1P2FA

Crystal structure analysis of response regulator drrb, a thermotoga maritima ompr/phob homolog
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
MMWKIAVVDDDKNILKKVSEKLQQLGRVKTFLTGEDFLNDEEAFHVVVLDVMLPDYSGYEICRMIKETRPETWVILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFLEREKKGLYDFGDLKIDATGFTVFLKGKRIHLPKKEFEILLFLAENAGKVVTREKLLETFWEDPVSPRVVDTVIKRIRKAIEDDPNRPRYIKTIWGVGYMFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response Regulator
publication title Structural analysis of the domain interface in DrrB, a response regulator of the OmpR/PhoB subfamily
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 69
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p2fA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p2fA01
3K1MA 1TVMA 1E2XA 2ETHA 3O6BB 2VBZA 2IA0A 5CVIA 1KYWA 3I58A 5E8IA 2O20A 4HYEA 4AIKA 3M9AA 2LIVA 4KREA 1SMTA 5ICGA 4M71A 4YFXF 1IIBA 2MYPA 4AWXB 2E4VA 3OLYA 4ETSA 5L3EA 3N97A 2F5CA 1K78A 4UHKA 4NICA 4XXHA 5KI6A 1XSVA 3TKYA 1T38A 1ISSA 2M1BA 5CVUA 2C6YA 5T3YA 1NXWA 1TW2A 3RVLA 1R23A 1USTA 2BBYA 4LDAA 5TRDA 2OQGA 2PJUA 1XWWA 1Z6TA 1JYEA 1HW2A 3BPVA 1USGA 2OD5A 3LUGA 3JW4A 5T7BA 1K79A 3RKYA 5DEQA 5DCMB 2WMYA 2K4BA 3SFZA 4MTDA 3WG9A 3O1JC 4H60A 4N0PA 3LMKA 1NTRA 3Q15C 3WGIA 2IRFG 3F6VA 1W5TA 2O6GE 2E1NA 4RWEA 1REPC 5I4CA 4IRGA 1TM2A 4KFCA 4G7HF 5CNKA 5IEBA 2LSOA 5IULC 3HUTA 4MR8B 2L54A 5GOTA 2QV0A 5BR1A 3EYIA 3NHZA 1YW7A 1FY7A 2HZTA 5KC8A 1Z2DA 4FX4A 3H1EA 4KA4A 2PJPA 1CF7A 4PICA 3LWFA 1ZG3A 1FWZA 2Q2EA 3KETA 1W7PD 4HA8A 1BI0A 2OZ6A 1EH7A 4WXHA 3LFKA 2O03A 4NCBA 4HNQA 1UHMA 3L7WA 5TE9A 4G94A 1NXSA 2K86A 1U2QA 1HKSA 1ZGZA 5B3JC 2M8EA 1Z15A 2LUOA 3SY8A 4OIOF 3DPLC 1ZRDA 2VXZA 3RVSA 2EFQA 1ZAYA 3HSYA 4RK4A 1W4MA 4Y13A 5ICEA 2X0LA 4IRIA 2H0AA 5LLQA 3H3ZA 5FB2A 2E1CA 2CW0F 4G9YA 5HOOA 2M87A 3K4HA 3D02A 3ECOA 2NS0A 1EV7A 3QLTA 2FQXA 4EYOA 2E7XA 2OU2A 1YVUA 2IYNA 1D8KA 3ROFA 3GA5A 3MF4A 1XSXA 2VT3A 4Q47A 1NXOA 3LA3A 1YLFA 5J6XA 2H27A 3KKEA 2P5LC 4LE0A 3F21A 1YK1A 5HKOA 4NHJA 3LUDA 2VK2A 4MQFA 1ZHFA 1JDPA 1OYWA 1HEYA 2DU9A 2FSPA 1ZLJA 1LJUA 2Z3YA 4EVIA 3W9SA 4WWHA 5H6RA 4PGHA 3P9YA 3EQ2A 3H5TA 3TO7A 2M5WA 3HRSA 4Q48A 3HDGA 1ISRA 2E7WA 3C3KA 3IWZA 2WY2D 4EGZA 3F8BA 5HLHA 3DV8A 4OMYA 3F23A 3CLKA 2QLZA 2L19A 3SXYA 5FD6A 1JBEA 3F72A 4A0YA 2L4MA 3KS9A 2QYOA 5FBKA 3W6KB 3F8CA 3HVRA 5TQ0A 2WTEA 4WZZA 4OU0A 1KA8A 2R4QA 1QPZA 2MYUA 2DFIA 1QKKA 3ZPLA 5K5QA 3C3MA 1T6SA 2M1ZA 2AYZA 2KIFA 2KYRA 4BXUA 2ZMEB 4GGGA 2JB9A 4MAAA 4KT5C 2MSWA 3TX6A 1RZRA 3SNKA 4BNCA 3Q9VA 2W57A 5HDKA 2G9WA 4XSXF 4P9FA 1KU2A 1SD5A 3BJ6A 1D8JA 3QAHA 2EK5A 1TQIA 3OOPA 2WWVD 2OA4A 2ISZA 3ELKA 5DD4A 3GFMA 2JVJA 2OBPA 3UUGA 5LBQA 5J8CA 3TDZC 4OIRF 3HRTA 4AD9A 3H6HA 2TMYA 3QPTA 1I27A 1PUEE 3FGZA 4OATA 1MGTA 4QPJC 5HSGA 3RVNA 5E1ZB 4I98B 4D0PA 4RB1A 3HSRA 3KLOA 4GCVA 4IGAA 4Q6WA 2YU3A 3EDCA 1JFSA 4Z4IA 2K4JA 4ML3A 2IKSA 3KCCA 3WTXC 1C4WA 2WJWA 3F6OA 3WGGA 1H9GA 4ETMA 3EODA 5IX8A 4G6QA 1E6KA 2A5YB 1D1PA 2YR2A 1U5TB 4CHUA 2GAUA 4HV6A 2ISYA 3QOPA 2VBYA 1IXRC 3KTOA 1F51E 3MFKA 3CHYA 4MLDA 3PQJA 1I1SA 1FQWA 1KU7A 4M74A 4TLMB 1XB4A 1U78A 2WRZA 4EMSA 2VOPA 2NAZA 4OIQF 1DDNA 2XGXA 2OAZA 1U2PA 1JGSA 2Q8KA 1FBSA 1FC3A 1YK0A 2P5KA 1Z16A 4ENNA 1Z26A 4JBAA 2W85A 3M1EA 3M8EA 1G3SA 1KYZA 3GL9A 1U04A 2PUFA 1ZRFA 3PFIA 2JBAA 2FU4A 4Y15A 4MS3B 3JY6A 3WTUC 5DCFA 4EUKA 3NRVA 3C1DA 2HYGD 3UK0A 3CO7C 4CDGA 3HJFA 4M6YA 5JI6A 3RQIA 1BBYA 4B09A 3GFIA 1BOAA 1B4AA 2DT5A 1K68A 5JS1A 1TW3A 2RN7A 2FEWB 3F3XA 5L3BA 4WXEA 4LDZA 5KC9A 1ZH2A 4NQRA 5BQTA 3RVPA 3T95A 2ESNA 4F06A 1P2FA 1JFVA 1ZGAA 4MNUA 3RYPA 3F73A 3EJWA 2XDYA 3N0XA 3RI4A 4O1IA 1XGMA 1TMYA 1H0MA 4H3HB 2EA4A 4UVBA 2FXIA 4RY0A 3EUHA 2A9RA 2PUBA 3TMYA 5D5UB 1Z6RA 5DGCA 5EWJB 3QEMA 1SD4A 2E4WA 5JNTA 1JHZA 4EYKA 2L3DA 4WX9A 2VE9A 1K6OA 4ZZDA 2B1JA 1D5VA 3P9CA 1YTYA 1F4KA 3L49A 3P7NA 5FO5A 3NNDA 4MRMB 5H6QA 5K5OA 5D6EA 3IP9A 3I0TA 3EULA 4G0OA 3BROA 2MYTA 2XV4S 5CLSA 1YW8A 5L3FA 4HDVA 4MQEA 4IVNA 1B59A 1JHHA 2IW5A 2Z9OA 3DXJF 1W7PB 5LGTA 1TJYA 4YCSA 3MEXA 1T0FA 1Q1HA 3RPUA 4LE2A 2VOOA 3O2JA 3IP5A 5FGMA 3E3MA 2PLNA 4RXTA 4LLLA 5CJ9A 4QWQA 4M73A 4LJZF 1B6AA 3LA2A 4HF1A 2CHEA 2ZWMA 2BEOA 4YG2F 4XLPF 3Q9SA 2XVCA 3SG0A 4ON0A 5HS8A 1CHNA 4F7ZA 5L3DA 3K1NA 5DYMA 4Y17A 3KP5A 4EGYA 4G97A 4MR9A 2E4YA 1DCFA 3J7AO 2YHAA 4D6XA 3KJXA 4IHSA 4YIIA 4P5OA 3H5VA 3R4KA 4EY3A 4B8XA 2FF4A 3QX9A 4NCAA 4R8HA 3V4GA 3QK7A 3I4PA 5TJJA 1P4AA 4MQ9F 2RV8A 1QQBA 1USKA 3OM1A 1R5HA 1XDSA 4EJVA 1D2AA 1E2BA 4NQWA 3W6JB 4O1HA 4ZYEA 1S7OA 1ZREA 3VNBA 4EQQA 4EM1A 3O74A 1HSTA 4ESJA 1ZDMA 2HEOA 3MM4A 1G4DA 2UZKA 1L0OC 3IP7A 4RGRA 3N4MA 4TLLB 3E5UA 5D8KB 5FBHA 2F2EA 4Z0NA 2FN8A 1SXIA 2XAGA 1LJ9A 2IPNA 3V7CA 5FWXA 3E3VA 3HTSB 2HS5A 5TPWB 2XAQA 4EJOA 2FQ3A 3SHFA 1ON2A 3EQLF 3BDDA 4M9XA 3JVIA 4I0BA 2PQ8A 4ENKA 1YO5C 7ABPA 1BDIA 4N41A 2OQRA 1MB0A 3CS3A 1T39A 1IAWA 2NNNA 3FM3A 1Z25A 3NHMA 5TQJA 2MC3A 2VBXA 4E7PA 5HS9A 3LAPA 3JPYA 1P8AA 4RAZA 1MVOA 1TLFA 3RDIA 2P6SA 2Q0OA 1UCRA 2BYVE 2XAHA 1LQ1A 5LHGA 1SD6A 3URMA 2GX6A 1J5YA 3M6MD 3D0SA 3O1IC 5BRAA 2HQRA 1O3SA 4P55A 1MJAA 1EWVA 2COMA 2B0LA 4L5JA 4N0QA 1BI1A 4ENMA 4IMJB 1XGOA 2WWYA 4LZLA 2Z33A 3E6DA 1ZH4A 1UB9A 3WTVC 1KQ8A 2DK5A 3KP3A 2RKHA 4A0ZA 3GZ6A 5LEJA 3FF5A 2PUCA 2Q5CA 3IKTA 1STZA 1R7JA 1ZESA 1I5ZA 2GZWA 1MJ9A 2QBYB 4RZSA 1SFXA 5D4SA 4G0XA 4MEYF 1O3RA 4XFKA 4HX8A 1UHWA 2CWEA 3FMQA 3CUQC 2NT3A 3IDOA 3MZYA 1Z2EA 3IKVA 1LVAA 1G3WA 1B9MA 3O2PE 2IA2A 2P4WA 1DBPA 2NNYA 4PYRA 4PGGA 3KZZA 1E6LA 2XRNA 1QGPA 4JOQA 1RIOH 3GV0A 3ROTA 4KICA 3GVAA 3FDFA 4KNYA 2BGCA 2R7DA 4KZKA 3ZMSA 1LK0A 3G85A 3GWGA 4OBBA 4YFKF 1EAYA 4CYDA 2TDXA 5JHUA 1GUDA 3OQNA 5C5CA 4I09A 2EFPA 2GQQA 3IP6A 3H75A 4EVSA 3RJPA 3RYRA 4G0PA 1P6RA 3WE3A 2GA1A 3RVRA 3IWFA 3ZMDA 2PL9A 1Z1DA 5EWMA 2R3SA 1DBQA 3G3ZA 2FLWA 1ZN2A 2VT2A 4M88A 1ONVA 3D5LA 5JFRA 5IUJC 4L9VA 2XUBA 1DC7A 3WU0A 3CRNA 3GLXA 3DGEC 1XMKA 1XSDA 3N0WA 4EYGA 3HYIA 5IUKC 5DDGA 3A3KA 2FE3A 5LRRA 2M30A 2Z5UA 4EJUA 2X4HA 1C0EA 4L4UA 1JL3A 2QENA 5F64A 3GBVA 3LUCA 4A5NA 3OO0A 1G3TA 2CGPA 4CO8A 4WUTA 2VE8A 1TNSA 4RGXA 1IRGA 1JH9A 4MS1B 4NV3A 1BC8C 4CICA 1U3EM 4HLXA 3T5XA 4YIFA 4PZ0A 2VYCA 3QLVC 1QP0A 4D6YA 2W25A 4TV7A 2W24A 1J75A 1UFMA 2UXXA 1JE8A 2A6EF 3OMXA 1DRKA 1CEYA 3M9WA 4K2EA 4M9ZA 2HGCA 1USIA 2HYFA 4UVCA 2AS5F 6ABPA 4XBFA 2IVMA 3T38A 1JX6A 5TPZD 4CZZA 3OQMA 3NBMA 4HQMA 1B9NA 2PLYA 2JVKA 2RC4A 4S04A 4KQ9A 4XRFA 4KYWA 3QU6A 1U5TC 1D3YA 2FNAA 2VC1A 1H9TA 3O75A 5JNWA 1ZYRF 2J48A 1GCAA 5DLEA 3QELA 1YQAA 3HRUA 3OLWA 3CUQB 2H09A 4A5MA 1VPWA 4FHTA 4LE1A 3K9TA 3C6QA 3C7JA 2RJOA 1XGNA 2CD7A 3OLVA 1M5UA 2VUIB 2RDPA 2DW4A 3ZQ7A 3KP2A 3JSOA 3MWMA 4ZYDA 4RK6A 2HQNA 1BDHA 3FZVA 4YP9A 4S05A 4N0BA 1LDJA 2JRTA 3BREA 1BJAA 1ZARA 5CHYA 1XDUA 2DAOA 4MHGA 1YYVA 4L9NA 3KE2A 2XASA 4YV7A 4GPAA 4Z4HA 1ABFA 3J80K 3HXMA 2DPDA 4AVPA 3ILYA 4O6JA 2QQ9A 5JNUA 1ZGJA 2A9OA 1IF1A 1BAPA 3FFXA 4MGRA 1L5ZA 2PAFA 2HKXA 4LGWA 4MTEA 1KQ9A 3T8YA 2HSGA 3HK2A 3LUAA 2XKOA 2STWA 2PG4A 1EWTA 2LF7A 2HQOA 1P6QA 1IXCA 4HOBA 3ECHA 3EAFA 5EWLB 1IRFA 4Q4ZF 3O2QB 4RY8A 4KV7A 3FHZA 1FX7A 3COAC 4JASB 2DQRA 4LG0A 3C3WA 4AIJA 3ZMTA 2H6BA 4W5RA 1FP1D 1Z7UA 1FFGA 5DTEA 4MR9B 4CGZA 2KJBA 1TLHB 1PP7U 3TOAA 2GKGA 4OG2A 1RZRD 3P9KA 1YFHA 3I59A 1RNLA 1TBXA 3IL2A 3FX3A 4XASA 1LEAA 4EVRA 5J8FA 3QX8A 2HTJA 1PDNC 2ZNZA 3OLXA 2ZFWA 4QYMA 2XHKA 4L0YB 3I42A 1PP8F 3IPAA 2Z99A 4JA2A 1V4RA 2MH9A 2GBPA 2YX4A 3GF2A 3JTGA 1GCGA 5L3GA 1EWKA 3KYJB 1FYMA 2K7LA 4MGEA 4MS4B 3MZHA 1E6MA 2BV6A 2P4UA 1YG2A 3U1DA 2MLKA 4ZYGA 2RVCA 3NQOA 4RDCA 2R25B 3CDHA 5D4RA 1GXQA 5BQ3A 5AIPA 3TB6A 4KIFA 4EJTA 4HV5A 1S8NA 4O5AA 2L02A 5EEHA 3HOSA 4ZH4F 4KMRA 2V6CA 4Q6BA 3JTEA 2FMLA 1HXDA 4KRFA 3FMRA 3F8MA 4OLBA 1Z91A 5F6FA 4RB3C 3GFLA 2ZNYA 2STTA 3FFTA 1KU3A 4MR7B 1YIOA 3F8NA 5FWYB 3U2RA 4L9JA 1GVJA 3GYBA 1SMYF 2ZCWA 2VONA 2A3SA 2J5PA 3RVMA 1QZYA 1Z05A 5E8GA 3I09A 2KIMA 1GUBA 4W5TA 3BOQA 1YW9A 3ABTA 2FTKE 2JT1A 4PCQA 5CVRA 4RSMA 2QWWA 4ZPJA 1E17A 2PMCA 3H6GA 4LLNA 1F1ZA 2L01A 1DC8A 3BILA 3A0RB 3FXRA 1KQ0A 5IT3A 2P6TA 1ZVVA 3K9CA 4W5NA 1WRJA 4RGSA 4P96A 3SQNA 2FMHA 2EJRA 2FBKA 3TOBA 5DCMA 4ESFA 2JTVA 3P9IA 3VODA 3CZCA 4L0ZB 5E3JA 3IPCA 4BQAA 1FFSA 2XROA 4Z9BA 5IC5A 1JYFA 3QLUC 2XAFA 4OLAA 5D5VB 2PKXA 1AB6A 2DK8A 3RVOA 2VBWA 3QPHA 1MDMB 2XIGA 4KIBA 1VTNC 4JQFA 2ZBKA 3CNBA 2DTRA 3E6CC 1BN5A 3CTAA 1BA2A 3HM9A 1R5GA 2FRHA 4MQVA 1MKMA 4IF4A 5CNMA 2QZ8A 5K5RA 2E4ZA 3MQ4A 3CO6C 4MR8A 1BI3A 4O5VA 3T8TA 1HKQA 3ISPA 5HS7A 2QSJA 2GWRA 4MLCA 3HOTA 4DN6A 3LA7A 3DGFC 5FFXA 3HS3A 4G7OF 2JRLA 4Z4EA 2EFWA 1DP4A 1PNRA 3M8FA 4Q5SF 1ZHHA 1NATA 6CHYA 4LB5A 4ASNA 2IDMA 2MSKA 4EVQA 3E5QA 1K78B 4D74A 4N03A 4IMIB 3IHUA 4RK7A 1PUXA 2WC2A 2A68F 3E5XA 2ZKZA 3J80Z 1HBXG 3IC7A 2IPAB 2IPQX 4KVFA 1UDRA 2F5FA 3OQOA 1CYEA 2PMUA 3KHTA 4EYQA 3DKWA 5TQ2A 4F11A 2RDMA 3KEQA 4ZMRA 3HZHA 3V8KA 3F22A 4WK8F 1B00A 3RH0A 2JCGA 3R0JA 1USSA 4L5IA 2MYNA 4JK1X 1QQAA 2MD5A 5BOXA 4FT8A 1GHCA 3U9GA 3LUKA 1G3YA 2L17A 4KUMA 5FFZA 4RGUA 4BH9A 2PUGA 3E61A 2O0YA 4FE4A 2HR3A 3DEUA 3KP6A 2FW0A 1URPA 2CFXA 1CF7B 3O21A 1C0WA 3V8JA 2AXLA 1JFTA 2BGGA 2GXBA 4A2UA 2KIUA 3BBLA 3OMWA 3CFYA 4RV5A 3J81K 3ZMUA 3DZDA 4HQEA 3HCWA 1R36A 2KJCA 1TQPA 2L4AA 1CGPA 4GYGA 2RGYA 2P7VB 1OYYA 1SD7A 3JPWA 3MQ0A 2DRIA 1XMAA 4WXMA 1Z9CA 2O3FA 2FEZA 1FSPA 2HWVA 2PFBA 4G0ZA 1R58A 3ULQB 2A61A 5JR3A 5D6FA 2JSCA 2GIVA 5AIQA 2ZMEA 4TN5A 1YTUA 3CTPA 3MCZA 5FLXK 4M9SA 3M7GA 4M72A 5D5WB 1XD7A 1IUYA 4RKRA 4YO7A 1OMIA 1XHEA 3E6MA 3F7NA 3FWEA 4U88A 2W42A 3WTTC 3CZ5A 2YHBA 5ERIA 2QQAA 3V8LA 4MQFB 2FXAA 1WKMA 3GW2A 3H5WA 3GZ5A 4L9TA 1S3JA 1V3FA 4G6DA 5BS6A 4IHTA 4H0EA 3RIRA 3CU5A 1W9HA 4UV8A 1WSUA 2QR3A 3QEKA 3GRCA 1FT9A 2WJAA 5B3JA 4ZYLA 3L00A 3CJNA 3QLVA 4FE7A 1I6XA 5BMZA 4HLYA 5CVJA 4ZJPA 4KPYA 5HDGA 4EV0A 1KGSA 3BJAA 4N47A 3WTSC 2QM3A 1OKRA 2H3HA 1R22A 1QO0A 2JPCA 1QPMA 2EV5A 4XAQA 5TQ0B 2WV0A 2FBHA 4RS8A 2IJLA 5E17F 2K02A 3CUOA 5C5EA 1QZZA 4PE5B 2JPBA 3DFGA 4WF2A 1U5TA 4YS6A 2IA1A 1PEYA 5KQGA 5CNIA 5CNJA 1NXPA 1DBWA 2FMYA 1T34A 2FNPA 3HUGA 4H3KB 2ELHA 4RXMA 3EETA 4R79A 4Z9AA 2Y75A 4XARA 5DUIA 2MH2A 4HF0A 1F5TA 1J59A 5H20A 3I59B 3EQZA 3ILHA 1K66A 5CYVA 1LEBA 3R0AA 1RXIA 3LSTA 3BZ6A 4ETIA 5IT9K 1EHCA 3G73A 3GO5A 4DQDA 4YWHA 3KCNA 2CHFA 2DQLA 3CG0A 2IPLA 5DV5A 2EFNA 2CG4A 3WTZA 1JWLA 4G0MA 2QW1A 2ZXJA 4UUVA 1BDJA 2LPMA 4XSZF 3MIZA 3TD9A 1KRWA 2PN6A 3ZMVA 4L85A 4HBLA 1ZITA 4LRQA 2D2WA 4UHTA 2W84A 4BHPA 3FXUA 1Z17A 3TO6A 3QRFF 5IEJA 4MYRA 2P5VA 5DCLA 3LAJA 2NYXA 2CWDA 3N8IA 1O7FA 1BVHA 3KZYA 4OINF 1U2WA 4MS3A 2FSWA 5JVTA 4N9IA 3ZMZA 3HDVA 1TQMA 4RB0A 3H1FA 4RK5A 1RZ4A 3BWGA 5D8LB 1KMIY 3SZTA 1FFWA 1GLGA 1LDKB 2HPHA 3LFTA 4KQCA 4KIGA 4F12A 3GFJA 5BRJA 4Q7EA 2CSOA 3BRQA 4WXDA 1SAXA 3WE2A 2QXYA 3J81Z 3RKXA 3LTEA 3N6VA 2H6CA 1LBIA 4PZJA 4KK3A 4RAYA 2WB4A 4IPAA 1FLIA 2LNBA 1MIHA 3UKJA 4YRZA 2EV6A 1D4ZA 1DP7P 3BPXA 2ACJA 1EFAA 3KEOA 8ABPA 2DI3A 3L09A 1QQIA 2JVIA 4U7BA 3H92A 5EWJA 4BAYA 2FMFA 5E20A 2RGVA 3T6KA 5HM6A 4HX4A 2O8XA 1K7AA 3GEZA 4IRXA 1LBHA 9ABPA 2MSLA 3DPTA 3WU1B 1BM9A 4RU1A 3QU3A 1A2OA 4RS3A 5DKFA 4MRMA 2F8TA 4AIHA 5FLXZ 3TQNA 2JBAB 3DF8A 2IT0A 3S2WA 3Q5FA 4JB0A 2ZO4A 1S29A 2E4UA 3LUHA 3A0UA 4WT7A 3PQKA 1I3CA 1F4VA 4XLTA 1FPQA 1FYKA 3HUUA 1MD0A 1W7PA 3I5AA 4JAVC 5DUKA 1H9CA 1NXVA 1L3LA 2ESHA 1VLZA 2A6HF 1DPUA 5E18F 4UNOA 4W5QA 4G8XA 1MZBA 1M2EA 2QVOA 2CO5A 4UV9A 3KP7A 4TMYA 3LKBA 3QP5A 1IN8A 1Y1LA 3JVDA 2A9QA 3WTWC 3GT7A 2K27A 5E1WA 5KQLA 1T2KA 1YMUA 4IILA 4QYWA 2KRFA 4P9UA 3VOEA 3QEMB 1M2FA 1R00A 2IP2A 1J9IA 1RXEA 5KQPA 5TPZA 2LKPA 5TQ2B 1O57A 3QLUA 1HQCA 4EGSA 4HF2A 2FMIA 1JLKA 1M5TA 1DJMA 3KLNA 2RQPA 1AB5A 3JAMK 4Y9TA 2G7UA 4M6XA 1HW1A 1WI9A 1ZRCA 1QMPA 4EM0B 2LP4Y 5ICCA 3E6BA 3TO9A 1LDDA 3TDUC 1Y0UA 1FBUA 2EWNA 2A07F 4MQEB 3I54A 1XGSA 1WETA 2RNJA 2FQWA 4HW0A 5IT9Z 2DLLA 1A0OA 2PBIA 5HLIA 4XLNF 2OENG 3F6CA 3A10A 2X7XA 3WTYC 3CKMA 4ENJA 1DG9A 3DLBA 5KVRA 3CLOA 2B4AA 1DZ3A 1XCVA 5TPWA 4EJWA 1RUOA 4U0WA 5IUNC 5KWSA 1P4WA 1JXSA 1ZAOA 1X3UA 4Z2YA 1IN4A 2UWMA 4QLCU 4IRHA 1IW7F 1P92A 2GA2A 1KRXA 4YGXB 3BRSA 1HSJA 3RVQA 4LMYA 4WCGA 1W25A 2ZJ2A 2FA5A 1HKTA 3HIFA 3B73A 4FB4A 3RPQA 2M45A 3HHGA 2V1XA 1VKRA 2LF8A 3BJOA 1FP2A 5LHIA 5LHHA 1U0SY 4RY9A 1TTYA 5JS2A 2HTSA 5D5XB 4F3TA 4F8JA 1FOKA 2LBPA 4UHJA 1EH8A 2V1DA 4IJAA 1O7LA 3K2ZA 4PDKA 4UVAA 4N9HA 1DUXC 2QVGA 3HTUA 3MAJA 1ABEA 2V1UA 1SFEA 2F5EA 1QNLA 4MPTA 3K0LA 4A0XA 2NRAC 4OTZA 2QBYA 3FMSA 3I5UA 1YS6A 2YX7A 5A2QK 3E97A 5LGNA 5FWXB 4QICA 4A6DA 4RKQA 2MLGA 4WXCA 4GYIA 2FOKA 3EYYA 2EB7A 2F8SA 1PEAA 4E70A 3VFZA 3OM0A 3L2CA 3M9XA 4EM2A 1R1UA 4N76A 3R61A 4ZYHA 5JNSA 1I1GA 2E4XA 2R7FA 1ZH5A 5GQSA 3KYIB 3RVJA 3KG2A 2PMHA 1WWXA 1QBJA 5FD5A 3FMVA 4RK1A 2PUAA 4KMFA 4G0QA 4LD5A 2HFHA 5KK1A 2YPRA 1LB2A 2NT4A 5LEKA 3QP6A 5ICFA 2J5OA 4NB5A 4BHCA 2HJ9A 1OXKB 4YR7A 4I01A 1GXPA 1L5YA 2PL1A 1TNTA 3D8UA 2R47A 4U0VA 3WODF 2XKPA 1AWCA 4RXUA 4P98A 4KN7X 3K69A 1FSEA 1R1TA 1JDNA 1LNWA 3LUFA 3HHHA 4P1ZA 3O3KA 1PNTA 3BY6A 3VB2A 2D1HA 1ZY2A 1FNNA 4GO1A 2PEXA 5ED4A 3G1WA 3I71A 2P9HA 1ZLKA 2XAJA 2NZUG 3Q7SA 2DPUA 3JSPA 4YLEA 2GI4A 3NEUA 4ETNA 4BYYA 1APBA 5HQJA 2V79A 4KDPA 1U8RA 4Z4CA 1J56A 1RPJA 1U8TA 4LLGF 3JAMZ 1T98A 1XN7A 3H1GA 1U6GA 3HO1A 3TGNA 4MS1A 1IN5A 3O1HB 3HRMA 5L3CA 3HV2A 2D45A 1NHAA 5CVVA 2G7HA 3ZN1A 2VC0A 4DQ2A 5F1RA 2NUBA 1QP7A 3REOA 1KU9A 3TO5A 4MEXF 3AAFA 1BC7C 2PE5A 1ODDA 3K1PA 5BPIA 1J0RA 3JTHA 3H5OA 2QU7A 2V9VA 1YMVA 3C18A 3MA0A 1EH6A 4ZMSA 1JF8A 5JNVA 2HKOA 3ERED 5IBQA 3LQRA 3JS5A 3T0YA 2MBFA 3LQQA 4RK0A 2VN2A 1G6NA 4CBVA 5JNRA 3H5LA 5EWMB 4L18B 2DO7A 6PAXA 4CXFA 2H94A 1J2XA 4ZZLA 2GXGA 3C97A 3F8FA 4HX7A 2L18A 1HW5A 4I7HA 2IOYA 2P7CB 1OYIA 2PI0A 3ZP5A 2MA3A 4BHBA 3CUQA 3OLZA 2YSRA 3GYHX 2M98A 4G0YA 2JK1A 3H5IA 3MYYA 5KQMA 1AOYA 1BI2A 2L2QA 3LUJA 3KP4A 2JZYA 3N53A 2F5DA 5ILVA 4U0YA 2I6FA 3ML6A 3T1BA 2ID9A 5HVQC 1OXBB 2ADUA 3Q41A 3IRRA 4PEVA 4Z4GA 3GWZA 1ULYA 2O61A 4OIPF 1P6UA 2KKOA 4Z4FA 4JB2A 1RI7A 4LFUA 2VODA 3ZN0A 3SAJA 5BPDA 3LOPA 1WQ2A 4IXAA 1BIAA 3NNSA 5HDNA 2FKAA 3H3UA 1SRRA 4A12A 2A69F 3DP7A 2V0NA 5K1YA 1ZG5A 2LDUA 5A2QZ 1J7KA 4HNSA 1DPRA 3HSFA 2IPMA 2ID7A 5LGUA 1B1BA 5EEGA 1Z13A 3SM9A 5EWLA 1XCBA 5ABPA 2DBBA 2FEPA 3B2NA 1IXSB 2FLKA 4YFNF 3VEPA 1MJBA 3NNNA 1QP4A 2QQBA 4OOIA 1RUNA 2AYXA 4I0AA 3IRQA 3QELB 1MB3A 1S7AA 3I45A 3RVKA 1YS7A 2CQKA 2QVCA 1PHRA 3FXQA 5PNTA 1O3TA 3RTRA 1JHFA 1O3QA 3GUDA 2EV0A 4GXOA 4I2OA 1IN7A 2FBIA 3HSEA 1ON1A 5AONA 4G86A 5D2CA 4ESBA 2Y48A 3RKWA 1SXGA 4KK4A 2N9UA 1IN6A 4LK1F 2P8TA 1W5SA 4OMZA 2FEKA 2RJNA 2Y0MA 2ZAYA 3GX4X 1NXXA 1DRJA 2BE5F 5HLGA 3F6PA 3KFWX 1ZGGA 4HAMA 2FQYA 4UXNA 4MS4A 1VRVA 4I02A 4LX8A 3LKVA 5ILUA 5LRSA 1F9NA 1BIBA 1A04A 1LJLA 3ABUA 3SZPA 3HEBA 3BP8A 4KMUX 1MAVA 3R6SA 3T8RA 2OZUA 1Z12A 3B02A 4Z99A 1QO0D 4LB6B 1SFUA 2HQBA 3L6UA 5ILSA 4HZFA 2HDCA 3EGCA 3OV8A 2FMKA 5E1XA 3N0RA 1D5WA 4LG0B 1FZPB 1DCMA 2PUEA 4DNCA 2D1VA 4MR7A 2EA2A 5FWYA 4R1HA 4HNRA 1XHFA 3GXOA 1NY5A 1FSHA 3FFWA 2FVYA 2VUHB 1ZG1A 3FM5A 2NZVG 3DQVC 1D1QA 3VNAA 4WWCA 3ROUA 1OPCA 3O2SB 4G7ZF 3GBPA 1FBQA 1P4XA 4FX0A 1R8JA 3MMNA 3I64A 4E7OA 2UXNA 1NXTA 1DCKA 4O3MA 4U7DA 1Z18A 4LK0F 4JP1A 2CYYA 4GNRA 3S99A 3Q7RA 3Q7TA 1R1VA 2EFOA 4DADA 4HDUA 1SXHA 3EDPA 1OR7A 3I53A 4W5OA 3OO1A 1MDMA 1S6LA 1QNTA 2QZJA 3CG4A 2PUDA 1IZ1A 2A9PA 2R48A 2FN9A 3V7SA 2HOEA 3L9FA 3N75A 3V7RA 1FYLA 2QUFA 3DBIA 5DD8A 4RB2C 3WGHA 4KN4X 4A6EA 3R60A 3KSMA 3DLHA
chains in the Genus database with same CATH superfamily
1UKYA 2FRDA 2VBZA 4G6ZA 1QK3A 4BEHA 3UYKA 3OHSX 3QYFA 3PQ3A 3E2IA 2KP6A 4LI0A 3MTBA 4UTPA 3TQHA 5T3YA 1EVKA 1GZVA 1UBNA 1USTA 4LDAA 3V2GA 3WWEA 1E3TA 4C0HA 3ZY6A 5DCMB 2EKLA 4F84A 1Y8QB 2WMDA 4D57A 1O0SA 1QU2A 4KOEC 3AXSA 5A5FA 2H1CA 5HOEA 3F6VA 2WP0A 2HJSA 3TSOA 1UMCA 5GOTA 1KI1A 4Z1MD 4LIUA 5REQB 4RMNA 5L95A 4KA4A 1MT3A 4KN5A 3RC9A 3T15A 1LUAA 4G8DA 4Z0TA 1HLFA 3ASNH 3UT5B 4MW0A 4PQEA 3E53A 4FCYA 3PRYA 3BGDA 2R62A 3ZU3A 5B3JC 1ZIOA 4QUJA 2C2GA 1FX0B 3RVSA 1MHPA 2WI8A 4RF3A 3NARA 2CL6X 5HOOA 1YHNA 2O07A 5E9WA 4B3TB 4PC2A 2PD4A 1E1YA 1MX5A 4Y7CA 3USCS 2HQSA 5FOWA 3SJAA 4AXXA 4PO8A 4Q47A 2LVSA 3L43A 3OUUA 3RABA 2FZCA 2AFIE 1H2HA 3WAGA 2H27A 3KKEA 4WNAA 1U8EA 3FRIA 3HKDB 4OAQA 3PT5A 5EZQA 1UK7A 2WADA 3MTGA 3UT6A 1JVBA 2Z3YA 2YZ2A 3R6DA 1GZDA 3LBYA 3TO7A 2XQFA 4NMWA 3HA2A 3HOXJ 1R6RA 1USWA 3N39C 5CJJA 3RJ5A 4ZIRB 3SBEA 4GPIB 4EGZA 4OMYA 4C01A 4F2WA 2G80A 3L7DA 1I4WA 2KISA 1DAPA 1QRAA 4US0R 1Q1BA 1XRRA 5HCIA 1ZC4A 5K5QA 2IZ7A 4LQLA 3AINA 5KYNA 4RVNA 1EVLA 2P78A 4BRUA 1EXNA 5H02A 2PBFA 1ODCA 3ADCA 3BJ6A 3DU5A 1Z0DA 4F4CA 3LP5A 1DQRA 2D5CA 4I1OA 1F8UA 3U9LA 1A1SA 3I73A 4GGMX 4DAEA 1U31A 4OATA 3BB3A 2E71A 4OQZA 3BT9A 5E1ZB 4RB1A 2FX2A 3HSRA 3TJZA 3KLOA 1UJNA 2BFDA 5AH0A 2P2ZA 4ML3A 5EJ8A 4RDUA 4LRYA 1U3WA 3N76A 4WACA 2D2VA 1OLUA 1D0IA 2V3VA 1D1PA 2MINA 5JCJD 4NMLA 1RW4A 2UZIR 3DCIA 1V3TA 4N54A 1ZEMA 4NZOA 1A7UA 1YZLA 9LDTA 3BCBA 1NKTA 2OZKA 4YPOA 4GS5A 2YHIA 5C1IA 4R5HA 1KFEB 3W2HA 2ZJYA 2XYGA 1WDWB 1Z22A 2OGTA 2VYVA 3MS2A 4OIQF 4IDEA 4OKNA 1A31A 4FYHA 5AKKA 1D6MA 1ZX1A 2VPQA 1QLWA 2XVAA 2XWJI 5DRYA 2ZSHA 1EDBA 3OY7A 1G3SA 4CT4B 2UU9B 2PUFA 2EF1A 4FHZA 2I9PA 2JD2A 3JY6A 1MBJA 2GS9A 2BEWB 3INGA 4M6YA 5JPDA 5LOVB 3ZIAD 5I7AA 3ZNNA 2DJ5A 2GTHA 3DMYA 1BVYF 5KC9A 1Z3XA 4CHGA 4F06A 2XDQA 3S81A 2ZIVB 5A9SB 2YFYA 1J8DA 1E2EA 1Z8HA 5DULA 1WUTA 3IH2A 3ETJA 1D7AA 4HH1A 1BXRA 2F7SA 2L3DA 4F2GA 1K6OA 1LFPA 5KX5B 1GO2A 3OOSA 4F9GA 2VNKA 2OXFA 2P30A 2JGMA 2HIAA 4BMCA 3FTFA 4RD3A 4JBLA 3BROA 5B1SA 1X38A 1HG1A 1Y34E 4X1EA 1W7PB 1SC9A 4YCSA 4JT2A 1TMKA 1PGPA 1USUA 4FONA 4MJXA 5HPYB 3CSDA 2BGUA 1GFWA 4NLLA 4QGGA 4J7UA 3IAAA 1OHHD 4B5LA 4Z4QA 3ECSA 3Q9SA 2O0LA 5B1IA 4DANA 2IA5A 3AQIA 4NZMA 3A4MA 5AJVB 2E4YA 3CVOA 2VSOA 2GK4A 2CNNA 3GLGE 1DIRA 4XX0A 4EY5A 2PXXA 2D7CA 3HXKA 2I2WA 2OCYC 4WDRA 3FPAA 3RWBA 1R15A 3V4GA 3W7AA 2NLOA 3GGGA 4OK5A 4CW7A 4DSOA 3EZ7A 1NX6A 4RA6B 4Z1OA 1T1SA 3S28A 1AUOA 2A33A 1E2PA 2XADA 2Y71A 4ND6A 4YJ2B 5IAJA 3TLCA 3A25A 3QVGA 2ZOSA 3I9LA 1P2DA 2HS5A 5A0VA 4L4RA 4CFSA 3JVIA 4RULA 3VX4A 1PKEA 4O4LF 2AJTA 4DIKA 3U7EB 2BOLA 2ZT5A 3CX8A 4BJ6C 2NSJA 2D74A 4RH1A 2HADA 1GPUA 2MC3A 1LTHR 1GGHA 1RVV1 2AZMA 1J5YA 2W48A 2AXTC 2OWEA 3UMCA 2C42A 3U3OA 1Z34A 1LNSA 4L5JA 2K9QA 1DGQA 1IZZA 3E6DA 1KQ8A 3TNDA 5JXGA 1HQDA 1ECCA 2RGUA 5HR5A 1VFCA 3V2UA 4HX8A 2NT3A 3OI7A 1E7WA 4LOKA 2FEOA 1M2KA 3FOAA 3JCUC 2P4WA 1XTTA 1VBKA 1OGIA 2W2VA 3V42A 1VA4A 1X1TA 1DO0A 2R8ZA 1Q1QA 1V5FA 3GEIA 2BGCA 1V1RA 4ZVKA 4YFKF 3ZHTA 3JRXA 1V54H 2VDNB 1GL9B 4E4YA 4MKFA 3S1AB 3IHWA 3SR4A 4OUDB 1P17A 4IXTA 3D31A 1L5VA 2BW0A 4I50A 3W5UA 4DMHA 4O63O 5AHWA 3FZNA 2NXJA 4FC7A 2PO7A 5LRRA 2Z5UA 4TMFA 1JL3A 3ZDAA 1UR5A 4H3VA 1SQFA 3AJDA 1XTJA 3OO0A 4NYIR 3NCHA 4HS4A 1IV8A 1Z7GA 4EP1A 2UYHA 3BTOA 2IHTA 1T13A 1DKOA 1W9MA 4UNPA 1QP0A 2WZDA 1NZFA 1O0BA 1XVLA 4EO7A 3K2QA 1PGNA 5DBEX 3G2OA 4I5DA 5KMGB 4KHZA 3I04M 1SXJB 3I56I 1QK4A 3RYCA 1YNSA 4HQMA 2JVKA 3Q7PA 4KYWA 1I3NA 1TDJA 3ZHSA 2W2QA 4UD2A 4N7BA 4YQYA 1GT6A 5FUBA 1BX3A 4LE1A 5A3QA 1PLKA 1KH1A 3KUCA 3MJ4A 1BTOA 4DNQA 4DM7A 1I3KA 3W1EA 2HQNA 4RMJA 2WFAA 2JRTA 4ER3A 5ALPA 4MI9A 4YV7A 3GBSA 4XQGA 2LW7A 2FPOA 2WT9A 4YDSA 3ILYA 2Q3LA 3GZTB 2DA4A 4UVHA 3RREA 3RLIA 1SBNE 3NWOA 4PINA 4LXYA 3OPQA 3VJKA 5JSFA 2FXVA 1GZHB 2CDNA 4HB4A 4IDPA 2DMNA 2VA8A 3BJIC 3P9QA 1RQPA 5I6DA 2H6BA 2LBFA 1FP1D 4OXXA 2X7JA 4GUAA 2GKGA 4WFJA 1YL6A 2ZCUA 2WKRA 2GVNA 3IUMA 2AHRA 4MW6A 2Q6OA 4NXNB 5F73A 4COKA 3V7WA 2HLNA 2BSXA 4L0YB 1OI3A 5SV2A 4OQMA 2Z99A 1YBHA 5CX1A 2ZQZA 1UBCA 1I7NA 2DA7A 4QPZA 5HHTA 2VTEA 4MS4B 1E6MA 3T1YB 1GITA 4M6WB 5BQ3A 4KN6A 2AX4A 5H7XA 1SBCA 3IOYA 3NWJA 1BU8A 3NHSA 2X1LA 3GTLJ 2I7DA 4O8ZA 3HR8A 2JS7A 1MMDA 3FPHA 3FYDA 4UU1A 1Z91A 3Q7QA 3ZXUB 1SAYA 3IAM2 2G6TA 4TXNA 3GFLA 2I34A 5E95A 1OBFO 2WA2A 4K46A 1PWEA 5EE1A 3TEFA 5DTQA 3T9EA 1W5AA 4NQZA 1SHZA 4ZYAA 3Q9NA 2WYIA 3KJQA 4ZU3A 2PZLA 4RGSA 3H2BA 2BISA 2FX0A 1I7PA 4BQAA 4Z9BA 5H8WA 3WMEA 5HYVA 4G5HA 4RDXA 3WGQA 2XF5A 4MQVA 1WU7A 2D0IA 1IULA 1LKZA 3WLKX 1JHPA 5KAPA 2QSJA 5CU7A 2XMZA 3CF4A 5DM0A 4ND1A 3HDHA 5FFXA 2YXBA 2EFWA 4AS2A 1A36A 1J24A 1K78B 3HJAA 3O6VA 4N03A 2PWPA 2ZYWX 2VYNA 3IHUA 5JH7A 1Q7BA 1HRDA 3THYA 2IPAB 4CCMA 3F8WA 2IPQX 1UL1X 3DKWA 2ZROA 1VLLA 1OZHA 1WTAA 1AUVA 4TLEA 2VZEA 3C74A 1BW6A 4INPA 2HOAA 1CT9A 2XB8A 4NJEB 3R4VA 5K3SA 3MMZA 4M0DA 1G3YA 1CX9B 3FXOA 1VXOA 2WHRA 4RTRA 1UK8A 4X7MA 1R9MA 5KCMA 1E32A 3KP6A 3MKYB 2BGGA 1YULA 4A73A 5K8CA 3J81K 4A5OA 3I61A 1L4EA 3W34A 1ISMA 1MU0A 1AC5A 5FAKA 4Q1BA 3UJDA 1OYVA 3TLXA 5JWHA 1CNFA 3DZIA 3EC1A 4LZPA 3MQ0A 2DRIA 4EYSA 3LC2O 1LZLA 1MVLA 3GJTA 5AKYA 4MVXA 1OJ7A 3SF8B 3E6AA 2B9SA 1YTUA 1U0FA 1A5AB 3A4NA 1IUYA 4BLUA 1RQGA 2RK4A 2I62A 2RGXA 1H8EA 1UMKA 1X4OA 4MVJD 1WOYA 3H5WA 3M0EA 1DT5A 1Q11A 4G6DA 4L16A 1QHSA 2P9EA 2BGIA 2HYDA 1MA3A 1JTXA 1K0FA 2WJAA 4PV7A 3R75A 4ND8A 3H35A 2IYRA 3U7QB 5B58C 1RI3A 2JFGA 1M6YA 2CBGA 5JDCC 1XL1A 3WU2C 2AH5A 4EV0A 1JAYA 1YDWA 2CKMA 4DEVA 3CNEA 4KDEA 4URWR 3RJZA 2AUMA 1Z8NA 3ED1A 5ER9A 3QVVA 2IIPA 5TQ0B 2WV0A 4RS8A 5AWFC 2EZLA 1ADFA 3ZWOA 2CKDA 1TCUA 2Q3CA 2A6TA 5DSXA 4NZ9A 4Z9AA 2EH3A 1WHSB 5FHRA 1XUOA 5JC8A 1Z5OA 3CXUA 4EFMA 4E11A 5DGXA 3MWEA 1YD7A 5DNYB 5CYVA 1SCUA 2HNAA 5IRCD 3CUTA 1G7CA 3G73A 3OSGA 4AIIA 3KU1A 4ZYWA 3AHJA 2E2HJ 3KQUA 3B6ZA 2XZLA 4IFBA 3SDZA 2KM1A 4X95A 1ZWKA 3FHJA 1VP9A 4DQXA 1E66A 4FZVA 1E4OA 1Z17A 2M2EA 4DSAA 1W2GA 4H7DA 4HB0A 3BWGA 1PEKE 5COBA 4B3JA 1UFKA 3DV9A 3KT0A 3Q3GE 1TJPB 4Q7EA 1JQBA 3S8EA 3OJCA 2AFIB 4O2RA 2FN4A 1FLIA 2B8JA 3JQ9A 3F9RA 4DA4A 1RLIA 1X3WB 4LHWA 4H7IA 1ZTRA 1XWIA 3FTPA 4CCLA 3AI1A 5JISA 3ITDA 4C08A 1LBHA 2MSLA 3RRMA 1T4CB 2QTVB 3QU3A 3OX4A 1NXQA 4AIHA 1F2VA 3H1AA 3C87A 4Z0PA 2PX3A 1CVIA 4AF7A 2OJED 3GUHA 1D1BA 4HDSB 2GBYA 1EE1A 2GEVA 5ENZA 1ZK4A 5CH8A 4V0LA 1EGHA 2GB4A 5I4KA 3VOTA 3ESQA 3TBIA 3UFBA 1DMRA 2IH2A 1E2KA 1I2DA 4CQMD 4BEWA 5FI1B 1H4SA 4CU2A 2VXDA 1WHUA 2IYEA 2VNJA 3L1UA 1XMVA 4X6UA 1U0BB 5TPZA 1O57A 1NFFA 2DWQA 3PFYA 2BF4A 2C54A 2FMIA 3NO4A 5AJYA 4DDUA 4F5DA 3ZX4A 3IAUA 4Q1AA 3PGKA 3FXKA 3H83A 2DCEA 2Z2XA 3E6BA 4XKBA 3K9NA 1UBMS 1FBUA 1EQ2A 1FUUA 4F5ZA 2Z5VA 5I9TA 2I6UA 3C8MA 2XT6A 3LCRA 4WECA 2IBTA 4N40A 1I5EA 3PQ5A 3LRTA 2X7XA 1X7DA 1PQWA 5KHDA 4LWZA 4BJ5A 4F3RA 5EHQA 1P4WA 3CUVA 2JI9A 2HCJB 3G2IA 1N6NA 2E2WA 2SKEA 3CBQA 1HSJA 2DMPA 2DPGA 4U2BA 3WWPA 1TRHA 3ITNA 3G9UA 5JFGA 1SY7A 4P33A 1Y48E 4XYBA 5E7JA 4M87A 4V0MA 2OO7A 2HA3A 4NS4A 1UOQA 4LXUA 1ZQ3P 3U09A 1AH2A 5IP9J 2BFAA 1HO3A 3WWZA 4FJ2A 3K2ZA 4F3QA 1TFRA 3FVRA 2VQFB 2F5EA 3A0BC 4RQTA 4B46A 3ANLA 1GFIA 3Q5EA 5IK2A 5FWXB 4C89A 4FIDA 4DYQA 4FFPA 3TM4A 5DXJA 2M2IA 2WILA 2HA6A 3THSA 5B30A 3KLBA 4J4HA 4LMBA 4IQGA 5JNSA 4XCXA 4BO4A 3OA0A 1YRYE 1WWXA 4MITA 3SLRA 4HGQA 1G7TA 2YN4A 4E4TA 1G8PA 1Y7PA 4KWIA 5FWDA 1NQOA 3BZWA 2HQ1A 3WGVA 3BFVA 1ZN9A 2I78A 1JA1A 4FUTA 1AM4D 3T61A 3NATA 4BJHB 1QA6A 4TRNA 4X91A 4MI3A 1ECPA 1Y8QA 1K6IA 2YU9J 4EQ6A 5NULA 4DEYA 4P7KA 4FZRA 2YJNA 1GAJA 1L4BA 5P8WA 2GI4A 3NEUA 1PR9A 2GEDA 5KKNB 4XWAA 3RHSA 2Z8XA 2DA6A 4D3ZA 2NPFA 4ZCMA 2VKQA 2PKRA 1YR6A 1B23P 3SYLA 5ALUA 2VJ4A 2C2MA 4RPJA 4ANFA 4ZQBA 1P45A 4EFDA 2EV9A 5HGXA 3IP8A 5K2MA 3PC6A 1JF8A 1XKXA 4B0OA 2HKOA 2YTZA 3ERED 5BOSB 4FOLA 3LQRA 3T0YA 1M2HA 1V6SA 3RRFA 1MB9A 2I2FA 3PC8A 2CUEA 1J2XA 2DTDA 2G72A 1OYIA 2PI0A 4CTOA 1TUBA 4ID3A 3H5IA 4JA0A 4QJ4A 1ETXA 1C50A 3HKDA 2F5DA 3PM1A 3VGPA 5JMPA 4P6VF 1G8KA 4P3KA 1ISGA 1S2GA 2C0PA 3GWZA 2ATIA 7MDHA 3ES9A 3RM3A 3C3YA 4YAJA 2PGOA 4CF6A 2FR0A 4B3HA 2R79A 3LOPA 4KSYA 1VLHA 2DBVO 1ZG5A 5EESA 1KP3A 2JUGA 5LGUA 1B1BA 1OV6A 4LXGA 5FT9A 4UUTA 3K53A 4E2XA 4PJLA 3MGKA 4GHWA 3EH1A 4ZVOA 1SQ5A 2EEZA 3QELB 4FSXA 2RGNA 2O54A 1VG1A 2AR0A 4EZEA 2ZRMA 2IYOA 4CM8A 2RNGA 2C4HA 2BUAA 4FFWA 4P38A 2C96A 4KNWA 2COUA 2YFKA 4W97A 1O6FA 2FEKA 4KXVA 4CM3A 3EG9B 3IA7A 2PMKA 1YB1A 3HCPA 3CZ9A 3II6X 2BR3A 2IXGA 4DEXA 1JKOC 4DF3A 2VNIA 1FS4A 3SLGA 3I3SR 2F5VA 2Q6KA 4B3GA 4LB6B 3TE7A 2AO9A 2Q99A 5H0IA 3VZQA 3SJZA 4LG0B 2H2GA 4XYGA 5AJTA 3U4GA 5JO9A 4AF8A 2X0DA 4Z9YA 3VR5H 3E9CA 1YRAA 2ASEA 1MNQA 1PSZA 2DHRA 2WIFA 1T6BY 3U3KA 2WPDA 4XQ9A 1Z0XA 3ZQCA 4GLFA 4FDLA 5FJIA 4Y2HA 2R86A 2B2NA 4DRXA 4GNRA 3KL2A 2DPMA 2QTCA 1F2TB 4A6PA 3AM3A 1LBTA 1PT8A 3NVMB 2ZZNA 2GNAA 1VPEA 2WHYA 2W2TA 3V7RA 1FYLA 1QIEA 2XA1A 3VR4A 2BEWA 3IDSA 2GN2A 3D3WB 4ENSA 1JR6A 1FLDA 2W9XA 5CVIA 2R1TB 5DBFA 4UHKA 4XXHA 5KI6A 5CVUA 5SY6A 5A9SA 1X7YA 1BH2A 3AKDA 1K7XB 1NDUA 1ORDA 1VQOI 4IJ5A 2PJUA 1XWWA 3U21A 4A0HA 2R7OA 1E5XA 4C3JJ 1GZ7A 4KFRA 2V59A 1H2ZA 3QUTA 3O8NA 3Q15C 3H2HA 3QSGA 3RW9A 3VYSB 2PFSA 1N9GB 4DV0B 1W5TA 3WK5A 5C8XA 2E1NA 1REPC 2I1WA 4HUTA 2E89A 3KE9A 5EIBC 2B4TO 1XMOB 4BFZA 1B3BA 1OU4A 3EYIA 2JFUA 3GJ6A 1SKAA 3QEOA 2GMWA 3FDZA 2FH5B 4XOPA 5DFAA 2UVPB 4UNSA 5LU8A 2FCAA 2POCA 1XU9A 3CWQA 3FROA 3B60A 1HKSA 3QLEA 2V45A 2E0IA 1JJVA 2WB1N 4D41A 1RKVA 3CKYA 1QWSA 4ZWNA 3HL0A 1RWWA 4G9YA 4RAOA 2M32A 2WVAA 3ZPXA 4KQ1A 1OZGA 1Z4IA 1YVUA 4UMVA 5BN1A 3ST7A 2BGKA 4Q0MA 2O2HA 4U8HA 4V0NA 4YUVA 3O8QB 3NANA 4YH1A 3SE7A 2W37A 1BXGA 2NVTJ 1JNXX 1Z28A 1LV8A 2OY0A 2JJ1A 4PR3A 1OYWA 5FA6A 1TZBA 2BBTA 2FSPA 2R7UA 1JI0A 3INYA 3DEZA 3W9SA 2YQ4A 1WMAA 4MQ6A 1Y1PA 2E7WA 1DIHA 1N7JA 4YELA 2HL6A 1JHAA 3IAM6 1UBFA 5CFNA 1KKUA 2BELA 4MCAA 4G2NA 3F8CA 2R4QA 3U1TA 1FB5A 2XOXA 4YECA 3W4JA 1NP3A 2ZMEB 2GZAA 4MAAA 2MSWA 3KQSA 2C31A 4R2XA 2XUDA 2AD1A 5H4HA 4GLBA 4MIKA 2IU3A 5JROA 3TQSA 4JDPA 1KAHA 2DPLA 1Z7LA 1P3DA 1IAVA 4X65B 1XTAA 4AD9A 1DAOA 2WJVA 3AEZA 4L3WA 2PMEA 2JANA 2B0JA 1MGTA 2Q4TA 4X00A 3QYEA 1WH5A 4I4TB 4OSPA 3A14A 4Q6WA 4TKZA 5FNVF 4F21A 2IHYA 3DMRA 1G2QA 1II8A 1JFSA 3L7YA 3UMMA 4MQUA 3NTRA 3WTXC 1T9DA 3F6OA 1QPBA 5AW4A 3EODA 4EITA 4G6QA 1MZPA 1HKUA 1V4BA 3MT7A 4HFRA 1Z82A 2VHCA 4ITUA 1L2TA 2PR2A 3OZBA 4CWAA 2AMYA 3ESZA 1YC2A 3KTOA 1IXKA 4DFDA 1IGNA 4DUZB 3M4ZA 2J6IA 4MLDA 1RP7A 3GG9A 1KI4A 4AECA 2FOLA 3OPYB 3ZK7A 3DQZA 3DBRA 2HPVA 4PXYA 1QM5A 2HA0A 5JMOA 1JIIA 4LSZA 3T06B 1OAAA 3N5CA 2QF7A 1HF3A 5JJCA 3QNUA 5EMLA 2VHZA 3IO5A 2FWMX 4QDXA 4X6LA 1LVKA 2LNDA 2JBAA 3T3EA 1LXCA 4MS3B 1TM3E 1YGPA 4QHSA 2EHDA 3CO7C 1I3OA 3FBTA 3VHXA 4JUBA 3UWMA 1FLAA 4GX5A 1HTBA 8OHMA 5LA6A 3EK2A 1X6VA 3TZLA 4Z3KA 5FFFA 1J1ZA 4LDZA 3COVA 3F6YA 3VH4A 5CA1F 1DZIA 2P11A 4QGHA 3BGSA 4EJSC 3KO8A 2WIGA 5LBIA 3VAAA 3I5XA 3OTOB 1KOLA 3EUHA 4Y2UA 4D9NA 4TV8B 4ZCPA 3UMFA 1Z6RA 2IVFA 5DYGA 1Q7CA 2CXSA 1JHZA 3KB2A 2OHOA 4KQWA 3ZX5A 1H42A 3OU7A 3L2OB 1QE3A 1H66A 4XNFA 4TWBA 1D5VA 2ZT8A 4JS0A 5E1MA 3GT4A 1YTYA 1KOGA 2W6OA 1TQ4A 3QHAA 4K6FA 4RANA 2IUEA 5D6EA 4TWIA 5C32A 1IV6A 1NT2A 3TJRA 4XGIA 4EAAA 1DAGA 1JHHA 2IOFA 4B6SA 2IYVA 3E0QA 2LD5A 1T0FA 4JV5B 1YBAA 3O2JA 3IP5A 2MD0A 4RXTA 2DFLA 2CLKB 4EABA 3E8XA 1B6AA 4PZAA 4JJKA 4BMDA 3S16J 1BKYA 4BIMA 5L3DA 1E1RD 1IHDA 3T0IA 4F86A 1T5DX 4PR0A 1NN3A 1DCFA 2YMLA 2YHAA 3ZWQA 4D6XA 4RGBA 4JXXA 3R4KA 4GR5A 3F6SA 4JP3A 3MGAA 1NLZA 4IH4A 4X1KB 3T34A 1TTPB 4GDFA 1I1NA 1K5DA 5FKJA 4BNWA 2WTAA 5EUBA 1P62B 1ZDMA 1PDOA 1VGVA 2C4VA 2OEPA 5BPFA 5BWBA 3RU3A 2IPNA 3V7CA 1T1EA 4NDNE 4QBHA 2GD2A 3AUAA 3HO6A 1E89A 3U26A 3T9FA 3X2EA 1ZHOA 4BB5A 3PXUA 2QS9A 1JHOA 5TQJA 4H59A 1ENZA 5EJCA 1P8AA 2Q0OA 5C51B 4OLFA 3RSSA 4ZOLB 4CTMA 3FUXA 5BSHA 5CT4A 2DHDA 3I72A 3CMYA 4OP1A 1EGVB 2YYYA 4WJLA 4CF4A 3DOUA 1ERDA 1YZTA 1F48A 2H4YA 3HN2A 5EXPA 3CCQI 3OT1B 1MJ9A 2WWFA 3SC6A 1JR3E 1PSWA 4K9MA 3TNYA 4DV7B 1SFXA 2V4ZA 2A5JA 3TAUA 4J1TA 3SE0A 3IOCA 5HWSA 2G0TA 3I12A 5B1AH 5IJ0B 4KTVE 3WFZA 4D9CA 3P2MA 2WD7B 4XGKA 3ON5A 4JYZA 2FEXA 2V9CA 3GV0A 5BUCA 1VG0B 2R7DA 2OTJI 4KXNA 3IQFA 4A0QA 1BN7A 3LE8A 1KJIA 3K72B 2EFPA 2GQQA 4DL9A 4JEIA 1VMKA 4X85A 2B2XA 3GFFA 4GPEA 1E9RA 1OTXA 3PI7A 1L7XA 1ONVA 4LZAA 3VSBA 5K3FA 1TVCA 4EF4A 4UBKA 3IBGA 3WY9A 1IHPA 4P5PA 4U2DA 3DE3X 4H2DA 2I03A 4KE9A 1J2EA 3QLVC 4CCNA 1J75A 1HT1E 3GTQJ 3E22A 2G06A 3HWX1 4B7XA 1IDOA 3N3BC 5J59A 2ZATA 2XA9A 2HGCA 2YWHA 4LF5B 5K0ZA 2BXYA 3AY6A 2VNSA 3KYDB 3OJEA 3W2WA 5AJXA 4J0IA 2Y6UA 4JROA 2QMYA 4MKZA 2G77B 2EP7A 1ZA2A 2XVMA 4YV1A 4ZJUA 2VBCA 3GTJJ 3OP1A 5CCEA 1KKMA 1UDCA 3BE6A 2EIKH 3AEUA 4L0QA 4RJKA 5GM1A 2PZBA 3L6OO 4MUFA 2O2CA 2F1OA 4RW0A 5K0JA 2Q49A 3EZLA 4YP9A 2LD4A 1ULHA 4S05A 3FNHA 5CHYA 4FGSA 1XDUA 3ZJ4A 1PWHA 2QN8A 1NVTA 3KE2A 3U7QA 821PA 4GYKA 2NUTB 4Y33A 2A9OA 1GIAA 3K4PA 1L5ZA 2VWHA 5KDLA 4MTEA 2CGEA 2MSEB 2Q6LA 3UC9A 5U4XA 4EKGA 4EHIA 4AMBA 3ZGVA 1T1RA 1G8JA 4W4TA 3FDYA 4KOAA 1B6SA 3O2QB 2ZJOA 2YQ5A 4P08A 1TD1A 3ZMTA 1M0WA 3FMIA 4PYMA 3REQA 3D6MA 4P3YA 1F3OA 4MQBA 4D7AA 1ID1A 4EVRA 2QN1A 1PJLA 1A7KA 1MQ8B 4W1SA 4QYMA 2XHKA 5EINA 2HK6A 2XITA 2R84A 1WE2A 3BRCA 2C2OA 4KW7A 4WXYB 2MH9A 1G3UA 2ODPA 4TL8A 5CJPA 1O9GA 4QM7A 5DM70 1ISHA 1TUGA 4CI0B 4BAGA 5TIIA 1Z8FA 5A3JA 2QXUA 4MJLA 4HV5A 2XUFA 3ZEAA 3U81A 2P2DA 1WXEA 1XG5A 2VRCA 4EAQA 1HXDA 2G71A 1ZL0A 1TYEB 1DTWA 4FMDB 4DZJA 1RKUA 2PVPA 2GBGA 1JMYA 3WADA 1WUYA 2JIZA 3KHUA 1HDXA 4W8OA 3QWHA 4DJFC 2A3SA 1RYEA 4M1TA 3G1UA 3OJWA 5E8GA 3I09A 4PCQA 4UHFA 3D2BA 3PWTA 2P6TA 5HFAA 2EFHB 4IZIA 3SQNA 4JUIA 5BN5B 2Y2VA 1Z6PA 1JYFA 3QPHA 2BKLA 2NADA 4JI7B 3TPCA 1MDMB 2YW9A 1V9LA 4JQFA 4RGYA 1CUFA 2ZI3A 1A9QA 2FWIA 2VP3A 3CTAA 1PGOA 1BI3A 5C3EJ 4RELA 1PFQA 4JYPA 4RTQA 3JQAB 5GZ3A 1U4OA 4DN6A 1FTTA 2REQB 2JRLA 3C7AA 1YOVB 5AHKA 4I9UA 4RV9A 3WTBA 2J0EA 1QIMA 3U5TA 1HT0A 2WC2A 2A68F 1ST2A 4G85A 4MW7A 4OCZA 3GRAA 3K0BA 3V32A 2XCSB 4ZOQI 2GZMA 4FSDA 2AN4A 1Q1NA 5AK6A 4LMPA 3T0GA 2FX5A 3QA3E 2FPGA 2R68A 1UMDB 4NMMA 2CBZA 4R31A 3Q3HA 2L17A 1RYNA 2Y76A 1KZ1A 2PUGA 3IBCA 3T94A 1Y1SA 4IDHA 2CS3A 1F1JA 4AUEA 4HBZA 3WLTA 2CFXA 2NSDA 3O21A 1GTVA 2KDZA 4QO7A 5AFSA 3SEZA 4A2UA 3G2LA 1R6XA 1KJZA 4B35A 4IV8A 3H2KA 3CB2A 4BRSA 5DLQC 3TLGA 4FMPA 3TTYA 2D2EA 2UUOA 4YRDA 3WHLA 5CDGA 4OQDA 2F62A 5JCXA 1VE7A 2PFBA 4LZWA 1JGGA 1HLGA 2J59A 3PNQA 1JEEA 4F04A 5EIAA 2B7LA 3IE0A 2PUVA 4O2AF 1MJHA 1MJFA 4LK3A 3T7JA 1R0CA 5F1YA 2BAGA 5IARA 1M1XB 3RTGA 3E6MA 4R1MA 4XWOA 3OICA 4D2IA 3WTTC 3RPEA 1SQ0A 1J9EA 3ZXIA 4W5WA 3AHDA 1C29B 4OO3A 3CU5A 3PUYA 2HBRA 2TYSB 1U9CA 4PHHA 1LRJA 1ULZA 1DAIA 1T36A 2JLUA 4P93A 1G8HA 4HLYA 1G8AA 1R0KA 3KQWA 2QE7D 3QUCA 1Z2OX 4PAMA 1CVLA 4Z7OB 1AKEA 1CJBA 3UHPA 2DFTA 1MUUA 1VCMA 3AEXA 2JA8J 5E17F 5IS2A 3CUOA 1M0EA 1KE2A 3WGZA 1TWHJ 4OGGA 4ZI7A 1H23A 2E87A 1ZJYA 1JHRA 1W36D 3IQEA 4HF0A 4YHHB 4K5QA 3AR6A 3Q88A 4BDTA 1IUOA 1QR2A 3KHSA 1Z5NA 1GGVA 3DMNA 1B26A 4UZSA 4C20A 3FKSA 2VDQB 5J1SB 1V71A 2CG4A 4FBLA 2G4CA 3H0CA 4UUVA 2HGSA 4RF2A 1YIDA 4L85A 1D2RA 2YUSA 3ZH2A 3FXUA 4N7MA 5D3QA 4IEEA 4ARZB 1FRQA 3MWDB 2WKWA 4QGSA 1JQ5A 3GLGA 1N33B 1DJOA 5ELXA 5DP2A 3OJFA 4KIGA 4FMCF 5ECDA 1SMKA 3BRWD 1XVTA 4AFNA 3SVLA 1DG1G 3E3NA 4DLXA 1FFXB 2X86A 4BKQA 5BOSA 1TM1E 3GNQA 3GDOA 3K4KA 3EVDA 3H2ZA 3N3AC 3UKJA 4MPJA 2BWJA 1M8KA 4MUNA 3Q72A 3H92A 4BAYA 2FMFA 1V8ZA 5TGDA 3QKUA 1P7PA 1P4GA 1U0NA 4AZTA 1K7YA 3VNQA 1TZLA 2F8TA 4MRMA 4BASA 1MC5A 2XGMA 2IT0A 4XYEA 1I14A 2ZJQF 1F4VA 3LV8A 3MINB 4MVJM 1MD0A 2PJZA 2L5QA 1Y4DE 2A6HF 5KYYA 2XMRA 2PZEA 3EXFA 5DTRA 1KERA 3STVA 4UNNA 1J4AA 5HUHA 5HA5A 1BS1A 3C1OA 2KRFA 3QEMB 1DUIA 5JATA 5AI4A 2P9FA 3NIGB 4G41A 3LDHA 3VPAA 2IEDA 3E7FA 2ZYRA 1SK9A 4I55B 3PIIA 1DEHA 3K4QA 1AB5A 5LIRA 4GI1A 3QU7A 1QMPA 4OJYA 1EFUA 1LDDA 1RZUA 2C0QA 2E36A 1MJGM 5F9MA 2WNSA 4PZEA 2WE7A 1UBLS 4GLOA 3CLOA 4B4VA 4RF5A 3JRNA 2JARA 1GPH1 2A4MA 4Q3BA 3LSYA 5F77A 3AETB 4DWVA 5J2UF 3LNQA 5IYZA 4IDDA 5F52A 4Y7NJ 2AW5A 3P0EA 3RPQA 3TZCA 2YZMA 1PYGA 1NURA 3VOBA 2IXAA 5LHIA 2X5JO 4FDTA 1KJWA 1D6JA 1JG4A 4LBYA 1JKXA 2GQ0A 3AR9A 4TUYF 3TUZC 4D25A 4Y2PA 3TZKA 2WUDA 3HTUA 4HC4A 4US2R 1EQUA 1JT6A 3LY7A 2K5UA 2QLLA 4E2WA 4AJNA 2IDZA 2BCEA 4M76B 1YB4A 3PDIA 3R3SA 1IQUA 1GQOA 2AQHA 3D3WA 3H9UA 4FFSA 4AIRA 1S02A 4ZZ3A 2H1IA 4CG1A 4QASA 2Z1MA 3QP6A 3K7AJ 3P9PA 4TT3D 1N3YA 4U0VA 3WODF 1H89C 2E6UX 3EXEB 5JCZA 2IDKA 3SZLA 3KNZA 4I8IA 3BY6A 4MKXA 3DVRX 1TI7A 1GAEO 3GCZA 2P9HA 1D9XA 1OBVA 5DN6A 2B69A 2ODWA 3P2JA 1P9NA 2WJYA 2WW8A 5E6SB 3RZDJ 4UPEA 1I7SB 3OFSA 4LLGF 2QD5A 4Q4HA 4Z7QB 2C1EA 4O08A 4AN0A 5IZCC 5HMLA 4KXFB 5HX7A 5L40A 1N6RA 2PE5A 3JTHA 1UP6A 1UZCA 3A1UA 2I7VA 4L74A 4I6JA 1TK3A 4AX8A 3BQ9A 3TDNA 1W0JD 2Q5JA 5B1YA 4ENWA 1OYOA 2PPLA 1ZA1A 2R8XA 3UAWA 5JSQA 3X2QH 3MKWB 1S72I 3GI1A 2C8KA 3GYHX 4XR9A 3BSFA 2P4HX 3LUJA 3JQ8B 3UXYA 3UENA 2WTMA 1GQRA 1UKEA 4Z7NB 3TK1A 5HQ3B 5BN4B 4RZQA 4W5HA 1H0SA 4BN5A 5GGYA 3DMHA 4DCOA 1XJQA 2XMGA 2I33A 5BQ5A 4HDNB 1C41A 4P7GA 3OU2A 3NHFA 3NNSA 5C35A 2A69F 4AVYA 1QVAA 3DE5X 2E1PA 1LC0A 2ID7A 4D9MA 5EGOB 3KKPA 4F9EA 5EEGA 2JG3A 2XUGA 2CQQA 1FRFS 2PKWA 4QGBA 3M4XA 3E81A 2BFOA 3L5OA 2DMQA 4YFNF 3L79A 2BKAA 1MJBA 3NNNA 4OOIA 5J1TB 3I45A 5DISB 1E1LA 5PNTA 3AHGA 3RTRA 4MCIA 3IELA 1XJWA 1IN7A 5CK5A 4UY8I 3RKUA 1J33A 4YAOA 4DM3A 5KIAA 2IZ0A 1YVDA 2VWQA 3BGOS 3UWKA 2HVRA 3QXGA 5FJJA 5EKUA 1SUFA 3CONA 2MHCA 4WCFC 4R2MA 3MUFA 5AUPB 2NP6A 4Q3NA 2PZJA 1P0CA 2FE4A 4I7EA 1QO0D 1OXMA 2JC3A 1NM5C 5LJLA 4JI5B 2PXCA 3DOEA 4MR7A 2NV6A 4BY7J 4V24A 3GXOA 1TAHA 4QG3A 2HIHA 1ITYA 2NZVG 4FU0A 4GE0A 3TQCA 1JJIA 3L8DA 5F0FA 4QDZA 1J8QA 1XPOA 1M76A 5JY6A 1YS1X 3B53X 4TYQA 3CZMA 1RM0A 3PPYA 4FW8A 4I6GA 4QNNA 2O3TA 4C3UA 1AQIA 3OOEA 4IINA 3VTZA 4A2QA 1G2OA 2BMJA 1F8GA 4XVQA 1SC6A 3OCZA 3EDPA 3I53A 3OTIA 1S6LA 1I1QB 2PUDA 2DFPA 4Q4AB 2ZTSA 1LS1A 4PSXA 1GEGA 4KQMA 2QUFA 1UPTA 4Q1VA 3KSBC 1ZKGA 3HLYA 5B53A 1AIPA 4A6EA 3R60A 3MBKA 5CXUA 3K1MA 4M0LA 2C4KA 3EISA 4W6ZA 3C2BA 5DX1A 4ETSA 5HEKA 5L3EA 1NLMA 3QIAA 5BXYA 4WD3A 2PLAA 3B6EA 2C5BA 1Q6ZA 3I55I 3V1NA 4MVJH 5BSGA 2OD5A 4RLFA 5T7BA 3H0EA 5JTTA 2QPTA 3B7WA 1BQ4A 3A1NA 5CM9C 3HRHA 5I48A 1IWOA 5JI2E 4D4KA 1Z2AA 2IRFG 4HWGA 1TM2A 3FZEA 4G7HF 4RKYA 3PC3A 4BEBA 1NBEA 2FSVA 4K9PA 3UA3A 1GD1O 2HZTA 4RVUA 4Y0NA 2E3JA 1ZISA 4TWZA 4KV9A 3QWFA 1RE0A 2BFBB 4E33A 5BMVF 2O03A 4NCBA 4DJDC 5LXTF 3SQLA 3L7WA 2OV8A 1NIJA 4UVIA 1BWPA 4QDJA 4INAA 2XDWA 4AS1A 1RYBA 5CA0A 2PCLA 5DHRA 2QGNA 1AGRA 3FIUA 4N9WA 1VJ1A 4D46A 2AF3C 3FVQA 3LX8A 4RIIA 5CAEB 1UPCA 5CEJA 1TF2A 1HYGA 4LXIA 1N2ZA 4X1KA 4C0KA 2WAOA 2C5AA 4N7JA 1NXOA 1JU3A 3WHBA 5DNUA 2DF8A 4R8RA 3R5JA 1WKVA 1ATIA 2P77A 2B6HA 1SVWA 1U90A 1GPWB 2QORA 1AF7A 3ZZMA 2V5VA 4JLBA 1KEWA 1Z6AA 1D6SA 4ZQCB 2IVZA 3A11A 3LP8A 5E6UB 1U1IA 3JYQA 4C0WA 3OSFA 2EWMA 3UAXA 221PA 3EIFA 4GPZA 2CQXA 4MWEA 3PXGA 1GSHA 4ZOLA 3DDWA 2Y69H 3ZGLA 1H8HD 2N8GA 1TU0A 1M8JA 3KUDA 3OZSA 2VSFA 3CEHA 3PGJA 2VUTA 1DKUA 5DYIA 1DELA 2V65A 1EP1B 3ELKA 4WZBE 3UIEA 2ZS7A 3DTEA 1PZEA 4PX9A 3U44A 3FYUC 2VZ9A 2XNDD 2FLVA 4D0PA 1GCUA 5CB4F 3BZKA 3NKFA 3N2ZB 4YAUA 1G8SA 3KPUA 1U28A 3WGGA 5KEIA 4QE3A 3BTSA 5I9IA 5MHTA 2GVDC 3T7IA 2J9FA 4UCQA 3NBUA 1D2EA 4QOFA 4RE6A 5BXQC 2IEYA 4LOLA 3S2IA 1VDZA 4DLWA 3DDNA 2WKPA 3U61B 4HV6A 3HBNA 2X2PA 2VBYA 1N92A 3JQ7B 3JU3A 4D9FA 4E6EA 3CLUD 3H9CA 2X6TA 3JQQA 1W0KD 4KHPB 1BDMA 1CZRA 1WNFA 3L05A 2Q8KA 3SHTA 2XGGA 2ECFA 3T35A 4JVSB 1B8VA 1Z26A 4ENNA 4IX9A 3ENWA 1YJXA 2OFWA 1FMTA 2PL3A 1T95A 5DGHA 4CODB 3GQVA 1N8KA 3E9ZA 2PH3A 2CEKA 1W75A 1OIVA 1HWYA 4AKEA 1PU2A 3GFPA 3RVPA 3GJYA 2VXBA 4EB6B 3DD5A 3TL6A 4A3BJ 4B34A 1E9EA 4HWSA 3U48A 4CL8A 5D5UB 3PZRA 3K1YA 2X6QA 3VV3A 1CUYA 3H0KA 2J0SA 2XF8A 3QVTA 4HLDA 2IW1A 1WJEA 2X0JA 5K5OA 5CVDA 3A03A 1WZ2A 4J4TA 2BY1A 4OHBA 1RM4A 2E37A 2KHZA 2R8EA 5J9FA 2PLFA 1RXYA 4B40A 3M6IA 2NUTA 3IT1A 5KWEA 3LRPA 1XDBA 2PLNA 4HXGA 4BMXA 3LSMA 5G02A 4GP7A 1GILA 2CDBA 3X1JA 4NAVA 4KZPA 1U0RA 4C03A 2NAFA 3K1NA 3LYLA 3KP5A 3UGTA 4CM1A 2BJWA 5KSZA 1OAKA 3OM8A 1FP7A 1PZMA 1FFBA 4P83A 3LSJA 4DGQA 1SHJA 3IDFA 4TMTA 1P0IA 1CW2B 4FQ5A 4EJVA 3IR5A 2DODA 3QF7A 2W2MA 4EM1A 1HSTA 3DNPA 3JYOA 2Q1ZB 2YASA 5EP3A 3M6AA 3E35A 5JSYA 2NXEA 4KU4A 1NG7A 3IDAA 3CCYA 4KPUB 4HFNA 5KYVA 5J58A 4BVEA 1N2IA 1PDWA 3MBIA 3CX3A 1XFDA 3DYBA 2OQRA 1K6JA 1R6TA 1MB0A 4FGZA 1WXGA 3FM3A 1UOOA 2C29D 1Y9ZA 5A5VA 2ALJA 5LHGA 2XEXA 3URMA 3PGXA 5AUNB 2CLOB 4FKMA 3EC7A 1USVA 2DMRA 4IMJB 3RBZA 4D5EA 2WWYA 1XMIA 2Y67A 2OE2A 1Y0BA 3CPHA 1IPFA 3MAAC 4CL0A 3K09C 1PJ4A 1Q21A 5EJ5A 1I5ZA 2GZWA 4S35A 1EG2A 4Y6GB 1MXFA 2NU9B 4CMHA 2WWRA 4MEYF 4B45A 1QYVA 1GAQA 1SNYA 1ZO8A 3IDOA 3JQAA 4FK8A 4ZVPA 1LVAA 1GJRA 1AMOA 3KD2A 3O2PE 3GTMJ 7ADHA 1QKIA 4MV0A 4Q4DA 3IERA 4PYRA 4R69A 1CY0A 2ODTX 5IASA 3KC2A 4E7SA 3OLQA 3RUFA 3E9QA 3U7RA 4OJMX 2NM0A 4OMFG 3U7FB 5JHUA 1E0KA 4BV8A 4I09A 4HQNA 2BM1A 4ZAZA 3NTQA 1RR6A 4IZHA 5AKJA 3GVPA 2JSPA 5IJ9A 1MO3A 4DIUA 4C07A 3FVWA 5EWMA 2J32A 1HKHA 1FU7A 1T0BA 4M88A 5AW5A 2IX3A 3JRFA 2DDBA 5IKEA 1VZ0A 3IBYA 1XSDA 4K7JA 3E3OA 1E62A 2IIVA 5F64A 3D5EA 1O5OA 4YUZA 1LPMA 1X9GA 1WZEA 1JJBA 3S8PA 1RXWA 3IR6A 1VZ3A 3MXTA 4I1SA 4B1FA 5DXFA 3UPUA 2YOFA 4ZKEA 4DPKA 1TCCA 4Q3EA 1XIVA 4XBFA 1PV1A 1JKPC 3BB1A 5L51A 4U2GA 4C87A 4RNDB 4XSGA 2QMOA 5EYRA 1D3YA 3SIXA 3FPSA 5GJWC 2RIRA 2JDID 4GDMA 4LF8B 2FDRA 4O2BB 1JNYA 2H09A 2I66A 1PZHA 1ITZA 1GQQA 1NDHA 4J9UE 2VZLA 4OPMA 4RA9B 2F9LA 2DW4A 1TADA 1UZMA 4RK6A 4NULA 2PUHA 3GMSA 1LDJA 4NI5A 4MHGA 2XR1A 5DCYA 1N2CE 4URFA 1Z5WA 1WCXA 1KAOA 2KQRA 4FHGA 1BAPA 1KDVA 3CT4A 1ZCBA 4RPCA 3OEED 3O0DA 4CR6A 2CVQA 3BTJA 1XHLA 4CEIB 4YX9A 1IXCA 4CTNA 2KW5A 3ECHA 4V1CI 1V11A 4D80A 3BWDD 5JJKA 4RY8A 4EJ2A 3DEYX 4W5RA 1J0BA 3WHCA 3P9KA 1YFHA 4PZZA 2XF6A 3KKOA 2AYYA 4YDRA 3T5AA 3RFXA 4V39A 3NHRA 3A6ZA 2Z4RA 1TVEA 1KI3A 4C6HA 1OPRA 1ND6A 5ILOA 2W4QA 5IKMA 4BLQA 1YXMA 5CPRB 3BWYA 4YQFA 2TMKA 4B43A 1FSFA 2MLKA 1VRWA 5D4RA 3ZS9A 3HB5X 2V3WA 4DMKA 4RSGA 4ARZA 2VDRB 1M9NA 1EI9A 3ZDXB 1TJ4A 1ORIA 3C7DB 3LX6A 1NYQA 2GOMA 2IUFA 1W52X 4B3CA 1X13A 2P27A 1MDBA 4OLBA 3PJGA 3HGYA 4RL6A 2IELA 1FFXA 3IPRA 4RD2A 1T0UA 1NLFA 4L9JA 4BMVA 1ZUWA 3M49A 3U62A 3HN7A 1DBVO 1MDFA 2E82A 5SZIA 1G3MA 2HJVA 3FFBA 1CXZA 4S1PA 2Z8ZA 3WRYC 1GV5A 2WPNA 4BP3A 2EJRA 1Z6ZA 3VPHA 5DCMA 2IS1A 3IPCA 2B7EA 4ZDWA 4AJPA 1HNXB 3BX1A 3EUWA 4MV6A 2ZBEA 1UBUS 2NZXA 3EXG1 1TZ2A 2CMHA 5IP6A 1XTKA 2WLTA 2E4ZA 4LYYA 3MQ4A 4OXIA 4IXDA 3SS7X 2JEOA 2IEGA 2ES4A 2H1OA 5REQA 4FVTA 3HOTA 3K1ZA 4FD3A 5K7FA 4KO8A 2GEBA 5B7GA 3Q8MA 5LBUA 3UT5A 4NFHA 2CLIB 3RHFA 5DM6F 3E5XA 3ACDA 1YTLA 4MZDA 4D0RA 1YDMA 1FX0A 8ADHA 2GHTA 4XRSA 1R3DA 2G07A 4NYMQ 3Q3SA 3KEQA 4M46A 4K86A 4I55A 1M6VB 3PEWA 3VDNB 3M3HA 2F90A 1EQAA 1GNTA 4YCCA 2OCGA 3J80A 1BWQA 3JAWB 1Z4KA 1G38A 3FTDA 1VF9A 1V6CA 1CV2A 2BFMA 4L3VA 2AFHE 1L7QA 2FA9A 2C5SA 1YJ5A 4I46A 4IJUA 2XMDA 1Z75A 1WX1A 3R6LA 4FOSA 2CB9A 5FP0A 3RPUD 3R7LA 5FX2A 5FFNA 3RVBA 1HQYE 1KYQA 3NZEA 3AILA 4GYGA 4ZIRA 3ZV5A 3EF0A 3AKZA 3F4LA 4QDOA 3G0GA 1FW8A 4QEDA 2M0MA 1E1QD 2JSCA 4KUEA 4A69C 1U0OC 3B9QA 4TN5A 3KJZA 3LDUA 4D1YA 3QPCA 3NMUF 1FBTA 2GM5A 4GT1A 4YUYA 3HJUA 5LQSA 1D4AA 4P58A 3OT4A 1KEVA 5ERIA 2YS7A 4FI3C 3RS2A 3TLJA 1I94B 2N3ZA 1S3JA 1COZA 2FZWA 3F3KA 5EA2A 4E14A 2QG9A 3CSSA 3FYHA 1W46A 3BOSA 1IUNA 4A4DA 5GIPE 2HQ5A 3FUTA 3OTGA 1F20A 5JD3A 2K5CA 3G02A 3NIBA 1NJ8A 3E18A 3QQAA 2QM3A 5LZ7A 3B1ZA 3CMCO 3NIFB 4XAQA 3RS4A 2QVLA 4YQZA 1F5SA 5KQGA 5LIPA 5A4DA 3Q2OA 2FMYA 3FISA 1H94A 1L6IA 2ELHA 3B5IA 2CMGA 2DOEA 3FB1A 3TH5A 4TXJA 3R0AA 1YC5A 1XZ8A 1TOAA 2VZ0A 4YWHA 2JNWA 2JKVA 5SICE 4AS3A 3OZCA 4YRAA 1ZITA 1LPQA 4DSNA 4Q7JB 4XUEA 5DDIP 3FMFA 1GOTA 3R4CA 1UXJA 3KR0A 4BECA 4EGQA 1H9AA 1GAXA 2PLRA 5D8LB 4X0EA 4M9UA 1LDKB 5IT5A 1O4VA 1P1FA 5LOVA 2HRRA 3DD1A 2H1FA 2CSOA 4RMHA 4CMCA 3SXPA 3GLIB 5ANRB 5EIFA 2QXYA 2IBDA 1LBIA 5PGMA 5LYJB 1Y7TA 5G4LA 4RH3A 2F1IA 3KYLA 2DI3A 2D06A 4U7BA 2QJTA 2I1LA 3VBCA 3K2EA 3GEZA 2JAPA 9ABPA 5KX5A 3HGMA 4RU1A 3U60B 1KBOA 2PU7A 5J1UA 5HQ3A 3S2WA 2EINH 4EHLA 2VSNA 1JPJA 1FYKA 5IXYA 1W7PA 4QBFA 2DWPA 2P9GA 3UWSA 5DUKA 9LDBA 1XZLA 4AYBA 3GT7A 5E1WA 5KQLA 4WZBB 1E7RA 1QHIA 3Q8WA 1S4MA 4QYWA 1DP3A 2V0GA 3K9LA 3O9ZA 4CKWB 1JR3A 1ZM7A 4EUNA 1AK9A 5AOVA 3D4PA 1JZTA 2B34A 4LCJA 5JVDF 3MT8A 3TOZA 2FWAA 4I1VA 3CZ6A 1T8TA 1GGKA 4PG7A 1JMKC 2GF2A 2W6CX 3HBFA 3QPUA 4RA6A 2VXCA 1ZGCA 2A07F 3I54A 3NKLA 1P4HA 1SUSA 2YJ3A 3T3MB 1IG3A 4BUPA 4YJ2A 3KUXA 2UV1A 1JQ3A 3OFND 2Y8EA 2B4AA 2Q07A 2IFTA 1RUOA 2I3DA 4REQB 4JQZA 2H9AA 4HQ6A 5A2GA 1YS4A 2ZK7A 3PHLA 3I9NA 3HP1A 4UM5A 4M3NA 4TMVA 5H9WA 3BRSA 3ODPA 3WBKA 5CIYA 3IR7A 1D2HA 5HP4A 3HZZA 5JECA 1HKTA 3HIFA 1JP7A 3AR4A 1W88B 4Y6QA 3GLVA 1VKRA 1Z5VA 2ZDGA 4ND3A 1U0SY 1H69A 2LBPA 4D56A 1ZQ9A 4OI0A 2PQ0A 3HYSA 5U9CA 5BQOA 3CLRC 1IG0A 2JN6A 1H8AC 3AQ4A 4ZT4A 1Y8ZA 2CV1A 4B3BA 3VFZA 4J4BA 3VR0A 2XSZA 1TO6A 3C7CB 5CXXA 4MIMA 3QOWA 3GH1A 1QB8A 4CKYA 4U6NA 5IBCA 1QBJA 2J3JA 4HMOA 3ZDZB 4RK1A 3AH8A 4XWKA 2PRJA 1RBYA 3ZE1B 1HOXA 2HJ9A 1VFNA 1OXKB 3CRQA 5HK8A 1D0XA 1I0LA 2EZTA 1YCFA 3BWMA 1XA0A 2H2HA 3S1AA 4WOKA 4OUDA 4FGWA 2DGDA 1O97D 4PRKA 4UHEA 1LBQA 2HYJA 2CUKA 2NZUG 4ROSA 3I2KA 3QPVA 4Y2TA 1MX1A 3LDFA 1C7QA 4PBTA 1Z3YA 3NHBA 2RGAA 4BYYA 1BE8A 4F3NA 4DNFA 2A58A 2F64A 1QFSA 3MCUA 1U6GA 1U2DA 3HM2A 2V8OA 3TGNA 5L3CA 3HV2A 3R7WB 4YV0A 2G7HA 1Z6QA 4DQ2A 4MVJE 4XPZA 2X8BA 3TO5A 3OA2A 3OQBA 1DC3A 3D4BA 1G7RA 1I7DA 1Y39A 3DEEA 3QI2A 3C18A 4ZRNA 5KMGA 3FYCA 3CRRA 1RKWA 2HAEA 1SXJA 2WAQA 3FX2A 5IAEA 2G0NA 1JT2A 3HU2A 1C14A 5I7WA 3N8DA 3D6NB 2P9JA 1ACIA 1Z9BA 3T1QA 1T3GA 1VTKA 2HC9A 1US8B 3WAJA 1BI2A 2GERA 3IKMB 4IQ0A 1ADBA 1YQTA 2BHRA 1KS2A 1E0JA 3Q41A 1KY5A 3V8MA 4EK9A 3AJEA 1DUSA 1FSSA 1J23A 3BN3A 1IL0A 3NHYA 4TMWA 4IXAA 3T7AA 3HJRA 4B71A 1UXHA 3A7EA 2HEIA 1XLVA 1G4UR 1V7CA 1WQ3A 4KSBA 1TU3A 2XGOA 4AKSA 2DBBA 1DSSG 1Z83A 2IF0