3DQZA 1RQLA 4MW9A 4ND8A 4WESA 1TLFA 3E8XA 2NZXA 3H7IA 2B9EA 3U7RA 3I61A 3T3MB 3R3WA 3KQOA 2AOTA 3SDSA 2DTEA 2G83A 1O6FA 1V9CA 1YC2A 2QLBA 4H4EA 4K6FA 3KPVA 5KZMB 3ZJUA 4DR4B 2VEDA 4OAYA 1UBMS 3AH8A 1N0UA 2ZRLA 1NZFA 3BCRA 4Q4JA 2NYVA 3QFSA 5C34B 2XYPA 2A9JA 5IM5A 1D8TA 4K86A 1ZJZA 5LQSA 4D7NA 1Q17A 2A33A 3QVMA 1Z7UA 3WZLA 3F5SA 4DNQA 5BV0A 5CX1A 5I8PA 5KWEA 3T1YB 4CR7A 4BZZA 3CDHA 4TV7A 5CJJA 3HM2A 3BH0A 1IQPA 1GPWB 2QRJA 1MQ8B 4LVOA 1QX4A 3DBLB 3CWZA 1X1RA 1SH7A 4KXXA 3RAFC 4P0PB 1KU2A 2BTEA 4IJQA 1REPC 3V8BA 3VPSA 2IZ7A 3KL4A 2ON6A 4EG1A 2DTZA 2ZYVX 1NLMA 5HZKA 2O8FB 1J2UA 3PTZA 5REQA 3IOBA 4KMOA 1TE2A 3LCRA 4QRIA 5KSWB 2EB7A 2RDPA 3PX3A 3VR6H 3ESRA 2BHRA 3B38A 1F43A 221PA 2B2XA 1E1QA 1BE6A 2F8MA 3CD6I 1R0RE 3EXG1 3P19A 5F4ZA 4AMGA 4C7KA 3EUHA 1NJ5A 2OESA 1OJLA 1Z8DA 3FLBA 3JQPA 2YVUA 1COWD 3OIWA 3VVLA 1C7RA 1CJUC 1USGA 4IOAF 4PLYA 1JDSA 2Q0OA 1SXGA 3AHIA 3EFOB 2ID7A 4RA6A 3E5NA 2QJWA 4AJOA 4Z0NA 3O8CA 2BFDB 3VPFA 1IXKA 1ZUNB 3RF7A 3G8DA 3JWHA 2Q9UA 1A2QA 1M2WA 2GJAA 2XE4A 5EYRA 2IIPA 2NO7A 3QMWA 3NBUA 4JU8A 2WV7A 4M46A 1PO7A 1YZQA 2Z5VA 1E18A 4DWJA 1NG7A 1TVMA 3SMQA 4FXPA 2GBCA 1Z5WA 4N6GA 1P9RA 2O8EA 4IKEA 4R1TA 2QT1A 5BUSA 2X85A 2PS9A 2IYLD 4BJ3A 5E95A 4BMZA 1G8PA 1PS0A 2BXYA 3HYCA 2EIMH 3TLMA 2ZJ0A 3IVXA 3ZGLA 1ZRFA 1RCUA 2C4UA 1B0ZA 2MA3A 2DO7A 3T7DA 3H6KA 4HUTA 3HKZN 4HSRA 3FZNA 2BD0A 2R4TA 4CLOB 4FMPA 1X92A 3V3TA 3CKMA 3FNIA 5F0FA 1L4EA 4LY6A 3JASA 3RTBA 1NATA 4CMIA 4D3XA 1NPYA 1HE4A 4XOTA 5DW0A 4DR7B 2XGJA 3BROA 5K5RA 3PENA 4UHTA 1QVAA 3V1MA 3F21A 3GIWA 4HQKA 1XRSB 1PNQA 1PS8A 1O8BA 3PC4A 1DG1G 1Z4MA 1J20A 1JJBA 2KISA 3BR2A 5LMZA 1SHTX 1RZRD 1BFDA 1Y4SA 3UW1A 5HKKA 1D8KA 1T2DA 3EHDA 4LNUB 4HMOA 4YX9A 1GUDA 5F1OA 5I5EA 5A9RA 2E4UA 4CEJB 1NXSA 3CDIA 3PUZA 2B4QA 4QT0A 2RNGA 3LSGA 5EG0A 1RXSA 1VJGA 4HBLA 1WL8A 3BFVA 5JZOA 2JK0A 1VQ9I 4BO6A 1DEAA 3HKCB 3OPMA 3QFHA 1LPSA 2R6DA 3CMCO 5LQMA 4CF3A 1NW7A 1RXWA 3GGSA 3PUXA 3QXHA 3WGIA 4K6HA 1CQIA 4ND5A 4L8LA 3V8LA 5EE1A 2AHRA 1YE9A 1B16A 1T8PA 4U39A 1BQ4A 2JIBA 1AA9A 3KXDA 5DJ5A 2OPHA 3RK1A 3X1KA 1FLIA 1AK2A 1YAJA 4JMLA 3IAM2 4FXOA 1E2JA 3S55A 1HLPA 2QQ5A 2I2WA 1LX6A 4C7XA 2VBIA 2YZMA 1WXGA 5F7JA 1CUJA 3QWHA 3L7DA 2ZJQF 3ESDA 3HA2A 1Z1DA 3CKYA 4Y6LA 1U5TA 2KLOA 3TZLA 4PX2A 4TGLA 4UW9A 1QDUA 3KTDA 1RPNA 2QV7A 1WUYA 1MJGM 1QYXA 3H2SA 3SR4A 5EJAA 2DAPA 2C8JA 3E4DA 3INGA 4F5YA 3NPAA 4MVJG 1X4OA 4HCJA 5KNCD 5EE3A 4IRGA 1AHIA 1IMJA 4AIRA 2M45A 3HJCA 4CJXA 5K0TA 3GA7A 3UB4A 3BXZA 5D3MB 4WXMA 4OBWA 4FZ5A 3ZWBA 1UC4B 4Q4AB 3MB8A 1G8SA 3I1FA 4RV9A 3ACCA 2QW0X 3AINA 4DVGA 1WPGA 1AHHA 2F4MB 3CMYA 4E5NA 1HBXG 1H66A 4FMDF 4OGKA 2G0AA 3M1LA 5E17F 5KX5F 1J42A 2WQ7A 2GIVA 2A9QA 3B48A 2VC1A 2CXHA 5EC8A 4QBKA 5EWLB 4RS8A 3IQHX 3T54A 3KYCA 4EG3A 2DY0A 3CO6C 2QRUA 3MINA 1SZDA 4OQMA 3CJQB 1DQNA 2VL7A 5LEKA 5M5BA 1Y6JA 1W0KA 5FFXA 2QK4A 1APLC 5H70A 4UDNA 5DMHA 1A4UA 2UV8A 5BMZA 1GDTA 3K73O 2JUGA 1EE1A 3BZBA 1D6JA 3VISA 3D4PA 3UJHA 3II6X 1HMPA 1ZINA 2IP4A 2JEOA 1OI3A 3DEUA 4G63A 4K8OA 1GTG1 4L0QA 2QAGA 1QYVA 2Y27A 3GCXA 4R54A 4FCYA 4PIVA 5EY5B 4NBWA 3HRIA 5ENDA 3V8EA 1SUFA 4AU7A 4MWEA 3NDIA 4NS4A 4WDQA 3AUAA 4OUKX 5EP4A 2EBWA 1ZC4A 2GCNA 1UEJA 1VBMA 4QGSA 4ARCA 2I10A 3TCNA 2WJIA 1BEUB 1NM5C 2N9UA 3IYLW 2W71A 3A04A 1SCDA 3K4QA 4IJ6A 1DU6A 2QN9A 4W5QA 1L5RA 2JLVA 3OZEA 2W24A 1GZ7A 4FD3A 1YKSA 2WBLC 4NBLA 3DF8A 3IELA 4BWFB 1UG2A 2ZIWB 2VG8A 1N2CB 3ITEA 3X43A 3GQBB 3MZ0A 4IF6A 4U7PB 4BXFA 1ZXXA 3R75A 3FK7A 4Q3KA 2IU4A 3IBCA 1P8JA 4IQJA 2P9BA 1HMYA 3ESCA 1XR3A 2H4HA 3QVGB 4BX8A 4GG1A 2VNSA 1N5JA 4ZEXA 4MTDA 2E1MB 2M8EA 3FMRA 1U1GA 2BFCB 4LMAA 4P4LA 5MF6A 1QC5A 3L0OA 1B9MA 2BBWA 5KKAA 2DJIA 4GOOD 3MJRA 2M0MA 4A0ZA 4P34A 4PYOA 1Z2CA 2Q4BA 3D4NA 4LW8A 3E61A 1QP8A 3EIXA 4E14A 5L3GA 1LFAA 1NW9B 4HQ6A 3OT1A 3PF9A 2PL9A 4GMXA 3ZHYA 1UIMA 1M9NA 3QP6A 1O03A 2G9VA 2QY6A 2WYOA 3IPYA 4B8YA 2ZZMA 2X0EA 4INPA 4CYMA 2JEYA 2O54A 5D85A 5LLTA 3L01A 4I55B 1MJNA 4UNNA 4K0RA 3R7AA 5JVDB 4OTZA 3UMCA 1WHSB 1YTLA 2V7UA 3WU0A 1N7GA 3N2IA 2UWMA 3DHEA 1KEZA 5FCDA 2A94A 4MPRA 2PMWB 5AKJA 4GBED 4L85A 4BBZA 4P4UA 4WJKB 1OLUA 1ANKA 3HCFA 2JS7A 3PA8A 1N5LA 2JAHA 4HEA1 4HQFA 4QC2A 3U4DA 4KITB 1YHQI 3GJ8A 3TBFA 1TYBE 4M6WA 4MVJA 2QRHA 3RHSA 1QAQA 5D5WB 1DUXC 4A8JA 3FTNA 2IHYA 3JYQA 2MLKA 1D2HA 4IBOA 3OOPA 2IUUA 4S1OA 4CMEA 2X23A 1IOLA 3G85A 3DBHB 1RRFA 1X1TA 4I1SA 2W2QA 5IDWA 4JHXA 2E60A 2GBGA 3BIXA 2LWIA 3DGEC 2GF9A 3MRSA 3NYWA 4ZODA 3UKJA 3ZMZA 4D9CA 3HHPA 5I7VA 3Q0UA 2HFJA 1XTVA 3RGWS 2Z99A 2QQ8A 1G60A 1JXAA 3VTKA 1WZNA 2DCMA 4DR3B 1XCVA 3ZW7A 4CM4B 3PQKA 1IDN1 2F4OB 1W1UA 2R65A 2X2FA 2C98A 4CF5A 2C7QA 1FL9A 2EXXA 2YIDA 3KOWA 4FHFA 4UXIA 1KEKA 4ER7A 4OFWA 1MSFC 5A0TA 3BUSA 1PWYE 4FZRA 3ZXSA 4GNKA 4RFLA 3U3KA 2VBCA 2EFJA 3ID6C 3AP2A 2GZRA 1J07A 4R2XA 1J1UA 3A4IA 4S1NA 2WLSA 3ORHA 2VSQA 4HGYA 4ZT5A 1M2FA 1Z74A 4DT1A 5K1ZA 1HWYA 3VNAA 4EH1A 5BN4A 1CERA 1CY7A 4GP9A 1Z4LA 5AIPA 4TKMA 3WNDA 2A7QA 5G4KA 1T1RA 4FSDA 3KSDO 4FC6A 4L8YA 4P7BA 4ZQIA 5E3IA 3LUAA 5BQ5A 3FKSD 3R3UA 3VZCA 2BVMA 1SQFA 1W5EA 2DECA 4JUBA 4L1KA 3RTGA 4YV0A 2JCVA 4RKFA 4B43A 5A7HA 2O23A 2W00A 2O3TA 2LF7A 2GF0A 4HDMB 5CLJA 1XAGA 3OC0A 3BTJA 3Q87B 3CX6A 1GLGA 1ZMRA 1QIDA 5ALPA 3NX4A 2F4VB 4J1QA 5SY9A 2FMLA 5EMJA 1EFVA 3DB1A 3LU1A 4TYMA 5HRAA 3SZ3A 3WZMA 3HZRA 4QUGA 4YPVA 5I9NA 2R7XA 1P1RA 2JI9A 3L7KA 4D9HA 2M6RA 2QUFA 1AKRA 3CM0A 3DGFC 3HCEA 3OJLA 4MMXB 4S2EA 5DNYB 2HXGA 3AGQA 2X2OA 3RHTA 1VE7A 2QN1A 1DFGA 4P7FA 3TRIA 4DA7A 1G8FA 4YP9A 4JYBA 3HV2A 3M7IA 2PH3A 3LT4A 3FXQA 3VPRA 3KYIB 3UHPA 1WBJB 1OR8A 4KXLA 1VBKA 3ZBTA 5JI3E 4CEIA 4US2R 1U9YA 2IKSA 3J80K 3ABSB 4KAAA 2WKWA 1D1CA 4URFA 4MGYR 1J24A 4J7UA 2HPMA 3ABMH 2FZ4A 1SKYE 3CCBA 2YW9A 3SF8A 1QH9A 5F5XA 5U4XA 1W34A 1MUUA 3C39A 3KHTA 1RYNA 3M5DA 3IJRA 1QJCA 4L4YA 2ZE8A 4XIGS 5T3UA 1B8NA 5DISB 1PR4A 1F0NA 2D0OB 2WU1A 3R6DA 5KVVA 5EZYA 4LITA 1ZD9A 2GB4A 1GCAA 1LH0A 1KQPA 5ILOA 5AKZA 1I5EA 2ACWA 5BNFA 4HFNA 1AOXA 3EOBI 4L72A 4E6EA 3BTLA 2J08A 2EX4A 1QGOA 1CZKA 5K7ZA 1GNVA 1KZYC 2F43A 2OY0A 1T0BA 1VLMA 2RC5A 2OQIA 4R68A 3ZWYA 4AYTA 4ZZ0A 2QZ8A 3HGMA 3K9BA 4Y2UA 3W5BA 1TYCA 1GQOA 2QTAA 3BHJA 3OT5A 4TPKA 5FWXB 5KBYA 4CMJA 5F5NA 2OG2A 2VF7A 2ZE7A 3VBCA 3K35A 1LZKA 1G98A 4DMKA 5AW6A 2HJVA 2PZJA 4F5EA 2JLBA 3CXUA 1IV8A 3VR3D 3C3BA 2O7OA 2M87A 2C4MA 3M8KA 2R8YA 4I3GA 3U1VA 1UG0A 2ZSHB 2JAUA 3OM9A 4EHAA 2QX8A 2D59A 3HZHA 3FLAA 4ZCMA 4RHTA 5JZMA 1OLTA 1FF9A 1VFNA 3R8FA 3O4VA 1P7IA 3WJ2A 2CMPA 3Q3CA 1YVDA 1OXUA 2C61A 4I3HA 3SF8B 4CLRA 3HH8A 1CIJA 1GVHA 4X8MA 5FPSA 3TR6A 2VPWA 1MRNA 1FMLA 3WRXC 4L74A 1U2GA 3A4NA 3MTAA 2JCGA 4FYWA 5JRJA 2JRTA 2NQTA 4JELA 2Y76A 2JCYA 3AR7A 3PNTA 1YJCA 2GXQA 4U1RA 4ARZA 3AZQA 2EBHX 1TTYA 1ISSA 3L2OB 3I04M 4FOTA 5DRYA 3UPUA 4PPFA 4RB1A 1F2VA 4FBLA 4LZJA 4UM7A 4BEVA 3QUAA 1PZHA 3ENZA 1JIXA 1P7ZA 3LUCA 2VBXA 3GTGJ 1JG4A 3FFXA 5BV8A 1PIWA 3WBJA 1Z82A 2WINI 2VOOA 4AN0A 5BSFA 4TYYA 2CXQA 3EE6A 5LYJA 3J7AO 2V03A 1BRTA 4HAOA 3UA3A 3T7JA 4AJPA 3FBGA 5KSOA 3UAWA 2Y6VA 2C83A 3AFIA 3UB3A 1TWFJ 1N5IA 5WRFA 2H4XA 3MYYA 1BI2A 4DA8A 3UF0A 1Z67A 2VJLA 3BR1A 2CVHA 2KLBA 3BWCA 4AAYA 4I09A 4ASNA 5FDFA 2FUNB 4C78A 3RSZA 4HQEA 5I4CA 3FETA 4E5PA 1BIBA 3MZYA 3K2AA 4ZARA 1JDPA 2DLLA 4RB0A 2KDZA 2KIUA 3QVLA 3TL2A 1X1CA 3BP8A 2YQ4A 4GOJA 1MGPA 2O4CA 5FPPA 4IHAA 2VTBA 2QX9A 4EF6A 5JSHA 4BY1J 1G7CA 2EZ8A 2ZOSA 1R0XA 4JX9A 4DXAA 5KSZA 1DKUA 3BIWA 3HY3A 4D98A 3OOSA 4KTTE 4Q16A 2J0UB 1Z3CA 4DV1B 5A06A 2CXXA 2YFQA 4TV9B 5LBUA 2ZYIA 3OCWA 3VTFA 5KJEA 1HSOA 3QUTA 4C06A 4RMHA 5I4IA 1WHUA 3B1WA 4IQGA 4H7KA 4TSRA 3AW8A 2CO5A 3FRIA 2P9QA 4X1OA 4XRRA 3RC7A 5JH7F 1L0BA 3AO0B 2GZSA 4F9TA 4GKAA 3TD6A 5K0JA 3TUZC 2YX7A 4BHBA 1M54A 5H16A 1FUYB 1L9XA 3RRBA 5JO9A 2OFXA 1Y6ZA 1IZ8A 3PC2A 1ZGZA 3K7AJ 4GWGA 1XP5A 3L46A 3O91A 4NCHA 3ASOH 5KYVA 3ABUA 2KJCA 1D1QA 4G1VA 1C9EA 3TZ6A 4AFNA 5C8YB 1CNEA 2R5WA 1FBSA 2VQHA 3SYNA 4EJVA 1IC6A 3A32A 4QDTA 4WFKA 5J9FA 3ZGYA 2ECBA 1FP6A 2VJIA 4EENA 4YJ2B 2O59A 5IHXA 4OGLA 3ZGXA 4EABA 2WF6A 1NUQA 2OFOA 4UUSB 1KONA 1DX4A 1KAGA 2J4CA 2XHZA 4O2AF 4U6NA 4YJ3F 5FBWB 3X3HA 5FLKA 3FGNA 1BC8C 1BYUA 3Q3VA 4TV9A 3LUGA 4LLGF 3S1QJ 5BPDA 3IKJA 4C6SA 4CMBA 4K9MA 4YIHA 4ZYYA 3NAMA 4BVGA 3DF7A 2WUGA 4RQAA 2BP7B 3ED5A 4OREX 2AXPA 5HSGA 1O9BA 4E5YA 2GN8A 2I4RA 4WZZA 3NRCA 4FHCA 4YRQA 2BBYA 4A2PA 1S1CA 4WV3A 5FRNA 1NL3A 2ZFWA 3VX3A 3VYVA 2O0MA 5BY2A 2EWWA 1M1XB 1WCYA 2CHUA 2KMUA 4RF3A 5CYVA 2EFYA 4W97A 5AQ1A 3S3MA 1LVAA 1LSUA 4HLYA 3RSGA 1F3LA 1VA5A 1GUFA 3DT9A 1ULAA 2HKIA 4PZAA 5IJXA 3AF1A 1WQ1R 2ZAYA 4J0JA 3WNQA 1Z73A 1G2QA 2IH4A 3CUWA 2GCPA 1FUIA 4TX1A 2GA1A 3BWXA 4RH1A 3ZVRA 1J99A 4XN3A 2CEAA 1J9IA 4LB5A 4ZC1A 1T95A 2Y9ZA 1JF8A 3J81A 2Y77A 5GP9A 2JHFA 4MARA 1MJAA 4WK0B 5F9MA 2OC6A 3D7SA 5FTWA 3VJKA 3IP5A 5CLSA 3QLEA 1KI8A 1I8TA 1SVLA 1KI6B 4CSWA 4FOOA 2TCTA 4A0RA 5KWJA 3QG5A 3MAAC 4H7EA 2YWDA 3IA7A 1QE5A 4MWOA 4BVEA 2DR0A 1ZJ4A 3JALB 1LEHA 1CB7A 4QHTA 3TSCA 3ZNPA 1HEYA 5I9IA 4JXXA 1ZVQA 2YYYA 4LXUA 1A97A 2FUCA 4RABA 3GEGA 3SSMA 2VBFA 3F73A 3LYHA 1O08A 2MTBA 5B1DA 1P3Y1 2B5VA 4WBSA 5AVTA 5IAAA 1SD7A 2E85A 1K6EA 2PX2A 5A9SB 4NV0A 1FYVA 4ZO9A 4RFVA 1K61A 2YHUA 3R0IA 1ZRSA 1JU3A 1XZGA 2RAPA 3SP1A 2KL4A 1IF1A 1OVGA 1X0XA 5B12A 1P18A 1NDQA 1RHKA 2ZETA 4YT8A 1Q1BA 1C7IA 1POXA 1BJKA 3K1PA 1JA0A 1H6BA 5B5EC 1B4DA 2HBRA 3HHHA 3GEBA 4K9SA