1P2FA

Crystal structure analysis of response regulator drrb, a thermotoga maritima ompr/phob homolog
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
MMWKIAVVDDDKNILKKVSEKLQQLGRVKTFLTGEDFLNDEEAFHVVVLDVMLPDYSGYEICRMIKETRPETWVILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFLEREKKGLYDFGDLKIDATGFTVFLKGKRIHLPKKEFEILLFLAENAGKVVTREKLLETFWEDPVSPRVVDTVIKRIRKAIEDDPNRPRYIKTIWGVGYMFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the domain interface in DrrB, a response regulator of the OmpR/PhoB subfamily
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
molecule keywords Response Regulator
total genus 69
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p2fA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p2fA01
4L18B 3W6KB 5ICEA 4IF4A 4OBBA 4GO1A 2A9OA 1D8JA 4LG0A 4L5JA 4RGXA 1NXXA 2CQKA 1HSJA 3H92A 3N0RA 1LJLA 2JVJA 4O1HA 4AD9A 1TVMA 2FW0A 5FFZA 1REPC 1YLFA 3GWZA 3GVAA 3F6PA 4EGZA 2PBIA 1QP0A 3RQIA 3ZMUA 2X4HA 5BOXA 3F8MA 3RIRA 2LBPA 1GVJA 5GQSA 1WQ2A 1AOYA 1NXVA 3H6HA 4M9SA 4TV7A 3B2NA 1FP1D 3Q9VA 5LRRA 5FBHA 2PUDA 4EJWA 2EK5A 2JVIA 1KMIY 3Q7RA 3FHZA 4HAMA 2X0LA 2R7DA 5IUJC 2NS0A 4IRGA 3IRRA 2FLWA 4M88A 1L5YA 1WKMA 2W84A 2DO7A 3UUGA 2FNAA 2RDMA 4LB5A 1GCAA 1H9CA 5F6FA 1IAWA 1FWZA 2QUFA 2QLZA 4IMIB 3U9GA 2HQBA 3ROFA 1G3SA 2OZUA 4CXFA 3HIFA 4H60A 1MB0A 4MGEA 1I27A 5HDGA 2M98A 1EH6A 2R48A 1W5SA 1XN7A 5B3JA 4OTZA 4MR7A 3KP7A 2P6SA 1QNLA 4RY8A 1SXHA 2FMKA 5A2QZ 4GCVA 2VXZA 2QU7A 1HW2A 4ZZLA 3GYHX 2MYNA 3GRCA 5TQ0A 2BYVE 1EWTA 3LWFA 3WU0A 1FFGA 3K1NA 1DDNA 3EODA 4HX7A 4LLLA 2PFBA 3ILHA 2RGYA 2JK1A 1WI9A 3GBVA 3N75A 1KU2A 1FQWA 3D02A 5LEKA 4KREA 4P9FA 3CU5A 3E6CC 1RI7A 3I42A 4JBAA 3I09A 3TD9A 2D1VA 3M7GA 2F5EA 4U0WA 3ZQ7A 2O20A 1AWCA 3I0TA 1RNLA 1MDMA 2P8TA 3IHUA 4EJTA 3JS5A 1D2AA 3LUCA 4ZMSA 3I59A 2EA4A 2FNPA 1P6UA 3JY6A 1JDNA 1LVAA 2FQXA 2E4ZA 4XLPF 4MAAA 2YX4A 3RVKA 1H9TA 2HR3A 5H6RA 4WXHA 1QZZA 1U2WA 3CJNA 3H5IA 1WRJA 4E7PA 3T38A 2WTEA 2CWDA 2PQ8A 1P6QA 4WK8F 1TQIA 5ICFA 3KCCA 4KRFA 1DP4A 4UVBA 2XAQA 4PDKA 2MBFA 5HS8A 6CHYA 5L3CA 1CEYA 1JBEA 2XKOA 2VC0A 4PGGA 2H3HA 2AXLA 2QQ9A 3FZVA 4MR9A 1IUYA 4D74A 2HQOA 2ESHA 4NICA 3R4KA 5ILUA 4MR8A 1ABEA 1TLHB 4ZPJA 3W6JB 3E6DA 2ZMEB 4W5QA 3ZMSA 5IEBA 4Z9AA 5DCLA 4RB0A 1CF7A 1DRJA 3MEXA 3RVSA 4RXTA 4JAVC 3QX8A 1ZGAA 4ZYDA 2OENG 3OMXA 3PQJA 1BAPA 3RVJA 4MLCA 2A68F 3EQZA 4F7ZA 4ZH4F 3DPLC 1LBHA 4HV5A 3MYYA 1T2KA 4IRHA 4LB6B 4N76A 3KJXA 4KK4A 1G3TA 4Z0NA 4LDAA 1Z16A 2CYYA 3LTEA 2HGCA 2K02A 2V1DA 4TLMB 4HF0A 2JT1A 1NXTA 1XSVA 2QVCA 3V8JA 1R5GA 3DLBA 1MGTA 1DG9A 5CVVA 1SRRA 3MAJA 4XBFA 3J80K 3HEBA 1J59A 1J56A 3H1GA 3HS3A 2GAUA 3A0RB 3DPTA 2DK8A 3GX4X 1ZHFA 3GWGA 2OQRA 3OLXA 3QU6A 1B6AA 2XAFA 4EJOA 1Z17A 3KCNA 3QRFF 4ZYEA 1SXIA 3CS3A 4G86A 4I7HA 2WWYA 1YQAA 2DAOA 4PGHA 2IPQX 3ZN1A 2VT3A 2WWVD 2ZO4A 2IJLA 4XRFA 1VRVA 4L9TA 1U5TC 2EFPA 3VODA 3JTGA 2DFIA 3G1WA 3RKXA 5HDKA 4F06A 1QMPA 4G97A 1USKA 4DQDA 4QWQA 1W7PA 2YHAA 3OLYA 4KVFA 1DRKA 3BJ6A 3GEZA 3AAFA 1P6RA 2A61A 1ZG1A 2STWA 3M6MD 2P5KA 3QEMB 5LLQA 5CVUA 1W7PB 1E2BA 4KIBA 4RK0A 2OD5A 2N9UA 4GGGA 4DADA 4N9IA 2DU9A 2X7XA 4G6QA 3E6BA 3NQOA 2ADUA 3EGCA 3A10A 3RVRA 2RV8A 3CTAA 4R8HA 3MZHA 2PUFA 5JNWA 4Z9BA 4ZYGA 3H3UA 5CYVA 1F1ZA 4LJZF 1R1VA 3GFMA 1NXSA 3VEPA 1DCKA 3CO7C 3H75A 1USSA 3JPWA 3EYIA 3F6VA 1J7KA 3HTSB 1K66A 4YR7A 3FXQA 4N0BA 1O3QA 1ZH5A 4WUTA 3MIZA 3JSPA 4A5MA 5DCFA 1Z13A 4EY3A 5BS6A 1RXIA 3E5UA 4G0OA 3COAC 4TLLB 1JLKA 1IN5A 2BBYA 3TDUC 1ZN2A 3G73A 2VK2A 2ID9A 3NEUA 2JVKA 2HZTA 1TNTA 2L3DA 1FY7A 2R47A 2UZKA 1JE8A 2Z99A 1YTUA 1JF8A 1JX6A 4A2UA 4KIGA 4BH9A 4EMSA 2M1BA 4XSZF 1JHFA 5HLGA 3O6BB 1USIA 4MHGA 4L9JA 2HS5A 3TO6A 5E18F 3RPQA 1LK0A 3OO0A 4EYQA 4KMUX 2KIMA 1YMVA 2CW0F 3OQMA 2Q5CA 2VBYA 5DKFA 4YO7A 2F2EA 4LLNA 3O2JA 3L2CA 5K1YA 2A6EF 3OLVA 1E6KA 3KS9A 4G0ZA 4N41A 4MPTA 3GF2A 4MS3A 5L3BA 3M9XA 4ENKA 2PUGA 1UHWA 4NV3A 3TDZC 1YK1A 2FEWB 3T95A 2QENA 1FYKA 5TQ2A 2HDCA 3N8IA 3E61A 1XSDA 2LNBA 3GA5A 2LSOA 5F1RA 1E6MA 1F51E 2STTA 3LKVA 4L85A 2VT2A 1SMTA 2E7WA 4L0YB 5PNTA 2GQQA 3BBLA 4MGRA 3O1HB 3V7RA 3IRQA 5AIPA 1Z18A 5ABPA 3L00A 5D5VB 2MLKA 4HOBA 3J81Z 1HKQA 3LQQA 2HWVA 2IP2A 5H6QA 4F12A 1BI3A 2IPNA 2CHFA 5CHYA 2BGCA 4ENMA 1U2QA 2EFWA 2FQWA 1U8TA 3BDDA 1TLFA 4Z4CA 8ABPA 3ZP5A 4RB1A 2GA2A 2WMYA 1A2OA 1MZBA 2PJUA 1QKKA 5J8CA 3E3MA 4HV6A 4ETIA 2BEOA 3RH0A 1BDHA 3QEKA 1M2EA 3GZ5A 3FM3A 2GX6A 4G8XA 1D8KA 1FLIA 3I5UA 3NNSA 3EQ2A 3QLUC 1Z91A 2TDXA 2O8XA 1BI1A 4U7BA 3QELA 4MQFA 3RVMA 4KQ9A 4MQ9F 4AVPA 2OA4A 3KZZA 2EV0A 4IHTA 2QVGA 1O57A 4WWCA 3MCZA 1J5YA 5TQ0B 2PJPA 4OG2A 4RY0A 3JW4A 1PEYA 3F6CA 4LZLA 3BRSA 5T7BA 2H27A 3CKMA 3H5VA 2L2QA 3WE3A 4KZKA 1VPWA 1ZAYA 4JQFA 3M8FA 3S2WA 5E3JA 3WTSC 4FT8A 2JB9A 4IILA 4XARA 5IX8A 4A0ZA 1P4XA 4EM1A 1T6SA 1T39A 2LF7A 4OIPF 4OLAA 3WG9A 4I2OA 4UV9A 2O6GE 4L9NA 1JHZA 3ZMVA 2HTSA 3CLOA 1KGSA 1G3WA 2JPBA 2CD7A 4CGZA 3LUJA 1FNNA 1R1TA 1RIOH 3GW2A 2QVOA 1K68A 4WXEA 2E4UA 4EJVA 4P9UA 4LRQA 2GXBA 4ZMRA 3R0AA 3U1DA 5EWLB 1R5HA 1BJAA 3DXJF 4AWXB 1GLGA 3HRUA 3LFTA 1ABFA 1NXPA 5TRDA 2O61A 1JWLA 2HYFA 3N6VA 2R4QA 3ML6A 1Z6TA 4JP1A 3NHZA 4UHJA 5IUNC 1EWKA 3R60A 2Y0MA 5D6FA 2IPMA 1C0EA 4ESFA 4O6JA 1U2PA 2MD5A 1HBXG 2F5FA 5KC9A 1QO0A 4H3KB 1FSPA 5IT9Z 2HSGA 3N97A 4KV7A 4W5TA 4MS4B 4ZYLA 4HDVA 1YW8A 5CJ9A 1CHNA 2DLLA 4EYKA 1K79A 1J2XA 3HRSA 2RDPA 3J80Z 2DQRA 1S7AA 3A0UA 1LEBA 3RVOA 5JVTA 3IP9A 4RAYA 3H6GA 3DLHA 1SFEA 2KJBA 6ABPA 5E8IA 5LRSA 2NUBA 2ZBKA 3P9KA 3HDVA 3F7NA 1D1PA 3EDCA 5K5OA 1DBQA 3G3ZA 2K27A 5TQJA 2G7UA 1FC3A 4RK1A 4HNSA 3ECOA 5L3GA 2QQAA 4QLCU 1GUBA 5DUKA 4I02A 5KQGA 2GKGA 5HDNA 3EETA 3L49A 5KI6A 2MSLA 5IEJA 3ULQB 3V4GA 2QYOA 3ROUA 3QELB 3KHTA 2XHKA 3O3KA 3C3KA 4A12A 4EGYA 4RAZA 4CDGA 1MB3A 4TMYA 3KP4A 3WTUC 1KYZA 1R1UA 1K78A 4HA8A 4L5IA 1Z2DA 1XDSA 2MLGA 2C6YA 4ETNA 3TOBA 5BMZA 5JNVA 3HTUA 2HOEA 3E5QA 5TE9A 1ODDA 2ZAYA 2WB4A 2PN6A 1B59A 1EH7A 3C3WA 4A0YA 1KRXA 1TQPA 4XAQA 1DPRA 3MFKA 3JTEA 1QQAA 2A9RA 3TGNA 4AIKA 4Z99A 1L0OC 1SD5A 1XMAA 2E4WA 5DD8A 3CUQC 3O2PE 1BC7C 2RC4A 6PAXA 1MJAA 3N0XA 1HSTA 3WTWC 1YK0A 3FMQA 3OM1A 2XROA 1ZG3A 4G0YA 2ZJ2A 3K1MA 1ON2A 3D8UA 4F11A 3R6SA 1OXKB 2TMYA 3O21A 3JVIA 2B0LA 1C4WA 4Q6BA 2V6CA 3FGZA 1RXEA 1RZRA 4IRXA 4OOIA 1SFXA 2DTRA 2GA1A 3DF8A 4RGSA 4NQWA 2FN9A 2NT3A 4RB3C 1D4ZA 2DW4A 4YCSA 5ERIA 2NRAC 3K1PA 4WZZA 2ELHA 5HKOA 2CWEA 2NZVG 2QZJA 2QZ8A 3V7CA 4HF2A 3GYBA 4G0MA 4HNRA 3R61A 3RDIA 1UFMA 4DQ2A 1TJYA 2LUOA 4UNOA 2PL9A 2QBYB 1B9NA 5DEQA 3DGEC 4EUKA 2JSCA 3I71A 1QPZA 1OR7A 1RPJA 2FRHA 3R0JA 3QLUA 3SG0A 3LSTA 5IT3A 2PMHA 2FQYA 2P7CB 3ABTA 3FWEA 1JL3A 2HYGD 5TQ2B 4NCAA 4A6EA 2Y75A 3ZMDA 4MLDA 1OYYA 4N0QA 2BGGA 2XAJA 2YU3A 2EFQA 2K4JA 3HOTA 2MC3A 3BROA 2W42A 1Z1DA 4ESBA 1QNTA 5CNJA 1U5TB 3OO1A 3IC7A 1UB9A 1G4DA 4BHBA 3S99A 4O5VA 4PCQA 2EV5A 1G3YA 4UHTA 1PP7U 1VLZA 3CZ5A 2ETHA 3URMA 1P2FA 2HKOA 5LGNA 5JS2A 1LDKB 1ZRDA 4RU1A 5JS1A 3IWZA 3C6QA 3GFLA 4MS1A 2XV4S 3L7WA 5KVRA 2GXGA 5ED4A 3HV2A 2FBIA 3FFTA 1HEYA 4CHUA 4UHKA 1KQ0A 3DV8A 3KG2A 4HW0A 3B02A 4U7DA 3BJOA 4Y9TA 4LG0B 4XXHA 4I98B 3EUHA 3DEUA 1EAYA 4BHCA 2FTKE 5L3FA 4H3HB 4ETSA 1I3CA 4Y15A 2L4MA 3KYIB 2GZWA 1DUXC 3CHYA 2ZNZA 3KP6A 2A5YB 4BHPA 3DZDA 3HSYA 5IUKC 1U78A 2EWNA 5H20A 1PNTA 1RZRD 2F8SA 3WTTC 3K9CA 2W25A 1ZVVA 4F8JA 4R79A 2QBYA 4I0BA 1STZA 3LAPA 3C7JA 1EHCA 3HSFA 4PYRA 5D5XB 3CNBA 2DQLA 4M74A 4GYIA 3H1FA 5BQ3A 3ZMTA 3LKBA 5EWMA 1FPQA 1LJUA 3LUFA 4MQFB 2F5CA 1IN8A 3CRNA 5HSGA 3WTYC 4Z2YA 1IW7F 3D0SA 1A0OA 4JB2A 3OQNA 3CG0A 5CNMA 2XGXA 4S04A 2RVCA 2FMHA 4RS8A 4GXOA 2R25B 1E6LA 4G7OF 3ILYA 3GUDA 3VFZA 1LQ1A 1BIAA 5FWXA 5CLSA 1QQBA 2PUCA 4QPJC 2K4BA 4ENNA 5LGTA 2R3SA 3WTVC 5LHIA 2LIVA 1BBYA 1FZPB 1QPMA 4KICA 2D1HA 5ICGA 3LMKA 2J5OA 4RK7A 1Z26A 3KSMA 1YMUA 4WXMA 5HS7A 5L3EA 1U6GA 1JGSA 4N47A 1VKRA 4Q47A 2IYNA 5J6XA 2F5DA 2WJWA 4RGRA 4UVCA 5D8KB 4KN7X 5DUIA 5D2CA 5CNKA 5CVIA 2PMUA 3HUTA 1QQIA 2CGPA 3IP6A 1QP4A 5DD4A 1URPA 2WC2A 2BE5F 2UWMA 3BP8A 4IGAA 3ELKA 5KC8A 2G9WA 2FA5A 4MYRA 2MH9A 4RY9A 1FT9A 1QP7A 5FGMA 1ZRFA 3ECHA 3F3XA 2PUBA 4P98A 2DRIA 4RKQA 2XKPA 2M1ZA 2ZMEA 2GI4A 4G0PA 1ISSA 5FWYB 4AIHA 1Y1LA 4CBVA 4PZJA 2P6TA 4YLEA 3J81K 1B1BA 2EA2A 3K9TA 3RYPA 2WRZA 4JASB 3HRTA 4IJAA 4EVRA 3NNDA 4Z4EA 5JR3A 2WJAA 5ICCA 3GLXA 4LE1A 1DC7A 4YFNF 4HQEA 4IMJB 3IKVA 4RV5A 4U88A 1XCVA 4M73A 2CG4A 3FXRA 1CGPA 1YYVA 2VOPA 2HKXA 4YP9A 4HX8A 3IP5A 4KK3A 5DGCA 4RK5A 3VB2A 3LA2A 1WSUA 4WCGA 4Q6WA 1Z12A 3OMWA 4MQEB 1BDIA 2B1JA 3HSRA 4BNCA 1ZRCA 4MS4A 3LA7A 3SZTA 3LUKA 1DBWA 1Z9CA 2QV0A 3KEQA 3BWGA 2GBPA 5FFXA 3RVQA 3EYYA 1R00A 4E7OA 1S6LA 2IOYA 2IA1A 2XAGA 1UDRA 2M45A 2IPLA 5DTEA 2HEOA 3VNBA 1GUDA 4HNQA 1TMYA 3BILA 2ZWMA 5CVRA 5E20A 3HYIA 3WU1B 1AB6A 2PL1A 3OQOA 5I4CA 1U04A 1ZGGA 2JRTA 2PAFA 1B4AA 4KA4A 1R36A 4S05A 4IHSA 4ML3A 1JDPA 3JPYA 3QPTA 1LDDA 1E2XA 3UKJA 4OIRF 3V8KA 2FF4A 3GZ6A 1XSXA 2XVCA 4Z4FA 1J0RA 1YFHA 4N9HA 5EWMB 4HBLA 1U8RA 1ZGZA 3FDFA 3CTPA 4W5RA 1UCRA 3BREA 4YRZA 2RNJA 3BRQA 4HX4A 5CVJA 1XD7A 1R23A 4G0XA 3LFKA 2VE8A 2YX7A 2ISZA 2IT0A 3N53A 1VTNC 1USGA 1NHAA 4Y13A 5HM6A 4ZZDA 5BQTA 3LUAA 1T0FA 2RQPA 2OZ6A 3HJFA 4ZYHA 3HDGA 3KZYA 2VODA 1DP7P 4G94A 5D4SA 3OLZA 1YW7A 3KEOA 1MVOA 4M6XA 1I1GA 4OMYA 2DPDA 3T6KA 1HKTA 4RWEA 4PEVA 3I64A 2CFXA 5IT9K 3QLVA 3O74A 1MJBA 3U2RA 3O1JC 4HF1A 2R7FA 1B9MA 2A07F 4IRIA 4YS6A 2QSJA 2E7XA 2RJNA 2MSWA 1QO0D 4KDPA 4KIFA 5HVQC 1FYMA 3TQNA 3RKWA 2FE3A 1USTA 4QYWA 4OLBA 1BVHA 1IF1A 4KN4X 4QYMA 3K2ZA 1FBUA 1ZH2A 2A9PA 2IKSA 3TO7A 5IULC 4O5AA 4FX0A 5E1WA 2JBAA 1J75A 2I6FA 1EV7A 1FFSA 1O7FA 3Q7TA 4M9ZA 3TB6A 2JZYA 2FSPA 2W85A 5FO5A 3WGGA 3Q5FA 3DP7A 1EH8A 4NQRA 4P5OA 3KP5A 4Q4ZF 1A04A 4E70A 4OIQF 1H0MA 3FMRA 2Z9OA 4A6DA 2NAZA 2D2WA 3I5AA 1R22A 2PI0A 4MS3B 1SD7A 2MYPA 5GOTA 5EWLA 3ZN0A 4N0PA 1HW5A 2PUAA 1APBA 3E5XA 2LKPA 5HLIA 2JTVA 3KKEA 4AIJA 4D6XA 3BY6A 4YWHA 1T34A 3QLTA 5ILVA 4RK4A 3SZPA 2AS5F 4RXMA 4Z4GA 5HQJA 2XASA 1SMYF 4RXUA 1JFTA 4HLXA 1LDJA 1FX7A 2PLNA 1MJ9A 3I4PA 2XRNA 4ETMA 2Z5UA 4RS3A 1JYFA 1K6OA 3Q41A 3SQNA 1Q1HA 2KIFA 1HW1A 1SXGA 2HQNA 4NB5A 4HZFA 3RVNA 2NZUG 1Z05A 3TO9A 2HJ9A 1O3SA 4EVQA 4MR8B 4F3TA 4FB4A 3L09A 4EQQA 1XB4A 2IPAB 4KFCA 3I58A 2MYTA 4M72A 1Z25A 2Q2EA 3KFWX 3MM4A 4BAYA 1ZY2A 3Q7SA 4EVSA 1JYEA 2JPCA 1PP8F 2FEPA 4FE4A 4A0XA 5BRAA 2V1UA 4Z4HA 4Y17A 5JI6A 2LPMA 2PMCA 3NRVA 3FFXA 2MA3A 3GXOA 1DCFA 3RPUA 2PKXA 1IN6A 2CSOA 3IPAA 1TQMA 5AONA 2H09A 5DLEA 2FKAA 1JFVA 1G6NA 4OATA 5T3YA 2D45A 5FD5A 4EM2A 3OLWA 3C1DA 3WE2A 5LBQA 2V0NA 5FWXB 3HUUA 1PNRA 1E17A 4WX9A 2DPUA 3FFWA 1SD4A 4YIIA 2ACJA 4MR7B 4A5NA 3MWMA 4HYEA 4YV7A 2G7HA 2B4AA 5EWJA 3TKYA 3CZCA 1TW3A 3EAFA 4L0ZB 3BPVA 2H94A 1DBPA 2ID7A 5E8GA 1V4RA 4B09A 1JHHA 3KETA 2H6CA 2E1NA 4RK6A 2PUEA 1F5TA 3WGIA 3HOSA 3KP3A 2FMYA 4CYDA 1IN4A 2IVMA 4D6YA 2V1XA 4EGSA 2P5VA 2L18A 1UHMA 4DNCA 2Q8KA 2L19A 4MQEA 3NBMA 1XHEA 1Z7UA 4H0EA 4BQAA 4U0YA 3P9IA 4YG2F 3T1BA 5IBQA 4JK1X 3I54A 1OYIA 1S3JA 1O3RA 1J9IA 1U5TA 5LHGA 4EYOA 1Y0UA 1ZITA 4YGXB 2P5LC 2NNNA 1ZAOA 1C0WA 1ZARA 1BN5A 4XFKA 4XASA 2M5WA 3JAMZ 3CUOA 2LP4Y 2FQ3A 2JRLA 1LB2A 1FYLA 3BJAA 1O3TA 3SM9A 3W9SA 3HO1A 1LEAA 1ZG5A 1ZGJA 2IW5A 1YO5C 1S8NA 4D0PA 3RI4A 1BM9A 2O0YA 3HUGA 4LX8A 1I5ZA 4U0VA 4MR9B 4P1ZA 1XMKA 1KRWA 2UXXA 2PLYA 3P9CA 2IDMA 2BV6A 2FVYA 1D1QA 1W7PD 1F9NA 4UV8A 2YHBA 5ILSA 1HQCA 2HTJA 4P96A 5FLXK 3KTOA 2RN7A 3E6MA 3HM9A 5FD6A 1ZREA 5HOOA 2VUIB 2K86A 1U0SY 1IRGA 3BPXA 3GV0A 3G85A 4LE0A 3HXMA 4UVAA 3O2SB 3FMSA 3H5LA 2IA2A 1M5TA 1BI0A 2Q0OA 1U3EM 4JB0A 2FBHA 3H5OA 5BR1A 1M5UA 3L9FA 1P8AA 4O1IA 1ZYRF 1IIBA 1ISRA 4M71A 3JSOA 1AB5A 4L4UA 3E97A 4K2EA 4CO8A 2NYXA 2V9VA 1FSHA 4HDUA 3H3ZA 4G7HF 5DCMB 3DGFC 1ONVA 2KJCA 1Z2EA 3ABUA 1JXSA 1P4AA 1KYWA 3MZYA 1LJ9A 3T5XA 1MDMB 1JFSA 1FSEA 1RUNA 3WTXC 2FMIA 1F4KA 4R1HA 2L02A 5LHHA 1RZ4A 4RSMA 7ABPA 2CO5A 5TJJA 4RDCA 3F73A 1DPUA 1PHRA 3F8FA 3T0YA 1KA8A 1ZH4A 1BC8C 2F8TA 1K78B 3JTHA 3M9WA 2QXYA 1QGPA 1F4VA 4WT7A 2KRFA 1XHFA 4KPYA 2MSKA 2HFHA 3SFZA 3O1IC 3TO5A 2EFNA 5LGUA 2O03A 2FU4A 1OYWA 1YVUA 3H1EA 3FXUA 5D8LB 3O2QB 3HHHA 1K7AA 3HVRA 1YS6A 4FX4A 1TBXA 3KP2A 2L4AA 3QEMA 2HQRA 3LUHA 3QLVC 2A6HF 3GL9A 5TPWA 1MKMA 1YG2A 5E17F 4XLNF 3M8EA 4TN5A 3CUQB 3QOPA 3P9YA 2VN2A 1PUEE 1ON1A 3QP5A 3C97A 1FOKA 5AIQA 5A2QK 1EFAA 2FSWA 3K4HA 4KQCA 2DT5A 5DYMA 5JFRA 3F23A 2IRFG 2E4XA 3MQ4A 2FXIA 1MD0A 5TPZD 2K7LA 3M9AA 1DJMA 3WODF 4B8XA 4Z4IA 2PEXA 3FM5A 1I6XA 3LQRA 2P4UA 3O75A 2E1CA 1T38A 1O7LA 4WXCA 1TM2A 4LLGF 4MS1B 4ESJA 1OKRA 1XGNA 1FBSA 3CFYA 1CF7B 1YW9A 3KE2A 2NT4A 2JCGA 3DBIA 5EEGA 2V79A 1IRFA 2QWWA 4GNRA 2AYZA 2ISYA 2KKOA 3RJPA 2HPHA 5C5EA 3MQ0A 3CLKA 3N0WA 2M8EA 4LK1F 4EM0B 2CHEA 4WWHA 3JAMK 1QZYA 4MRMB 2UXNA 3L6UA 2FBKA 4OMZA 1XWWA 5FB2A 1EWVA 2W24A 4EV0A 2P4WA 1IXCA 1IXRC 4IVNA 2KYRA 3QK7A 4LDZA 3N4MA 2FMLA 2Z33A 1OXBB 1GXPA 3GFIA 3PQKA 3QX9A 1XGOA 3D5LA 1S7OA 4PICA 3EDPA 5K5RA 2A3SA 3OOPA 4YFKF 1XDUA 4FHTA 1FP2A 2VBZA 3KYJB 3OM0A 3CUQA 5BRJA 1L3LA 2L17A 2P9HA 2DI3A 2ESNA 3LOPA 1OPCA 3IKTA 3Q9SA 1KU9A 1S29A 4Q5SF 2ZCWA 1M2FA 5KQMA 1KU3A 4O3MA 5FWYA 5BPIA 3ROTA 4G6DA 2FLKA 2VC1A 2W57A 1BIBA 2J5PA 3I59B 2ZNYA 3VOEA 4BXUA 3RYRA 3CG4A 1W9HA 3NNNA 5KQLA 2RKHA 1R8JA 3QPHA 1I1SA 2VOOA 5D6EA 2EV6A 3DKWA 5K5QA 2LDUA 5J8FA 5EWJB 1R7JA 4UXNA 3CO6C 2EJRA 1YIOA 2VBWA 3ZMZA 1W4MA 4Q7EA 2Z3YA 4G0QA 2DBBA 5FBKA 1IXSB 3VNAA 3H5TA 4FE7A 2COMA 3B73A 3IPCA 4CICA 1PEAA 2VYCA 2H6BA 4LK0F 4L9VA 3KLOA 1W25A 5CNIA 2FN8A 1L5ZA 4LFUA 4ENJA 2H0AA 1B00A 5E1ZB 2EB7A 4MEYF 4OINF 2OAZA 5JNRA 3LAJA 4HQMA 4PZ0A 4YIFA 3A3KA 5EEHA 4G9YA 1ZLKA 4PE5B 4IXAA 3QP6A 3GT7A 4EYGA 2PE5A 3MA0A 3EJWA 3HZHA 3T8YA 4JOQA 4Q48A 2QR3A 1ULYA 2ZFWA 3KLNA 5IC5A 1ZHHA 2MH2A 5HLHA 4ZJPA 2EFOA 2PG4A 3HHGA 3SXYA 4RB2C 3IP7A 3UK0A 1NXOA 2OBPA 3SHFA 2Y48A 2FXAA 2QW1A 5KQPA 2ZKZA 2A69F 5D5UB 1JH9A 1BOAA 3F21A 2YR2A 3V8LA 1GCGA 3SNKA 4GYGA 3F22A 3MMNA 3QAHA 3GFJA 2FEZA 1KQ8A 3T8RA 3JVDA 1XCBA 3SY8A 4G7ZF 1XGSA 1BDJA 2IA0A 1T98A 1LBIA 1YTYA 3WGHA 1P4WA 4W5OA 1MAVA 5E1XA 5JHUA 1WWXA 2QQBA 4XSXF 4HLYA 3K69A 4RKRA 2VONA 1ZESA 3TMYA 4UUVA 3ERED 1D5VA 2M30A 3WTZA 1OMIA 4GPAA 4NHJA 1SD6A 4QICA 5KK1A 4MEXF 5FLXZ 2FOKA 2YSRA 2GIVA 3EULA 3RVLA 1TW2A 1Z15A 3ZPLA 3QU3A 1TTYA 2JBAB 2MYUA 3EQLF 3ISPA 1SFUA 5JNUA 2FMFA 4LE2A 2VE9A 4LMYA 1KU7A 2VUHB 3C3MA 5D5WB 3GBPA 2E4VA 3RKYA 5D4RA 2QM3A 1Z6RA 1NTRA 4I01A 4WF2A 1RUOA 1GHCA 9ABPA 4MRMA 4MTEA 2OQGA 4NCBA 1MIHA 3F72A 4KYWA 2J48A 3HK2A 5LEJA 3TX6A 3IWFA 5F64A 3NHMA 1NXWA 4WXDA 4KNYA 3RVPA 4EJUA 3GO5A 5HS9A 3F8BA 2KIUA 4M9XA 2FEKA 2XDYA 2L01A 4EVIA 3FMVA 2WY2D 1R58A 5TPWB 3Q15C 5TPZA 1DC8A 2DK5A 3M1EA 4M6YA 3F6OA 2NNYA 3FX3A 3J7AO 1H9GA 3F8CA 2XIGA 4I0AA 3FF5A 5L3DA 5C5CA 2O3FA 1FBQA 4CZZA 2VBXA 1X3UA 4XLTA 2GWRA 3V7SA 1IZ1A 4YFXF 1BA2A 3BZ6A 3K0LA 3REOA 2RJOA 4KMRA 5B3JC 1W5TA 5DDGA 1FFWA 3DFGA 3I45A 3LA3A 3LUGA 4BYYA 1YS7A 4ASNA 1P92A 2XUBA 4LD5A 1IN7A 2P7VB 4MTDA 4RGUA 4RZSA 4N03A 4P55A 3CDHA 5JNTA 3OV8A 5JNSA 3P7NA 1PUXA 5BPDA 1GXQA 1V3FA 3T8TA 1CYEA 3E3VA 2OU2A 1HXDA 3IL2A 1NATA 4KMFA 1ZDMA 5KWSA 3IDOA 2A9QA 4OIOF 1TNSA 4IPAA 4ON0A 3HCWA 3MF4A 1D5WA 1BI2A 4OU0A 1SAXA 3BOQA 2M87A 2E4YA 1XGMA 1PDNC 2WV0A 4I09A 1D3YA 4KUMA 4MQVA 4LGWA 1ZLJA 1WETA 4DN6A 2YPRA 2XAHA 3HRMA 3TOAA 1HKSA 2ZXJA 2RGVA 2AYXA 3I53A 3LUDA 3DQVC 3PFIA 3RTRA 2L54A 1QBJA 1DCMA 5DV5A 3C18A 4KT5C 4MNUA 5DCMA 3HSEA 2LF8A 1DZ3A 3F8NA 1NY5A 4W5NA 3SAJA 3H5WA 1LNWA 1KQ9A 4JA2A
chains in the Genus database with same CATH superfamily
5A62A 7AT1A 1C0IA 5FOWA 4LY3A 4OU4A 5JOQA 2VL8A 3OL3A 2QVZX 1X4OA 5EN4A 4ISBA 1MO4A 4PJMA 1X38A 1KH2A 1EVEA 1WD7A 2LH9A 4L5JA 4K1LA 4QWWA 5LDHA 1EFPA 2CQKA 1HSJA 3H92A 1Z82A 1UK7A 4D25A 2JVJA 2ODTX 4ZYXA 2ECKA 3JQ9A 1JJVA 1AOXA 3ITEA 3N76A 1O8CA 4CKEA 2FWMX 1Z0IA 3WNQA 1O77A 3C45A 1REPC 3OOSA 5L6MB 2X8BA 2BZ0A 3PUHA 3GWZA 4C76A 5LD2B 2R79A 4IW3B 3OOYA 4Y1GA 5KTNA 2PBIA 1CDOA 4KU4A 4QJ4A 1MX3A 4MV0A 1V1RB 3EC2A 3ZMUA 2X4HA 1VMDA 2R9VA 1CX9B 3RIRA 1AKQA 1QBKC 5BMVF 3PJFA 1LSSA 1OZHA 3BEOA 1WQ2A 5EG0B 5LA6A 3LSRA 3WJ1A 2ZRFA 1C9NA 1MA0A 1E7MA 1FMVA 1Q0QA 3D6FA 3RABA 1IZ8A 3OSUA 4TV7A 3B2NA 3CZQA 4M1KA 1HTTA 5ERGB 2HVQA 3FKIJ 3JZAA 1VL2A 3R5HA 3UK2A 2JIRA 4EJWA 1ZSVA 5CXXA 1W0KA 1NOIA 3GFGA 2XOXA 3PS9A 4BU1A 3ZZ1A 4HEA6 5IC4A 1KMIY 4JLVA 1N1EA 4PJNA 3QFFA 3BR2A 1MF7A 4TMKA 1DPGA 1M0TA 4PWZA 4BJ5C 2PUHA 1ZPDA 4IRGA 3IRRA 2DY1A 1F2VA 1JQLB 2HHCA 3AR8A 4RHTA 5DGTA 1BOBA 1YB2A 2ECPA 2ZJ6A 5IAGA 1Y3CE 3ZTTA 2IS2A 3DTVA 2IYQA 2Z4SA 4FKMA 2WZDA 2RDMA 2X58A 3L1HA 5REQB 4HG2A 4Z7OB 3BB1A 2AI2A 4NCXA 4DVGA 5INTA 1H9CA 3ZJ4A 3RJ9A 5F6FA 2QUZA 1EWQA 3FSRA 3ZK7A 1FWZA 2B5OA 1BTOA 5KVAA 3W2EA 3NBAA 1F8YA 4CNBA 4MKGA 4NYJQ 4A3BJ 1RMTA 4B4DA 4XIDA 3RRNA 2PO5A 5L45A 3U9GA 3NI2A 3ICQB 1K92A 1Z56C 2DCUA 1O95A 2HQBA 3ROFA 1LQUA 2A0UA 5DCWA 2OZUA 1F06A 1WCV1 2GBGA 1BCSB 4J8PA 3U0BA 2YNMC 4QUIA 1GQYA 3A6FA 3HIFA 2CY0A 3KB2A 3L4BC 3PQ3A 4H60A 3EVZA 3H2GA 1UKEA 4UBNA 2YYAA 2JHCA 1EH6A 5KO2A 4BASA 4JLWA 1W5SA 2QAGA 1OT3A 5FCDA 3DMRA 2VT7A 1OCZH 4HPXB 3RBXA 3PGA1 3CSUA 1AIPA 1C8VB 1CUGA 1DTWA 1K7FB 2AL7A 3JQ8B 4Y2HA 5CFLA 4IHVA 1Q7GA 2GSWA 1GA6A 4X7MA 4DDMA 2ZTHA 4RPHA 2PAAA 4Z4QA 4OL9A 4Y2SA 3CH7A 3KP1A 4W99A 4D82A 3GYHX 4TVBA 3T0GA 3PDHA 1S5PA 3QBDA 4RC9A 4UARA 2R8EA 1TZCA 3UOGA 2I1LA 3WU0A 1VCOA 4NESA 1QWSA 1JMVA 2WG2A 1H2AS 4M49A 2HO4A 3QOEA 2P69A 1W0JA 4BTLA 3WGJA 5BMOA 4HX7A 3RQ4A 1GPUA 2PFBA 1YI1A 3ILHA 3OQIA 3WE7A 3J7AC 2R6HA 3G71I 4P4SA 3N07A 3Q12A 3A01B 3FMGA 1WI9A 1ZUWA 2VPYA 2AQ8A 3GBVA 3N75A 1NKSA 1RYBA 3F9CA 3QUTA 5E3IA 4R3NA 2NUAB 5FJJA 3CGWA 4QKQA 3DTVD 4KLZA 4YMWA 4II2A 4ZC8A 3E35A 4U5XA 1ZI6A 3M4OJ 4KITB 2I1VB 3FPHA 3GR6A 3QVGA 3K4JA 5F1OA 4XRSG 5JMPA 4A15A 3K0KA 1RWWA 5FKMA 1T8TA 1X7ZB 3JRXA 3JXEA 2GVZC 3M7GA 2FSVA 3TZKA 4PX3A 2RIRA 3VVCA 2HR1A 3QY0A 1ZM3A 2OILA 2PA0A 3IVXA 4X65B 1JDUA 2VJMB 1V35A 4WBNF 1RRVA 2GPAA 1SFKA 1N4AA 3S29A 1Z4PX 3AILA 3P2OA 4WZ6A 2YUSA 4V0SA 5L3SA 3HG7A 5EKDA 4A23A 4EJTA 1SPBS 3F0TA 3IXQA 4JC8A 1Y8AA 2JHAA 4YB8A 3Q3GE 1U0BB 5JS8A 5IKMA 4NU6A 1D2AA 3QHAA 1UAAA 4KSCA 4RKWA 3V8EA 4PQEA 2WTMA 3MWKA 4ZMSA 5EVJA 1BE8A 2XUZA 3JY6A 1I2AA 2HSEA 2LE0A 2IVFA 4FYXA 3ZZMA 2B4KA 3L6DA 4X7BA 5DXJA 3TX2A 4FMDB 2AOXA 3D7KA 4I50F 4M3NA 4XLPF 5K3CA 5AJVB 3PEYA 2YX4A 3DEKA 3IVRA 3OD1A 5EIBD 1NBMA 3JVVA 2E6KA 3TTTA 1NUAA 2HR3A 5CCEA 5H6RA 3O4IA 1V45E 4CHGA 4X1EA 1UC5B 3OIVA 4AP9A 4C0KA 3R5XA 1WG8A 5DU2A 4E7PA 1WDLA 2CEAA 3IIEA 4OVKA 2X77A 5EHIA 5LQMA 3LK7A 2CCGA 5EG0A 1T4CA 3A7EA 1MORA 3K0EA 3QX7A 1ETWA 2PXAA 3TQFA 1WV0A 2PQ8A 4KIUA 2QMYA 1P6QA 2Z3VA 3SQMA 4J2OA 4CJXA 2H1WA 3P9PA 1FCJA 1CUUA 1HG0A 1QPBA 3HNPA 3KCCA 4FFNA 3OH8A 5EP1A 3TSOA 3MMYB 2VUUA 2PSDA 4PDKA 3S15J 4PBRA 5HS8A 4E7JA 2QMOA 2CH0A 4IAOA 1FLAA 1V8PA 5L3CA 1IK6A 4MYUA 4BVAA 1NG6A 4JOMA 1Y7IA 1JBEA 2HPAA 2M2IA 2VC0A 3M5DA 1ZOPA 4UC0A 3GRYA 1A4UA 4XJXA 5L7YA 2G9ZA 4V0NA 5IDVA 4XIIA 2QQ9A 4MVXA 4NCHA 4ZWNA 4IFTA 3FZVA 3QIAA 4F2GA 2DGDA 2NVXJ 2AFVA 2HQOA 1IM5A 4MVJG 5ILUA 2WB1N 1XZBA 4KR7A 4ZT7A 2PSSA 1TLHB 5E4FA 4UUTA 2AZMA 4A10A 4F7WA 2ZVQX 4HN2A 1LTQA 2XDQB 3MJFA 3RGWS 3K8YA 3MHPA 4KDFA 4EY8A 1SRQA 4NENB 3A05A 1VL5A 4D81A 2ZMEB 1DXHA 3I9V2 4UBKA 1IRXA 3ZMSA 3HWX1 5IEBA 5E0KB 3VMMA 4Z9AA 1HEIA 2VRNA 1AU7A 2OYRA 5ECYA 4CNQA 2WAYA 4RB0A 3JQCA 4ZCIA 4CZCA 2BTEA 4FDTA 5KVCA 1AV7A 2W37A 3P2KA 2C5EA 4DNQA 3EXFB 2ZJQF 3EXIB 1G6Q1 3GLGB 3QX8A 5HF9A 3GFFA 3PQJA 3A1UA 1OFIA 2LVSA 2PGLA 3RVJA 3PVSA 2H2IA 4YRBA 2A68F 2R5YB 1U5CA 3GAAA 3NUGA 4IH9A 2Q45A 4M0MA 3DPLC 3AHHA 3H1CA 3H3JA 1LBHA 5JARA 4IRHA 4J4TA 2QR5A 1A8QA 2HSDA 3PR1A 4MLPA 3GDHA 1TGYA 4CEIA 2C92A 1TMGE 3BD8A 2AUMA 5JVGF 2V4UA 3BB4A 3G0BA 4LDAA 2DCEA 2AR9A 2IUUA 4CLXA 3L1JA 5CFMA 1C7JA 4L78A 3CCYA 3ULKA 1PV4A 1A76A 1NXTA 1U3CA 2HO5A 4AKTA 2CXUA 2AYYA 1G41A 4EM6A 4B4VA 1XZKA 5CT9A 5BSMA 3ZD9A 2FW8A 2QVCA 2XB2A 1R5GA 1G7CA 1MGTA 2DBYA 3H0GJ 1NA5A 2MOKA 2XNSA 4QXOA 1TCCA 3MAJA 2VUSA 1JAHA 1X7HA 1UOOA 2EKZA 1LUJB 2W6JD 3HS3A 3HXOA 4F3NA 2LY2A 3A0RB 3PC8A 5K0GA 1EESA 2HMAA 2DK8A 1OGYA 2REXB 3PDIA 1KIMA 2I2DA 3GWGA 3ZW9A 3OLXA 1SR8A 3QU6A 3FMOB 3OFKA 3Q3IA 2LKDA 3ZCPA 3MINA 2XAFA 4EJOA 3KCNA 4ADSG 3ZE2B 2K9SA 3DHVA 5A3RA 3DDOA 1QYIA 2ZRMA 1Z08A 2X8AA 2WWYA 3KOZA 1MVNA 4DSOA 2IPQX 5BYKA 3WBBA 2YHIB 1T3TA 2WWVD 3DFIA 3PXGA 3L5OA 1ELOA 1SMKA 2WKPA 4GICA 2P6PA 2SKEA 2FUG1 4ND2A 5FPTA 4B40A 4OX9B 4XGRA 4A26A 3O8NA 3R09A 4WCDA 4XJSA 1UAYA 4JUBA 2B78A 2G67A 5DBOA 5EI5A 5C31A 4PC3A 4CEHB 1OF1A 1IOZA 4UD6A 1QV6A 1GNPA 2DFIA 1P5ZB 3HA7A 5F77A 2JLZA 1XLTA 2Y8EA 1MBFA 1NT2A 5CYFA 5C8VA 3G7SA 3NXKA 4G97A 3H4TA 2VHVA 5JO0A 2XWJI 5NULA 4BO1A 2QJRA 4MUXA 4MDHA 3S6JA 3OIUA 4CUJA 2H57A 2JD1A 2R85A 2EBWA 2RAEA 2FWIA 2G70A 2VDJA 1GYPA 1U9IC 1DCTA 2VLBA 3NPMA 4OMDA 4LYYA 4CU2A 3CEMA 5IN5A 2O8EA 1IM8A 1P6RA 2EOAA 2STWA 3K6KA 5AJWA 3PLRA 3HTXA 1YE3A 2QVYX 4FWTA 3B6MA 3BWXA 4PPFA 4ESOA 2HCRA 1DIGA 4FFRA 5FA8A 5DWVA 1DX4A 1P17A 2NO0A 4CM9D 2OD5A 5FUBA 1N0UA 4UU8A 5KOHB 2PGOA 2ZE7A 2TMKA 1OR8A 4FLFA 5DTMA 2LP0A 3FOBA 3KFXA 3E6BA 1P0CA 1AU9A 3FNQA 4BKOA 1NFRA 3H9UA 4YXFA 7MDHA 2JRMA 2YY7A 3EGCA 4I8IA 5K7SA 1VQKI 3GC6A 5JCPA 1V5FA 1W4ZA 5AYVA 3HZJA 1T10A 3HU5A 2X9LA 2O2XA 3AU8A 3OFJA 2IPXA 1BYIA 5FPHA 3NAUA 3HZOA 2XCUA 3MIIA 4RULA 2ZBVA 2JJ1A 3MZHA 2JQ7A 1G64A 3HB1A 1B4DA 3QTLA 5AXDA 5JAPA 2XNJA 3WWCA 4DWVA 4OY3A 2O0LA 1OFUA 3C3BA 3FWPA 2C3UA 3SHOA 5IYCJ 3AJ9A 4PRKA 4K6HA 1BO6A 4E03A 1K08A 1AF4A 4JVMA 4RMHA 3KSBC 1R1VA 4L2IB 1QFJA 2Z5FA 3BJMA 1Y7LA 4I4TA 1S5LC 2V7WA 2G72A 4Q4JA 1T6NA 4NBTA 2FUKA 3VEPA 1TUBB 2JGNA 3UAOA 1XZGA 1EM8B 4BVGA 4L4RA 2A9KA 5J3JA 3JPWA 4HMOA 3GNLA 3CCBA 4N7MA 3ZHXA 1K66A 1OAAA 2OMEA 3UBMA 3WYGA 4DYDA 3Q1LA 1CU1A 4YR7A 1ETVA 1IFXA 3VDQA 4N0BA 5I9BA 2Y1FA 4OGGA 3U61B 3QHPA 4RH3A 3TL4X 5K7ZA 1JGTA 2SKDA 1O3QA 3RC9A 5EFZA 1LX6A 2WICA 1RQPA 2CW5A 3BSWA 4JJEA 5ECDA 5DCFA 4I1RA 3OESA 5D5QA 1E9RA 4P9NA 1LJ8A 5TS3A 5IOYA 1RXIA 3E5UA 2DY0A 2FRDC 4G0OA 2ZYHA 4H6VA 4MEJA 4BQOA 1EA5A 1ZGWA 1JLKA 1TQDA 4PG4A 1NF2A 3CM0A 4UXJA 2VK1A 1KEEB 2QRQA 2VUTA 3MK31 2IU3A 2AG6A 2Z04A 3H8JA 4I9NA 4L76A 2WJ4A 4YJ2F 3P0EA 5B6PA 3MILA 2VSQA 2R11A 1L5FA 3IB6A 4LXTA 2JVKA 2HZTA 2LV8A 1AUOA 2L3DA 1ZN8A 2R47A 2X76A 1LTKA 2UZKA 1JE8A 3PC2A 2ECCA 3DKIA 1YZFA 2EIKH 2Z99A 3DE1X 3VU9B 1SKUA 1VPTA 3W3AH 2FSGA 2Z1MA 1JX6A 1ZJYA 5GJCA 3WKCA 4AMGA 3IQIX 1MJFA 2JCVA 4X41A 4A2UA 4QLBA 5AM4A 2KT0A 2VQCA 2ZUUA 1D0VA 5HJ2A 3AEQB 2ESRA 3CBQA 3ESQA 2Q4RA 3E5MA 3NCHA 1YA6A 1G5FA 1Q6ZA 1USIA 3VC2A 4WZBB 3SBXA 4R2MA 3TTYA 3CW8X 1LK0A 1UZMA 1WE2A 5TT1A 1IK4A 2PLWA 1JSRA 3M2PA 1EJ0A 1IWBB 4KYIB 5DM0A 5G1PA 4DM7A 4YCNA 1EXDA 4OXKA 1TT0A 4KMUX 1QPIA 1US8B 4FPXA 3MGBA 1VTKA 2JFBA 5J47A 3VR6H 2EV9A 3ZDBA 2VI6A 4LK3A 5DKFA 1QFMA 1Z0SA 2XSZD 3DQZA 1NRJB 1XTRA 5CH3A 4YRFA 2CXTA 3O2JA 4A6XA 3L2CA 4UUPA 3ERCA 3E15A 1VIAA 3DO6A 3L4SO 3FNRA 4IXDA 5HMLA 2ZUVA 3IIJA 1R16A 3FDYA 1CZKA 4XIYA 1F9AA 2QA5A 3JV7A 1XXHB 2D1RA 2DCMA 3GF2A 2RONA 4IH1A 3IS3A 4C4OA 4OHMA 1WCIB 3PBKA 5ARBA 1HH4A 4RPCA 3AH8A 1BX1A 4MFDA 1RHQA 2OZLB 4HV4A 4DLRA 4XSHA 1XZCA 2QENA 4YCBA 1FYKA 5TQ2A 4BN0A 5I9IA 3DBHB 1XSDA 3MKZA 2LNBA 1EX9A 4E7HA 3GA5A 1FNDA 1OLSB 5IANA 1I33A 4D8XA 2LSOA 5F1RA 1OW3B 5CFNA 4HJXA 2ZRLA 1OCCH 2STTA 3CH4B 4UNNA 4K9NA 4DIFA 4L85A 2ZWOA 3AZOA 5KQSA 1CWUA 5AOVA 4Y9RA 3TLJA 3B6JA 4CMEC 1NAIA 2P3QA 3BBLA 1JYSA 3FPLA 3KELA 3NBKA 1G20A 2YJ3A 3O1HB 5JQGF 3LSKA 2A2ZA 1Y89A 4JLBA 5EHXA 4YRCA 1GEEA 5FKLA 3CNLA 4DAEA 5EGOA 2OJED 4EI2A 1ULAA 1HKQA 3DVLA 2X23A 3ZH2A 3SR3A 2YYYA 4INOA 1KBOA 2HWVA 1Q0PA 2BH2A 3E48A 1EFKA 1ST2A 3BTSA 2MCFA 4UCFA 2ZJRF 1BI3A 4K9MA 3AG2H 1E2MA 2G17A 4N5LA 4F12A 1AXEA 1TTTA 2BGCA 1H3NA 3HADA 1QFYA 4C6HA 2EFWA 4I46A 2FDRA 2VJ4A 3LJKA 4Z9XA 3I6ZA 3BDDA 5FWNA 3L0YA 3PNKA 1W4BA 4B7UA 3W5HA 5IBCA 1PWZA 1TLFA 1VQ8I 1YFZA 1XG1A 1KETA 2CMHA 4IWNA 4KVZA 4KH1A 1CJMA 1E8MA 2DA2A 3RJTA 3N2LA 3LL4A 3QV1A 2DQYA 3DZBA 1A2OA 2OKGA 2OGTA 1MZBA 1E4YA 2PJRB 1P73A 2Q4TA 4CM7A 4M60A 2BHLA 1R5JA 5J1RA 2ZI5A 3IA2A 5M34A 1T5HX 1QKKA 2AOVA 5J2TA 4RQAA 1QHEA 4TGLA 5HLTA 3GJ8A 4ZVLA 4F72A 3TOSA 2NVUB 3K92A 3L9WA 4M9CA 4K8OA 2K9QA 1XTUA 5LOVB 1BDHA 1GAEO 2DDAA 2W00A 3DA8A 1Z29A 3ISVA 1Y7HA 1K3TA 1OJLA 3BZBA 1RCUA 1OROA 2UUCB 3BAZA 3LLUA 2Q7DA 3DS8A 4HH0A 3MS7A 4JBNA 3BDVA 3ZI7A 5BSVA 5LNK1 3R9WA 1CUEA 2YZNA 3USZA 5DYTA 1E7QA 4DLBA 3S2GA 2Q1TA 4PK4A 3GLIB 4F52A 3VYTB 1G21E 2C5FA 1NUSA 3A2NA 1GP2A 2CSXA 4KE9A 2F59A 1NX9A 1PGPA 1BRTA 3ILVA 3CH5A 3MD2A 3H2ZA 1W75A 3DUFB 3K4MA 1LW6E 5H5JA 4DPKA 4E4HA 3CNEA 3LVRE 1HDPA 3IJRA 4B4CA 4RLFA 1HORA 2A59A 3LBNA 4U7TB 3COZA 2PWAA 3M1IA 3O9ZA 4QE3A 1NU6A 1S0UA 3H1AA 4AVPA 2H9AA 2OA4A 4G0WA 3KZZA 4LHSA 5TEWA 2EV0A 4IHTA 4Q9AA 3IMEA 1B0ZA 1U0OC 3HYCA 3SU8A 3D6MA 4MI1A 2YVAA 4W1RA 3WX0A 5IASA 1I3AA 2AMVA 3KYBA 3DWEX 4PFKA 1R6TA 1QANA 3UMSA 1CUWA 3JQ7B 3WFJA 1ZGHA 3OYLA 3F6CA 3TTXA 4FDAA 3PFCA 2XQKA 3V9AA 4AJ4A 4UBIA 1TADA 3CUUA 1I6WA 2BFEA 4MYTA 2H27A 1UPTA 3CKMA 4PSXA 1T9AA 3HGMA 2PMFA 3WE3A 1I2DA 3GHHA 1T0FC 1JUSA 1K5HA 1P31A 2GYWA 1ESMA 4KZKA 2HXGA 4GWKA 4XRGA 2J9ZB 4JQFA 2HMVA 1ZNXA 3OMYA 3WTSC 2VEDA 2XV1A 3ORFA 5IZ4A 5E7QA 3DTIA 1TF7A 4KLNA 1IRZA 4IYRA 4XARA 1LE8A 5EJ7A 1FDUA 3IVCA 4A0ZA 2XF2A 3SSNA 4D9EA 4ZYWA 1P4XA 3HUEA 1T1EA 3ZQJA 2DTZA 4EM1A 5KX5A 1T6SA 1NNI1 3EHEA 2XYGA 2AN3A 2QLLA 2LF7A 3IULA 3KVOA 3W2WA 3PNOA 4IDEA 4Y1RB 2HTFA 2H07A 4Q4HA 4IEIA 3WG9A 3NUZA 4J9UE 1A5AB 2O6GE 1L3CA 1ZRMA 2PL5A 4L02A 5LM3A 2JGDA 2DYSH 1JWBB 4FFBA 1XD8A 2ZGVA 1L4UA 5DW3A 2I7CA 2JPBA 4CGZA 5JDCC 2KPMA 3Q11A 1R1TA 3MB5A 2E5WA 2QVOA 4AJ2A 4EUFA 1VHWA 2D5CA 2FQ1A 3OIQA 2EFCB 4FOSA 2E4UA 3GD7A 4J07A 1PJZA 5COAA 2ZRCA 2X2OA 1GKIA 1PK9A 4W9NC 3V4VB 1W47A 1TL8A 4HJRA 2ZQYA 5EWLB 3I6MA 3P9RA 3DXJF 1V1MA 4YRAA 3HRUA 4ZVTA 2VXCA 1ABFA 4PZDA 1KPIA 3QJ5A 1TQ8A 1KJYA 2HYFA 4KWEA 4RYLA 3U7QB 3GT0A 4NK5A 3V1KA 4B35A 5FEMA 1T0HB 4XH9B 4B74A 4AAYA 1BJZA 1P1BA 1P4SA 4F6CA 4OI0A 3ZYCA 2Q49A 4ZVKA 1PZHA 1BH2A 2AOUB 1NBMD 2SICE 4B4OA 4ZO7A 5CPFA 1N34B 1EWKA 4ZI3A 3R60A 4H6PA 1USWA 4QTXA 1SC6A 1KZ6A 1C0EA 3D5TA 1CNEA 4ESFA 4O6JA 1B41A 1HBXG 1N7GA 2BGIA 4IKPA 1BGXT 3NANA 4WZAB 2B6NA 3EAQA 3RWOA 1FSPA 5DIFA 1M33A 2HJSA 3N97A 4W5TA 4J3JA 4HDVA 1UWKA 4TZ6A 4ETWA 3AY0A 4LK2A 2WIFA 1SUWA 4P80A 4HB4A 1K79A 2VCEA 1J2XA 1E64A 2WM2A 4N39A 3HB5X 3ZEAA 1SHJA 2PA3A 1GTRA 1Q22A 1CV2A 2A67A 2YN2A 4LOKA 4FCCA 4PZCA 4QOIA 1S7AA 1RKUA 2KWIA 5CLQA 1KMCA 5JAOA 4CQMB 5JXHA 4X97A 1W8DA 3KYDA 4XKVA 1U8UA 3CQ9A 3GW8A 2J6IA 2ZAOA 3D2BA 3EFOA 2LKCA 4N1AA 4WGGA 4B8WA 3PZBA 4X1YB 2VYNA 4JGGA 4I55A 2CXHA 1DKRA 2O1XA 2X5JO 1ZK4A 1XK6A 3R5FA 2H31A 4KR2A 3DTKA 1CPYA 1PIWA 1W19A 4EJSC 4PO3X 3LY9A 3W5VA 1NHWA 1GPJA 1SBTA 3JQQA 4RGYA 5FPYA 3F7NA 5IXYA 3GB9A 2DKFA 1D1PA 1PJCA 1B72B 4JGIA 3G3ZA 1W34A 1I3KA 1P1FA 3HA5A 5M3FJ 1DINA 3MNFA 3OCZA 3WRYC 3AFIA 1TT7A 5E9JA 4IGIA 5TQJA 4D2IA 1FC3A 1V25A 2XE6A 3IP8A 2W6MA 1EVZA 5D1HA 4O4IB 4EJSA 3BPSA 3ZVKA 1V26A 2JI6A 4FGJA 4IHKA 1UFQA 3B6KA 3C6MA 3H9CA 1UAGA 2IGOA 4C6TA 4YMLA 3OIOA 2YDXA 5BSEA 4CWAA 2WSLA 2RI0A 5HGJA 1BD4A 3KXLA 5A4FS 2ZRKA 1OX5A 5FV7A 1AN9A 4YJFB 5HQ3B 2ZTMA 2A94A 4UNRA 4L6AA 3ULQB 1PR5A 1ZXLA 4B17A 1IY9A 5K3SA 3X43A 4GX5A 2EFJA 1T5DX 2TS1A 2WR8A 5HEKA 4OGFA 3RIMA 1R15A 1ZRNA 3C3KA 4WXYB 4EGYA 4F5YA 1JPJA 3EUWA 4CDGA 1UDCA 1E20A 1XNGA 4D5GA 4HX2A 1P60A 3OYIA 4E6KG 3NC4A 1JKOC 1A8PA 1WBJB 4L5IA 3BTUA 2NO6A 1TP4A 1ZUIA 4M6VA 2C6YA 2PYIA 4N9QA 4M36A 5D6NA 1DUSA 3OBBA 4AQDA 3KJHA 3TOBA 1ZRHA 2WUFA 2X4GA 3HTUA 4PC6A 4AG3A 2LFBA 1LS6A 1E3LA 1POXA 2A0YA 3M3DA 1H89C 3OYBA 4M0EA 4WN9A 1KDRA 4YJHA 3RSLA 3U1BA 4B2IA 3K0FA 1QLWA 4Q1VA 3U44A 2QQ0A 1JHPA 1O96A 3C3WA 4F55A 5CB4B 3FRIA 3PUXA 3TLMA 1GNSA 1KRXA 4GOND 3OPYB 4EUEA 4HUTA 2VTDA 3DJFA 3A1DA 3R5JA 1UFVA 4JJKA 4GMHA 5A5GA 1PSWA 5AVYA 1QQAA 4AIKA 1SVWA 1BMTA 1JG3A 2Y9YA 1RI1A 4G5RA 1G8KA 1XCOA 4KPUB 1OX6A 4ZV7A 3RJMA 3T7CA 2BR4A 1TECE 5FAXA 3NOOA 3UGKA 4CIWA 4WA7A 1YE9A 3HA3A 2OLKA 3CRMA 2EFEB 2ZYDA 4B9AA 2DBRA 3WWPA 1H4TA 3DL0A 5AVSA 5AUPB 1Q3KA 2O1WA 5TB5A 4UFPA 2IS1A 1QX3A 4DV4B 2HU8A 2W2NA 2YCBA 4NZOA 4YRSA 5K20A 1NM5C 3DOHA 2XGJA 3BLYA 4MUYA 2J32A 4IPTA 2GHQA 2XMGA 5KBYA 3C5EA 3D8UA 4LC9A 4OEHA 5HZMA 3LM8A 2FN4A 4PGMA 4FIZA 1Z4NA 2ZSIA 4MV8A 5TARA 4BO6A 2YWRA 1JKPC 3JYQA 2TMYA 1DEKA 2ZSFA 3LLSA 3M6VA 4E7KA 4AW9A 4D9KA 3TLGB 2B61A 3T7IA 3LXMA 3QITA 1DBSA 2MIIA 3R40A 4FDLA 4L0QA 3PHCA 1PV2A 1C3VA 3VSAA 3T4UA 3H8SA 4OOIA 5IU6A 3JAWB 4H0CA 1Q77A 1DEHA 2GF0A 3FMFA 4JJAA 2WBMA 4ND7A 2DMPA 4TTPA 4RGSA 4UOZA 1Q15A 2FN9A 5GMOA 1ML3A 2CFIA 2NT3A 4YCSA 2BE9A 4ND4A 2ZCVA 5ERIA 1Y39A 1ULSA 3HEFA 3KJFA 1BQ4A 2UVDA 4WZZA 5F35A 5HKOA 4DYRA 3RU7A 1XMJA 1WO8A 3INGA 1F1JA 1KZ7B 2QZ9A 2WYUA 1DADA 1O1YA 1MAAA 4G0MA 4M9UA 3ROPA 2HWYA 4HNRA 3KAJA 1H5NA 3ND8A 3AHIA 2KJQA 3PPIA 2CBXA 1TI7A 4UNOA 2Q50A 5BSRA 3V4OA 4BMZA 4O2BA 1B23P 4EPXA 4GEKA 4YRNA 2QBYB 4PRZA 4Q4DA 1T2UA 2Y0BA 3F6EX 5DEQA 3DGEC 2XMPA 3U6KA 1RU3A 4EUKA 3LSHA 4TYPA 3IDQA 1T13A 1MO5A 4MV7A 2P6MA 2XGOA 2HWWA 2GBIA 1OXUA 1SXJB 2W11A 1IEQA 4RO0A 1SKBA 2C77A 5JUWA 2GCOB 3JQRA 2B20A 2JCXA 2B92A 4V0ME 5FLKA 3SG0A 2ZETA 4DILA 2PMHA 5I48A 2XUHA 1K2VN 3NT5A 1JL3A 3ABTA 3FWEA 4DJAA 1L4KA 1L5QA 4LSZA 3C7TA 4DVJA 4NCAA 4A6EA 1R0CA 2WVGA 3GLIE 3HR4A 3VSBA 4CG1A 4QARA 4JVNA 2I76A 4RPIA 1XC7A 4CIVA 1KZHA 2WJZB 3JR3A 3T94A 3K5PA 3HH8A 2C9DA 4M0FA 1G21A 4EAAA 4N0EA 1QIDA 2A5FA 2OBBA 3M3HA 4EL0A 2JAHA 1YR9A 3SZGA 1Z1DA 4ESBA 2WNSA 5CNJA 5DTJA 4ER0A 4F7DA 1G4DA 1L4FA 2Q4DA 3SLKA 4BP1A 2PD3A 1MJHA 2OAGA 1BE6A 3L05A 3MMZA 3OKFA 3ZOKA 3S99A 1S2GA 1AURA 2MDTA 3UFXB 1MX9A 3GEGA 1HOTA 2CB0A 1M2HA 3GZNA 2EV5A 2X15A 1LFAA 4A92A 1KY3A 5BYBA 4KGXA 1HE5A 4UHBA 1NRIA 1XTIA 3AVQA 2ETHA 1G4UR 1OHHA 2VYVD 1BVUA 4O3FA 1U02A 4ZVVA 4OA8A 3SD7A 2BGRA 3URMA 5K7HA 2EJCA 3G1OA 2O52A 3LZCA 2HKOA 4BB6A 5LGNA 2QXUA 3I2YX 4OOEA 4DXAA 5KNDH 1YBHA 1ZICA 1C9YA 1W2HA 2WD7B 2Z3ZA 5BWBA 1Q21A 1ZA2A 2JZCA 3EF0A 1GQFA 1JW9B 1AVTA 3PQ4A 3U7HB 1A69A 4HATA 3D7RA 4MMXB 4MS1A 1KEZA 5A7FA 4EGJA 4JUCA 2CXXA 4D9JA 2B7BA 3EK2A 4YEDA 5BV8A 3BG9A 1DELA 1S2NA 1SHZA 2PZEA 3B1YA 3OY7A 4HAYA 4J1NA 3HV2A 2FBIA 3STVA 2E5NA 1ZUD1 3BFKA 2H18A 1K83J 2B9VA 3AV0B 3M82A 4CHUA 1TYAE 2GN0A 4HWKA 4LDJA 4JT9A 4ZT5A 3TNDA 3WMGA 3NH9A 2G9QA 3VKGA 2WYHA 3WQBA 7REQA 4KQGA 4U7DA 2QKLB 2HVRA 3H1GA 3R5KA 3ITDA 4I1VA 4E08A 2XTZA 1TRHA 3VUEA 4LG0B 1MLDA 2DA4A 2CFCA 2P81A 4XXHA 2VNHA 4I98B 621PA 1Q7EA 4O08A 2FTKE 1CRQA 1T6YA 3FA2A 5CDGA 5AH0A 4FDMA 3MOSA 2MSEB 4H3HB 4N3BA 3QXSA 1WB9A 2ZAIA 3N5CA 1FQOA 3GGJA 4JQZA 1M0SA 3EMDA 1OBHA 4O0LA 1Z6PA 3ROXA 2JLAA 2UZ0A 4MWOA 3RE1A 1GADO 3KK0A 2DMQA 2L4MA 2BFOA 3KYIB 1U4SA 3MAGA 5JU6A 2HDOA 2ZNZA 1QCCA 3QEBZ 1X39A 3L02A 4H7KA 4W9RA 1LFPA 3KP6A 2WA0A 1ONSA 1QFXA 2A0WA 2Z5VA 5IUKC 2C7OA 2EWNA 3S2FA 5H20A 1L5HB 1ZZEA 2RHDA 1FIAA 1ADBA 3JYLA 3ESRA 1GPH1 2AD5A 5ITVA 1N33B 2M4GA 3U6BA 5LN1A 4PZ9A 2PCJA 2GNAA 4V38A 2IUFA 3OJOA 3Q0VA 3HB4X 1P0MA 4HX5A 3OOWA 1ODCA 3C87A 3IT0A 2DT7B 4QA9A 4YRLA 1V0JA 5EXSA 5CEJA 4U6SA 2BT4A 4B3HA 1RRGA 4F4JA 2QBYA 2CMGA 2J41A 3I56I 5C5DA 3TMAA 5C4GB 3ZE1B 5C1BA 1RP7A 4YP7A 5TF4A 5D5XB 1DAMA 2DQLA 1QUEA 4OXIA 2EKBA 3DD5A 2EU8A 4GYIA 3H1FA 2J9RA 2JKZA 3AESB 4QL3A 4RFLA 1AQYA 1TM4E 4TMXA 3UZUA 1FPQA 1NW3A 4QT4A 5FRNA 1E62A 1IN8A 3P19A 4Z6YA 4XDHA 4YP5A 4FOLA 2Y99A 3CIOA 4KUGA 1CZOA 3FUWA 1T26A 3TD6A 4Z2YA 1FOEB 2GEVA 4J43A 3OQNA 3HA2A 3QKUA 2RVCA 4F4CA 4GXOA 1PTJA 2OLJA 4FC6A 4BKMA 1W30A 4KR3A 1IU9A 3PPVA 4V0KA 3FCOA 5IAKA 1E8NA 3ZCVA 5E8RA 1BIAA 1N75A 1ZNQO 3F3KA 1PZEA 3L43A 1UPAA 4IDQA 4A8JB 4KAXA 3H65A 4QNMA 2VDKB 4FQ7A 5D8DA 5AD1A 3PNVA 5CXSA 4KPGA 1BBYA 1FZPB 2O07A 1SCUA 5LOVA 3D0KA 2PQ6A 5BV1A 1NVBA 3PFNA 2QPLA 5BN4B 2J5OA 4CM4A 4RK7A 2ZI3A 2GRJA 1HT1E 3AF0A 4ALJA 1RRCA 3K0AA 3DCNA 3FXLA 3VO8A 5EJ4A 3FCXA 1I7SB 1SG6A 3BG5A 4MUHA 5JD4A 3MLBA 3GEMA 3KOMA 3D7NA 4HXEB 2FJUA 1VHLA 2QIPA 1UEJA 3FKQA 1DTWB 5L3QB 1VHTA 3GLTA 5JTTA 3PVCA 4GZ3A 1YZHA 2C59A 2HIMA 2F5DA 3A3NA 3D5RC 1K6XA 2R7AA 3K20A 1YZGA 2OG2A 1KMHB 1LNZA 4KN7X 5DUIA 1PG0A 1Z8HA 2C2ZA 3CO0S 3MLEA 3NIWA 4FEYA 3MTQA 1VGVA 1QNFA 5FL7D 3VV3A 5C3EJ 3W8NA 2C5GA 2K3PA 3HUTA 4GM4A 2M6KA 4BLTA 1E3JA 2CGPA 1H6BA 2GPJA 2OUMA 3IVGA 2CLCX 5IFKA 4P54A 2LDBA 3PPYA 5BNGA 3RARA 3BP8A 3QE2A 2BMJA 3W8FA 1ZVMA 1XTSA 1XLWA 4IGAA 2ADOA 4LHVA 4CL8A 3FOFC 2G9WA 2IYTA 3KKZA 4DQ0A 2J0UB 3NG1A 2V8BA 4JNCA 2FZEA 3M70A 2XGGA 4M0UA 1TAGA 1FT9A 3L7KA 3EDOA 3Q87B 5K3DA 1SC1A 2ILTA 4C0HA 3KLMX 3LDAA 3QU7A 4O4LB 5B53A 5JYDA 2NS7A 1WHUA 4H7JA 2C8VA 2DRIA 4L6IA 1MOSA 3P2MA 4E1AA 4FBGA 3RAGA 3EDYA 3VPHA 2M1ZA 2SCUA 3F3SA 1P74A 5JZVA 4KHPB 1NVDA 1PSDA 1V16A 3ESYA 2C2KA 3BRWD 5F1KA 2I2AA 4FOTA 1LSJA 1DJNA 1PS8A 1K3UB 3R3XA 5HZKA 2WQ7A 3AI1A 1VBMA 2Y1OA 2D1SA 1XLTC 1HA8A 4PYLA 1M0EA 2R1ZA 1DI0A 2P6TA 1YBMA 1GL7A 4O4LF 10MHA 3FHTA 3TAXA 1C9KA 4RF3A 3ZGKA 2HMUA 1XDBA 1GPLA 2XZLA 1B1BA 2HBRA 2WRZA 1GDTA 3ZVLA 1RAEA 3F5FA 2ODNA 2VSNA 1UKAA 2XE4A 4IIBA 1E3WB 4Z4EA 1I4OA 5DK4A 3ZWPA 3GLXA 4B3XA 3G5TA 2O6HA 4L73A 1JXAA 2D7JA 2DVMA 1BMDA 3HKEA 3NYQA 4BZZA 3LY5A 2XCSB 4HQEA 4IMJB 4EI9A 1ZM7A 4U7HA 3A70A 3L07A 4K81B 1RQ2A 3G3EA 1G8HA 2CG4A 1OXTA 4IJVA 4TTVA 1CGPA 1N5RA 2BKEA 2NZ8A 3BIJA 4TKVA 1Z75A 1YYVA 3U7QA 1G1MA 4YIKA 4L0DA 3ROGA 4JX4A 3QKIA 3RUEA 4YI5A 2PRSA 4ND5A 3WZLA 1JLHA 3M83A 4JEIA 4HPWA 3K1TA 2XB5A 1J25A 1ODFA 4HX8A 4IJKA 4WIAA 2DBZA 2JFQA 1CE8B 5EMLA 3SSMA 3IAM2 2Y1GA 4KK3A 5KUTA 4ZI5A 4OUKX 4AY2A 2VJAA 4RK5A 2DPYA 3VB2A 1GVDA 1PZFA 3IUBA 3LA2A 1VZ3A 1YO6A 2OV1A 2WJGA 4KQHA 4Q6WA 2HOQA 3OMWA 4ZEMA 2W6JA 3PD7A 3A7DA 4G8BA 1BDIA 3HSRA 1Z4OA 4J4HA 4QXRA 4BNCA 1KFEB 3KQYA 3N2NA 1T6ZA 4GG1A 2GN4A 1OYVA 4KSYA 4XB2A 1JKIA 4QU5A 1KWGA 3LUKA 3OVMA 5EZQA 3WDLA 1WTAA 1CLEA 1S2MA 5GTDA 1VQ1A 5HKLA 1JXQA 3CX6A 3R8XA 4W8HA 5EINA 2PXCA 4DW8A 3S1MJ 2VPQA 1FNSA 2OFPA 4XIFA 3K0CA 3EZYA 5L3QA 3U60B 5FFXA 4DBVO 5I7RA 1M9NA 3QA9A 4F97A 4LA4A 1H5QA 3V4FA 1J42A 1S6LA 4OI4A 2EFHB 2ZSBA 3SZ3A 2IOYA 2IA1A 4MYHA 1U2DC 5K8UA 2ZRPA 3KSZO 4OGKA 4KNVA 3H3FA 2JAWA 2IPLA 4TLBA 1T0IA 1YTLA 3VNBA 1XLVA 4PYKA 3JAKB 2JK3A 4URFA 1T4DA 2X4IA 3ZHQA 2YJZA 4PZAA 4A3IJ 4PF1A 3V1TC 3I2GA 3ESXA 3M5CA 3OZBA 2C2HA 4TV9B 3WK5A 3HYIA 2D8AA 2Y30A 3WU1B 1DRUA 1P4GA 1SC4A 5D3KA 5I4CA 1XIVA 5JT1A 2OFXA 3OQOA 3SP1A 3T7TA 3S32A 4BFSA 4TZ0A 1DGWY 1QB8A 4KA4A 3LMMA 1VKZA 2Q2OA 2EDAA 4X00A 5HTKA 4UM9B 3OYDA 3W5IA 2GETA 3BE5A 2X19A 3NQ41 1E3IA 3I0ZA 5CH5A 2Q2NA 1AC5A 4KQWA 1QRYA 2WV1A 3V8KA 1PGOA 2OFWA 3IMGA 3K1JA 3SGLA 5KHAA 3DL7A 4ARZA 2XVCA 4XQEA 4Z7NB 2DT8A 3ENWA 1J0RA 1KDVA 4YJGB 4ARUA 4Z4FA 5ALMA 1AK1A 3W6OA 2GEUA 2J59A 2H5IA 1ZGZA 2ZRJA 1NDUA 2X9NA 3LBFA 3A14A 1YI2I 1DC6A 2LCIA 3PCRB 1YB6A 4OB8A 2PMZA 4CUZA 2K9NA 2CCJA 3CUTA 3BRQA 4DCNA 5FOVA 4BX2A 4E31A 5E1OA 1N32B 1XD7A 5FRMA 3MUFA 2W83A 1U2SA 2NUTB 4ONEA 4OMUA 3TTSA 2HJGA 2CMDA 2F90A 4IDCA 2I03A 2NS8A 4DMLA 4DRXA 2X8LA 3COJA 3QUCA 4KN6A 4AZVA 1WABA 2BGNA 3WWZA 2NO5A 1WCXA 2P35A 2R0QC 1IJKA 2L0KA 1VTNC 1E2QA 1JDTA 2ZJOA 3NHWA 4UQOA 5BQTA 3OCJA 1GPMA 1Q3TA 4YRRA 2QPOA 3ES9A 2DULA 3TDKA 2JH3A 2V45A 4I5EA 2OZ6A 3GT4A 1ZMOA 1Z4QA 4LJ4A 2FPWA 1MKYA 1WDKA 3VUFA 5K0FA 3W5JA 2ZJBA 1GSIA 2VODA 1PG2A 3IH2A 1HKUA 1FPMA 1BW6A 3OLZA 4YJGA 2X6XA 3NETA 3W6NA 3H1PA 1T3SA 2AC7A 1AHDP 2BONA 2FXVA 3PHJA 4FS8A 1D2CA 2I67A 1JU9A 4O4IF 4P7BA 1LFUP 4PV7A 4RWEA 4PEVA 4UAVA 1BSVA 2CFXA 5IT9K 1Q95A 3K6RA 1WW3A 3QLVA 1U0NA 1GV0A 5KNCA 4IVQA 3S2YA 1KVUA 2Q6VA 1OFUX 3H6KA 3IEUA 4NI5A 1RQ7A 2WJJA 1X1RA 2GD1O 4AF8A 1UKBA 4PYOA 4EHIA 3C74A 3EJ6A 1BXGB 2ZJ0A 3KQLA 4CL0A 2A07F 2XB9A 1M6YA 3PHGA 3MT9A 1CUDA 4LJAA 1U6IA 2QX4A 2FX0A 2NLOA 2YVQA 3IEKA 2VCYA 2OAQ1 4ER5A 2BCGY 5HF6A 5BV7A 1LDGA 3L8HA 5A0TA 2J6CA 2HPMA 1XVIA 1FYMA 1CBUA 1FDVA 1U8XX 1XD2B 3DCFA 3AQ4A 3NWOA 5BSUA 4EG5A 5FORA 4Y2XA 4OYLA 2NADA 3GDOA 3KT3A 4K05A 2NU9B 4KN4X 4HLQB 2FZVA 3MTDA 4BZWA 1ULBA 1FBUA 2YICA 2E1OA 1AQNA 2A9PA 5EMMA 1FTSA 2CU7A 3TKAA 1DHTA 2YZMA 4O5AA 3BDIA 3RTDA 1E0SA 3HJRA 3THYA 3KEMA 1BXRB 1TLLA 1C14A 1G42A 1J75A 1YJQA 2I6FA 2X85A 2JA8J 2JBAA 3L6CA 3MJDA 3G59A 1FFCA 1FFSA 4R68A 4JGBA 4CQLB 1TTHA 3GJ6A 3SYNA 1E4EB 5L3VA 4FIDA 4XONA 1WPRA 2FSPA 3EBPA 4AY6A 2BUAA 2MGQA 1IAVA 3M1LA 3U4QB 4H59A 2G1PA 1SZDA 3IPXA 1YRHA 4TN1A 3ADBA 3WGGA 3Q5FA 4EUNA 1MAUA 3COSA 1G4AE 4Q21A 3KP5A 5CH8A 2PS9A 3T1VA 4AC0A 2Q4BA 2AOWA 3GTMJ 1XTAA 3IDZA 1KZ1A 1QG2A 3O3CA 3TJRA 2BFMA 3JD1A 1MGOA 3LVQE 2AOUA 4JFAA 4NS1A 4X8OA 1DGRM 2Z5LA 3RZOJ 3MG9A 3R0QA 2XZPA 4WNIA 4R8KA 4XM2A 1OFTA 3ZQ4A 4EHLA 4G25A 2KB0A 1SY7A 4JBWA 5CK5A 1J23A 3HEMA 1ITYA 1UPCA 2D2WA 4OLJA 4F6RB 4ZTUB 4DW6A 1AKYA 1UXOA 4HMQA 1O95C 3IQFA 4MS3B 3ICEA 1G7TA 1R5NA 3PG5A 5EWLA 4Q12A 2BUCA 5KSOA 2JLWA 3WJ2A 1YB7A 5A6VA 2PUAA 3HGYA 4BNGA 2EX1A 5CX4A 3UPDA 3C0KA 5CURA 5K09A 2H4ZA 3ZDZB 2W6OA 3DTYA 2VNSA 4KFSA 3V46A 1NQ5A 5A5FA 2P5TB 1DBRA 1A77A 1MTOA 2B69A 2HHLA 1TZJA 3QF4B 2UXCB 3EZ7A 3L18A 2JGMA 3WI7A 3PGLA 3SIRA 1M34B 2I33A 2PQMA 3PKZA 2LREA 5G41A 2XA2A 4BU0A 4EMUA 4RK4A 5E3MA 3SZPA 2AS5F 1JHMA 4DZPA 1KJWA 1TOAA 3B7PA 2CDNA 3HJTA 3K1ZA 3MGCA 5HQJA 5K4HA 3A1VA 5DB4A 3R0ZA 4UHDA 4Y3OA 3QPSA 2HWXA 1LDJA 1MA3A 1KAMA 2CNWA 2M9MA 4Q1AA 3VOTA 2FWJA 4B4WA 5GINE 2J0QA 4BEJA 2J45A 2PLNA 4MO9A 4CF7A 2AIRA 4N18A 4BGDA 4RAGA 1U5BB 2F17A 2EF1A 2EAUA 4EWLA 1QHHD 1DUVG 2GWHA 2QL6A 3OCYA 5BOSA 4X6UA 1BRMA 5SZHB 3A1SA 2KIFA 4Y7CA 3TDNA 4B84A 1HW1A 2QNIA 1ML4A 4B3CA 1UBHS 3EF3A 2A1IA 3SKVA 2J31A 4R69A 3WLTA 2QGNA 4HZFA 3GTPJ 2NZJA 3KV1A 3QWFA 4BDYA 4K9SA 4OP1A 1Z05A 2I6QA 3BIOA 2HJ9A 4C5AA 4P32A 4EVQA 4RS4A 3L8GA 5FOQA 4Z86A 3H11B 2ZUFA 4GBJA 4RIHA 4G12A 5LA6F 2AFHE 4UTVA 3A0BC 1CEQA 2QP4A 3IBFA 4MRSA 1PU2A 3I58A 2V7GA 2HSZA 5LWHA 2Q0QA 4UBOA 3ZU2A 1TRKA 2Q2EA 1XZLA 2NO7A 2WSBA 3FKSD 3MM4A 1C7QA 1E5VA 3ONEA 4DMUB 1T8SA 5LPNA 2H1IA 4RZQA 5IKOA 2JPDA 3AU9A 7MHTA 1PP8F 2E35A 1G3UA 1MSEC 1TU4A 1IZ9A 1PUJA 2WYOA 1EYZA 3C15C 1PJTA 3LC2O 4P0PB 4A9AA 4A0XA 1YS9A 4XUGB 3BA6A 5CR9A 1LLFA 4ENPA 4IS3A 4NU0A 1FRFS 3R7WA 2O3QA 5BRAA 3VH1A 1BEEA 1BMQA 4Z4HA 4XD7D 4NNJA 5JI6A 2XY4A 4B71A 3CWQA 1E32A 2LPMA 1DDIA 2VIIA 1U2DA 1XNRB 2R84A 1XVVA 1H2HA 1PZGA 2FW7A 2ZITA 5KOIA 4CMGA 5KOYA 1TQMA 1XN4A 5AONA 1ZC4A 4RHYA 4QXMA 3ZGVA 4Y7DA 1RC0A 2H09A 3AEKB 4BRZA 3VJMA 2HDWA 3FXKA 4GP7A 3TRJA 1CEXA 1G1AA 3RTAA 4DJDC 2YJTD 3I8XA 3OLWA 1W85A 5FO0A 2V0NA 3HUUA 1UBRS 2H7CA 1XKTA 5FBRB 3FOWA 3PSFA 1ZUHA 3KZIC 1CUZA 4W6ZA 2CUNA 3MS2A 3OPNA 1FUEA 1OFGA 1OCOH 1SD4A 2ACJA 2JI7A 4CEHA 2JAUA 1FQJA 2OUIA 2VSXA 4BX8A 1QKJA 1QTQA 1BW9B 3CLTD 4LXIA 3K6GA 1WF6A 4B48A 2YWJA 4J90A 3MWMA 3L1VA 4Q9JA 5A3VA 1CIVA 2P6NA 2GEFA 5CB4A 5HDQA 5EWJA 4C4PA 3CZCA 1E96A 1LVKA 1G20B 3K31A 1TW3A 4POAA 4L0ZB 1JEEA 1BWQA 1GU1A 3RAEC 1IAQA 3T4XA 4YTEA 3Q2OA 1G8FA 1FFBA 1SXJD 3PICA 4MGYR 1UF9A 5HKKA 3ID6C 1ZN7A 3HFJA 3OT1A 3L7IA 3BCBA 2CL5A 2NVUA 4XI9A 1FUIA 2FP4A 3F2VA 1LKXA 2E1NA 3LPMA 4K46A 1HDRA 1F5TA 3LXRA 3WGIA 2BHNA 3UM9A 4DCOA 3PI6A 2I54A 3KP3A 1LBTA 1RWOA 4K3VA 4HAVA 2F43B 4CYDA 2LGJA 3OQIB 4D4LA 3ORRA 3VZBA 1ORWA 2I80A 3LOUA 2OSVA 3TR5A 4QPNA 4AG6A 3D81A 2WKWA 1UHMA 2CC2A 5HODA 2Q8KA 1YR3A 4MQEA 1QH1A 4ECEA 3JRAA 1WSBA 1NZDA 1XHEA 4PO1A 1EQ2A 2X3FA 3O8QB 1D2HA 3QNWA 4FHCA 4H0EA 1EZZA 4YHHB 1WSAA 4BQAA 3HSSA 5KTKA 1KJ9A 1TPZA 4M98A 3S2UA 5DHRA 1RKXA 2W71A 5H68A 4K2HA 5I7VA 2XA9A 5FWAA 3ZCXA 1UXKA 2JJ2A 4JOSA 2VK4A 1OYIA 4JK1X 1ZD5A 4AJ9A 1U5TA 3OPVA 1RP1A 3TQQA 2Q1ZB 4Z2AA 4DCVA 2Z6AA 3H2KA 4US1R 4HRXA 4KWCA 5KJFA 2P5LC 3ZDRA 1D6SA 1Y3IA 2JJ1D 5AVVA 3BJEA 2QT1A 5DYNA 1ZAOA 1PUFA 1TEXA 4PBSA 1EZ4A 1ZMRA 2XGSA 1OX4B 1FRZA 4MKFA 4E5SA 2CUJA 4XFKA 5C7IO 2M5WA 1MQ8B 3TTUA 2LP4Y 1P0FA 1RPWA 3CF5F 2FQ3A 3QSGA 4BVKA 3FTFA 1EUCB 1KI4A 3F6SA 2WTAA 5FR2A 1O3TA 4F9TA 2B4TO 1GCOA 2YMMA 3BGSA 3K9WA 3QNMA 1XUOA 1J8YF 3SM9A 3GTQJ 2QTTA 3HO1A 3STHA 4OLFA 4YYEA 4NAVA 1BC5A 2IW5A 1IHXA 4PXYA 2PH1A 1HZJA 3CUKA 3ROKA 4J9VA 2CZCA 4JXXA 4ENUA 3Q8LA 1PE0A 1HDEA 3NATA 4ZQCB 4DB2A 1EUDB 4D0PA 4QT0A 1P1RA 1N7JA 2VF7A 2O0YA 4XFDA 1C30B 3C16C 4U0VA 1XMKA 5ALFA 5KSYA 1KRWA 3RYIA 2XECA 4XCVA 3UJCA 3UB4A 4FW9A 4XGNA 5KDOA 2BV6A 4Q3BA 1JTFA 4BNNA 1K7SN 2PYDA 3LBYA 4LYGA 3VSDA 2QTNA 3TTWA 2RK6A 1TMKA 5DHFA 4CCJA 3NM6B 1EVIA 4UV8A 2AOTA 3D6AA 1N78A 3C24A 3CEHA 1HQCA 4P96A 4EHJA 5E4YA 3CVWA 2V3VA 5KYWB 4GYKA 3A4YA 3W9YA 3EY9A 2D62A 5KX5B 5B3LA 2BKXA 2Q4EA 1BXRA 3QG5A 3GLGE 1NDHA 3OHSX 4HN4B 3HM9A 4DLYA 5FD6A 1KSFX 5HOOA 4DC9A 2AF4C 1WHTB 3ORHA 1IRGA 2YWFA 3GV0A 3LW8A 4JHXA 1MB9A 1UM9B 3G85A 4KO4S 2M6LA 4UVAA 1KR2A 3FMPB 3LE8A 3FLMA 3H5LA 2MW8A 1M5TA 5JD6A 2A30A 4Y98A 5AW1A 4FHGA 5KSPA 1SQSA 4UTRA 4QPZA 2KE5A 3ZDEA 1PYDA 2ZDQA 4KGVA 2VZ0A 3TR6A 4L74A 3G2KA 1WDTA 3LC7O 3UOWA 2F3QA 4HNHA 4MUEA 3UNXA 1IIBA 3CXUA 2CNNA 1CQZA 3L8MA 1NC1A 1CUCA 1ZH0A 1ZCZA 1OWLA 1AB5A 1Y0BA 3CW9A 4FMDF 4PQYA 4ER6A 4CLRA 3ANNA 5CDYA 3AVVA 3S1RJ 3BERA 4WEQA 4BEVA 2XUQA 1BD3A 1P91A 2DMUA 2YMPA 1U7OA 1SCBA 1CUAA 3H16A 3GRKA 4FGUA 2CDRA 1Z2EA 3M3YJ 1IM2A 4MKIA 3E9NA 3MZYA 1LJ9A 5TT0A 3KR0A 1ZJJA 4FU0A 3SC2B 1FSEA 2FR8C 4L5EA 4I5GA 4M2LA 3QW2A 4BGEA 1PJLA 1N6NA 3GLQA 3VJRA 4AYBA 1RUNA 3IYLW 5IP9J 3H5RA 5LHHA 3P5BA 1RZ4A 2IOQA 3WLEA 2R4GA 4I50A 2J07A 4MKZA 2PSEA 5EYRA 1UBLS 4MUGA 4LHEA 2REBA 5D6OA 1Z5NA 4AROA 2F8TA 1KA8A 2XYVA 1JUPA 1XYVA 4XKWA 2E4AA