1P2FA

Crystal structure analysis of response regulator drrb, a thermotoga maritima ompr/phob homolog
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
b'MMWKIAVVDDDKNILKKVSEKLQQLGRVKTFLTGEDFLNDEEAFHVVVLDVMLPDYSGYEICRMIKETRPETWVILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFLEREKKGLYDFGDLKIDATGFTVFLKGKRIHLPKKEFEILLFLAENAGKVVTREKLLETFWEDPVSPRVVDTVIKRIRKAIEDDPNRPRYIKTIWGVGYMFTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response Regulator
publication title Structural analysis of the domain interface in DrrB, a response regulator of the OmpR/PhoB subfamily
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 69
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p2fA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p2fA01
3KP7A 2QXYA 3FDFA 3PQJA 3K0LA 3ILYA 1IW7F 2RC4A 1DRJA 4A6DA 1QQBA 2DLLA 1ZRDA 1ZHHA 1FOKA 1ZGAA 2D1VA 3TDZC 1ZY2A 3WTVC 2LNBA 4GNRA 2CSOA 4HAMA 5DD8A 3DPLC 4YIIA 1FZPB 1SXGA 1ON1A 3FZVA 3OO0A 3LUGA 3A0UA 2V0NA 2P4WA 3B2NA 3NRVA 3HRUA 4JA2A 4M6XA 1K78B 3WGIA 4AIHA 3O3KA 1CEYA 2NYXA 3CLKA 2LPMA 2XGXA 2VUHB 1M2FA 1I1GA 4L0ZB 3WTWC 1ZG1A 1TQIA 4N03A 4BHPA 5KQPA 4MS3B 1RI7A 2DW4A 1HW1A 1YMVA 3HRSA 1TJYA 3WE2A 5L3BA 2DI3A 1BDHA 1MDMB 4Z4EA 4KZKA 4Y17A 3FF5A 5LBQA 3WTXC 1J75A 2VT3A 4Y9TA 4MR8B 3N75A 5JNRA 3ISPA 4O1HA 1D2AA 5JHUA 2ACJA 1Y1LA 2ZO4A 2FNPA 4ENJA 1W7PA 1CHNA 4NB5A 5C5CA 3VODA 4E7PA 1K6OA 4TMYA 3KE2A 3BPXA 2LBPA 2RJNA 2L02A 2OAZA 2WB4A 1TW2A 4RY9A 3H5VA 1JL3A 1KU9A 1ZH4A 3KHTA 2FEPA 4XFKA 4HV6A 4L9NA 3HUGA 2PMHA 2HWVA 4HX7A 4HW0A 1FY7A 2GIVA 1FP2A 2RQPA 4MRMA 2TDXA 4R1HA 4KPYA 3IWFA 5E8IA 5F6FA 1HEYA 3WGGA 2LF7A 4OMZA 3HOSA 1EAYA 4BHBA 2CWDA 3I59A 4NV3A 2L4AA 1KU7A 3CTPA 4Y15A 3M8FA 3HSRA 3MYYA 1NXXA 3H1GA 2NNNA 4RK1A 1KGSA 1USGA 4HQEA 1V3FA 3O6BB 3LMKA 1W25A 3O1IC 1T0FA 1W5TA 1T2KA 2IVMA 3RTRA 1KQ9A 2PLNA 5L3FA 2IPQX 1U2QA 5FD5A 4OLBA 4W5TA 5BMZA 1YW9A 2FBHA 2OD5A 2IT0A 3CG0A 3LUDA 2H0AA 4FB4A 3JY6A 2XROA 3N0XA 4UV9A 4G7HF 2FQWA 1XMKA 5D8KB 1RXEA 3P9CA 5IX8A 1T98A 1QO0A 3ROFA 2NNYA 4ENNA 1BI1A 3IP9A 4LE0A 4BAYA 3F21A 3SNKA 4HF2A 4LFUA 4PICA 1VKRA 1DRKA 2FBKA 2FXAA 3HHHA 4HNRA 4ETMA 3MMNA 1YFHA 1KMIY 1IXSB 2A6EF 5J8CA 4L18B 5J6XA 3KP2A 4RXMA 4CBVA 3B02A 3HHGA 3GL9A 1ZGGA 3GFLA 4KN4X 2EK5A 4G94A 3GUDA 4RGXA 3RVLA 3OOPA 1PEAA 4MTEA 1AOYA 4RU1A 1ONVA 5CNJA 3QX8A 3VB2A 4BH9A 2MA3A 4S05A 5JS1A 4Z2YA 2VBYA 4MQVA 1Z1DA 2O0YA 5LHHA 4FX0A 3KTOA 5LLQA 3O2QB 2OA4A 1ABEA 3C3MA 4ZH4F 4GYIA 1LB2A 2FF4A 4ZZLA 3JVDA 4WXDA 3KEOA 4EJVA 2A9OA 1FFWA 3LA2A 3BBLA 4YP9A 4BHCA 3EQ2A 4HZFA 1P92A 2NT4A 2P9HA 4ZYHA 2HYGD 4I0AA 1J59A 4MS1A 4YO7A 4RXTA 3NNNA 1PNRA 4EVIA 5HM6A 2E7XA 3QLUA 4Q5SF 1JE8A 4RK5A 4DADA 3L49A 1T34A 2YHBA 3LSTA 1DG9A 4MEYF 2R47A 3RJPA 3V8KA 4YFXF 2VE8A 4ESFA 2O3FA 5DCFA 4LX8A 2NT3A 2V6CA 3QEKA 5HS7A 2PBIA 3FGZA 1E17A 2JVKA 4WUTA 3FWEA 5J8FA 4P9FA 5KC9A 3WTUC 5D6EA 3H5LA 3W6JB 3O74A 5JS2A 3IPAA 1VPWA 2DTRA 4OIRF 1ODDA 3HK2A 2JT1A 3DP7A 5LRRA 4E7OA 2QBYB 2HKOA 2E1CA 1A0OA 4HX4A 4MGRA 1PHRA 4XASA 3I4PA 2IOYA 2PLYA 3Q15C 2EA4A 5AIQA 2DPUA 5HS8A 4OG2A 2Y75A 1U2PA 1BIAA 1USSA 2JTVA 1U5TB 2A9QA 4EM1A 1YS7A 4MS4B 1STZA 1CYEA 3QEMA 3IKVA 4OIQF 1IZ1A 2F5EA 4W5QA 4RSMA 3BY6A 3L9FA 1IN8A 4I02A 4RB1A 4I98B 5HS9A 3IKTA 5HLIA 5E1XA 3JVIA 3REOA 4G9YA 2XASA 2P6TA 1T6SA 3M9AA 3WTSC 2KIUA 4UVCA 1EWKA 3GVAA 1KYZA 1O3QA 2IA2A 4RKRA 3QLTA 2RN7A 1IUYA 1LQ1A 3QLVC 4WXEA 5IEBA 2H94A 1FSEA 1DC8A 5KI6A 5FBHA 2VK2A 4MQEB 4F12A 2ZBKA 2H3HA 4YLEA 3I58A 2HJ9A 4RXUA 1KQ0A 1KRWA 2NUBA 2HOEA 4EGZA 4G0PA 1ON2A 3EJWA 1DCKA 2RGYA 3N53A 3CUQB 4L5JA 4RB2C 5JR3A 1LDDA 1GUDA 4MR7A 4A0ZA 1XGOA 2LDUA 2MH9A 5DEQA 1R58A 3IRQA 2A68F 2DPDA 1XHFA 1QP0A 1IN5A 3OQOA 3KCCA 1MJ9A 3MZHA 3RVQA 1K66A 3M9XA 3IP7A 4EQQA 3IHUA 2QENA 4ZJPA 3QU3A 2IP2A 1YW8A 5ICGA 2PUCA 2HTSA 3AAFA 3OO1A 2W57A 3CKMA 2ZNYA 2KKOA 3SHFA 2H27A 2ZMEB 3QELB 2A9PA 3TGNA 4CICA 2VC1A 4I2OA 3HM9A 3SXYA 3CUQC 1YQAA 2XAJA 1IXRC 4ZYEA 5FWXB 1U04A 1XGSA 4Z4IA 2OQRA 3EYIA 3C1DA 2P7VB 4WXHA 3P7NA 4LG0B 4AD9A 4MHGA 1LDKB 4ON0A 1D4ZA 4EVRA 4RV5A 4RGSA 4O6JA 3F8MA 4U88A 3H1EA 1GXPA 2F5FA 2MYNA 1QKKA 3I45A 2AS5F 4F06A 1T39A 4N76A 4G0QA 4RAZA 2YX4A 3NQOA 3KYIB 4W5RA 3T0YA 2VBXA 3RVOA 5JNTA 4TLLB 1MIHA 4EYOA 1OPCA 3ILHA 5TPWB 4XXHA 2Q0OA 3GWZA 1SD4A 4KIGA 4E70A 5E17F 4PYRA 1HQCA 5EWJB 2FOKA 2GBPA 4JASB 4KQ9A 3KG2A 1R5HA 4RAYA 5BPIA 2KJCA 1GUBA 3OM1A 4RS8A 1D8JA 2FEWB 5BRAA 4Z4GA 1F1ZA 2WJAA 3I0TA 1R22A 1H9TA 1UDRA 1XSVA 2PE5A 3IL2A 1SFUA 5ERIA 3LTEA 4JQFA 1APBA 2XKPA 4Q7EA 3GYBA 1LBHA 1BN5A 4KK3A 1JYFA 1UCRA 1QP7A 1FLIA 5D6FA 2LUOA 4Y13A 1ZHFA 1PP8F 2FKAA 4EM0B 1PUXA 3D02A 4XAQA 3TX6A 4G97A 1E2BA 1SFXA 1KRXA 5IUKC 3QPTA 2FNAA 3T8YA 3MEXA 4Q6WA 4CXFA 2LP4Y 3K1MA 4JOQA 2M5WA 4A2UA 2CHEA 2GA1A 3VNBA 1KYWA 2Y48A 3ULQB 3ZPLA 4JB0A 2M98A 4KMUX 3QP6A 4I0BA 1YTYA 1S7OA 3I53A 1BAPA 1MB3A 2WRZA 3T6KA 2COMA 4M9XA 1V4RA 1ZRFA 2G7HA 4XLPF 4O5VA 1F4KA 1K78A 3NNSA 1QZZA 1TNSA 2HYFA 4OMYA 3LFKA 2R48A 3N0RA 2JBAB 1B00A 3KEQA 3K2ZA 4LLGF 1NXSA 2LF8A 3HUUA 1JX6A 5TE9A 4EYGA 3DEUA 4BQAA 4U7DA 2JRTA 2A6HF 4XLNF 1P2FA 3ZMTA 3F8BA 1BDJA 2HFHA 4HNQA 1XGNA 3GEZA 1BIBA 1D5WA 5LGUA 4CYDA 1MDMA 2JVJA 2GZWA 4KIFA 3NNDA 7ABPA 4WWCA 2O20A 4EVSA 4EY3A 1JYEA 2QU7A 2FVYA 1JFVA 4MTDA 3FXUA 1IRGA 1ZG5A 1I6XA 1R7JA 1F5TA 1U2WA 1LEAA 3L2CA 2V1XA 5BPDA 4F7ZA 4A0XA 3DFGA 1ZGJA 5D4RA 1JBEA 1TBXA 4CO8A 1PNTA 1Z18A 1WI9A 3KLNA 5DCMB 5BR1A 3ECOA 3C97A 3EETA 1C4WA 4A5MA 1F4VA 1BI3A 3ROTA 3R61A 4BNCA 4EV0A 1MD0A 2HR3A 3GW2A 1QPZA 1QGPA 1KU2A 2FMYA 3M9WA 4UHTA 4IHSA 1P6UA 1FX7A 4EM2A 2A61A 3MWMA 3HV2A 4Z4HA 1ZN2A 4KVFA 4RY0A 1BVHA 2HEOA 3EQZA 4YV7A 3L00A 4M6YA 2IKSA 2M87A 3H5TA 1CF7A 2A07F 3BJAA 4LB6B 2LIVA 4N9HA 3CFYA 4XRFA 1SMYF 4KNYA 1ULYA 4UNOA 2ZJ2A 1TLFA 3WE3A 1HKQA 3I09A 1BC8C 3OLVA 2ZKZA 3CUOA 1YVUA 3JSOA 5L3EA 1LEBA 5CVJA 3GT7A 3O1HB 4MR9B 5ICFA 4IRHA 2QLZA 4LJZF 1ZDMA 1KQ8A 3ZMDA 5LEKA 1OMIA 4ESJA 1MKMA 5F1RA 1DDNA 1M2EA 1JFTA 3GBVA 5JNVA 5DGCA 5LGTA 3H6GA 4WF2A 5IBQA 4EGYA 1Z13A 1ZH5A 2I6FA 2ZWMA 1GXQA 3ZN1A 5FO5A 1P4AA 3LQQA 4G0ZA 1O3SA 4ETSA 3GRCA 1G3TA 1ZESA 4KV7A 1BI0A 3RVRA 3V7CA 1JGSA 4DQDA 2Z5UA 3KZYA 2ISYA 5CVRA 5IULC 1B59A 3OMXA 1Z91A 1TLHB 3TOAA 2W85A 1P4XA 3M6MD 1O7LA 2QSJA 2MH2A 2OZ6A 2NZVG 4LLLA 4KMFA 3F8FA 1TW3A 2MD5A 5ICEA 3KP4A 2X7XA 4N0QA 1KU3A 3CJNA 3CO7C 2K4BA 3MZYA 4L9VA 4O5AA 2CO5A 3LAPA 4IPAA 2MLKA 3TDUC 4O1IA 1JHFA 2X0LA 1OYWA 4BXUA 3SFZA 1E6KA 2FQ3A 4RB3C 2NRAC 3FHZA 1S3JA 4HA8A 3WU1B 2FMKA 3R0JA 5FLXZ 3HJFA 1L3LA 3Q5FA 4Q6BA 3KJXA 4FE4A 4Q47A 2H6BA 1LJLA 2FSWA 5HDGA 4ZYLA 1MAVA 1Z6RA 2DQLA 4PZJA 1BM9A 5D5XB 3LUHA 4L4UA 3GXOA 1WKMA 2PAFA 4Z0NA 2QQ9A 4HLYA 1U8TA 1SD6A 3J7AO 2F8SA 4KMRA 2GXGA 3BRSA 3M1EA 3LUAA 1BBYA 4A0YA 3F22A 3GF2A 5D5VB 3DXJF 4AWXB 4MYRA 2HGCA 2V9VA 3OQMA 3QRFF 4ZYGA 5TQ0A 5D5UB 2D2WA 4ZZDA 3MQ4A 5FLXK 3IRRA 3FM3A 3HSEA 3N97A 3DZDA 3G85A 1GHCA 5LGNA 5EEHA 3D5LA 4P5OA 2EV6A 5D4SA 4Z9BA 1USIA 1IXCA 1U0SY 2IW5A 1YYVA 1YMUA 1SRRA 1DZ3A 2XHKA 3GO5A 2JCGA 5JNUA 3HRMA 1P8AA 2ESNA 1E6MA 1FFGA 4QYMA 5DUIA 1O57A 3S2WA 3TB6A 2FMFA 3WG9A 4GXOA 4MPTA 1MJBA 2QM3A 4PCQA 3CZCA 4I7HA 4MLDA 2PG4A 5KC8A 4IRXA 2MC3A 1U5TA 2OU2A 2QW1A 3LUJA 4WXMA 2A3SA 6ABPA 1IAWA 1H0MA 1NXTA 1WSUA 3V7SA 3I71A 5D5WB 2FRHA 1I5ZA 4MRMB 2FBIA 3JTHA 2YSRA 1RNLA 1AB5A 1ISSA 5EWMB 3GA5A 4RGRA 1G4DA 3SG0A 5KQGA 2GA2A 5DTEA 2E4VA 3KFWX 2M1ZA 4IRIA 3HEBA 2F5DA 3LA3A 1NXWA 4PZ0A 4EJWA 2WTEA 1ZREA 1FNNA 3BZ6A 2VBZA 5E20A 4KK4A 5B3JA 4LGWA 3U1DA 3BPVA 2WC2A 3FM5A 3MFKA 3F6CA 4XLTA 1FP1D 3QOPA 1VRVA 2IA0A 3IP6A 5DDGA 1FYKA 4P96A 3CZ5A 2FN8A 4NICA 4MQEA 5LHGA 3GYHX 4KYWA 3RVMA 1ZAYA 4EVQA 3ZMUA 4UVBA 3D0SA 2HS5A 2O6GE 1NHAA 3JW4A 1S29A 3H1FA 4LLNA 2ESHA 1R36A 3CTAA 1LK0A 1UFMA 2CGPA 4Z4CA 4G6DA 1NTRA 1Z2DA 2IJLA 2VOOA 5DCLA 5EEGA 2YX7A 3IP5A 4LE1A 4D74A 5BOXA 3QK7A 4ETNA 3LFTA 2ZNZA 4EMSA 4YFKF 2DK8A 3GZ5A 4A6EA 4ZPJA 5K1YA 5CHYA 2G7UA 1J7KA 4OOIA 1DP7P 1OXKB 4QLCU 4GGGA 2CWEA 2YPRA 3H3ZA 3LUCA 2GWRA 3RPQA 4F3TA 1SMTA 4DN6A 3EGCA 2Y0MA 2ZXJA 5H20A 5H6QA 5FWXA 4CGZA 4MLCA 2MSKA 3C6QA 1XCVA 4RK0A 3NEUA 3JPYA 1K7AA 1Q1HA 1IRFA 1X3UA 2FMIA 3ML6A 4KFCA 5E1WA 2QYOA 4N0BA 2PUGA 4IMIB 4LE2A 4Z99A 4H60A 2FXIA 1BI2A 4FHTA 1C0EA 1OYIA 5CNKA 4AIJA 1OKRA 3LUKA 3NHZA 3I42A 5C5EA 2A5YB 4MS1B 1H9CA 3TMYA 5AONA 1D5VA 1TQMA 3UUGA 3KYJB 1LVAA 3CLOA 5D8LB 1M5UA 1ZG3A 4KICA 4CDGA 1XD7A 4P98A 2V1DA 3RQIA 4H3HB 1EHCA 3OQNA 2R7DA 2W42A 1PDNC 1MVOA 1SFEA 4M9ZA 2FEKA 3FFXA 2XRNA 5IT3A 3KKEA 3SAJA 2PUFA 2L54A 1IN6A 2PI0A 2Z99A 2FLWA 2WJWA 4QPJC 2OZUA 1HKTA 4YCSA 3DKWA 1J9IA 5I4CA 3MF4A 2E4WA 1Z26A 2ID7A 1ZITA 4HNSA 1R00A 2FA5A 3KSMA 1IIBA 1FQWA 2KIMA 1RPJA 2XKOA 1FBUA 2L17A 3QLUC 4KUMA 3RKYA 2H09A 4EJUA 2K27A 3VEPA 1QPMA 2FW0A 2PN6A 4HBLA 2QVGA 1QMPA 1IN7A 1Z25A 4RK4A 2ISZA 3ZMSA 2ID9A 5EWLB 3RVJA 3WTZA 2Z3YA 2PL9A 4TLMB 4MQFB 4HYEA 4MQ9F 1IF1A 2IPNA 2PUAA 2HZTA 2NAZA 1B4AA 3TQNA 2DFIA 4IMJB 2EA2A 1TQPA 2KJBA 3SQNA 3BOQA 2FMLA 2R3SA 2ZFWA 3HO1A 3OLZA 2K7LA 4KN7X 1RXIA 4NCBA 5HQJA 4KT5C 1JDNA 3Q7SA 5ICCA 3L09A 3RYRA 2P4UA 4KRFA 3LQRA 5CVIA 1ZH2A 1WRJA 4LZLA 4N47A 4M9SA 1RIOH 1JF8A 4GCVA 1J2XA 3S99A 3TO9A 3J81Z 3RKXA 3BP8A 2JBAA 5A2QZ 4YS6A 2OQGA 5L3GA 4XSXF 1ZGZA 4UXNA 1ISRA 1EH6A 4EYKA 3TO6A 2G9WA 3LUFA 1YW7A 3V4GA 2QV0A 2F2EA 4L9JA 2DU9A 1L5YA 3F8NA 4EJOA 3DGFC 4RZSA 2RVCA 2WWYA 2IPLA 4QWQA 4PDKA 3H92A 4ETIA 5JFRA 1Z15A 3F3XA 5FFXA 2PJUA 4MR7B 1EH7A 3TD9A 1RUNA 5GQSA 3K69A 1W5SA 3J81K 3LAJA 4RKQA 5E18F 5TQ2B 1UHMA 4OIPF 3LOPA 4G8XA 3MA0A 1YLFA 3F6VA 5A2QK 4WT7A 5IUNC 4ZMRA 3O2PE 3QU6A 2AYZA 3BJ6A 2L18A 1A04A 4ENMA 3UK0A 2P8TA 1ZARA 3KLOA 1SD7A 1DC7A 3DF8A 3G1WA 3RVPA 1W9HA 2PL1A 1DCMA 5FWYA 2K02A 5H6RA 5BQ3A 2XVCA 1Z7UA 3BDDA 1QP4A 1YS6A 5F64A 5DV5A 2P7CB 4WXCA 1U78A 2XAHA 3KP5A 2UWMA 1U6GA 1P6QA 3E61A 2JSCA 3V7RA 3T5XA 3C3WA 4H3KB 4MEXF 1QNTA 3I54A 4GO1A 3OLXA 4LD5A 1FYLA 6CHYA 2PQ8A 1DBQA 3N0WA 4JK1X 5BQTA 5KWSA 2ADUA 1U8RA 4A12A 2L3DA 2W24A 4Q4ZF 1I3CA 4KIBA 3Q7TA 3V8JA 2VN2A 1J5YA 1TM2A 1KA8A 2P5KA 2ZCWA 4MS3A 1RZRA 2EFOA 2FQYA 2JZYA 3F8CA 2Z9OA 1ZLKA 3RVNA 1FBQA 5E3JA 1NXOA 2ELHA 5FGMA 3E6DA 2D1HA 3JSPA 1TVMA 4M72A 3EQLF 3IDOA 4IXAA 5HLGA 1RZRD 1G3YA 1ZVVA 2CG4A 4MR8A 4CZZA 1R1VA 4ENKA 4DNCA 3O75A 3E5UA 1EH8A 1IN4A 2NS0A 4WK8F 1OXBB 2RKHA 4OIOF 4UV8A 3GZ6A 1JDPA 5JI6A 5K5QA 1SD5A 1VLZA 4IF4A 3I5AA 3CDHA 2PKXA 2E7WA 4S04A 2QQAA 4ZMSA 4L85A 2RV8A 2OENG 3TO5A 2LKPA 2UXXA 3B73A 1YG2A 3WTYC 3JS5A 2STTA 3CG4A 3OM0A 4U7BA 1ZLJA 3ECHA 1S6LA 4HDUA 4NCAA 2CHFA 1OYYA 4W5OA 2KIFA 2GKGA 4A5NA 2A9RA 5D2CA 3L6UA 2GXBA 5TJJA 4RWEA 4EYQA 5KK1A 1FSPA 1B6AA 5ED4A 2XIGA 2FE3A 3WODF 2Q2EA 2MLGA 4F11A 1JWLA 1R5GA 5LRSA 3NHMA 1Z12A 1DPUA 3CO6C 2M8EA 1FSHA 2YR2A 2PUEA 4G0XA 3I5UA 2YU3A 1DPRA 4CHUA 3U2RA 3T8TA 4YRZA 2E4XA 2F5CA 5IEJA 2RJOA 1O3RA 3F7NA 1XHEA 2VT2A 3K9CA 1XMAA 4NHJA 2IYNA 4HDVA 3HTSB 1PEYA 4WWHA 3LA7A 1LJ9A 3M7GA 2XAGA 1L5ZA 3ZN0A 1J0RA 2MYTA 2BE5F 3RVKA 2M30A 2P5VA 2A69F 3H6HA 1XSXA 3EAFA 3HVRA 4LK0F 3RH0A 3O1JC 4UHKA 6PAXA 3T95A 2VBWA 2J48A 2F8TA 3GX4X 1D1QA 4HX8A 4IHTA 4R79A 2HDCA 3RVSA 4OU0A 1SXIA 3EODA 4OATA 1XN7A 2GX6A 2NZUG 2O61A 1CGPA 2STWA 2WY2D 4JB2A 4ESBA 2GQQA 3J80Z 2L01A 1HW2A 3RI4A 3ABTA 1QQAA 5ABPA 5K5OA 1FT9A 1LBIA 3IWZA 1K79A 4JAVC 3IPCA 4Z9AA 1SAXA 1FPQA 2BV6A 3VNAA 1HSTA 3TOBA 1W7PD 3DLBA 2L19A 4UVAA 4U0WA 3L7WA 1R23A 1O3TA 3LKBA 1GLGA 1E6LA 2FSPA 4RK6A 5FD6A 5HSGA 5DLEA 4I01A 5EWMA 3V8LA 2D45A 4ML3A 4L9TA 1PUEE 4IRGA 2FQXA 2UZKA 2VYCA 3J80K 3F72A 3O21A 2QQBA 4YR7A 4K2EA 5AIPA 1WQ2A 3DGEC 3BREA 5L3DA 4G7ZF 2RNJA 3JAMZ 2W25A 1Z16A 3JPWA 2XV4S 1I27A 2YHAA 3G3ZA 2E4UA 2CYYA 4LRQA 3KCNA 2QR3A 3Q7RA 3HDVA 4PGGA 1MB0A 8ABPA 1DJMA 1CF7B 2QWWA 4PGHA 2EFWA 2M1BA 1BOAA 3OLYA 3IC7A 4RY8A 3E5QA 2Z33A 1Y0UA 1VTNC 4D0PA 5IUJC 2VODA 4LB5A 3DLHA 3GFMA 5K5RA 2M45A 3F6PA 3GBPA 1NATA 2O8XA 4ASNA 4N9IA 3KZZA 4LK1F 1K68A 4UHJA 4G7OF 5ILVA 3GWGA 1F9NA 2QBYA 5TRDA 4L5IA 4H0EA 4IGAA 4KQCA 3JAMK 5T7BA 4TV7A 3HYIA 4WZZA 1B1BA 4RK7A 2IPMA 3MAJA 1W7PB 3I64A 2B0LA 1QO0D 5ILUA 1TNTA 2B4AA 1XCBA 1XB4A 1ZRCA 1T38A 3KS9A 1MZBA 3HOTA 3BILA 4MS4A 2FTKE 5DKFA 3QLVA 1D8KA 5CLSA 2WMYA 1P4WA 3QAHA 2N9UA 2DO7A 3HUTA 5E1ZB 2GI4A 1FWZA 2XAFA 4M88A 1Z6TA 3HSYA 3RDIA 1DBPA 4U0YA 3KETA 4KDPA 1PP7U 3KP3A 2QVCA 3I59B 4G86A 2BYVE 2BGCA 4N41A 5T3YA 5BRJA 1XDSA 4PE5B 4FE7A 4R8HA 5DUKA 1MGTA 3U9GA 2RDPA 4B8XA 2VONA 5KQLA 2W84A 5HOOA 3EYYA 1REPC 1R8JA 4ZYDA 4XBFA 4D6XA 3FXRA 5CJ9A 1YO5C 3BROA 5JNSA 4G0OA 2DAOA 2FU4A 1Z17A 1RZ4A 3HIFA 1HKSA 5IT9Z 2HSGA 3CUQA 3TKYA 2JB9A 1I1SA 2E1NA 4LMYA 2CW0F 3ZMVA 1O7FA 5TQJA 1P6RA 2IDMA 2KYRA 2MSLA 2WV0A 3OMWA 2QZJA 2HQRA 3D8UA 2HQNA 5TQ0B 2GAUA 2JK1A 2VUIB 3N4MA 3K9TA 2EWNA 1XDUA 5CVVA 5DD4A 4B09A 1NY5A 2CQKA 2EJRA 1MJAA 3FMRA 2MBFA 3HTUA 3T1BA 1ABFA 3PFIA 4KREA 3NBMA 3KP6A 5CYVA 4QICA 3W9SA 2ZMEA 4WCGA 3ZMZA 3FXQA 3QELA 4N0PA 2P5LC 4JBAA 1NXVA 4MNUA 5IT9K 2KRFA 5IC5A 1J56A 4XARA 2QZ8A 1QZYA 3C3KA 1USTA 4M73A 4AVPA 3TO7A 4W5NA 1XSDA 3CRNA 1FFSA 2MYUA 4IJAA 3R6SA 2DT5A 4TN5A 3QP5A 4RS3A 1ZYRF 5EWLA 4LG0A 4HV5A 2E4ZA 2V79A 4MQFA 4NQRA 4IILA 4RGUA 3HXMA 3E97A 2JPBA 2O03A 1EFAA 2XDYA 3HSFA 4DQ2A 3VOEA 4F8JA 4MGEA 5HLHA 3ZP5A 3RYPA 3SZTA 1W4MA 2PUDA 3WTTC 2ZAYA 1AB6A 4BYYA 3A0RB 5CVUA 3FFTA 3UKJA 4HOBA 4WX9A 3LWFA 3P9KA 5TPWA 4OTZA 1FC3A 1D1PA 4NQWA 2JPCA 1U5TC 1GCGA 1QBJA 3F73A 3RKWA 5EWJA 1JFSA 3ELKA 1B9NA 3FX3A 4P55A 1E2XA 3HDGA 2FLKA 2PJPA 2EFPA 3Q41A 2DRIA 3OLWA 2X4HA 3GV0A 1U3EM 2VXZA 4LDZA 3VFZA 2L2QA 1RUOA 1LNWA 3FMVA 1FBSA 3A3KA 2PMUA 3FMSA 3RPUA 2PEXA 4HLXA 2VC0A 3CU5A 2L4MA 3E3VA 3HS3A 3N6VA 2PFBA 5B3JC 5TQ2A 5LHIA 3H5WA 2E4YA 2R25B 1TTYA 5FB2A 1R1TA 2HPHA 2UXNA 1R1UA 3GFIA 3R4KA 3JTGA 1YK0A 5L3CA 4KA4A 2PUBA 2JRLA 1JLKA 3BJOA 3E6CC 2R4QA 4FX4A 4JP1A 4FT8A 2BEOA 2QUFA 1JH9A 3EUHA 3K4HA 3QEMB 4HF0A 5CNIA 5KQMA 4U0VA 2VOPA 2EFNA 5BS6A 2FN9A 3SY8A 3H3UA 2MSWA 5GOTA 3HRTA 2H6CA 2LSOA 2WWVD 1UHWA 1DUXC 3MM4A 2EFQA 3O2SB 1JHHA 3QX9A 3GFJA 5TPZA 2HKXA 4PEVA 1Z05A 1HBXG 5DYMA 3K1NA 2TMYA 2HTJA 2AYXA 3DPTA 4EJTA 4YIFA 3CS3A 3DV8A 2R7FA 3H5OA 1G6NA 2P6SA 1G3WA 3T38A 3P9YA 5TPZD 3E6MA 3DQVC 1FYMA 5HKOA 1EV7A 2K86A 3K1PA 4Q48A 3BWGA 3FMQA 1Z9CA 1S8NA 5CNMA 1UB9A 5KVRA 4XSZF 1EWTA 2XUBA 1HSJA 2VE9A 4HQMA 2DK5A 3ZQ7A 2DQRA 3O2JA 1B9MA 2RGVA 5E8GA 2EV0A 1QQIA 2QVOA 3M8EA 4P1ZA 4RDCA 3C7JA 2V1UA 1QNLA 1YTUA 4LDAA 4G0YA 1URPA 4Z4FA 2HQOA 3EDPA 3P9IA 5DCMA 3CNBA 3HCWA 3EULA 4YWHA 4GYGA 4HF1A 3F23A 2BGGA 5HVQC 4YGXB 1JXSA 3PQKA 2MYPA 1A2OA 4I09A 4D6YA 1DP4A 1H9GA 1BA2A 3URMA 5JNWA 3E6BA 5FFZA 3MCZA 2Q5CA 3BRQA 3JTEA 3MIZA 4QYWA 1OR7A 3EDCA 4L0YB 2C6YA 2DBBA 2XAQA 4OBBA 4AIKA 3ABUA 3COAC 1AWCA 1G3SA 1JHZA 1YK1A 1Z2EA 5ILSA 5HDKA 3SZPA 3OV8A 1LJUA 2OBPA 1USKA 3QPHA 3WGHA 3ERED 3DBIA 3R0AA 2CFXA 2J5OA 1ZAOA 3N8IA 2FMHA 5FBKA 3H5IA 2ETHA 3ROUA 4MR9A 2IRFG 3E5XA 4RB0A 3F6OA 5LEJA 1YIOA 2J5PA 1EWVA 1C0WA 1WWXA 1WETA 2K4JA 3GLXA 1L0OC 4OINF 1XGMA 2RDMA 2EB7A 1GCAA 4EUKA 1NXPA 2AXLA 3RIRA 4IVNA 1BC7C 1HW5A 9ABPA 2PMCA 1HXDA 1F51E 1BDIA 1GVJA 4G0MA 4M71A 3R60A 5JVTA 3HZHA 4YFNF 1TMYA 1D3YA 3WU0A 3G73A 4GPAA 2Q8KA 2IA1A 4YG2F 3A10A 4UUVA 4EGSA 2IPAB 3MQ0A 1SXHA 4MAAA 3H75A 3SM9A 2HQBA 4O3MA 1LDJA 3FFWA 4P9UA 2FEZA 1DBWA 1M5TA 3C18A 4OLAA 2JVIA 1BJAA 3CHYA 2B1JA 5PNTA 3Q9VA 3Q9SA 2EV5A 3LKVA 3E3MA 3W6KB 5HDNA 1S7AA 1DCFA 4M74A 3T8RA 5FWYB 2BBYA 4G6QA 1XWWA 2CD7A
chains in the Genus database with same CATH superfamily
2ZUBA 3IR6A 4GXTA 4L5BA 1K27A 3TQHA 2FX3A 3SEAA 3RBZA 3PGXA 1G9XA 2E2IJ 4YIIA 1SXGA 4ER7A 1YGYA 4N7BA 2M4GA 1KEVA 3WLNA 2V7VA 3AR6A 4RD3A 2GLUA 2A0KA 4N7JA 2WAEA 1EFCA 2ZVJA 3VGPA 4DJAA 2FR8C 3HRSA 1ORDA 3E3NA 4EBBA 1BDHA 4Q4JB 3HLKA 4B5LA 1OY1A 4OIFA 1SRQA 1GN9A 4Y9TA 5CB8A 3Q8MA 2CHQA 1ZM4A 4K28A 1KJYA 2FNPA 1DHRA 2QS9A 3T7CA 1V8PA 5DM2A 1K6OA 2B4KA 2NTYC 5F1KA 1YHZA 4D99A 1H4SA 4LHEA 1KERA 1ZH4A 2EEPA 5IT5A 2ZRKA 2HWUA 3BTUA 1BDMA 4M7WA 2R7UA 3T52A 2WE7A 2YIVX 1M2KA 2LP0A 2B4RO 4ER6A 4R1SA 4JR0A 4E4HA 2CUZA 4YAKA 5JMOA 3PLAE 2B98A 1IBMB 2I4MA 3WHCA 5CB4B 4FT4A 4BQEA 2BGWA 4UOZA 3O6BB 5BW4A 3HB5X 2DR0A 3LW8A 2QMYA 4BLUA 1RYHA 4CV2A 2OV6A 4RZ3A 5GADl 2IHJA 1NVMB 1UPAA 4W5TA 1H2EA 5BMZA 3AR7A 3MLAA 2DFPA 5JVDB 3A9WA 4MWCA 4UV9A 1DS6A 3P9CA 4GSYA 4RGQA 1CUSA 5C8YF 4M8NE 1XCMA 4Q9JA 1EKEA 1NUUA 1VP9A 2ZRBA 4L3VA 5EKDA 3ROKA 3KXDA 1YFHA 1PGJA 2OWDA 2ZP1A 3HNPA 4KDCA 3WHBA 1TC1A 4E7JA 4ZEOA 1BRMA 2FSIA 4ZGGA 4HYYA 2O6LA 4DCPA 2EFHB 5FO1A 2QEXI 1QRRA 3Q4GA 4GL4A 1QHHB 1T33A 3DR3A 1VGRA 3AJ8A 1Z1DA 1D2MA 3O4VA 4PQRA 4DNPA 4NF2A 3FSGD 1KP9A 1F9EA 1K2VN 3TW0A 2HCFA 2I22A 2RHDA 5E6RB 4Q9LA 3AINA 1T4BA 3U9SA 2BEWB 3K10A 3WO1A 1F3OA 3ZKWB 4OL9A 4X1OA 1IH8A 3LHFA 4NCKA 4CCMA 4HNGA 1FDUA 3T61A 4PZYA 1RVV1 3RJPA 3S44A 3X0DA 3K1JA 2XB8A 1CEQA 1XEFA 3CCRI 1BR2A 2MR5A 3ER8A 2O8FA 5JADA 2YRXA 4F91B 1XF9A 1GPH1 2DFLA 3AUSA 1Q12A 3UENA 1XN1A 5C1OA 2IKQA 1U9YA 4QL3A 3PIRA 1DRVA 4DIQA 2VDWB 4IXNA 5DX8A 3BSFA 4QX6A 1AS0A 3K2QA 1BS1A 1Q1EA 4DUGA 2QYSA 1XZEA 2LNDA 4NCJA 1QE3A 5DBGA 5HS9A 3P9XA 4D9MA 3HADA 3BN3A 3ZHBA 4XB1A 2CYBA 1AKRA 4TTVA 5JSQA 4EW2A 3QWAA 3FYHA 2G9VA 1D4OA 2GJKA 3GVAA 2X58A 1O3QA 4NXNB 1PI3A 2RN7A 1FS5A 3VGJA 4GX1A 5FBHA 4I5IA 5K5EA 4I55F 4PZDA 1C29B 5ALGA 1KRWA 4R9SA 4EGZA 3OJFA 4ILEA 4YR9A 3UYKA 3A0BC 2I3DA 3IH5A 3ESAA 1QORA 1IN5A 4IFEA 2ODBA 2BHSA 2W0SA 1O6BA 4J43A 2HVRA 2EKLA 1QR6A 4KN6A 3QU3A 3I2IA 5JQGF 3WNDA 1G7SA 4LYGA 3OO1A 2PX6A 3UTDA 1BW6A 3GAAA 4H7EA 4CICA 5AK0A 3S6JA 4PLPA 1T5HX 5TY0A 4WZ6A 1X7GA 1PJ8A 4Y3OA 1U04A 3W5VA 4LG0B 3BICA 5EE9A 2DBQA 4B7CA 3DTNA 3SKYA 5D5PA 3FWPA 4TWRA 4M7OA 2DBYA 2DPYA 4M1TA 1W76A 4JDUA 4WZBA 3SOZA 1GPYA 3BKXA 5FI1B 3EPRA 5ESWA 1GQYA 3CN7A 4ITRC 3R7AA 5A3JA 2PVPA 1RQRA 2L9VA 4D4MA 5IY5H 2YKGA 4NQWB 4E70A 4PYRA 1ZAKA 1MIOA 2XR1A 3IAS6 4RAYA 2KJCA 5M29A 1I1NA 1L2TA 5JLAA 4Z4GA 2V45A 1H6AA 1ADGA 2HJGA 2ANBA 2HA2A 3DD1A 2HJRA 2K87A 5I7EA 3BQYA 2W83A 5ENZA 2LUOA 3NHPA 4QHTA 1QYVA 4EM0B 4QUAA 3WO0A 4WKBA 4G97A 4BRUA 4HMPA 1NBEA 4NC7A 2Z8XA 3PDIB 1Z21A 3EVCA 3RJMA 3OFSA 4XX0A 3KZOA 4XWAA 4R8MA 2PXXA 3DVLA 1Y1TA 3LM8A 3D6MA 1M0EA 3WSTA 3OPVA 2A1TR 1FRQA 1UC9A 1Q14A 3V2UA 4GMGA 1LJ8A 3F0TA 4MKZA 2XT6A 1HC8A 2JUGA 2JD1A 4B6EA 1VI5A 3EXHC 1T5LA 1E1KA 3SHWA 2QLTA 2JRTA 3RRMA 3OJWA 1Y81A 3F8BA 4LOLA 3GEZA 5KWVA 2C95A 4OHRA 3GMDA 1GAJA 3I9V6 3EIHA 5KTSA 4ZTFA 2AN5A 2OGTA 3BFPA 1L5LA 1JFVA 1IRGA 5KOHB 1F5TA 3VX3A 2PT7A 3ZD7A 4ND3A 2WT4A 3LDAA 1ZK3A 2D5AA 2DKNA 3Q1LA 1NZDA 3B6IA 3RIGA 1B0AA 4UKDA 3RLFA 2YZ2A 3JRNA 3OCJA 3IV7A 2QRVA 1DIOB 3HYTA 4HEA2 1GD1O 4L07A 2QMOA 4QXMA 1Z47A 4WOBA 4BASA 1SXJC 1JS1X 3H4TA 1UBOS 3AVXA 4M49A 3G0CA 2QQ0A 1W52X 1XMPA 3KVRA 2GO7A 2FMYA 1N3BA 3TW8A 4S1PA 2BN4A 2A1IA 4UQOA 1SUPA 2HEOA 3EQZA 4HVCA 3EPLA 3E3OA 5CAEB 2YIDA 2IKSA 4YP6A 4WADA 2GBLA 3I4LA 1M6VA 2V26A 3IT3A 4RE5A 1BYIA 4RC9A 3GEDA 3FDZA 2ODQA 5L3EA 1FB5A 1H4VB 1VQ8I 4M8LA 3CQ9A 4LJZF 3GXBA 1TFRA 3RDPA 3HOZJ 1NP6A 1Q0QA 2G4CA 1PYVA 1IUNA 4TMZA 4A0GA 1TCBA 2C3UA 3ZN1A 4E11A 4JI4B 4G0ZA 2HQ1A 4KV7A 1IZ8A 4WLEA 2RGAA 1CDEA 2FY8A 4RMHA 5GGXA 4RFLA 2CFTA 3WK5A 1VJ5A 2JIZA 3TUZC 4MI6A 1P4XA 3M6MD 2O3JA 1A31A 3NRJA 1Y39A 1HTBA 5IDXA 4HB4A 4CT0A 4QVKA 1GAXA 2ZZMA 2F55A 1IGNA 4TS1A 3CJNA 2K4BA 5BMOA 1NASA 4X1KA 3WTBA 1ZW6A 1PK7A 4RB3C 4YRRA 2FUG6 3P0JA 3WLKX 2XGCA 4FE4A 5CA1B 2CV2A 3DHWC 5T6MA 5E6SB 4DREA 3S1SA 1Y80A 4C3OB 4GZ6A 4HLYA 3TCXB 2IGNA 4KMRA 4ARCA 4M55A 4BO2A 4WFQA 1OYVA 3KYBA 4ZAVA 1QCCA 3L3BA 3PXCX 2R8OA 1P2DA 3AVTA 2M4KA 2G1JA 4AROA 3WIUA 2HTFA 1V8BA 1Z5WA 4BMNA 2EV6A 1IXCA 3GUHA 3TLKA 5IDVA 1A98A 3K71B 4RKEA 4L9AA 3YASA 4MMXB 1X14A 4ZO8A 4EGFA 4WXMA 1NG7A 4H1WA 2YWFA 1L3CA 4EG0A 3C6ZA 2P5TB 4QU0A 3NJRA 1QKJA 1NMSA 2XB0X 1AB5A 1WEHA 1P19A 2VQLA 5JLWA 5KQGA 1OZFA 2NZWA 3WGLA 4C03A 2H4HA 3U13A 2WTEA 2FB9A 1MUUA 4D8WA 3F6CA 1FP1D 4S2EA 1JTXA 2HRCA 4RVOA 1LPMA 5DDGA 1G3UA 5LYJF 1BQ4A 2QZPA 3EEOA 3VKHA 1ZAYA 2JUCA 2Z9CA 2X3UA 3Q9LA 1T0HB 2MABA 5DBFA 1RRFA 2M6SA 1MG0A 2JHCA 4KCGA 3PL1A 5EEGA 2IYAA 2EBUA 5AKXA 1RI3A 3Q6MA 4TUYB 4IIXA 4OOIA 3WMWA 4PSDA 5FI5A 4AP9A 5C8YA 3H3ZA 1OZGA 2HCJB 2VHQA 4B85A 4RACA 4DSNA 2D2FA 3F7TA 3QM1A 3TVYA 2XE4A 1ANKA 1DSSG 1Q1HA 3UJHA 3M1IA 1ZOPA 1Q1ZA 4TKLA 4RY2A 4KFCA 1FVFA 3CF2A 2AEMA 4FHTA 5CNKA 5C44J 5D86A 2XXBA 4KVGA 3TL2A 4CKWA 2NVQJ 3FHJA 3KKPA 3LIPA 4GLJA 3QE4A 3FSEA 3ZZTA 5IW8A 5H59A 2VHXA 4TV8F 1DO8A 1JIUA 5IP6A 1HDOA 1IN6A 4B32A 1X1DA 2WAYA 2E4WA 4UBLA 2L17A 1ZH6A 1ID8A 4MV3A 3HR7A 1QPMA 3FD8A 5AVWA 3I6QA 2ISZA 4TT8A 4OHCA 3F5QA 1Z7BA 2H9IA 4KO3S 1MZPA 5CW2A 2FX2A 4ZJUA 3R0VA 3BOQA 2X1HA 3RFTA 5A2GA 5JSFA 1WS6A 2VP3A 5AW5A 4Y2QA 3VR6H 1NRWA 3QQPA 4XFJA 1ENHA 3UT5B 1J8DA 5JWOA 1M6EX 3TO9A 2YUSA 3AZOA 1LCIA 4FCWA 2B21A 3OOHA 3QPVA 4EP1A 3LUFA 1YW7A 1SCKA 1XXHA 3DGFC 5CBPA 3M9LA 2I6SA 6REQA 5G40A 3TD9A 1HORA 1QU3A 1AKWA 4CMAA 1PSZA 1UKYA 4LJ7A 4JL6A 1ZUNA 3TQFA 1CRQA 1GLVA 2WF6A 2CXTA 3G1WA 4PSUA 2FJ0A 2UUZA 5KBYA 5FKMA 1AA6A 3TQCA 4ZVVA 5HK8A 1DWQA 1YKSA 3OX4A 2G1KA 2K3PA 3OUTA 3C3WA 5IYDJ 3AUYA 1K08A 1PBNA 1GGEA 1NLYA 2KHZA 1XRMA 2V9CA 5BQTA 1GKYA 2G4VA 3I39X 4UCXA 2ATIA 2ZDHA 4LY9A 3ZNQA 2VN2A 1J5YA 2QZ9A 2DMUA 3MYRA 1NI3A 1SKMA 3RBVA 1OAOA 4ZDLA 2EILH 5DHFA 2R4TA 1E3SA 1B43A 4HDNA 1KWKA 4CMEA 2FQ4A 3BIFA 3A6DA 3IEPA 1OXBB 2E5NA 2ZIEA 1QFMA 1NKTA 4URFA 3I5AA 4QXRA 2QQAA 3TXYA 4KWCA 2P3SA 1SJ9A 2LKPA 4MVJM 4DLNA 1ZQ1A 3OA2A 3OZ7A 5A0VA 4BU2A 1WABA 4EPWA 2WMNB 2H8KA 5ALQA 3MTDA 2GXBA 4QTUB 5FT9A 2QTMA 3CCJI 1PJAA 3QG5A 3KP1A 1HH4A 3G8AA 1FJ2A 1B3BA 1KWGA 4MA4A 1ADCA 2D5BA 5AKLA 2Q29A 2C4TA 1LTQA 2Q4BA 3FCYA 5J2TB 4YRZA 3DWGA 2O23A 4BFLA 3OYKA 3I2GA 2EINH 2J0UA 3QXCA 4FYMA 4DTIA 3TKLA 2JBHA 3CLRD 3G2QA 3M7GA 4PSWA 4GI5A 1L5ZA 1FXSA 2Q3DA 4XVUA 1EEHA 3E7FA 1U9JA 3I05A 1YFJA 4DA6A 2VBWA 1D1QA 4OB6A 2ZSHB 1SHLA 2ZJ1A 5IZ4A 3GZJA 2KLOA 3JQ9A 4RGVA 5GZ1A 3AFIA 4IVRA 1DLJA 1R4NA 4K88A 1UFOA 1LBIA 2J3EA 4JVLA 3G2OA 4FNOA 1OREA 4OHWA 2L19A 3RRJA 1RQ7A 4QUGA 4IHXA 5I8WA 5B58C 5EWMA 3V8LA 2D45A 5DLYA 3O3OB 3Q3SA 3E9MA 1CX9B 2FQXA 2E19A 4JHLA 1HSZA 1GOTA 4G7ZF 1ZK8A 3UWPA 2W25A 2NAFA 5EHIA 2E4UA 3MB5A 3ZY3A 4HUJA 2PSEA 2YXBA 2C1ZA 4PANA 4L22A 5LMCA 3JZMA 1BOAA 4BCBA 5KKAA 3E5QA 2HMAA 3C4JA 3EH2A 2H29A 3GBPA 4UHJA 2DZDA 2VP2A 2C4UA 4EMUA 3RU9A 3A9VA 1ZIOA 3K1YA 4IGAA 1NSYA 4HL6A 4I9FA 3HY6A 1O58A 2QHXA 4HDOB 1ZRCA 2GBLC 2GQ0A 3QF4A 2CY0A 3ZGOA 4MS4A 2WMYA 1JR4A 4JS0A 4V1CI 2ZYIA 3A03A 1JBKA 3HCNA 3RSSA 2DT6A 5KS2A 2BGCA 5B5SA 2PL5A 1E9RA 4ZT7A 2DP4E 4KPGA 1YHYA 3UMBA 1QP8A 1E7YA 2AOUA 2J45A 5IKPA 3HDTA 5E6UB 3V1NA 3AB8A 1VMKA 1OH8A 2BTQA 3FIWA 3O0DA 4FD2A 4XBFA 1LDMA 4D6XA 1Q1BA 3DKVA 5CDTA 2DAOA 3WYDA 2IHUA 5J4KA 1HKSA 2LH9A 2ODAA 1U3DA 2II6A 5HM8A 4LW8A 2ZIUB 1C3OA 3SGLA 2QZJA 1LSSA 2GAUA 3K9TA 2EWNA 3KJGA 2QSYA 5MN5A 4IQGA 7REQB 2FUG2 4R05A 3SP1A 2VKTA 1RRMA 3HVHA 1HWYA 1YQUA 4N0PA 2PMZN 4X84A 4DXHA 2QZ8A 1B6RA 5MGNA 3I0NA 4AVPA 3ZD8A 3SIWA 1R8XA 3TO7A 1DXQA 1VQ9I 2ADOA 5LWHA 1JVSA 4ISBA 4A0SA 1GPJA 3GJYA 4U7WA 1FFHA 1ZYRF 1AKEA 5EWLA 5BWLA 2AC4A 4JU9A 4UOQA 5IP9J 3SJUA 2EQAA 5IVIA 1VYVA 1LA2A 2RGEA 4MGEA 1EUDB 3ZP5A 2ECFA 1UM9A 3GJXC 4GLOA 1YS1X 3UAXA 5TSDA 4H7PA 1VHJA 4YUXA 1GFSA 1T0IA 3NAUA 1RLUA 5JY6A 3FX3A 3H83A 2XB5A 2ONJA 1T13A 1PCXA 3QG1A 1U6IA 4E32A 1U3EM 3U1TA 4Y2VA 3OKFA 1FE8A 1H1DA 5LP1A 1G1AA 1VLVA 2E4YA 1NF2A 1BD3A 1UMKA 2ONCA 3Q40A 3PEVA 4X7MA 4GPBA 2IWHA 2WFLA 4HN2A 4H3VA 3HXOA 4HF0A 1VPEA 4B3AA 4AY2A 1GZ7A 4MITA 2GN1A 3NH9A 5J2UF 5JANA 5JJCA 4U6QA 2KI5A 4DCUA 3FISA 4POOA 1VBFA 2JGFA 2TMYA 2Y66A 1JIXA 1D2GA 3A6LA 2BY2A 5KPJA 3H5OA 5TEVA 1QLJA 4F92B 2P9CA 2GD6A 5MFPA 1FYMA 1H0HA 3LHDA 5BVHA 4NU5A 5B2FA 3MJTA 2R5FA 2O07A 1X4OA 4QRDA 5KVRA 2CN1A 5TS2A 1E6WA 3N8GA 3P2OA 2GXSA 2WKRA 5LOVB 5E8GA 1QQIA 4EL5A 2NS7A 2P9YA 3H3VK 3UKOA 1TPZA 5K3FA 1Q6ZA 2HDOA 5K8CA 3S1AA 4YWHA 4JEUA 4HGYA 4I09A 3RASA 2XJ9A 1KSFX 4FOTA 2VF4X 5EUMA 2OWEA 2P68A 1P0PA 1OR7A 3QU7A 3M4JA 3S3NA 3OYLA 3R3XA 4H4DA 3AC0A 4WY8A 1YVPA 5H68A 3RTAA 3FKQA 3JQ8B 1W4BA 2B82A 2QTWB 1R5BA 2B83A 3TBHA 3V46A 1BR4A 1LJUA 1JG7A 3DWLE 1MKYA 1E9FA 4AMBA 2RHRA 2R60A 3R3ZA 4UHDA 5M3BA 4O5OA 3G88A 2IRFG 1TVEA 1JDUA 2J5QA 1QAQA 3PSFA 2Q5EA 2CLIB 1NXPA 1TCCA 2PMZA 4CYCA 4G0MA 1OXVA 2XLBA 3DDCA 2Q8KA 4JITA 3COZA 3HXKA 3A10A 1YA6A 3CCBA 2ZJ8A 3LECA 2HQBA 5ADHA 3OECA 3QEBZ 3C18A 2JVIA 4Q3CA 3Q9VA 3B9BA 2EV5A 4WNAA 2K9LA 3B1KA 1DJNA 3V4OA 2ECQA 2EHJA 3PPWA 4MJ7A 4LXYA 4KPEC 4RPHA 4Q03A 3ZQIA 3EAQA 1E7MA 4TSRA 1VHTA 4PFJA 3I6YA 1Y6FA 3VV3A 2PRZA 1F7UA 2WWXA 3HG9A 3IJ5A 4MWEA 2C9DA 5L4LA 4MWSA 1KBOA 2ZWOA 1N36B 2HYJA 1AG9A 3EIUA 3HDJA 4I9NA 2OK7A 2BMDA 1V7CA 5HBRA 5F23A 1LLCA 3QI2A 3HJHA 2AQHA 4HDCA 2R8BA 2Q2VA 1T91A 5JNRA 3OZXA 1FTWA 1ND6A 3NIBA 4ENJA 3A1WA 4FWIB 2X0EA 3CD6I 2XVAA 2XUAA 4E7PA 3KE2A 3CT6A 5JAUA 4KXXA 2LBPA 5CT4A 1XTQA 1W29A 2G7ZA 1A97A 1A7JA 2X0JA 3O83A 1OAOC 5IXYA 2IJGX 4RETA 5B3SH 1GRRA 1CY4A 1S2NA 3L7KA 4CMEC 3ZW8A 3LCCA 1SZDA 1FA9A 2CW7A 1H8AC 3QSGA 2W6IA 3KVOA 2D13A 3QU4A 1USGA 4UVGA 4XM0A 3SJBA 3ZWWA 3L6RA 4E5DA 2OV1A 4ZI2A 2W6ID 5A4KA 2PZFA 2IPQX 2AFRA 3R5XA 3UIEA 2FBHA 4CR6A 1DQNA 1IEWA 3ICVA 4CLOA 1U90A 3SNKA 1N2BA 5A0FA 1VRCA 4ONEA 5BNWA 1DRKA 4JUFA 2O59A 3SYTA 2F8LA 4XVRA 4AURA 1A69A 1DJOA 3PHBE 2M34A 3JQBA 4RXMA 3CW8X 5B7QA 5C31A 2ZAGA 1E4YA 2AQKA 2VC2B 3HHEA 1CUXA 3WLLA 1P39A 5HR5A 5T64A 4BH9A 1BIFA 4FN4A 3R7FA 2ZIAA 4K8RB 2QAGA 2FZ5A 3PUFA 2VLBA 4OKSA 4QAQA 4CEIB 3OYIA 3ORQA 1UP4A 3G5TA 4PLHA 2BHZA 1JHQA 3EDYA 3EQ2A 3DBLA 1F2UA 5L3RA 4MS1A 1OLSA 3JQ9C 4DM7A 4UVIA 3CE6A 1C4XA 5MN6A 4Y52J 1MO5A 3THXB 5HM6A 1YVRA 4OXNA 5LMZA 3NHFA 3UB2A 1UODA 2M0CA 5EKXA 2QRKA 1T34A 5E3IA 4ZEXA 3ESXA 2ZE6A 4LX8A 4V0LA 5HS7A 5AK6A 2PBIA 1HGXA 3FWEA 2YYYA 3OCWA 1G2IA 3WTUC 3N2EA 4JT8A 2XF8A 1TM5E 3W6JB 1QVRA 1ZNZA 1F6BA 4PO8A 4C4YA 2A1TS 2M2IA 5EMHA 4IIJB 3DP7A 4E7OA 2QBYB 2R5ZB 5KOJB 1QC5A 5AKGA 3KT6A 3Q15C 2EA4A 2NOGA 4G24A 4Z7NB 1NJ5A 2B8TA 3E03A 1YZQA 2Y75A 4MGHA 2ECKA 4BEVA 2WNSA 1ZUIA 5IRCD 9GPBA 1IZ1A 3QUCA 3WHLA 1FBTA 1IBKB 4IIGA 1G18A 2A5WA 4YWJA 1ZH0A 3FZEA 2BT4A 5IAAA 4M54A 4YDSA 2P6TA 2JGRA 3FUTA 3NBZC 3DUWA 4LSWA 3FUWA 2Q5IA 3C3EA 3FVTA 4MDHA 3AVQA 2YDXA 2F6CA 3AZPA 4E5UA 5SZJA 4LXHA 2ZJPF 3FPGA 3X2EA 2XA2A 3MN1A 1Z35A 2KL4A 4L5JA 4XN0A 1EUYA 1XGOA 2R8XA 2PTGA 3LSMA 3LT5A 2VJ5A 4X6LA 4OI0A 4BE0A 1RKTA 2QENA 3TVTA 3O26A 4FGUA 4CN9A 1RXYA 1GQFA 2PUCA 4M46A 4LA4A 5DBIA 3KJFA 4V0QA 1MZVA 4NMWA 2C00A 1A5ZA 1RPZA 1OVMA 1L4MA 2J3LA 3V2IA 3UJNA 3IAM1 3GLFA 2WHRA 5KHLB 5LM3A 4O4HF 3D3KA 3P5JA 5FDFA 3S2GA 2QUAA 3ZHCA 3F8MA 2PUHA 4QHSA 1V5FA 2ZBFA 1OUMA 4MUKA 3F2VA 5B6PA 2VPZA 3WRVA 2JBWA 3DV0A 1FW8A 3OYEA 4JX4A 3WL6A 3CUYA 3IA7A 4JBLA 1P5JA 1M8JA 1IMJA 2QD1A 4HPWA 2A0UA 2C9CA 5D85A 4W8HA 5ALMA 4CCNA 4JI8B 4GUDA 3KG2A 3C5VA 5DLPA 3IDQA 1U3GA 1MJ5A 2BEUA 2Q0QA 3H2SA 1OIVA 3HKCB 1H4TA 4JQFA 4Q9AA 3CZAA 3LX4A 2GNPA 2Y4OA 2IL1A 3B9PA 3DMPA 3PNKA 3H0KA 1KRXA 2Y1CA 4E08A 5IDWA 3VVBA 3C0KA 1EUCA 4GWKA 3K1MA 3FWNA 4ZRNA 2F8MA 1VE5A 4A2UA 3FBIB 3VC3A 1DEAA 1KYWA 2RC5A 3FUXA 3NBFA 1NMEA 3D5QA 1WXFA 2WSSA 3Q12A 1BAPA 1MB3A 5EHNA 2VDUE 1DJPA 4BO5A 1NOKA 2WSSD 4J9VA 1Z36A 5JD6A 3D6AA 4MI9A 2ZSIB 3RNOA 3A8TA 3H2GA 3V1UA 3CQZJ 4KH1A 5J2UA 3PHHA 1BDJA 1PZFA 1N9GA 1KSJA 1G8HA 4QXQA 4QARA 1QRUA 1HDYA 3NNDA 1FFYA 4N65A 4EGCB 2JN6A 1V7QA 1GG2A 3ZEIA 3H87A 5JD5A 5FLYA 3AEYA 2BBTA 1OBCA 1Y8RB 2BY4A 1N5LA 1V11B 1ETUA 1CDDA 1L1EA 2W6CX 2V6BA 3DEKA 1PJBA 4A8JB 1UQTA 1G7TA 4DOZA 4HS9A 3OIGA 4O33A 1TK3A 4LGMA 2ZITA 3FLAA 5DNCA 1BI3A 4WKOA 4YJFB 1W9MA 1TPYA 2VH5R 3TOXA 1JE1A 2QG4A 3HV2A 3INTA 5E0OA 2CE7A 3B52X 1NF3A 2R1TB 3G2KA 3L7LA 1I36A 1ZUHA 2XADA 3ZE2B 4CM6A 1CF7A 3O8LA 1ULYA 2WJ3A 4N0DA 3TAHA 1D2NA 2ASVA 3E5MA 5H3CA 4AJIA 3BGIA 2QLZA 1OR7C 3RSNA 2OHXA 3X1DA 3DM9B 3ZMDA 4RBNA 2P9JA 1Z82A 2HI3A 1FX0B 4QU5A 5I7UA 1JTVA 5EQFA 1G5IA 1EFKA 1TQ4A 4Z49A 5BT9A 4ETSA 3OL4A 2FDXA 3KZYA 5BURA 1UC4B 2GFIA 1P5RA 5AXCA 4E12A 2MTBA 2EFYA 1AN9A 1X3LA 1WH5A 4KMFA 3CW2A 2EBHX 3HI6A 1XK7A 4C6RA 2JLVA 5HJEA 3IOYA 3D2CA 2PNFA 4OFZA 1R64A 1LRKA 2D3TA 3K9GA 2JJMA 3DE5X 4LJ9A 5IVDA 2R1ZA 3WU1B 4KDFA 1UBRS 1K0UA 3R9XB 3KHUA 1JN0A 1H2RS 1Z6RA 5E9WA 1PTKA 3JRHA 4C3IJ 1QUFA 2G17A 1O6CA 2L2OA 1JUPA 1DDGA 3WYAA 1NBME 3WLQA 4ZZDA 2CW5A 2I55A 4OD0A 1NF9A 3HKZN 3AG6A 3DNPA 1V9CA 1USIA 3OX1A 3NT2A 3WHKA 1YJNI 5M3MJ 3RAFC 4IJVA 3UUFA 4FMDF 4BXOA 4I7HA 5JAHA 1NW8A 3S5JA 3HB0A 1WSBA 1XWFA 2ZUWA 1C41A 3MTEA 4GYWA 4AZ0A 4BUJA 2H7YA 3U5TA 1VZ3A 2I62A 1K06A 1ISIA 1NVDA 4MFEA 2DA7A 1YZHA 3SG0A 1LZLA 4D25A 2M1ZA 3N6RA 3LA3A 4GM0A 2SECE 5JWHA 1FLNA 3NO4A 4N48A 3U1DA 2JA6J 1JIVA 1SC6A 4MRPA 1R7RA 1FUEA 2I7VA 1F2TA 4WK4B 1UELB 4P96A 1FUUA 3GRZA 4MEBA 3FGOA 5E3HA 5BY2A 5BNTA 1ADBA 2CVPA 3PE6A 5B53A 2OXEA 1D5CA 1IL0A 2RH4A 4RWZA 2QMQA 3RT7A 3VR3A 4B3CA 3AHIA 4MIYA 3MKZA 3M6VA 1OCRH 3C7DB 1WBJB 1M66A 3MW8A 3AWIA 2AW3A 4ETNA 5IJAA 2V6JA 1MORA 4ADSG 2PD6A 2NX2A 3C6BA 2AJDA 3NC4A 2P0YA 3HYCA 2Z1NA 2DUMA 3LSKA 2XTMA 1XVUA 3T7TA 1JALA 4YUAA 3FYSA 3HBMA 5HCUA 5H6QA 2O14A 1PR3A 2IYEA 3CXRA 2ZTSA 2WLTA 2ZQYA 3KYCB 3MCUA 3CISA 1QHNA 3L6CA 5I5GA 2OCAA 5ALNA 4LE2A 3JQBC 3QGMA 4H60A 1UJ2A 3OH8A 2X3FA 1WI3A 5K6AA 4FK8A 4O4JA 2OYCA 3ZE6A 4UJ5A 5GPAA 3KQTA 5HMMA 3AETB 5BPHA 4DMRA 1QANA 3G2PA 3VSEA 2QAGC 1P7CA 3EYWA 2B7LA 2DA4A 4UUSB 5F35A 5IT3A 1GCIA 4I6ZA 2AHQA 5HS6A 4LY3A 2WJWA 5AQEA 4HZGA 1HKTA 1N2CE 4RTQA 4Q21A 1PJZA 4R16A 3KOXA 4LPSA 4QWMA 1HZJA 4Q82A 4HTFB 1OV6A 3M4ZA 3PWKA 2X14A 2XCTB 4F93B 4R83A 3A1YA 4RNCA 4OHXA 1BFKA 2CXSA 2K27A 3VEPA 4CMKA 2JD2A 4NE7A 3MWYW 2VRWA 4R7ZA 1WCIB 3ZQ4A 2EG9A 5LKRA 4X62B 3MGKA 4Q4HA 2I1VB 1F2VA 4M8SA 3QOWA 1G41A 2RAPA 3A37A 2I1LA 5BN5B 4LXGA 2FMLA 3D81A 4HCJA 3WLEA 2O5VA 1IVNA 5KNCA 4UHBA 4HSGA 2PZEA 4V0ME 3E6AA 4PJMA 1JF8A 1G38A 1CUYA 4BFVA 3JD3A 3J81Z 2BKAA 2R44A 2C94A 2JBAA 2Z1DA 1RFGE 4Y2YA 5DI9A 4HEA6 4MWGA 5IP5A 4ARZB 3ZQHA 2QV0A 4O3FA 3HJAA 1BE6A 2PJUA 3BWMA 4X64B 5BT8A 5KWIA 1N7HA 2XRMA 4RKQA 3D4NA 4OHKA 4FFBA 3BA6A 1LK7A 2OXTA 5KTYA 3RREA 3K9LA 4PBSA 1Z38A 4HN4B 5EIHA 3DFZA 1P3DA 5EIEA 2B9VA 2CVFA 4JLDA 2NQ8A 5FUVA 3LWNA 1J00A 5KUTA 1OW3B 1A88A 1BCSA 4FJ2A 4WXCA 2XF2A 3JRCA 4IPTA 3UTCA 1C8KA 1XKLA 3AL0C 3EZNA 4H35A 4AZ3B 1YDMA 4A0QA 4C22A 4JCOA 5FQOA 4G26A 2DWOA 1BXRA 1R0KA 3OSZA 3BYZA 1GCOA 5DV9A 2DPGA 4M99A 1TM2A 1YX3A 2O2CA 4Q1AA 2LOOA 1VHLA 2JZYA 4P81A 1WCV1 4KBGA 1XLVA 4PTZA 2IT1A 1Z63A 1S89A 2GPBA 4O4HA 2FFAA 1U9ZA 3EQLF 3AHGA 4DILA 2XUPA 1N9ZA 1K2WA 3O31A 4DIDA 2C29D 1LWOA 4MGYR 3IODA 3D0KA 2DUUA 4UV8A 2B36A 2R65A 4H7FA 4NY1A 4EDFA 3UCXA 4F3QA 1G6Q1 4QLOA 1C7EA 2OG1A 5CA0F 1Q19A 1ZI9A 5KK1A 2P2CA 3TPCA 3EVZA 4AIDA 2AKAB 4J0HA 1K3FA 3D54D 1YI0A 3NDPA 1ZBDA 1F60A 2MMGA 3WLRA 3ACDA 4DPLA 4TYYA 3UOWA 2Q5FA 3A9UA 4ZYZA 3TECE 4E7ZA 1VLJA 3LRXA 1O3RA 1JLSA 1ZH8A 2DSNA 1WU8A 1U8ZA 1XMAA 1N5IA 1FU4A 2P9BA 5B58T 3LA7A 4DXAA 1YVDA 5LDGA 4CTJA 3VZRA 1L0BA 1TGYA 1PGNA 5UKDA 1J0EA 5KHOC 4E2ZA 4RA9A 4CT4B 3GX4X 1XRLA 1LFPA 1RXWA 2HDCA 4C0BA 1KK2A 1TK2A 4YDRA 2HB6A 2YOHA 4INJA 2B8WA 5HUJA 4J19A 4D9EA 2FFHA 2MSYA 1HW2A 3D4LA 3ZE1B 2Z09A 3LCUA 2BV6A 1HSTA 3RBAA 1E2FA 1ODCA 4FEYA 3UH0A 3VVLA 1Q7EA 3LT1A 2VSYA 1F1JA 4C3JJ 3FTEA 2OSVA 2HX1A 1FJGB 3L06A 3UA3A 1ISPA 1ITZA 3IXQA 4EG6A 1EB8A 1BA3A 1C9KA 2P9QA 4MKFA 5LLSA 3Q7RA 5INTA 2XYPA 1US8B 5IJ9B 2Y68A 3DAOA 3PITA 4I3GA 1SQFA 3OLYA 1DPFA 2LREA 1JG2A 2P6UA 3GLLA 3OX2A 2PKYX 1U8FO 2QKMB 1ZCAA 2ECBA 2Y92A 3ZS9A 1SBZA 3Q7EA 4KR0A 2IV3A 2C99A 1T08B 3TNYA 2BHNA 3FVQA 2IOQA 2VJDA 1JXOA 1M73E 3BMOA 1N2ZA 2G0EA 1B93A 2VDOB 1K6IA 2DO7A 4PLWA 4BECA 2DR2A 3IOMA 4G86A 2ZS7A 4MARA 4ENPA 3VZSA 2IZOA 2MGQA 2ZS8A 3PU6A 4ACBA 2HZBA 5DYYA 4CSWA 2RK6A 1DOHA 4R9RA 2OTJI 2RDPA 3NMUF 1RR6A 3SDZA 3G1MA 2OO5A 4YYZA 3BE8A 4LISA 1QAOA 1RMTA 4OYYA 4L28A 2GFQA 2E1NA 3NTVA 1OGYA 3HYLA 1D0YA 1DU4A 1IEXA 3ONDA 1NPTO 5LZ9A 1JI8A 4FFOA 3DEJA 1OAAA 4URYR 5HVNA 3V32A 2IUEA 4CUJA 1ATZA 2JI8A 2WM2A 3QSYA 4YMLA 1ETYA 1L6IA 1XQYA 5CJJA 3PR2B 1HLGA 4JBAA 2QGNA 5EJGA 2EWMA 1QZYA 3KFVA 4YCNA 5HJ5A 2BGJA 3RTBA 1Z0DA 1Y48E 2Z8YM 2O5CA 3K70B 2XKKA 2OYSA 2PX3A 2ZR7A 4ZYYA 2BEVA 5F77A 4K6KA 4CQLA 1SMKA 4FFSA 4LSZA 3VOEA 3H19A 2DBZA 2JJ7A 2WQ6A 3PDUA 2IZ0A 4EPXA 3D8NA 4XLCA 3AGQA 4DUGD 3IQXA 3WU2C 4BJ5A 2D7DA 2Y1GA 3OU7A 1NLFA 1QQ6A 4RAOA 4MJ3A 5F2NA 5CIYA 2FLKA 4BS9A 1QYWA 2VHJA 5FNZA 1UPCA 2WTAA 3BB1A 2C58A 4MV1A 2QTAA 1NNEA 2PMUA 2X42A 3KELA 1WZIA 2L4MA 3ONFA 4PCAA 3P5BA 4GX0A 5GAHJ 3ISTA 3HL0A 3V7UA 3I9KA 2X3YA 2QUFA 1Z67A 4G89A 1YJXA 2VSXA 5JAOA 4QNMA 1IPHA 1X39A 3VVMA 4D8YA 2VF8A 3O47A 1TO2E 3QIVA 2JZNA 3L9XA 3WK6A 3AFOA 2HU7A 3SBDA 3C39A 1NW3A 3LT2A 2HKXA 3ESQA 3UKGA 2K7FA 3K31A 2YZ7A 4L8YA 1VB3A 4WDQA 3KOZA 4PPQA 3IUYA 5L40A 1XZFA 3BR3A 2DHQA 2DOFA 1A95A 3UXHA 4WNYA 1YCDA 4BNJA 1TFUA 4L27A 4XSZF 1QVZA 2HU2A 2W2LA 3LAWA 1QRYA 2A9JA 2OCYC 3BZKA 1T3GA 2E6UX 2WICA 5DM4A 3V2HA 3UFBA 1PNQA 3LL7A 2W2LD 2HU5A 3BGWA 5K6AC 4BGDA 3PFKA 3OOJA 3EDPA 1Z2NX 3CNBA 4XM2A 5DZSA 4W9RA 2NO5A 3PUVA 5CFZA 2BGGA 3DONA 1U4SA 4QBTA 4UUMA 3IAXA 3EASA 3SF0A 1G2HA 1MRNA 4W6QA 3EDCA 1Y63A 3SX2A 1XEWY 1UBGA 1R8YA 2RHGB 3BK7A 2JA8J 2HNAA 3ZD9A 3OIWA 1V1RA 1PG5A 3AUXA 3WMRA 4ZC1A 3D6VA 5IKMA 1TWFJ 5KJFA 2R00A 4BVFA 3N8IA 2FZLA 3QVJA 2PDAA 3MTGA 1RAEA 4CH7A 2SNIE 3VSKA 2NSHA 2E9SA 1T0BA 5L7YA 1XBTA 4E4TA 2YN0A 1T56A 4HR7A 4MV7A 2G3YA 3RTEA 4GRIA 5H82A 2CL0X 3J81k 3ZCOA 1EZ4A 3I4FA 5CDUA 2XCUA 4BUCA 4L6IA 3D7KA 4EKDA 4MAAA 4M0MA 1WUIS 2K5UA 1MRZA 5JAIA 5IJ0B 2JAQA 5BV2P 5I7AA 5EMLA 4TZ6A 2X1EA 2HT6A 2XUFA 3U4GA 4X6YA 5FOTA 4RAFA 4M6VA 4WPGA 3NOXA 1OPRA 1QYRA 3ME5A 3PQJA 5EZGA 1DRJA 1YDEA 2GJ9A 5JARA 2HCTA 2PA0A 4MRNA 2P4WA 3ZVMA 4WMLA 2QYHA 3I32A 1ZG1A 3SFIA 2QXTA 4G01B 1L5OA 5JISA 3UZUA 1VI0A 3OI7A 4MS3B 4XR6A 4EPYA 4UVDA 4QVIA 2DW4A 5B37A 2HK7A 1DP3A 4H2DA 2Z5LA 5L3BA 2CWWA 5LDDC 1F6WA 1F14A 3KWLA 1YNOA 5FWAA 3FCSB 3BBPA 4BDTA 2A33A 2WKWA 2VQSA 2JIQA 4CU5A 4U7GA 2WYIA 5C5CA 2WADA 2PH1A 1E3WA 3VBCA 1TZMA 2GZRA 4MQUA 1SN7A 3KQOA 1KU9A 3NI2A 2FEPA 3GJ4A 4XFKA 4XIJA 1QGZA 3W90A 3I4NJ 1PFYA 2HJSA 3BWEA 3E7WA 3MUNA 3WGGA 3P9PA 1X15A 3RKSA 3QNMA 3ZGXA 3K1AB 5DEIA 2JIZD 2R7KA 3B7WA 1KGSA 4TTIA 5TMBA 1ZVJA 3WNBA 1W25A 5L3ZA 4OSPA 5CA0A 1YJ9I 3QZUA 3SOPA 4JYBA 4Z86A 1KF0A 3LUDA 4I9HA 1ETKA 3VA7A 3JY6A 3N0XA 2CFOA 3I5YA 3HOXJ 1QO0A 4QQ8A 2Y0CA 4V02A 4LE0A 3QKWA 4ZHQB 5JTTA 3AERB 1B8IA 2NO4A 2O8BB 4S1VA 1D4AA 4N5NA 3WJ1A 3E0QA 2A6EF 4L18B 4FX5A 3P9RA 3HDDA 3GFLA 5IBRA 2RSLA 1CDOA 1FY2A 2HFKA 2NU8A 5ALIA 3FOCA 1RKWA 3MK31 3KB2A 4C0HA 4LIPD 2RKOA 2J6HA 2BI8A 2I4RA 5LLQA 2ZE8A 2R7VA 4YMSA 3U1KA 3ITKA 2EX0A 2CV0A 3GW8A 1FFWA 4OJYA 2ZRLA 2AVNA 1E9VA 2V5UA 5JCJA 5BOSA 7AT1A 2Y1LA 1ERDA 2CKMA 3NNNA 3ZQQA 2NVUA 4R6WA 1P62B 4R3UC 5DISB 1DXOA 2C0PA 3FXMA 5JCJD 3ZDZB 1ONPA 2C4NA 4G6ZA 4NCXA 4P33A 3EX7C 2HJVA 2NT3A 2ACWA 4F04A 2NV6A 3BCAA 1IM8A 2RK3A 4B79A 4H4EA 2XZDA 2BFBA 2H18A 1E8DA 1SBYA 1GRQA 2JQ7A 3L8ZA 1SB9A 1EE1A 1CQTA 4OAQA 4O8CA 5KKNB 1Q6YA 3RGWS 4UUOA 3ECCA 4HRVA 4OJQA 5AIQA 1IONA 4MKRA 2Y1DA 1TKRA 1R6DA 2C20A 3GCZA 3DTTA 4H16A 1V6SA 2WVHA 4IEEA 5EG0A 3KJZA 4A3FJ 1FOEB 3CINA 4DEYA 4RSMA 3RZDJ 4YV0A 1WJBA 1G9TA 5J1UA 1YB7A 2HXOA 4ZDKA 3ZY2A 4S0HB 3VYTB 4Q0MA 5BW8A 2IE0A 2KIUA 1EWKA 3JWGA 1R5NA 3GG2A 3L8FA 4U2DA 2GPJA 1KI6B 5FTNA 1NX6A 2H3HA 4QOFA 3Q3HA 1PS0A 3GJ0A 2AW5A 1LDDA 1ZJWA 4HP8A 4Q02A 1PR1A 1A1VA 2MH9A 4YALA 5T5QA 3HCEA 1QP0A 1Y37A 3PX3A 1TLTA 2R7ZJ 3IP7A 3EZLA 2VCHA 1EVEA 2IP2A 2ZYSA 1SHJA 4I66A 4X9XA 5DM70 4QOEA 3IESA 3ESYA 3FVRA 2KKOA 4R8RA 2OO5C 5HIJA 4EZBA 1YDFA 2QQEA 3MLEA 5JO9A 4BKXA 4U3JA 1S9HA 2D5IA 3D6FA 1XGSA 3B2EA 2BLNA 1MVNA 4WKNA 3T4PA 5AIBA 1ZQ9A 4NPAA 3K5WA 2ZB8A 3HVIA 3FHLA 3VU8A 4U88A 3H1EA 5CCEA 1U7WA 3BZBA 3NVKI 5ERYA 3GJ5A 3M4YA 3DDUA 2GZSA 3L1HA 1MIHA 1RKQA 4HAIA 1ICEA 3ZI4A 3ETGA 3RI3A 4BXXJ 2OP0A 4D9BA 1SD4A 5IHPA 4UUNA 1NURA 1TQ8A 4C01A 3MD9A 4US0R 3LVQE 3U16A 2AXTC 4PRKA 3X1MA 4RPLA 3I0TA 4L2IA 3A1EA 3GEPA 3NHJA 1IUOA 5IT9A 2I3BA 3EZ7A 5BV8A 2XKPA 1JYFA 1MAHA 2FOWA 2NU6A 4WA7A 3N8DA 4JQZA 3P20A 4BJ5C 3BF7A 1ZXLA 4RPKA 2WZCA 2BZ1A 2XIJA 5EJ4A 3OF3A 4LC9A 2ZYTX 3ABLH 3HG7A 3ZCRA 2JF0A 2VXCA 3U4QA 4KMUX 2WMOB 2ES4A 1C8LA 1QHSA 3CZMA 3BD9A 4KZPA 2VDMB 3BWCA 2B78A 4IDFA 1RADA 4ZZ1A 2AC2A 3EEIA 4C6TA 2XGMA 4LWPA 2R85A 2V65A 3SQMA 1W0JA 3NYWA 2AWNA 4DIFA 4F2WA 4BNFA 1QV9A 4PLVA 4XWGA 1SXQA 2NU7A 3IJPA 1W0JD 2H2IA 1Z75A 5G4LA 3IQFA 3E9EA 4BVHA 5TRTA 2PK3A 4GMDA 2PYIA 3T54A 3FXUA 2Q5HA 4MUFA 3UJAA 1II8A 3DBRA 3MT7A 4UM9B 4FWBA 2E1MB 1NW9B 2HA7A 4OOEA 1JTFA 5M7EA 4DBVO 1O77A 5KTPA 4MCAA 4BQSA 1VL1A 2CXXA 1MTZA 3MJHA 2QTVB 1L5KA 2EWVA 1S5PA 2ETXA 3SI7A 1FX7A 3S1QJ 2R79A 3MPOA 3EGXB 1JT6A 4WKPA 4A36A 3UXYA 5DCWA 2HPMA 221PA 2IH4A 5AM5A 4UEWA 2WSMA 1LC0A 3KQKA 3DOUA 5BUCA 5BSHA 3I09A 1DQPA 3QYBA 1V48A 4ALMA 1KQ8A 1EX7A 1U8UA 5JNVA 4HG2A 5ALUA 1XA3A 2LY2A 5DS9A 2WR8A 4QDJA 1K75A 5CDGA 1XALA 2I6FA 1O3SA 2FPIA 1BI0A 2JFOA 1Z29A 5TJHA 3FTDA 4FUQA 2R00C 4II2A 3DOEA 5LZ2A 4L78A 1MO4A 2IBTA 2GDJA 3K72B 3S8MA 3ANLA 1O97D 3H1AA 1SVLA 3TDUC 3RLIA 3NWOA 3UPUA 4CU2A 4M1SA 3SFZA 1Q7BA 4CQNA 2AMVA 1ONSA 3CPEA 4UVEA 2F67A 3R0JA 1AMOA 3WL8A 4U2CA 4Q47A 4ZWNA 3ANYB 4G67A 3BQZA 3GXOA 2W2PA 2EYQA 5AR1A 1T43A 3PJEA 1E0EA 1FP7A 3OQBA 1MAWA 1Y34E 4QUIA 3OQMA 2XXAB 4FLMA 4ZMBA 3QU5A 4N01A 4E5SA 5HIMA 3M3HA 3K4NA 2VNJA 3VISA 3CX8A 2VPIA 5FLXK 1GV2A 3SQXA 1T3LA 1P4JA 2GCEA 3S2IA 4B6RA 2XHKA 2R7AA 4AKGA 3A04A 4UCFA 5IJWA 3TOZA 3T9DA 2CLOB 2V3WA 3HWSA 1VMIA 1YIJI 3AHFA 2QT9A 3RK1A 3TIVA 5E7MA 2FBIA 2LG4A 3LQ2A 5HF6A 1RRGA 4IHJB 2A35A 4RGRA 1G4DA 1FNCA 4BJ6A 3I2JA 1ESZA 2H7VA 2YW2A 5B3JA 1USUA 3SDGA 3IUSA 1UMDB 3W1WA 3BT7A 2WC2A 3PQFA 1FYKA 1P80A 2GN9A 1AKHB 4KITB 3B6ZA 2AHRA 3VHXA 5FPYA 1LS1A 2YC2C 2EZIA 1FMJA 2H06A 2B9SA 3VTKA 4QPQA 4AXBA 2CBZA 4B87A 1GAQA 3EW9A 4Z4CA 4N4AA 4G6DA 1FX1A 1ZK0A 1H9AA 1II0A 4WCVA 2GDZA 2ZNZA 2UZAA 3QVVA 2P5YA 2VZ0A 1Z4PX 3SM3A 3GPCA 2D0IA 2CWEA 3BTCA 4CCOA 3D31A 3KPHA 5B1AH 4OK5A 1PWXA 1LSJA 2GMWA 1DKOA 4LJ8A 2V4ZA 5LZ8A 3D3JA 3JPYA 1X3UA 3DE3X 1KVSA 3JAKB 3PXXA 4PSAA 2ZWIA 3QKRA 2B4QA 4MPDA 4LRYA 2OVFA 1JH8A 4FSHA 3WRWA 1BQEA 4ARIA 3DYBA 5D8LB 1M5UA 2EH3A 1V16B 1UL1X 2WAAA 1YF3A 4KXQA 5AKJA 1MVOA 1SFEA 3P8ZA 1AN0A 2G83A 3CTMA 3Q9UA 4WSOA 5E7QA 1CVRA 1HF0A 2W70A 4NK5A 2AWOA 1Z26A 4X3PA 2ZJ0A 1BL0A 4HNSA 3CURA 5CT5A 2XKOA 5CFQA 3G1LA 2LKDA 3OJ0A 4CVNA 1PF7E 2PN6A 4KYVA 5C8ZA 4DUPA 3P2IA 3ZU5A 3JRBA 1TCUA 2Z3YA 3EH1A 2GTPA 3GZNB 1OX5A 2HHCA 2NAZA 4W1UA 2DFIA 3SD7A 4QFBA 4MW2A 1LLQA 5TXGA 4XL9A 1TK9A 1OGIA 2HQSA 3MFQA 5EGOB 1YDHA 4TKVA 1J2XA 3FJOA 3ABQB 3ETHA 4UHFA 2LFBA 3E1KA 3T7DA 2O5RA 4JSTA 3L6BA 1PW7A 1MMGA 1D2HA 3QRWA 3F8NA 3RABA 2IPLA 4B7XA 5DBOA 2Q50A 2VKVA 1XDDA 2NYAA 2DBRA 3P45A 4JI1B 3GB9A 4R01A 3NWTA 1DV1A 2FRDA 2FRVA 4U9UA 1IHXA 1SD7A 4XLFA 2X0NA 2FPXA 2B7BA 1Y1WJ 1J5XA 1VPDA 2PL1A 3A70A 3WBBA 3TLYA 2W82A 3GJSA 3D5SC 2W4MA 2QRQA 2IA5A 1ZYUA 1WBBA 5AHRA 1GZ3A 3KP5A 5HF9A 5GP1A 3I54A 1QTQA 4HO1X 4EYSA 4R0NA 1PX0A 1E6EA 4ZU1X 4A12A 1A4XA 3D4IA 2VO1A 1OBVA 1J9EA 4TMTA 2XSDC 1UZUA 4QT0A 1KA8A 3MUOA 4AQYB 4UULA 2Q1UA 3IUPA 2F1IA 2FQYA 4YDHB 3THOA 5HA5A 1KPIA 1D6NA 3U7IA 4MGIR 4LFBB 1H85A 3L1JA 4EGAA 3LXMA 4KN5A 4NL4H 1CUAA 1V8FA 3E5UA 5HRCA 4BNYA 5JI6A 3ZXYA 4KSCA 1PDVA 3G7NA 4PN7A 1LFAA 4NZZA 3X1XA 1WW3A 2RIRA 4RDIA 4KE9A 2STTA 3VPRA 3A1TA 4HDUA 2Z2IA 4PX3A 2P2DA 2ON6A 2OUIA 2X1LA 1U7ZA 1B6AA 2VP5A 4L5CA 5C51B 4BQIA 3SHTA 5K4AA 1Q1NA 2RG7A 3BG7A 3OJEA 4L0QA 3LO8A 1KTIA 3DE2X 4G4IA 2CRGA 4TKZA 3IQZA 3STUA 2Z2SB 5C32A 1UMBB 1CF9A 3W9YA 4WWHA 2XT0A 1XZIA 2X7JA 5IAEA 3E9QA 1BCRB 1AMUA 3FA2A 2PEYA 3I3SR 3UHAA 2ZZNA 3KVVA 4RFSA 2FE4A 3WGTA 1W6UA 1G21A 4OU5A 3U2QA 3RVSA 2VPRA 1WX1A 4MUNA 1AXEA 5GONB 4AYTA 2DTDA 5CLIA 3WI7A 4E46A 3SLKA 5EQTA 2PEZA 3NM4A 2W22A 1V5WA 4U39A 1JV2B 1RRJA 1R23A 5JZVA 2GILA 4L9TA 2B5WA 4K40A 2Q3HA 1O95A 1PW5A 3DZBA 2QTTA 3FI9A 4C6HA 4UE3S 3BREA 1KARA 4NDZA 3N2KB 3C3BA 3RZOJ 2GM4A 1O95D 5K7FA 1UZMA 2XUQA 1FJLA 3UGQA 2RCNA 2B2XA 3GFFA 5A5GA 4TSFA 1ZVQA 2GYYA 3DTVA 5B1IA 4PLYA 4UTVA 3MAJA 2R7MA 2GBYA 3FMGA 4AICA 4C4ZA 3G9TA 4EUEA 2IU0A 5ILUA 3W2IA 2F64A 3KS9A 4ENRA 2AZXA 3VYRB 1Q1AA 3LY5A 4RVUA 1CZRA 2C2HA 1G17A 4BWGA 4RABA 3QP9A 5DEOA 1X1EA 2IPOA 2JIBA 3PQ4A 4O4JF 2XAFA 1EIZA 1KI1A 4CKEB 4DIEA 4IDPA 4MQ5A 3IAUA 3U6BA 1RI1A 1PWHA 2KIQA 4V0NA 2NUTB 3I2KA 1WMEA 4D4JA 3FZYA 1RWOA 4BZXA 1O97C 3SDSA 3UANA 3DWFA 3F90A 1R8JA 2BV3A 3BROA 5JYDA 1DX6A 1CQJB 2HWYA 1JKJA 1N3YA 2JB9A 4G5GA 4F60A 4ZCTA 3GA0A 3ZMVA 1O7FA 3F4LA 2ARKA 2ZYDA 4HUTA 1ARZA 3O1LA 3KJEA 2HT1A 2Z6UA 1KO1A 3N2NA 5H4GA 1H6CA 3EA4A 4K3UA 3A36A 3ZMZA 3T0GA 2GYVA 1XL0A 2ZROA 4XARA 2ZJ6A 1JAHA 4BEHA 1QCDA 3EY9A 1D4FA 3NTXA 3TSCA 4MWZA 3BG6A 3RS9A 4A0RA 1T8TA 2JPBA 2AF4C 1VTKA 3ZEAA 4D3XA 3IXLA 5F7XA 1W1WE 1L5RA 4ZI7B 1KDRA 2PKEA 1R1DA 1YIAA 3ACCA 1SGWA 3KWMA 2ID6A 2WPDA 1E2LA 4H0CA 4HOBA 5TPWA 2HMSA 2Q1ZB 5ILOA 4DA9A 5EWJA 5EJMA 4P84A 2WPDD 3BD6A 2OZVA 1G5FA 1PLKA 4RL6A 2HOQA 4RYDA 1T4GA 1LNWA 1XCLA 5CM9C 4BJ6C 1EM8B 5JAZA 3H9UA 3CSUA 2AZ4A 2BGUA 5B3JC 2CLSA 2R25B 1Y6RA 3LPMA 3KTDA 2UXNA 2WU3A 1YK0A 2W4QA 4H6WA 1Y1VJ 1WUYA 3BJOA 1GU1A 3C3JA 3E22A 1W5EA 1OFTA 3IS3A 1OF1A 5EYRA 1YIDA 2DERA 4YJDA 3UT0A 5FTJA