1P2FA

Crystal structure analysis of response regulator drrb, a thermotoga maritima ompr/phob homolog
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
MMWKIAVVDDDKNILKKVSEKLQQLGRVKTFLTGEDFLNDEEAFHVVVLDVMLPDYSGYEICRMIKETRPETWVILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFLEREKKGLYDFGDLKIDATGFTVFLKGKRIHLPKKEFEILLFLAENAGKVVTREKLLETFWEDPVSPRVVDTVIKRIRKAIEDDPNRPRYIKTIWGVGYMFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of the domain interface in DrrB, a response regulator of the OmpR/PhoB subfamily
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription
molecule keywords Response Regulator
total genus 69
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2003-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p2fA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p2fA01
3O2QB 2HYFA 2KKOA 3P9YA 4W5TA 3MM4A 5J8CA 4EJTA 4YWHA 1SFUA 4F12A 1C0EA 5JS1A 1HW1A 5I4CA 4L9VA 3REOA 1BIBA 4IMJB 3NRVA 2LUOA 2RNJA 2VT2A 3RVNA 2W85A 4K2EA 1EH8A 2Y75A 3K4HA 2HOEA 3ABUA 1FP2A 3LMKA 3E3VA 1NATA 2NYXA 1ZVVA 5IEJA 1S7AA 3BRSA 1Z2DA 1X3UA 3RDIA 5FWYA 3QRFF 1TM2A 4XSXF 3VFZA 3OO0A 2QQAA 2MLGA 2ELHA 3NEUA 2NZUG 4EYOA 2OQGA 4A2UA 4AIJA 3T8RA 1EWVA 4CYDA 3WTUC 1U0SY 3QX8A 3ZMDA 5CNJA 3GVAA 4KK3A 1HBXG 3TD9A 1AOYA 5LEJA 3QLVC 2H6BA 1R23A 4N76A 4KIBA 1W4MA 2DTRA 3IWZA 2XROA 2OENG 4Y13A 2F5DA 4OLBA 2H09A 2XAFA 4L0YB 1M5TA 3QEMA 1CHNA 3QLUC 1LJUA 4KT5C 2MYTA 3I5AA 2BBYA 3GZ5A 1L3LA 3WGIA 1YTYA 3WGHA 4M9SA 4RB2C 1YG2A 3KP7A 1MVOA 2B0LA 1YLFA 4LK1F 4MRMB 2ISYA 4IRIA 4EM2A 3JVDA 5KQGA 1VRVA 3QK7A 3LA7A 3V7CA 3HVRA 2RDMA 2M5WA 3H5IA 3RVLA 4DN6A 1FFWA 2NRAC 3MQ4A 2PMUA 3HTSB 2EV5A 2H6CA 5DKFA 3DLBA 2FLKA 4IXAA 3VOEA 1Z18A 3VNBA 4CBVA 3KCCA 4LFUA 3CUQA 5K5RA 5BR1A 5LHHA 3BJ6A 1E6KA 5E1ZB 1R5HA 1J5YA 3G1WA 3G3ZA 1TTYA 4RK7A 3S2WA 4M9XA 2GWRA 1GUBA 3BY6A 2W25A 4FT8A 3EODA 1UHWA 2Z33A 1J56A 3DXJF 3MCZA 1W9HA 3J81K 4XARA 2M45A 2O0YA 1E6MA 3LUJA 4XBFA 1JDNA 1MB3A 2O61A 1D5VA 1DG9A 2X7XA 2XHKA 4F7ZA 1BA2A 4MS3A 4QICA 4RKQA 3IDOA 3RVOA 2CWDA 4G0ZA 5E8IA 2L54A 2L4MA 1ON1A 5EWLA 4F06A 1BN5A 1XMAA 4PEVA 2M98A 2ZKZA 2F5FA 4QPJC 4ML3A 2FE3A 4JQFA 3BRQA 4HV5A 2PUBA 3VB2A 3LFTA 2E4YA 1P4XA 3DPTA 3FMRA 1WQ2A 3EDPA 2G9WA 1B1BA 1E2XA 3A3KA 4FB4A 5DEQA 4RY8A 5H6RA 1GXQA 3E5XA 3CO7C 3KEQA 4JOQA 5H6QA 2LIVA 5BMZA 2Y48A 3OM0A 1I27A 3HDVA 3QP6A 1QPMA 1RIOH 2FOKA 2Z99A 2KIMA 4RS3A 4IRGA 3GBVA 5L3DA 3Q15C 3IP7A 1PNTA 1P4AA 3HRSA 2WY2D 3I59B 4BHBA 1BDJA 4HQEA 1IIBA 2MYPA 5D6FA 1ZRCA 3IHUA 5D6EA 4EYGA 3J81Z 5BRJA 5LEKA 5A2QZ 4WXCA 4BXUA 4RAYA 3RVJA 4RXTA 1I1SA 2WWYA 1RI7A 3EYIA 4EGZA 2IDMA 2EA2A 1FYLA 2DQRA 5EWLB 1HXDA 4Y9TA 5EWJB 2PJUA 3L00A 2ADUA 5DD4A 5IBQA 4H3KB 3HUGA 4WT7A 4KMUX 5JR3A 4I2OA 2IJLA 3FZVA 2JRLA 4RU1A 3N4MA 4G7ZF 3DGFC 5HKOA 4KMFA 4ESBA 4QLCU 2X0LA 2QBYB 3KTOA 2JZYA 3T5XA 3F8MA 2EFPA 2PEXA 3FMQA 4RK6A 5ABPA 5DCFA 4MLDA 3TB6A 5L3BA 3LTEA 5JFRA 2NZVG 2K02A 4G0QA 2DLLA 1FBQA 5E18F 1WKMA 3D02A 4W5NA 1YK1A 4IILA 5FGMA 1FFGA 2W57A 3GT7A 1R1VA 4M88A 3CU5A 4G0MA 2UWMA 3EQLF 3I53A 4ESFA 2YHAA 3WU0A 2VC0A 1U04A 1K6OA 1PUXA 5CVRA 2JRTA 5JVTA 1D1QA 2L18A 4OIQF 2FBIA 3ZMVA 4PZ0A 1XGNA 4PE5B 1QO0D 1DBPA 1LDDA 5DDGA 4IPAA 4UHKA 7ABPA 1CYEA 2E4UA 1O7LA 5FD5A 4ENNA 5BRAA 4HF2A 2JBAA 2RJOA 5A2QK 1RZRD 3M9WA 1HEYA 5TQ2A 2TDXA 2QR3A 4KN4X 4MR8A 3BBLA 2DAOA 1Z15A 5LBQA 1BIAA 4WZZA 4BHPA 3RYRA 4W5QA 2XRNA 1ZH5A 2ZXJA 3MQ0A 3LUKA 2EFNA 1JWLA 1KQ0A 2GA1A 3OQNA 3F6CA 3K9TA 1BOAA 4IF4A 1EV7A 3H1GA 4I0AA 3GO5A 2OZUA 2ID9A 4AVPA 3D5LA 4KIFA 4JAVC 5TQ0A 1GXPA 4LMYA 3RYPA 4TV7A 1J75A 3JSOA 3EULA 1QZZA 1STZA 3BJOA 3R0AA 1TW2A 4O5AA 1SXHA 3E61A 2ID7A 3IRQA 4G0OA 3ML6A 1PHRA 3F6PA 3CTAA 3MA0A 4RGRA 3KP6A 3R0JA 2OU2A 2ZAYA 1ISSA 2HQOA 4RAZA 4EMSA 3ZPLA 3QLVA 2Q5CA 4F11A 1EWTA 2HQRA 4QYWA 1Z91A 2BGCA 2DW4A 6ABPA 1NXXA 3C7JA 1TMYA 4G8XA 2PUFA 2AYXA 2DPDA 1RXIA 3EYYA 5D8LB 2CFXA 3QLUA 5CVUA 3H5WA 5ILUA 4GGGA 4OMZA 4N47A 4UVCA 3GFJA 3A10A 1A0OA 1NXWA 5FFXA 4Q47A 1FYMA 2QLZA 4RY0A 2KJBA 1QO0A 3JVIA 2IA1A 3OM1A 3COAC 2KRFA 3KKEA 2VOOA 4YIFA 1TW3A 3C3WA 2QWWA 1YIOA 4P9UA 8ABPA 2G7UA 3HRUA 1Z13A 4N0QA 2Q0OA 4TLMB 1T38A 2IT0A 5IX8A 1GVJA 3H92A 5FWXA 2R4QA 3FFXA 5F1RA 5T3YA 2OD5A 1Y1LA 1IN8A 4HLXA 2QVGA 5D5WB 2F8SA 1XMKA 2Q8KA 2ESHA 1IZ1A 2FN8A 2V1XA 1KRXA 5IT3A 3GZ6A 3C3KA 4D6XA 3OLWA 1BC7C 1D3YA 1T39A 1XCVA 4EUKA 4GCVA 4U0YA 2E7WA 1Z2EA 3C6QA 3F22A 4HZFA 1DUXC 4MQVA 1Z7UA 5K5OA 4EVSA 4RB0A 1UDRA 3E3MA 4YV7A 1D2AA 1S29A 1Q1HA 1KYWA 1S8NA 1CF7B 4RWEA 4ZJPA 1MGTA 4NQWA 4RSMA 4WK8F 1OYIA 1ZAYA 3RIRA 4OIRF 3Q7TA 4LDAA 2NT3A 1JFVA 4LE1A 3QU3A 2ACJA 2V1UA 2VUIB 4EY3A 2PI0A 2FEZA 1IRFA 3H5LA 2D45A 4I09A 4ESJA 2UZKA 2QW1A 2PFBA 4U7DA 3NHMA 3ILHA 1YMUA 1ZREA 1D1PA 4ENKA 4MR7B 1SFEA 1JX6A 4HV6A 4EJOA 1OXBB 5FBHA 5FWXB 4W5RA 2JVIA 3QELB 3QX9A 5TPZA 3O2SB 2LF7A 3C97A 1ZH4A 2IA0A 2GXGA 4P1ZA 1TVMA 1ZLKA 3FM3A 1QP4A 3F8NA 2YSRA 3I58A 3ROUA 4L18B 3H6GA 3H5OA 1ONVA 5HSGA 3EGCA 3OQOA 1YTUA 4HNSA 1F4VA 2LNBA 3P9IA 1FWZA 4Q4ZF 3V7SA 4QYMA 4GO1A 1G4DA 1JGSA 3SZTA 3CJNA 1ZDMA 5HDNA 2FQWA 3O1HB 2GXBA 2CYYA 2HTJA 1XSDA 3I54A 3R60A 3CS3A 3HK2A 3U2RA 3N53A 4M9ZA 2FKAA 3BPXA 5ICEA 5C5CA 1BI3A 2Q2EA 1P6UA 2BEOA 3KCNA 2PUDA 4XFKA 1S3JA 3KS9A 4HX7A 1GLGA 4M73A 1QMPA 1LNWA 3GUDA 2QENA 2IKSA 1YFHA 3GL9A 3HJFA 1JBEA 1V4RA 1VPWA 2YR2A 5PNTA 4Z4FA 2CHFA 1SRRA 1HKQA 4B8XA 3DLHA 4MQEB 1VLZA 1USIA 2IPNA 3DGEC 2DK8A 2VE8A 3JSPA 4G97A 3CLOA 3FXQA 3HSRA 5DCMB 1DP7P 1GUDA 3OLZA 2VC1A 4LDZA 4MR7A 4CICA 2IW5A 4EYQA 4F8JA 1XGSA 3M7GA 4BQAA 4G6QA 4Z99A 2K4BA 2MBFA 3IP5A 1XGOA 3QELA 1KA8A 3R6SA 4LZLA 3HHHA 2KIUA 5CNKA 1JE8A 4M6YA 1WWXA 3K69A 4HQMA 3WE2A 3LA2A 3H75A 2GAUA 3O6BB 2LF8A 4R1HA 4GNRA 5F6FA 1Z17A 1NXVA 4IRHA 2ZNYA 4HDUA 1PP7U 4OG2A 1A2OA 1K79A 5LRSA 4XASA 3LAJA 1DC8A 4A0XA 1W7PD 2LSOA 3TX6A 1BBYA 3CUOA 1JLKA 4FE7A 4XRFA 4JK1X 4M72A 3L7WA 3WG9A 1ZH2A 1P6RA 1IXRC 4L85A 5H20A 1RNLA 3JTEA 3NBMA 4G0YA 4KA4A 1ZGZA 1JF8A 1J59A 1QQIA 2FA5A 2R47A 2FRHA 4D6YA 2GZWA 3RPUA 3WTVC 3TDZC 4O3MA 1OYWA 2OZ6A 2XDYA 1MDMA 2PAFA 4NQRA 4RDCA 4AIKA 3T6KA 4UHTA 4KIGA 5JI6A 1L5ZA 3IKTA 2MH9A 1B6AA 1T34A 2STTA 1ZN2A 2VBZA 2FXIA 2XAHA 3MF4A 3TO9A 5K5QA 3RVQA 4KV7A 4L9TA 2HZTA 3I09A 5LLQA 3CDHA 4EGYA 4JP1A 3PFIA 3FX3A 4UNOA 4YFKF 5E20A 5B3JC 2GA2A 1XHEA 4RKRA 1PEYA 1ZESA 4MLCA 3ZN1A 2IP2A 3Q7RA 1Z25A 3KP3A 2STWA 1Z12A 1AWCA 1SFXA 5JNUA 2O03A 3P9KA 3N0RA 2PE5A 2QBYA 5IULC 4O6JA 2VK2A 2XGXA 1NY5A 1G6NA 1W25A 4G86A 1KMIY 1USKA 4NV3A 4Z9AA 1T2KA 4Q6BA 4EJVA 2BE5F 5E8GA 2L3DA 3ROTA 3Q5FA 1O7FA 5IEBA 4LX8A 1H0MA 3ISPA 4O5VA 4XLNF 4YR7A 1YYVA 3GXOA 3NNNA 3FDFA 2FMIA 3KLNA 3EAFA 2ZO4A 1HW2A 1Z05A 3IPAA 3WTWC 3MEXA 3HCWA 2PKXA 3K2ZA 1BDHA 4LGWA 4UHJA 2L02A 2P4WA 1BVHA 3ABTA 1ZLJA 3WTYC 1QP7A 2O3FA 1BDIA 4TLLB 1MKMA 2ZBKA 3J7AO 2WWVD 3T8YA 3LSTA 4MR8B 1USGA 3HZHA 1DP4A 5LHIA 2VODA 3CNBA 4KZKA 5CYVA 3GBPA 1B9MA 5D4SA 1USSA 4MHGA 2VOPA 2V0NA 4L5IA 3J80Z 1DBWA 4U7BA 2MLKA 4JA2A 3O3KA 3MWMA 1Z6TA 5EEHA 4YP9A 3RVSA 3E97A 2JTVA 4MQFB 1P2FA 3H1FA 4KRFA 4HA8A 3CFYA 5L3EA 1TNSA 4L0ZB 1B9NA 1UFMA 5HDGA 1LJ9A 1U6GA 5EWMA 3D0SA 4OINF 4YRZA 2RV8A 2MA3A 3F8FA 2E4XA 1Y0UA 3JPWA 1ZYRF 4P96A 2IRFG 1QQAA 3W9SA 1J0RA 1R5GA 1JHHA 1R1TA 1BJAA 2NNYA 1FOKA 1C4WA 2V6CA 3GLXA 4Y15A 5LGTA 2EV6A 3V7RA 1SMYF 1T0FA 1Z26A 5HOOA 3N97A 4MS4A 2E1NA 3ZMTA 3V8KA 3VODA 1H9TA 2W24A 2ZFWA 4N0PA 1U3EM 2IPMA 4N03A 4S04A 4ZZDA 3F8CA 2PUCA 1O3SA 1ZHHA 3HRTA 2ZWMA 2LBPA 3FMVA 2WB4A 4WWCA 3J80K 1QNTA 5DTEA 3EETA 5FBKA 3IL2A 3K9CA 3KJXA 4WXHA 1FSHA 1XDSA 2P5LC 4ZYEA 5CNIA 3IP9A 5ICGA 3FMSA 1P8AA 2A5YB 2IPLA 4H0EA 2PMHA 2V79A 3DV8A 3WE3A 4B09A 3MZYA 2JSCA 1ZARA 1VKRA 1U8TA 2Z3YA 2CW0F 1YW9A 5HVQC 1YVUA 3F6OA 4E70A 3CRNA 3JS5A 4ZPJA 4BHCA 4G0XA 3K1NA 2WC2A 5J8FA 1LDJA 4OIOF 1D4ZA 1ZAOA 4GYIA 3SQNA 2HDCA 1Z16A 3EJWA 3DP7A 3TMYA 4HF1A 3TO7A 5BPDA 2D1HA 3I5UA 3E6MA 3O21A 3HXMA 5LGUA 3R4KA 2FBHA 1FSEA 4I98B 2EFOA 2M8EA 1DCFA 3HTUA 3QEMB 5DLEA 1APBA 2L2QA 5FD6A 2P5KA 2MH2A 2QZ8A 4KPYA 3KETA 3HUTA 2RC4A 3JW4A 1JYFA 4KUMA 5JNRA 5BQTA 4OU0A 3CTPA 3M6MD 1F4KA 4IHSA 4WF2A 1KGSA 3FFWA 3KP5A 2FBKA 1BC8C 1G3SA 1AB6A 3EUHA 2KYRA 4DQ2A 4WUTA 4N9IA 1O3RA 3MMNA 3KE2A 1LEAA 4EV0A 5ED4A 3LUDA 3O1JC 1H9CA 3F8BA 2F5EA 4ZYGA 5BPIA 3RI4A 4E7OA 5DGCA 3CLKA 3QAHA 2A68F 2FEWB 5TJJA 1CF7A 4HDVA 6PAXA 2N9UA 2R25B 4HOBA 3L6UA 3M8FA 3WTXC 4G7HF 4H60A 4Y17A 2HWVA 2WMYA 2PN6A 3GWZA 5D5UB 2NAZA 3RKWA 1S7OA 4CXFA 3QOPA 1EH6A 4UXNA 1KU7A 3L09A 3SHFA 3EQZA 2WTEA 3KEOA 2HS5A 4Z0NA 2PUAA 2H94A 1K7AA 1RPJA 3QP5A 2VE9A 2RGVA 1YS7A 5DCMA 3ERED 1ON2A 3GA5A 5ICCA 5CNMA 5L3GA 3FGZA 1HSTA 4ZYDA 1LK0A 2YU3A 3E5QA 3HUUA 4RK0A 4PYRA 3RKYA 1F9NA 1FYKA 1IW7F 3EDCA 1J7KA 3ZP5A 1GCGA 1GCAA 4ENMA 2ZMEB 1ZG3A 4LG0B 4CZZA 3SXYA 3NQOA 1F51E 3F23A 4OMYA 1XDUA 1YO5C 1DRJA 1SD6A 2HKXA 3HSEA 3IWFA 3IPCA 2P4UA 4ASNA 3JTGA 1K68A 1LQ1A 3CHYA 1EH7A 5DV5A 4F3TA 1V3FA 5HS9A 3VNAA 2D1VA 4H3HB 3ECOA 2H3HA 5D5XB 3C3MA 5LHGA 4LB5A 2A61A 5FO5A 1OKRA 3BILA 3GYBA 3ZMSA 2FSPA 3ZMUA 5F64A 1I5ZA 3RVKA 1LBHA 3DQVC 2HFHA 4Z4HA 2IVMA 1JL3A 2H27A 1MDMB 1TQIA 2OQRA 2VBWA 1Z6RA 3I59A 2IA2A 3V4GA 3HSFA 4MQEA 2QM3A 3WGGA 5TRDA 1L0OC 1E6LA 3OOPA 4LE2A 3F3XA 2O8XA 4CO8A 5TQJA 4RXUA 3IRRA 4JB2A 4PGHA 4MPTA 3RH0A 5DUIA 1LDKB 4WWHA 3TQNA 3BZ6A 4XSZF 3WTTC 1ZHFA 4A6EA 2M1ZA 3I45A 2PMCA 4XXHA 5HM6A 5D2CA 3GX4X 1EHCA 3RVMA 3KLOA 4MEXF 3ZN0A 1HQCA 2A69F 2XUBA 5LGNA 4MRMA 3RVPA 2E4ZA 4EYKA 1FSPA 2HR3A 4WXEA 2AXLA 5KK1A 1UB9A 1HKSA 3CO6C 2HGCA 2J5OA 3ZQ7A 1OXKB 4YLEA 4N9HA 1O3QA 4MS1B 1IRGA 2XKOA 4OATA 2A9PA 4MR9A 2GKGA 2A07F 4IVNA 3TOAA 4M71A 3PQKA 4KK4A 2FTKE 4YFXF 1KQ8A 2DO7A 3H3UA 2YHBA 2B1JA 2Z5UA 4Q7EA 1USTA 3HS3A 1SMTA 1U5TA 3F21A 4WX9A 4OOIA 3CZCA 4YS6A 2JVJA 2VXZA 3SM9A 3FM5A 1P4WA 1T98A 1TQPA 2L01A 3BJAA 1UCRA 4D74A 3HV2A 4A6DA 2A9RA 3K0LA 4EQQA 4ETIA 1QNLA 4KREA 3V8JA 1PNRA 1FC3A 4U0VA 1MJAA 4UVBA 1TQMA 1PP8F 2EK5A 5KQMA 3QPHA 2FQYA 4ZMSA 2MSWA 1G3TA 2RGYA 4ON0A 1R22A 2PLYA 3M1EA 3TKYA 1U8RA 1DPRA 4ETNA 1XGMA 3JTHA 5TQ2B 2VBXA 4MGEA 2MYNA 2YX4A 4EJWA 1DRKA 4RXMA 2XIGA 4BH9A 3HIFA 5FFZA 3B02A 3S99A 3HOSA 1T6SA 1FPQA 3LUCA 3OMWA 2B4AA 3ELKA 4P5OA 4KFCA 3GV0A 2EB7A 4O1HA 1MIHA 5FB2A 4NHJA 3JAMK 1W5TA 4DADA 3EQ2A 4ZYHA 2FNAA 4ZMRA 2PUGA 2FF4A 2M30A 3HEBA 2DQLA 3MYYA 1QZYA 3AAFA 1G3YA 3FHZA 1HSJA 2PQ8A 2J48A 1FBSA 2NS0A 4M74A 1U5TB 1BM9A 3GW2A 2PJPA 5J6XA 3F73A 4PDKA 4KQ9A 1YQAA 4UUVA 5K1YA 1SXIA 2BV6A 4DQDA 6CHYA 3HHGA 4RZSA 1IN7A 2EFWA 1D8JA 1KRWA 2FMFA 2FEKA 1CGPA 4Z9BA 4U0WA 3T95A 1HW5A 2QQ9A 1B00A 3SFZA 1FQWA 3E6BA 3BWGA 4YFNF 5CVJA 3DFGA 3H1EA 3DEUA 4KYWA 4RGSA 2C6YA 1M5UA 2P9HA 1ZRFA 2VT3A 4IHTA 1OYYA 2CSOA 5EWJA 1RXEA 1BAPA 4G7OF 1K66A 2DU9A 2F8TA 2P8TA 4LB6B 3T0YA 2JT1A 1Z9CA 1IN5A 4MS4B 4YCSA 2EWNA 1JHFA 4LD5A 2PG4A 4UV9A 4KN7X 3L49A 2VN2A 1TLHB 1QPZA 3UKJA 4WCGA 3KHTA 4A0ZA 5HLIA 4N41A 1XSXA 1WSUA 2XAQA 4CGZA 2EV0A 2QSJA 3L2CA 5JS2A 2V9VA 4EVRA 3O2PE 5B3JA 3JAMZ 4MTEA 3NNDA 1BI2A 4HLYA 4TN5A 1EWKA 3LQRA 2Z9OA 3GYHX 1LBIA 1F1ZA 4ZYLA 2ETHA 2V1DA 3LA3A 2JK1A 4ETMA 9ABPA 4R79A 1XHFA 4JB0A 3LQQA 3F72A 4A5NA 2MYUA 5DUKA 3TDUC 5EWMB 2GIVA 3GEZA 3HDGA 5IT9Z 4FHTA 1R7JA 1SXGA 4QWQA 3L9FA 3OQMA 1I1GA 2VONA 3H3ZA 3O74A 1JFTA 2E4VA 5CVIA 2A9OA 4Z4EA 3WODF 1FFSA 1OMIA 4PGGA 2L17A 2GQQA 4XAQA 4DNCA 2HPHA 4L5JA 2UXNA 2WJWA 2MSKA 1W7PB 3I4PA 1WI9A 1M2FA 1H9GA 4BAYA 1YW8A 3ILYA 3IC7A 4RGUA 3H6HA 2HSGA 1SD4A 5D4RA 4HYEA 3DBIA 1NHAA 3C1DA 3GF2A 4XLPF 2LDUA 5IUNC 2K7LA 3VEPA 4A12A 3Q7SA 3E5UA 3P7NA 3RKXA 1R36A 1QP0A 5CLSA 1SAXA 2FU4A 2CO5A 2RDPA 3QU6A 2ESNA 5HS7A 4HNRA 1JH9A 2AS5F 3RTRA 3E6CC 2FMLA 2EA4A 1YS6A 4BYYA 3CG0A 2EJRA 3T1BA 1W5SA 2XAJA 4HX8A 3Q41A 1EAYA 2XKPA 3CUQC 5KC9A 3P9CA 2P6TA 4IJAA 3M9XA 3UK0A 5ERIA 4EGSA 1DCKA 2GX6A 3BP8A 4RK5A 1RZ4A 1QKKA 2IOYA 2CHEA 4Z2YA 4OLAA 4I7HA 1REPC 2VBYA 4YO7A 2G7HA 1XWWA 4ZZLA 3QLTA 4PCQA 5FWYB 4CHUA 2HEOA 3N0XA 1P92A 2DI3A 4EM1A 1R1UA 2LPMA 3U9GA 5IT9K 3M8EA 4AWXB 3GFMA 1XN7A 1NTRA 1FNNA 1SD5A 1TNTA 1M2EA 4GPAA 1TBXA 3LKBA 1QQBA 1RUNA 4GYGA 4W5OA 1W7PA 4LE0A 3HO1A 1D5WA 1XB4A 3A0UA 3SNKA 2QZJA 4LLLA 2HTSA 1LEBA 5L3CA 2FQ3A 4MNUA 4NB5A 1MJBA 3LUAA 3RJPA 4M6XA 2QUFA 5JHUA 2GBPA 2KJCA 1TLFA 5HS8A 2P7CB 5E1XA 4HF0A 4GXOA 4CDGA 2FNPA 1R58A 4MTDA 2YX7A 3DPLC 2MSLA 5ILVA 1BI1A 3KFWX 2HQNA 2FVYA 3KYJB 1FBUA 5JNVA 5LRRA 4LJZF 3G85A 2H0AA 3N6VA 1G3WA 1O3TA 4P9FA 3DKWA 1DBQA 2FXAA 1KU2A 3RVRA 2ISZA 1PUEE 3CG4A 3OLVA 1FZPB 4HBLA 3GFIA 1O57A 4G6DA 2EFQA 1U78A 4LG0A 1P6QA 4XLTA 1WETA 1XD7A 2W42A 2E4WA 4ETSA 4RV5A 2FMYA 2OA4A 2FN9A 4HNQA 1ZG1A 2RVCA 5TPWA 4MGRA 4NCBA 4YG2F 2Y0MA 5KQLA 1MJ9A 3HM9A 1JFSA 4I02A 4G94A 5CHYA 4FX0A 1L5YA 5KQPA 1F5TA 2NUBA 5DCLA 1Z1DA 2MD5A 2CWEA 2I6FA 4MQ9F 3FXUA 3LUHA 4AD9A 3T8TA 3Q9SA 4LRQA 4EM0B 4KVFA 1DZ3A 2CG4A 2K86A 4ENJA 2PLNA 1AB5A 2R7DA 4P98A 3ECHA 5ILSA 4BNCA 5CVVA 1D8KA 2QXYA 1XSVA 1JXSA 2PUEA 2WV0A 5L3FA 1SD7A 1ZY2A 5IC5A 3URMA 4JASB 1ODDA 4UVAA 5E3JA 2FMHA 1WRJA 2ZMEA 3BROA 2A3SA 5JNWA 2CQKA 5TE9A 5BS6A 3O75A 4ZH4F 5CJ9A 3SY8A 5BQ3A 5D8KB 2DFIA 2M87A 3U1DA 5HLGA 1URPA 2HJ9A 3OLXA 4IMIB 1ZRDA 3CUQB 1J9IA 2PL9A 1B59A 1U2QA 5TPWB 3K1PA 2D2WA 1K78A 2R7FA 4S05A 1RZRA 5IUKC 1ULYA 2NNNA 3HOTA 4AIHA 2WJAA 1FY7A 4PICA 1VTNC 1JYEA 2X4HA 4MAAA 2QYOA 5E17F 3M9AA 1XCBA 5GQSA 3MZHA 3TO5A 3FF5A 2QVCA 1KU9A 3KZYA 3KG2A 2FLWA 3R61A 1PDNC 2A6EF 2L4AA 1YMVA 3HRMA 4WXDA 1R8JA 2NT4A 2BYVE 4OTZA 3HSYA 4MS3B 5AIQA 1OR7A 2IPQX 3ULQB 3A0RB 3W6KB 4L4UA 1IN6A 3KYIB 1NXTA 1R00A 2DK5A 2CGPA 4HAMA 3H5VA 1YW7A 2FMKA 1FT9A 2K27A 4Z4CA 1E17A 4KDPA 2QV0A 3PQJA 3QEKA 5E1WA 2QVOA 5BOXA 4RB1A 3F6VA 3N8IA 1QBJA 3DZDA 1KQ9A 2HQBA 4MS1A 5JNTA 4I01A 3GRCA 1U2WA 2XAGA 3HYIA 3D8UA 3GWGA 4PZJA 4MR9B 3B2NA 1JHZA 1C0WA 1ABEA 1ABFA 3CZ5A 4HW0A 4KQCA 3I71A 5C5EA 2W84A 2OBPA 3DF8A 1IXCA 4LLGF 3OMXA 3RPQA 1JDPA 3ZMZA 1K78B 4G9YA 2PBIA 2COMA 3QPTA 4EJUA 4Q6WA 3OV8A 1MZBA 2E7XA 4OBBA 5KC8A 2AYZA 3JY6A 1I6XA 1J2XA 2P7VB 1YK0A 3CKMA 3TO6A 2JPBA 2JPCA 4D0PA 1KYZA 2MC3A 2ZNZA 1LB2A 3H5TA 2IPAB 4RY9A 1DC7A 4JBAA 4O1IA 3FXRA 2FSWA 2K4JA 1IN4A 2VYCA 2A6HF 2P5VA 2HYGD 1S6LA 1EFAA 2OAZA 2R48A 3N75A 2ZJ2A 4UV8A 4FE4A 4L9NA 2RKHA 4Z4GA 2FEPA 3OO1A 1ISRA 2ZCWA 4I0BA 2JBAB 5AONA 3IP6A 3BPVA 2L19A 4YIIA 3LOPA 1OPCA 3MIZA 3KZZA 2RN7A 3RQIA 3FFTA 3JPYA 2JB9A 4LK0F 3LUFA 3UUGA 2XV4S 2R3SA 1ZGJA 4KICA 1DJMA 3KP2A 5HLHA 1E2BA 4HX4A 4OIPF 1LJLA 3F7NA 4TMYA 4L9JA 5TQ0B 2HKOA 1A04A 5KVRA 3TGNA 3SAJA 2JCGA 2LP4Y 1IAWA 3B73A 4RB3C 3MFKA 1GHCA 5T7BA 1LVAA 4IGAA 3TOBA 5DD8A 3O1IC 3NHZA 5GOTA 1BI0A 5FLXK 4RK4A 1U2PA 2XASA 3O2JA 4R8HA 2VUHB 4FX4A 3NNSA 2XVCA 1ZITA 3I42A 3SG0A 4KNYA 4EVQA 3WTSC 2RQPA 4P55A 1U5TC 1FLIA 1QGPA 5TPZD 1HKTA 2DT5A 2M1BA 4KMRA 2J5PA 4IRXA 3LAPA 1DPUA 2DBBA 2BGGA 5HDKA 2UXXA 3OLYA 4NICA 1MD0A 1B4AA 3I0TA 4MYRA 3GFLA 3FWEA 4EVIA 4A5MA 4LLNA 3BREA 4MEYF 1IUYA 2KIFA 5IUJC 3V8LA 3K1MA 5AIPA 3BDDA 3LFKA 1MB0A 1IXSB 4RGXA 3LUGA 2P6SA 1IF1A 3W6JB 1DDNA 2LKPA 2WRZA 1FP1D 2YPRA 2DPUA 3SZPA 1ZGAA 3LWFA 1NXOA 2A9QA 2O20A 1ZG5A 3WU1B 1NXPA 4G0PA 3BOQA 3E6DA 5KI6A 3I64A 3N0WA 2F2EA 1ZGGA 4RK1A 2RJNA 4WXMA 4MQFA 1MAVA 2DRIA 3LKVA 1I3CA 5ICFA 2FW0A 4YGXB 1CEYA 1FX7A 4NCAA 3G73A 4Q5SF 1NXSA 2GI4A 2F5CA 1KU3A 5KWSA 2PL1A 5JNSA 3KP4A 2IYNA 2TMYA 5DYMA 4Q48A 4N0BA 3WTZA 4A0YA 1RUOA 4Z4IA 5FLXZ 2JVKA 4RS8A 2O6GE 1TJYA 4U88A 5EEGA 3IKVA 2CD7A 2E1CA 2QU7A 3MAJA 5HQJA 1PEAA 4E7PA 3Q9VA 1UHMA 3C18A 5D5VB 3ROFA 2FQXA 3KSMA 3T38A 1DCMA 2QQBA
chains in the Genus database with same CATH superfamily
3FNHA 3DL4A 3VGJA 1LPNA 5ELMA 4I4LA 3FI0A 4BBRJ 4LCEA 5D3MB 3V8EA 5JS8A 3O2QB 3ONWA 2OM2A 1T15A 3QBJA 5TR9A 1RYMA 5GAHJ 1KVRA 2KKOA 1RPNA 2VF4X 2XOEA 2XYRA 3B38A 3FLAA 5JADA 1HXHA 4LV5B 1QORA 1ATZA 3CBQA 3MS7A 5E7IA 5AXBA 4LTNA 2HMAA 3MM4A 1IQPA 2JJ2D 4AJNA 1X1CA 1TTQB 4F2WA 4I1RA 4F12A 1EFLA 1A9YA 1MQSA 4EUHA 1UPXA 521PA 1ETQA 1FP6A 4EHBA 2HK7A 3NYRA 1BCSA 4FKMA 3CJTB 5GAEJ 1ODFA 2QIPA 2X2PA 1T9ZA 3H1AA 3EZYA 3P0HA 4PX3A 3PCTA 4O4LB 3T7JA 5EGOA 1KMHA 4E2WA 1QFJA 3HKBB 1W93A 3PI7A 4RJTA 3ASVA 4KAXA 1YUBA 3E5NA 1ZOLA 1MOZA 1NJGA 3PDIA 1P0IA 4CHGA 3PHLA 4UMVA 5BVGA 2FPRA 2WG0A 3FJ1A 5FO1A 3UPTA 1H2XA 3ONFA 1VQPI 1DC5A 1PG5A 4ROSA 1D2GA 2CL7X 1PVEA 4JL5A 4ZDWA 1H0SA 3JQEA 3UKGA 2QRVB 3N2LA 4OHOA 5EGSA 2P1DA 1MNAA 2GOMA 3EVNA 3M83A 1UBKS 4OK5A 5EMMA 2E1RA 2Q3BA 5JSZB 3HKEB 2ZYDA 3V8VA 2QTNA 2PWAA 1ZVVA 1EVJA 1YQXA 2EH3A 1FVFA 1LVHA 2A78A 4DSTA 5F73A 2ZS7A 2Q9BA 1J8FA 4I5IA 1Z2DA 2O0MA 3LAWA 1X3UA 3PSHA 3RDIA 3OQBA 4UUOA 2PZ8A 3VWBA 4ZVVA 1XDZA 1PZNA 2CLIB 5FI1B 5FWYA 1IV6A 4FM9A 4C4AA 2B30A 1HWYA 4ZU1X 4CU2A 1DQRA 1YBAA 3AIOA 2BGTA 4EK9A 4E7JA 3ESAA 3FD8A 5D7NA 1L1FA 3TFWA 1O0CA 1SHJA 1NUUA 2VPXA 2MLGA 3GFBA 3JQ9A 2ELHA 4QJ3A 5FKKA 4M7PA 1JQAA 1BA3A 1LF5A 3NIDB 3NCHA 2OQGA 4A2UA 1ONSA 3U1BA 1IO2A 2C7RA 4W5JA 4PNHA 3IOYA 4LXIA 5EHNA 3UHFA 3T8RA 4FHFA 1EWVA 1UJBA 4RVNA 5KHAA 1GYPA 1XC5A 4B3XA 1L5RA 5GWXA 4MWGA 4R7TA 1X3SA 4PSWA 2VHJA 3WTUC 1P1RA 4LFBB 4ONEA 1ZK8A 4L75A 4U7FA 1VQKI 1OR7C 3IB3A 3MXOA 4HTAA 5EKXA 1PW7A 5DTMA 3O47A 4EFMA 3AJDA 3CF0A 4YRMA 3TD9A 5JQGB 5EZYB 3TIGA 2A1TS 1T1JA 3WDMA 5KBYA 1NRXA 1US8B 4BTEA 3GFOA 3MWDA 2H6BA 2KDZA 3BKXA 4RNDB 5E3NA 3WMGA 2EZIA 1NI3A 2CLMB 2ZJ3A 3HN2A 3FZYA 3IQEA 4KIBA 2DTRA 3O4JA 4PYNA 1DADA 2OENG 3UMMA 3OZSA 2ECQA 4Y6OA 3RTAA 3PL5A 3U44B 3VI4B 3P45A 4PNEA 3ZEIA 1VCMA 4NK5A 2BR4A 4HVAA 1CHNA 2F3QA 1XNRB 5IN4A 3QLUC 1LJUA 4HF7A 4EH1A 5JPCA 1WZ2A 4AC0A 4FFVA 4WCFC 1TYEB 1AQUA 1UBCA 1XZPA 1KP9A 3I5AA 1WJDA 3G88A 2DQYA 3DXFA 4L22A 5JAUA 5FUBA 2KT0A 3PNBA 3ZS8A 3FHLA 4PJNA 1L4BA 3OIQA 1J0XO 3AM5A 4MUJA 1EFRD 4XSVA 3FKJA 3SLRA 3JYQA 2Q3CA 4YRIA 3HR8A 2V55B 4NMLA 4YQFA 2GM9A 3A25A 3B7PA 1KYVA 3TKAA 1YG2A 2XA2A 2Y27A 2DMNA 1KI8A 3KP7A 2BDUA 3GIDA 4MVJH 3I9MA 2DA2A 1G3RA 1AS0A 3I04M 3AX6A 4MRMB 1TM1E 3TJRA 1FFEA 4M1YA 4B0OA 2ZU6A 4JXJA 3S5JA 4BVGA 1E5LA 5GJBA 4IJ5A 2V6EA 2OD2A 2PO5A 4MGKR 1Z4MA 4EYSA 1HE5A 1HZJA 1HE8B 4KHPB 4AY6A 2V7QD 4MV8A 1U4OA 3JQAA 5AICA 1RHJA 3PNSA 1A5BB 1L7MA 3D3KA 1QH8A 1VHJA 1W0CA 2GPNA 4UTXA 3T1YB 3A6KA 4HUQA 3TNLA 1RQ7A 4J2OA 4WNAA 1TADA 2C7BA 2Q9AA 1LZKA 3QGMA 1JKJA 4DPMA 2PWYA 4X60A 2NRAC 3MQ4A 4HDMB 5DDIP 5ITSA 1QH0A 1RJ9A 1Y9JA 1E63A 2H6CA 1H0RA 5DKFA 3DLBA 1BKDR 4OP3A 4FFNA 3FUVA 5GAJA 3VOEA 4JR1A 1Z18A 8ADHA 5H82A 1LRLA 4UREA 3VNBA 4BFYA 5HCUA 3IDSA 3KYDA 1XRMA 3M5CA 3R6TA 3OJ0A 2NUPB 5FL7D 5ARBA 1XJCA 4V38A 5DRYA 1E6KA 2C4UA 2PD3A 3WA6A 5C8YF 3RRJA 3RU7A 4URFA 4BKQA 3G1WA 1B41A 1TTYA 1MORA 3ITKA 5J2TF 3S2ZA 3ZWPA 4ZZ1A 3VAZA 2ADFA 1PO7A 4F6CA 3U60B 1EDOA 2GWRA 2A9FA 2QYHA 2ZB8A 3LO5A 4UMFA 2B8NA 4PZYA 2JLUA 1W4AA 3DFUA 4NQZA 3I8SA 2GN9A 2HRQA 1B0ZA 3RUAA 3S27A 3EODA 4AF8A 4JEIA 5EZYA 3ELWA 4I0WB 3NC0C 5BQFA 2ZUFA 4NDNE 2XXBA 1CQIB 3GARA 2EDCA 5IU6A 2CMGA 5FLVA 2VBIA 3W8RA 5KTTA 3VHXB 4NPHA 3HXMA 2ZRHA 3MCZA 2F3TA 3HCCA 3J81K 5FI5A 4A1OA 3E1GA 4BQIA 4Q1EA 1ADBA 5REQA 3WNCA 4JFAA 1E6MA 3IBFA 4DMFA 2O07A 3H2JA 1G38A 4A36A 1XDDA 5I7RA 4DLAA 5HX7A 4F3KA 2Q99A 3D6FA 2WJPA 4ARCA 1GRRA 4K9NA 2FSSA 2QTHA 2ZPAA 3PPXA 5EKUA 1XCLA 4MS3A 3AFNA 2QT0A 4RKQA 3LP5A 2NNLD 2CNNA 4Q37A 1PGOA 1NMSA 2WINI 4JWKA 2C9DA 2QTAA 1BN5A 5CD1A 3OF3A 3FUXA 3CJQA 5AXDA 4DLTA 4JKOA 5CGQB 2VSYA 4PEVA 1Y5NA 1Y34E 4V0ME 4F56A 1XCOA 2WT9A 4Z9XA 2ZKZA 2WV9A 4KO4S 4OMFG 4JYCA 2WTAA 6REQA 4PZZA 3FIJA 1C80A 3ADCA 4XGRA 1HKUA 1O95C 2LP0A 2W7TA 2BR5A 4HV5A 2FPIA 1FIUA 4P0QB 3VB2A 5DS9A 2PZLA 5DLPA 5DU2A 3WK4A 2FFAA 2A5FA 2WT4A 3WLIA 4ZK6A 1WXEA 2NVUB 4DBQA 1E2IA 1P4XA 4UULA 1NDQA 3FMRA 3A1TA 3NGMA 1HQDA 3EDPA 4KUGA 1IY1A 1PX0A 3VYTB 2I4IA 4E31A 1CUZA 421PA 2QL6A 1YOVA 1B1BA 1E2XA 3A3KA 4HDMA 5HOQA 3E5XA 3FPEA 2NVXJ 2HA3A 1OWOA 4GXRA 1IDZA 2JGAA 3EQ7A 4UZFA 4X63A 2ZIAA 5CAEB 4EI2A 3U1TA 1UC4B 2Z5GA 2O7SA 1DG1G 5AVJA 1Q0TA 1E3JA 3WMFA 5H6QA 3ZHBA 1T0BA 4BLTA 2FA9A 2BGWA 3TUIC 2FI1A 5ENVA 3GVPA 3CVOA 2OF7A 3OM0A 1I27A 5DHFA 2JFYA 3RF6A 3RRNA 2OVFA 4KIUA 3D7MA 4LNAA 2VRBA 3HDVA 1DAKA 1QR2A 3W4JA 2GPTA 3VTFA 1QLWA 3G8BA 3M1CA 5FRMA 2HH9A 2NN3C 2FOKA 2HBQA 4V2UA 1Q7EA 2Z99A 4B3DA 7YASA 1XXHA 4IRGA 3GBVA 2QJRA 2FZ5A 3E7LA 1OZ0A 1ZX1A 4AYBN 3I39X 5EJ5A 1GPKA 3AOEC 1PNTA 2Q2WA 2QD5A 4WY8A 2JJYA 1E98A 1G0NA 3O9ZA 1M1NB 3G7SA 4JY7A 5JAQA 3UT5A 1E1CB 2YWBA 2YV5A 5CB8A 1XSEA 1BDJA 4HQEA 4B3FX 3AZQA 4WK6A 3W9BA 1VQ1A 3UKOA 5HIKA 1ZRCA 4NYJR 1BDBA 1X80B 4V19K 3X1MA 1BXGA 5TLSA 2UUPA 1FL9A 1U5BB 1VRWA 3F0TA 3LVQE 3LXUX 4XRRA 3RYFB 3MN1A 1NUSA 4LBYA 5DBHX 4C3OB 4ZHQA 3GR6A 2GVZC 1W5AA 3ZQ4A 1I1SA 1FTSA 2O9LA 3SC2B 5HGXA 3WWEA 4KR6A 1R0KA 3EUFA 2IDMA 4QOIA 4IJKA 3GFVA 2DQRA 3WU2C 5EWLB 4ZYXA 1EWQA 2NSDA 1KZGB 5IT0A 3T1QA 5B1EA 4UMDA 3I2FA 3O8OA 3U13A 1M1YE 4PAQA 4PRZA 2WLSA 3L6DA 3L00A 5GTHC 1AKMA 3KR2A 5ALXA 2XYQA 4XLEA 4QGSA 4JX5A 1RAIA 3N28A 4HLDA 1O4WA 1Y5RA 3KUDA 3SFVA 3UWOA 4KMUX 1AZLA 5EP2A 5JR3A 1ANKA 4E5KA 3LFUA 2IJLA 1ODKA 1TQ2A 1V9LA 1VLVA 3BJZA 1A9OA 4F38A 2JRLA 4NULA 1NNI1 3QE4A 4RU1A 3DGFC 2PO7A 1B6RA 1Z6QA 4KMFA 4YTEA 3S55A 1C0PA 3TRHA 4BO0A 2X0LA 1PGNA 1WCV1 2A2ZA 5FR1A 4DG5A 2GF9A 2VVTA 3KTOA 5CQGA 4MV1A 5K0EA 2FSIA 4GC5A 2PEXA 3SQOA 1ESEA 2JQ7A 5ABPA 4E1AA 5DCFA 3N2GA 2FSGA 2E48A 3LTEA 4NJOA 4GQIA 4ZRNA 5JFRA 3CLSC 1IOLA 1UFKA 5JAOA 1WHUA 2K02A 1UM9B 3K6SB 2X2EA 5GONB 3KQWA 2K9SA 2FW1A 3PXBA 4O4JF 4KR9A 4TWIA 2QXUA 3HYCA 4Y0VA 2LKXA 4JI7B 3D02A 4MFEA 3DBRB 1I80A 5AVOA 1XMOB 5HOEA 1E3TA 4RDUA 4PFPA 2VYQA 3X1ZA 5FGMA 1FFGA 4Z8YA 2EKQA 2C8KA 2WM3A 3GT7A 2CK3A 5JTUA 1WP9A 2CUZA 2N1BA 4Y2UA 3OTQA 4XYGA 3VJLA 1WH7A 3LSIA 3UPDA 4G0MA 4ZEVA 3BE8A 3MCVA 3RO7A 2VIXA 4MNTA 3VPDA 4LY6A 2YHAA 5AW6A 2D00A 4OAQA 2Q5IA 1BNCA 3EXIB 3O95A 2C5FA 1JW9B 3KKOA 4FFLA 4HZUB 4Q3OA 2VC0A 1A4RA 2PJRB 3U7FB 2G06A 1U04A 1MN6A 4N7BA 1PUXA 5CVRA 4DOZA 1H9BA 2JRTA 1VQ9I 2GPYA 2X1MA 3PNMA 4CV2A 2VJLA 9LDBA 2AE1A 4OIQF 2IKQA 2J0UA 1TTPB 2WFLB 2V6BA 3EZGA 3KL4A 3U3OA 1WSBA 3GT4A 5FPPA 3NT4A 1B8PA 2JFGA 1F2UA 1M0WA 4B4CA 5DDGA 5CJ2A 4F93B 2GN4A 4UHKA 2PSSA 7ABPA 5ALLA 4CEHA 1MNMC 1F3LA 4ENNA 3ZQCA 4ZREA 4EO9A 3H4TA 3NMUF 1ZW1A 2D0OB 1C3VA 2D2VA 2H8GA 2GPAA 3FG9A 4FUTA 5EHIA 1CUSA 3NORA 2E2IJ 4LSMA 1HEYA 5E9QA 1CY8A 1IHUA 5AP9A 4L9SA 4OGWA 1WX1A 4FR2A 3TTWA 1P1FA 1VSQA 4L8GA 4C7XA 3VSCA 1LE8B 3GYGA 2WJHA 4JT9A 1VYHA 2Z56A 4AP6A 3Q3CA 2YYSA 5P21A 3HXLA 1BIAA 1G20B 3GPIA 1YJCA 4D0LB 4NBNA 2I7XA 1NMYA 2VDOB 3RYRA 2H5IA 3FFAA 3HJBA 4LDQA 1EM8A 2DBQA 3MQ0A 1JWLA 3ZJVA 4BQQA 5EDNA 2FP3A 3DUFB 1U9JA 4IZZA 2PTGA 3GEEA 3ROZA 2M6KA 2C99A 4MKXA 1C9DB 4ZZIA 3K9TA 1EV7A 1BRTA 4HDOB 1W6RA 1UELB 3I2HA 5T57A 4A0QA 4F84A 4DB4A 2YCBA 3C5HA 2EV9A 2JRMA 3D5LA 2ZJPF 2G5GX 3IT0A 1USUA 4BB0A 2XF8A 3EDQA 5F21A 4C87A 4CIYA 4L9WA 5M3BA 3SQXA 2VTDA 4FWTA 4TV7A 1J75A 1PZFA 4L74A 4BNWA 2W00A 3RZOJ 3B1XA 3OEYA 1W4BA 3DOJA 4GI2A 2L9SA 1DKQA 3WJ2A 1TYZA 2R86A 1QKJA 4UATA 2ID7A 4H6WA 3ZU5A 3PNKA 3KTDA 5FD8A 4Y2QA 4BACA 3IRQA 2HJSA 1CV2A 1MQ9A 2WPDA 4QUBA 3VU9A 2I9PA 4G0OA 4JSRA 4YRQA 3A27A 5A6VA 3AHIA 1AZTA 1U8YA 4I50F 1UCFA 3CTAA 1UMBA 1WBJB 1YRAA 3O8QA 4L51A 5CW1A 4RGRA 2OD9A 4GRDA 1ZC3A 1P2UA 2XZDA 3VH3A 2KJQA 2ZAYA 3F47A 1UG0A 2SCUA 1W4RA 3STXA 5G1PA 3EXIA 5C4MA 1IOVA 1QHHB 2R1TB 2DJ5A 3ZPLA 2OLEA 5H3CA 3ZGZA 2E1PA 2WEKA 4WL0A 4J3FA 1EWTA 1UUFA 2JGMA 2P6UA 3DE1X 4HQRA 4TTVA 3UQZA 3CVYA 6ABPA 1H1LA 3WMWA 3N8GA 3ZHOA 3S1NJ 1TMYA 2PUFA 4X6LA 1SZJG 3L0OA 4HRXA 2ODNA 1EE9A 5CFLA 3CSSA 1DKOA 2VJNA 3JZDA 2LRDA 5CVUA 4ZVMA 3AG4H 2JAHA 4EG0A 1OI7A 5C51B 1PSZA 4M98A 2JLZA 1EFVA 3PSFA 1N2SA 1SUAA 3CQ9A 3V7WA 1S2NA 3DKRA 5FFXA 3MRTA 5AVKA 1KJJA 3IVXA 2I3BA 1B8UA 1QO0A 2ZROA 3TR6A 1P3Y1 4Q03A 1OIWA 2BKLA 4QQ8A 3TE6A 1GM5A 5I3CA 3RPUD 2JUGA 1BX0A 2YMMA 3UH1A 2R5FA 4UTNA 4ZTZB 5ENDA 1CS4C 4BAZA 2KP6A 2NXNB 3P9NA 5D3MA 1TW3A 2QWWA 1JJ7A 3LXMA 4MWTA 1NBHA 2IELA 3OZAA 3B3JA 1XUOA 3RR2A 8ABPA 4CKWA 1O7JA 2G7UA 2B8JA 4YV1A 1VBFA 2VB6A 5C3MA 5IVKA 1ST3A 1P6XA 1VXOA 4PX5A 5IX8A 4ZAWA 4RAOA 1P19A 5KNDA 1Q92A 4MV3A 2OD5A 2G09A 4IV0A 3EJ6A 2HXYA 4P80A 1Y0NA 4PYOA 3IIIA 5EVJA 3ZBTA 1NZJA 4JBXA 5J9FA 1H89C 4CXMA 1QE5A 2QVGA 3KJGA 1CR1A 3HGGA 3KUCA 2VP5A 2EJUA 2FN7A 4G1CA 3I6IA 4F7DA 3WHLA 1GUAA 1XPUA 3PHHA 1LFAA 2IZOA 2QDKA 2YFHA 4IIGA 1TEZA 3RKRA 3VDRA 2ANCA 5C4JJ 2Q6TA 3QKRB 4H27A 4JU8A 4MI1A 4RMIA 4B46A 4BWGA 4QGGA 4QLOA 3DZ8A 4ZU3A 4C0JA 1KRXA 3RBVA 1UWCA 3I0ZA 4MYHA 2DLCX 1TECE 3W2HA 3PX7A 1BC7C 5J5CA 2TCTA 4NENA 5L4LA 4CL2A 3VZRA 2PDAA 3D8NA 1T39A 1PDOA 2G0NA 3IBGA 1VCOA 4RETA 1UK7A 4OO3A 3OTOB 4UB6C 3D8RA 3CUWA 1XVAA 4TWAA 3W5IA 3K0SA 2HU7A 2A4KA 3NJ8A 1Y9ZA 1G2HA 2Y67A 4HNTA 2NVQJ 3F9CA 2VASA 1LSJA 3L04A 2P9GA 3G0DA 3I9LA 3Q12A 5AK3A 2CQNA 4HZFA 4YH1A 1F5SA 4DOMA 1AKWA 1GV5A 5L51A 1Q57A 2X6TA 4EA8A 5CA0F 2OUIA 4CI9A 4YV7A 2HXOA 1D2AA 1XTIA 2QI9F 2M6LA 2P6OA 1Q1HA 3ZGYA 2GUGA 2EYUA 1MENA 2O2HA 3MINA 2XNDD 1NMXA 1ZZEA 2CJWA 3ZIUA 1JKMA 4ZJPA 1MGTA 1V35A 4QXOA 3QA9A 3UANA 3QFTA 4RSMA 3CVXA 4Y3UA 4JFRA 1GG8A 5HNHA 4IHKA 4QBIA 5FLKA 2PH5A 5KYUA 4LDAA 4KXFB 1RCFA 5IN5A 2GJSA 3TTSA 3DEHA 1PJ4A 2Z2KA 4HGNA 3OQIA 3PEUA 3PUXA 3AF6A 5IP9J 2FEZA 2OXTA 2GZRA 3H5LA 5C80A 2QSZA 2KB0A 5K9ZA 1YFJA 2UZKA 1IZ0A 1E2EA 2QW1A 4E6KG 4U7DA 1AY0A 1DKUA 5DN6A 4JROA 5HCIA 5K45A 1MSFC 1LFBA 3NT5A 1QNFA 2QUHA 4BO8A 2ZUBA 1RMYA 3C6KA 3EIXA 3GJSA 1VI6A 4BB6A 1D1PA 3D6MA 4C3JJ 3ND7A 3QX3A 1SFEA 1BX3A 1JX6A 1TA0A 1FBTA 1WB6A 3DMDA 5BV7A 2OCBA 4LJRA 4B47A 2RCNA 5HBGA 2QSFX 2RGWA 1TT5B 4UBIA 5EZQA 4I55F 3P2OA 3WXBA 4O4JA 4A26A 3JAMA 2QAGA 3M7IA 3M33A 2QRQA 3KJIA 3BA1A 2FPSA 2KLOA 4OXRA 1ZLKA 1WBDA 1VHLA 4FFPA 5DSZA 2A1IA 3JWPA 3F8NA 4FYXA 4RIGA 5MDHA 2YSRA 2W90A 3NHBA 4YACA 4BP1A 4DIFA 3RRMA 4ZI2A 4L18B 4AURA 1TM5E 1IBSA 5IASA 1VTKA 2FFQA 1ONVA 4XYLA 3DZHA 3OTIA 5L7WA 3WL8A 3SKYA 2Y0SA 3I1IA 4ENTA 4OATA 4NC7A 3M0EA 4WJZA 4NENB 3MRSA 1EA5A 1EKXA 1QRAA 1YTUA 1G20E 2NU6A 3IV6A 1IMJA 1X9HA 1FWZA 4Q4ZF 3S2DJ 1YVEI 3NM6B 1WJCA 1VHWA 4GO1A 1X1BA 5IKEA 4MQLA 4LY9A 3SZTA 3HBJA 4ZYYA 5HDNA 1U90A 2ABWA 2XUHA 2XTAA 2PGOA 3PXUA 2CYYA 1JG6A 2HTJA 1XSDA 1AQIA 1PV4A 1B2RA 5L4NA 1R9JA 3ZI7A 4NMHA 1U7PA 4YRGA 1GSHA 1V1RB 4RH0A 4WQMA 1N6NA 4M38A 4MULA 3U2RA 2CKDA 1H3NA 1OC4A 3L8DA 4FGSA 3HK2A 4BNYA 3HM5A 5LQCA 3L8YA 2CLOB 4PTLA 1ST2A 3S8EA 4JH0A 1Y7LA 3CUTA 3SVZA 1Q6ZA 3KB8A 3G23A 4Y67A 1UWKA 1ORKA 1AKQA 1RHRA 2WWHA 4XFKA 3KS9A 4HX7A 2JI9A 3E81A 3L93A 1QX3A 4D5CA 3BIJA 4Q7LA 3T3DA 2B35A 3LECA 3I9JA 5BSWA 5I45A 3P32A 3GUDA 4I99A 2ID8A 1L4MA 2LRHA 4GE3A 2IKSA 3GL9A 3BGWA 5DK6A 4TT8A 2G8LA 1HT0A 2EP5A 3HU2A 3ZDCA 4XKWA 1EZZA 1K3UB 1YR3A 4Z4FA 1CU1A 2YIDA 1BL0A 3E7FA 2FK8A 1SRRA 1HKQA 1VL2A 3KXIA 1USIA 1DO0A 2V6FA 3HU5A 5CMLA 5AVTA 1IOZA 2WV1A 2HLDD 2J9XB 1T36A 3AU9A 3P9ZA 4G97A 3DCFA 4CFSA 1DP7P 2VC1A 4BBSJ 1HURA 3ABLH 4MR7A 1E4VA 1EX6A 3DONA 4H17A 3ZK9A 3T3IA 2IW5A 4F8JA 4DMMA 2VDUE 2Q9UA 3A04A 2VEDA 3RIXA 4XVRA 2YY6A 4B8WA 1C1YA 7REQA 4H9GA 2C7QA 3IP5A 3T7KA 2G7ZA 2H54A 2HNAA 1OGYA 1U2TA 1WB9A 4Q21A 3FYHA 1JE8A 4M6YA 4CTMA 1WWXA 2WJ4A 3BMXA 4TMFA 5JJCA 1LWOA 1ZOSA 2P2DA 4J94A 4M60A 3UV7A 3LA2A 2XA1A 1YNSA 2Q2OA 3CZPA 3RFFA 3FKSA 2H06A 1IBLB 1NJ1A 4ER0A 4JUDX 4IDAA 2B1GA 4CTOA 1G21B 2VYVA 3FY4A 3KR1A 2NU7A 5HZHA 3C45A 5LLTA 2ZNYA 1YDFA 2CLFB 3LCRA 1ZL2A 4HEA6 3RC8A 1PLLA 5LRSA 4XASA 2H07A 1NI5A 2PX2A 5LZ7A 1NUQA 4Z3KA 2ZXHA 1CERA 2HF2A 2KIQA 2BFOA 3ZR4B 2G1AA 1NLYA 1KK1A 2WHPA 2PWBA 4NSNA 3IAHA 1XEXA 1JLKA 2YJZA 4RKWA 5K6TA 4U9UA 4JK1X 1APLC 3JYPA 3AM4A 1ZK4A 2CNBA 4K3UA 4J3JA 4NYMQ 4WGFA 3V33A 5CAEA 2OTJI 4W9MC 4QOFA 1IXRC 3LT1A 4XXHA 3WGMA 2PFGA 5H20A 3H3FA 2I2CA 3PVSA 4B3HA 1Q7RA 2Y99A 3DAPA 5EPUA 4EL0A 4V2GA 4GI5A 4M0KA 5G0VA 4KA4A 1ZGZA 3GA0A 1JF8A 3QU5A 4GPBA 1J59A 4ZEXA 3O3NB 2XB0X 1Z77A 1V71A 2FHSA 4XK4A 2R8RA 4FHGA 4TXHA 4W5WA 5E6RB 3PUBA 2FQ4A 4B0PA 5J58A 1Z5UA 2J32A 4K5QA 1R15A 2FRHA 3NV7A 5GV8A 3LTNC 3A06A 2X0KA 1BQEA 3TW4A 5LWQA 2NYAA 3WTVC 2JFNA 1XXHB 4IOCF 1HSOA 4O3MA 3AF4A 1KIAA 2OZ6A 5CXSA 1R6XA 1E6EA 1YS1X 2J9FB 3F0CA 3E05A 5JY6A 2WYWA 4RDCA 4OFWA 3AF1A 2BKEA 3QMMA 4BVAA 5FL7A 1SKYB 3IT2A 1DQUA 1W8IA 3T6KA 3W1EA 4YONB 3GTQJ 3AUAA 1U3VA 3MMYB 3CUKA 1T34A 1RI4A 4E21A 1NNLA 1M1NA 3UT5B 2VT7A 3G49A 4HTFA 3FISA 4N01A 3KQKA 2VBZA 1YHYA 1WCXA 3F5DA 4P7JA 2G1UA 2OTCA 3OETA 2IL1A 3QFRA 4MW2A 4J7UA 5H9VA 5JAHA 1T8UA 3FUUA 1Y9EA 4KMOA 2HNBA 1ECPA 4N7MA 4IFTA 2A86A 1QB8A 2WAEA 4PNZA 3RD5A 3GMIA 1VL5A 5E6SB 3EMKA 2Q07A 2Y31A 3LBFA 5EP1A 4QULA 4EGYA 3CZAA 3IIMA 4WOCA 2H5EA 1Z7BA 1ILWA 1WUHS 3PD0A 4X8MA 3K09A 3D7KA 4DYVA 4DDHA 3LT4A 1M1ZA 1XZAA 3DFIA 4ZOLA 3EWIA 1MPXA 2FPGA 2I1WA 3D2BA 5E20A 2AFIA 1CKEA 3EY4A 4J03A 2B3DA 2FSVA 3IYLW 4S1WA 2II6A 1K4SA 1XHEA 4IF6A 4RW0A 1PEYA 3ITDA 1KQPA 1QBKC 4X7PA 3B85A 3KELA 1FSFA 2HK6A 4MLCA 5GPAA 5BWNA 4FOPA 1LRKA 3PNVA 1KFCB 2GOXB 1V6SA 3DBVO 1YL7A 3FKSD 3Q7RA 3UTCA 1VPLA 4NFLA 5L3QA 3OA0A 1NI4A 1YHZA 3SSOA 3JQ8B 3QM1A 3VC2A 2V8OA 4W4TA 1Z8DA 2WUWE 3KHKA 1NBMA 3EEBA 3P9KA 3E3LA 3N0RA 2PE5A 2AF3C 2M6RA 2QYSA 5BQ5A 2GS9A 5K09A 2E5LB 3I04A 1E1QA 1Z4QA 1Y6FA 1N36B 2R7AA 1UFRA 3VNUA 2XAUA 2CFRA 5COQA 1NY5A 4AIIA 2YY5A 2G40A 2DERA 1N3LA 1D9ZA 2HLPA 3OE5A 3PHBE 5B7PA 2XF5A 5I4IA 4E5SA 2H65A 1Y48E 4G86A 1NASA 4LYDA 1POWA 1UM9A 2GXUA 4FKZA 4LDNA 5AK5A 3UXEA 3KQNA 1ZKGA 1UBNA 4EJVA 4OB7A 4Q7QA 1YRNB 2HLDA 3Q4GA 3E03A 4RF4A 5DP2A 4KRGA 1DJNA 1P9LA 1QIEA 3Q5FA 1U1CA 3DBRA 2XEDA 4LX8A 3W6NA 4B79A 4QDTA 3BIXA 4EI9A 2C8VA 3ISPA 1EGAA 4PW0A 2ZC2A 3OFND 1ZM3A 1E1DA 2BW0A 2JANA 4ITVA 1V6AA 4M0UA 3RC1A 3NU1A 3REQB 4Z51A 5JXWA 1GFZA 3FDFA 1YHNA 4JJEA 2FMIA 5ALQA 3P96A 4Y6PA 2ZO4A 2IVZA 2J6HA 4PR3A 2GBLA 3IPAA 4B33A 2BHSA 3JRGA 3KSUA 2SKCA 4ZDOA 1WTAA 2QVYX 3HCWA 1KSGA 5KX5F 1R8SA 2C95A 1BN7A 3K2ZA 1AG9A 2BHYA 2NS7A 4MJXA 4LGWA 3TAXA 1QYVA 3FBGA 4MDEA 1I1NA 1PJCA 3KPUA 1MBGA 1TA4A 1YJXA 4KUHA 5EQJB 2G9UA 5CBPA 1TZLA 1Q21A 4WDQA 1BVHA 1NW8A 4BIIA 4P3XA 5FUWA 1ZLJA 4ASUA 1DRUA 4ZU6X 3UAVA 2HA4A 1V4BA 3V1MA 4KB5A 1HTWA 3B78A 4EMBA 4ZOAA 1D6JA 3NDIA 2KBFA 3MLBA 4GR4A 3LLVA 3R40A 3T8YA 3COSA 3MYRA 4MR8B 1ZCZA 2FR8C 2PHZA 4HAUA 3W3ZB 4D81A 1X1DA 3C5EA 1FFBA 3LOQA 5KMGB 4YMLA 4AYTA 1DOAA 2QQ8A 1DV1A 5LHIA 2GZDA 3IHKA 4B31A 1AHNA 4PYJA 3TP0A 3UIEA 8GPBA 4OXQA 4V1CB 5DM0A 1T3HA 1W2HA 2DY0A 2Z1MA 3BMNA 4L7QA 4UVIA 5DOZA 3LXRA 5DJ5A 5HG0A 3GLIB 1KAMA 2ZVQX 3RSFA 4IQJA 3B51X 2X41A 1M74A 2BHZA 3QWHA 5JBQA 5ULLA 1ENHA 4P83A 5J1RA 5CDFA 2FCAA 2BGUA 3HVHA 3UA4A 4JA2A 1CQJB 1NK2P 2ZRGA 1Z2AA 1YGPA 1SBTA 3O0TA 5BXYA 2IX3A 3MWMA 2LFBA 3USES 4MRAA 4M53A 2ZRLA 1FJHA 2JTVA 3Q7PA 4NJMB 3H0KA 3HXQA 4LQLA 1I0IA 3UWKA 4HDKA 4MO7A 1QCDA 2ZUUA 4MQFB 1D1AA 1FXWA 3AF0A 2VP4A 4K81B 1CY4A 5CLGA 2XODA 5K3FA 2HREA 2YRWA 1VJCA 4KVZA 2R92J 2BI4A 2RGNA 3TPZA 3WP0A 3H7AA 4F46A 1OZHA 3CX7A 3FMFA 5CHEA 2VJ5A 4DDWA 4JXZA 5BSFA 4BCCA 4HA8A 2E37A 1Y33E 3CFYA 3T9AA 2X5JO 4W8GA 3GLFB 3O2NA 3GTLJ 3KXDA 5G0UA 5C52B 2H6EA 2ZSFA 4CV0A 5KAIC 3U9TA 1MOQA 4PQRA 5CA0A 3ZD6A 1UFMA 1ODJA 5DNYB 2P2LA 2P75A 3D0SA 3MGGA 3PQDA 3RRYA 4MYCA 4DLWA 4F6RB 4YRZA 4C3IJ 3UJ3X 2VCYA 5IT9A 1SRQA 2A0WA 1RQNA 4EX7A 4B4UA 3LCUA 1YFZA 3HUEA 4GDMA 4K6CA 5JAIA 3PCRB 3JQFA 1YR9A 3BHNA 1Y0UA 3OU6A 1N5DA 1CUYA 2Q7DA 4ABYA 3HYNA 1R5GA 4ISBA 1O95D 1D9XA 2ZXUA 4BV2A 4FISA 3RU2A 1VJ5A 4Y15A 1LDNA 5LGTA 1BOFA 1OXUA 4JIMA 4R1OA 1YR8A 1J9ZA 1W2GA 5FBQB 3SYKA 5E79C 2X6YA 3VU0A 4E03A 2W2KB 4ABTA 4II3A 1YQEA 1A7KA 3U1KA 3I01M 1VI0A 2CNKA 2ZJQF 1JQDA 1M10A 2X1CA 4ANJA 1AXGA 4GM4A 4ZT7A 3N87A 1BH2A 5EE0A 4BIMA 2ZFWA 4LY3A 4J7AA 4KODA 2W93A 3WLKX 2QT9A 1JSXA 2ZCVA 2I3GA 1MDFA 3H8JA 2VZ8A 1K7CA 3L9WA 4N3NA 3VYWA 2RB5A 2WI8A 2WWGA 3UMRA 4CH7A 2PUCA 1QIJA 3CMMA 4CEIB 4XIJA 2ZWMA 4L08A 2HCFA 4CM1A 3TN7A 2IGKA 1P4RA 3ZGLA 2BXYA 4WNCA 2QN9A 4D4LA 1ZUWA 3EMDA 5KYYA 4F52A 2E3JA 3BIFA 4W5TA 1X2MA 4MARA 3P2YA 1I6HJ 3ESDA 1NRWA 1M66A 1H9AA 4WWCA 3EDYA 1E66A 1QNTA 3D6AA 4QAJA 4O3FA 3MZ8A 1RR8C 2HWUA 2XQIA 4LOKA 4W6ZA 2R87A 3HOYJ 4A03A 4B17A 1NQAO 3FI9A 5FBKA 4DCGA 3DTNA 1H8HD 1RKBA 3PFHA 4LKOA 3SPXA 3K9CA 4M8LA 4RYDA 4PHFA 3AP3A 1QZTA 2R7NA 5EIBC 3FHNA 1FSHA 1HQYE 5FOVA 3SGLA 4OREX 3HMQA 4INPA 4X1OA 1ZH8A 4L0QA 3TDKA 3IP9A 3GLTA 3EK2A 3FMSA 4H1VA 4PQYA 5LOVF 2XJ4A 3QEOA 4QAQA 1YSCA 4DWJA 3S1LA 2HRRA 2YNMA 3MS4A 2VWGA 2HW8A 4LOHA 2G77B 3K16A 1ZVQA 1U28A 3I2GA 2LV8A 5A4JA 4LFAB 4PX2A 1AHIA 4IW3B 4A4DA 4AXBA 2Q9CA 4D6PA 1XMSA 3KV1A 1UJ6A 2LD5A 1W0TA 2GT1A 1NRIA 1U8TA 4NF2A 2DDBA 1GJRA 2OZLB 5FHQA 1DXHA 3TNYA 3VMMA 2CW0F 2ZSIA 3ICWA 4NDAA 3S3TA 5G40A 3SQDA 4D43A 3GZJA 4E70A 1U11A 3AJEA 4ZPJA 3B7GA 2M7BA 2C59A 4G63A 3WGLA 5ADUS 2H2GA 5FXMA 5BWBA 1M8JA 5J8FA 3K8QA 3V46A 1IU9A 5CURA 5F9FA 4OIOF 1ZPDA 1SOVA 2J9GA 2GXSA 3OAAA 4FW8A 3ZJYA 4D3XA 1UP6A 2EHDA 2QM8A 3SQNA 5K6RA 3SU8A 4E11A 1U3WA 5T6BA 2XMCA 3DUWA 3ENQA 1B26A 1CY0A 1OFCX 1M6EX 3EUAA 1U7HA 2PPLA 4LX0A 2BY3A 1DRWA 1LB1B 4NOKA 5KHOC 2DR3A 3IAM2 1Z2CA 4ADSG 3GLHE 4IMRA 2QU8A 4ESEA 3H16A 3FJYA 3MB5A 4WTOA 5AM4A 5A6SA 4CLDA 1EZ1A 3QEMB 1IBRA 3HWSA 4HDSA 3ZCVA 2ELJA 2L2QA 3LC7O 1VIMA 3EZ6A 5I9LA 1R5OA 4D7NA 3F1KA 4AD8A 3KZKA 2WDZA 5FD6A 1AKVA 1LX7A 1MZVA 3FPJA 4MEAA 1Z4NA 3VQTA 2YQ5A 3EZ7A 3RAPR 4D9BA 1A71A 1JYFA 3JW4A 3IOCA 4ZODA 4HYYA 5FRDA 3RE1A 4D9NA 4KUMA 1I33A 4RPJA 5EF6A 5F76A 3SWWA 1C29B 1M75A 1HH4A 4DMUB 3LK7A 4RHFA 2IXGA 2XDQB 2XGEA 1WG8A 4WOJA 4DHEA 2JSPA 1RP7A 2I99A 2P4SA 2YMLA 3CM0A 3OD1A 1KY3A 4U63A 3VR4A 1F4KA 2JLAA 2WVGA 3MGBA 2FUCA 1FRFS 2F1RA 4WF2A 1L1RA 2NSHA 5CA1F 3EG9A 5JS1A 1Z75A 2KYRA 1G3SA 4KE8A 1U9CA 5A04A 4WUTA 3WZMA 4FCWA 4J07A 1O3RA 5CGZA 3P26A 3KE2A 1IE3A 1FIAA 1U3CA 2BMJA 2YIMA 1LEAA 3GDGA 4OXIA 4V0SA 3RABA 1ZQ9A 1HR0B 2EBIA 1H9CA 4EMUA 2ZGVA 4ARIA 2JGLA 2BFNA 1V26A 2GZAA 4MB0A 3UXHA 1IUOA 2BY4A 4YCBA 1L5HA 4DQVA 4CIBA 4EHLA 1WPKA 3ZBUA 4E7OA 4KV9A 4AECA 1Z7LA 3QI2A 4UOQA 3DB2A 1CP3A 2AW3A 2F43B 3ELYA 2ZSIB 1BSVA 2IQ5A 1NVUQ 2DTXA 2WJJA 4U7HA 1JR3A 2XMRA 2MMCA 5CK4A 1W49A 2WILA 2ZUWA 4URYR 1QJ4A 2R8BA 4NATA 1XZ8A 4XJSA 5TGZA 1ACIA 1SBCA 1CF7A 2FFHA 5AVXA 2HZBA 2QN6A 1GOTA 4HOBA 1E9VA 4PLCA 5CB0A 5F0HA 3PQCA 3OKCA 4UTRA 2ZKIA 4GKBA 3ZZUA 3WQHA 2DPHA 5SZKB 3A11A 1T24A 4K6GA 2Y0SN 4WKCA 5E38A 4CQLA 1DLJA 2L69A 4EYEA 5I8ZA 1K8YB 2IGBA 2NAZA 1JG1A 1XKQA 2LH9A 3E0QA 1X1TA 1YU6A 4U2DA 1D1SA 3FX2A 2L2OA 5E8JA 2QGUA 2OFWA 4BKMA 4AAYA 4ZQIA 2LNDA 3I1YA 1YC2A 2YHSA 1WCMJ 1KU7A 2Q6KA 3L09A 3NTVA 1KP2A 3E7XA 4WJKB 3W2IA 3K70B 3RRFA 3LOUA 2FWAA 2WTMA 2VYVD 2ZYVX 4FS8A 4MYSA 5DRTA 4Z0NA 3ER8A 2H94A 2NQ2C 3WYEA 3DTVD 2BGIA 3I4CA 3BOSA 4TTRA 1WUJS 2AWNA 5IK2D 3WAKA 5JMOA 2EQAA 3W6UA 5KYWA 1Q3HA 5AK4A 2I33A 4EDFA 3CE6A 1A3CA 1NBEA 1AD2A 1TQDA 2FWNA 2C3PA 2DBVO 2QLFA 1DP3A 1DFIA 1XVLA 2D2IA 1KO1A 3HA2A 1HSTA 4H7DA 4PVCA 4O02B 3UMSA 3E5QA 1ZRNA 3HUUA 4IPTA 4RK0A 3HKBA 4H1TA 1UXIA 2WAMA 4HGRA 1RWQA 2WIKA 1J21A 2ZYSA 3DZCA 1EBFA 4K9QA 4REOA 4KAJA 2FZ4A 4TS4A 5CFNA 1RKVA 2DMPA 1IUNA 2IW1A 1TK3A 3MMZA 3KK0A 4OH7A 3RIMA 1FOYA 3JAWA 4OOEA 2FJ1A 3UJ7A 3VV2A 3DT9A 5D85A 4CUZA 1J09A 4HYQA 4BEBA 2BGNA 1DJLA 1A50B 1AUVA 1NQVA 2QRVA 2NUTB 4UKDA 5EKSA 4D0SA 1E18A 1R6DA 4LI3X 2GK7A 2I66A 2O06A 1G42A 3G7UA 3KHUA 4XIDA 1CUUA 4ZOLF 4EPRA 3NQOA 3LNQA 1F51E 4TTPA 1DRJA 2RI6A 2Q1WA 4KWCA 2CBGA 4S3MA 2HKXA 3HSEA 1GGMA 1GPDG 2R00C 3TB4A 3KALA 3G5MA 1FBNA 4GGMX 4RTKA 3H35A 3A6HA 4GDFA 3C6BA 2HSDA 3HLKA 4FXOA 3IWFA 4GBMA 5GOZA 5B7NA 5FOXA 3QE0A 3R9XB 5ADVA 2FG6C 4WHMA 4JVNA 4LDJA 5KX5B 3TOXA 5JARA 3KUKA 1LQ1A 1PFVA 4L3WA 1P1KA 2ET6A 4ZCTA 3CHYA 5DV5A 1X1PA 1DJQA 3K31A 5FR2A 3T7IA 3WMEA 1FZTA 3EAQA 5BQOA 4LRUA 4LWZA 2OV7A 1EP1B 1I3QJ 5HS9A 2R8XA 3BZWA 4HB0A 1MP0A 3DR3A 3ECOA 1P1CA 3IUPA 2OV4A 4PC2A 3C3MA 4DQKA 2IDJA 4C7KA 1QYRA 2QVZX 2VQSA 1PDWA 4PY2A 4YJFA 4AF7A 4DIUA 4EG5A 1WXGA 3G2PA 3I5XA 2HZ7A 3BEDA 2R6JA 5D7BA 1I5ZA 4HN2A 5DNDA 1NPYA 1I10A 1Z0FA 2NNWB 2BY0A 3W3CA 2VZEA 3BHJA 2UYQA 3FRHA 2IVMA 4L6IA 4L8FA 3SZ3A 4CMIA 3EUKL 3GRUA 5CPRB 3PTLA 2O7NA 4DMKA 3VR4D 1W1WA 2VP6A 3HSFA 3IUSA 3NOVA 3WGGA 3JR3A 3QUSA 4KAAA 3OX4A 4MQEA 3VKHA 2CEKA 4D8TA 2XGSA 2X6OA 4LE2A 5IC4A 1JA1A 4FNOA 3F3XA 2A0UA 2GAFA 1E2UA 1VI5A 3NANA 1XN4A 4RV4A 3SOPA 3ZTYA 5TQJA 4PBTA 1K83J 2UYGA 3NH9A 1M2GA 4J0FA 3RQSA 3KPVA 4JB2A 2HTFA 3LSMA 2R6DA 3CW9A 1XTTA 2RNGA 1AN0A 2B0CA 3PO3J 1J23A 3PJRA 1E2GA 1CRLA 1VI2A 3TQNA 1X7HA 1JLSA 5KZMB 1H4QA 3IO5A 3WTTC 4A6EA 2FVXA 2M1ZA 2P4HX 5L7YA 2BUAA 2VAWA 2PAAA 2FUG1 4WZBA 2CXTA 1EHCA 2B21A 3DO5A 4ASUD 3HCAA 4DLLA 1FVXA 1TT0A 2OCKA 3JCUC 1NV9A 1NKVA 2AF4C 4RZUA 1U9YA 3QNWA 2XUBA 3GD7A 4ZI7A 4GL4A 2IITA 4MINA 4MRMA 4OYHA 3CONA 2ALJA 1X8KA 4QRDA 3H17A 5JEEA 4HNAB 2R85A 3PA8A 5KK1A 1PR9A 1UB9A 2CNLA 2J3LA 4AJPA 3CO6C 1EQAA 1E3WA 1PQUA 3JV7A 2ZJ1A 4G5YA 2WE8A 4UEJA 4XWGA 1NI4B 1A7UA 2B34A 1U8UA 2WA1A 1XTKA 4YLEA 1O3QA 1ZH0A 3E5RA 3KDSE 3NBZC 1E3IA 3K5PA 1JAYA 4ZOEA 1SC9A 3B1WA 4GLLA 3OIVA 1FY2A 2ZIVB 3DH0A 2AVDA 2Q5QA 4I6GA 1BG6A 2QJFA 3JQ7A 2A07F 2P2GA 4FC6A 1UQUA 2IGTA 3A4CA 3A6LA 3E9ZA 5DNCA 3E70C 1TNDA 5E4JA 2FRDC 3V1UA 1TZJA 1XP8A 4K87A 2XCTB 3KYDB 1KVTA 1XQXA 2OSBA 1I14A 3Q11A 1IM8A 4Q1AA 5E2AA 5EMHA 5B2FA 1OY1A 3LH5A 4OAPA 2YHBA 3EVGA 3GJXC 3X2SA 4DLBA 3SBOA 3W79A 4Q7EA 1USTA 2QMEA 3RFVA 3VO1A 3WE7A 1SMTA 1RU3A 3CZCA 3E9CA 5KSWB 1GG5A 2JVJA 2VXZA 1B3BA 3EWNA 1XTSA 1P4WA 4FGUA 5UKDA 3CV3A 1B8NA 4UBJA 3R75A 2YWFA 1XL1A 1E7QA 4D74A 1JQ3A 2OFXA 1SUFA 2PLAA 3BH7A 3REQA 4L07A 3KKQA 4EQQA 3SJAA 2BTQB 3H87A 3ZD7A 2O2JA 1JHOA 1PG0A 2IHTA 2ZXFA 3CLUD 4O4IA 3VHXA 1QVTA 1TEHA 2DPXA 3CCBA 1RQ2A 1C1DA 2TECE 3V7FA 4Q5IA 5DI3B 1Z83A 3ZWYA 3FWHA 4LQ4A 3ZU2A 2AFIE 5E0KB 2NOJB 1O9HA 1ZJYA 4JI5B 3MVPA 4UVBA 1TQMA 4K0RA 1L8LA 5FKOA 4D5FA 1LVUA 3QFFA 2IC5A 4YJ2B 3ZDZB 3U3JA 3VNQA 5A3QA 4S0XA 2W6IA 4KLAA 1KYTA 3IMFA 1V5EA 4G12A 1A8QA 1R9GA 2ZYHA 5GPBA 1UEXC 1G3TA 4WFQA 3S7ZA 3SOZA 3CP8A 1UKYA 1DPRA 4A2WA 1DOHA 4QT0A 4WASA 3DWEX 4MGEA 2JCYA 2CK3D 2MYNA 4EJWA 3HXKA 4NR0A 5GIPE 3N59A 4ITUA 3PKJA 4HVCA 3VVMA 4RXMA 4LYFA 1WJEA 3R3XA 2F9LA 5TRTA 2XIGA 4KR7A 1SQFA 2VP0A 3CVJA 2JHGA 4CKEB 3KQVA 4DXHA 2ZXIA 5FFZA 5KMGA 4Y7CA 2PLWA 4UVDA 4JJAA 3W05A 9GPBA 3L8MA 3QVVA 1DO8A 1I4WA 1E7MA 4B80A 1A4IA 4KFCA 4YXWD 4QT4A 3GV0A 2EB7A 1H2ZA 1QRTA 4DMLA 1U0NA 4D92A 3ZU4A 3SI7A 4HB2A 4EJSA 3OBBA 2OK8A 3EQ2A 4UFNA 4XIGS 4E2ZA 1PSWA 2GYVA 4BTLA 4ZMRA 2XRZA 3ZC3A 2M30A 4OPMA 4KG7A 3MYYA 1SC3A 2Q4DA 3VYUB 1G3YA 4AO7A 4X9XA 4A9AA 1JSZA 3KFVA 4Q18A 4BGUA 3PDUA 1N1MA 1Z6GA 2WUDA 3CWZA 4YAGA 3CCLI 1TC3C 1KPGA 5JLXA 4JYMA 3X44A 5I01A 4M6VA 5IYCJ 4O6VA 3QUQA 3OHPA 4HQOA 5JRDS 1UQTA 1XZQA 2ADOA 5ARDA 1U5TB 2E36A 2R7SA 2X5KO 4CTKA 1EB8A 2BFCA 1SG9A 4FGZA 4CMBA 5HZMA 1CE8B 3ZR8X 1JE0A 2CU7A 1GNQA 1TIKA 2D62A 3NDBB 3RFXA 5GADJ 4Y52J 1F6DA 1HY3A 2I6XA 6CHYA 2AT1A 1X6VA 4IXDA 4MP3A 3QODA 3M2TA 5KNCD 1KQ3A 2FR0A 8ATCA 2O57A 1WHTB 5IVHA 3MTAA 4JEMA 2H4HA 3L82B 3ZDYB 1S4QA 4Z7NB 1F9EA 3RHFA 2QMHA 1D8JA 1K9SA 3CPHA 3K5IA 4HNHA 2FEKA 2VRCA 4F6RA 1CGPA 1ISHA 2RMKA 4N5IX 1KFBB 1HW5A 2ZITA 3BWGA 2EX0A 5LXTF 3DEEA 1T2FA 4ARBA 4FCVA 4QHYA 4E2XA 2G67A 2P35A 2PH1A 1NDHA 3ZTWA 1RKUA 5BNZA 3GPCA 1E3OC 4RGSA 2W0SA 2C6YA 3ABZA 2ZIXA 3QOWA 5TNXA 4LYEA 3TCKA 4CJXA 2WYUA 4P7KA 2E5FA 2VT3A 5F0FA 1DWUA 3KDPA 4J0DA 4R0NA 3ZRGA 1RXEA 5K0SA 4BFSA 1MBHA 2VRNA 3LPLA 2DU9A 4R2XA 5I8PA 4OK3A 2P8TA 5E6UB 4LB6B 1PBNA 3KL2A 4PRYA 1OB5A 3HZJA 1LBTA 1UOEA 2V6IA 3T0YA 4CKEA 1J2UA 1OFVA 3U21A 1HO3A 3L1IA 2Q2QA 1IN5A 1GP2A 2QN8A 4KPGA 4MS4B 2UVPA 2YWDA 4QRIA 4GMGA 1PFUA 4UV9A 2BFBA 1ZOIA 1WQ1R 1ZWLA 1TLHB 2H1CA 4LY0A 1IY8A 4S1OA 3NM4A 4DVGA 4LOJA 4OHZA 2PMWB 4K05A 2E1MC 3ORSA 4M99A 3BCUA 4AUMA 4CCJA 3U80A 1U81A 3NC1C 1Z6ZA 4NIMA 4U8HA 4QNMA 2QW8A 2JEYA 3MT9A 4EVRA 1SEUA 1IN1A 2E5ZA 3H5AA 1KPIA 2YNMD 1QV7A 4QM6A 3K92A 4LWOA 1SUIA 3K6SA 1F12A 1Z62A 4POAA 1FOWA 4H3VA 3K0BA 3WL6A 4MCAA 4WN9B 4PAOA 2QN1A 3LIIA 2W4MA 4ZDLA 1BI2A 1TJPB 3NP7A 1MDBA 2MMGA 3AT1A 4XJXA 2F1JA 4FR0A 4CRWB 5HE8A 4E5DA 1P2BA 1X1SA 3S1RJ 1DUVG 1K92A 1T1IA 2GTIA 4BMDA 4L78A 3CEJA 2Z9OA 3GYHX 1Q3TA 2IYVA 1K27A 2HO4A 3H9QA 4B34A 1R50A 3IJ5A 4Y0NA 1GGFA 2V1DA 5KOJA 2J6IA 4ETMA 1VMIA 1IMOA 4B1RA 4R79A 4ZTJA 1GXSA 2YC2C 4J43A 4Z86A 2AVNA 3PFFA 5CDHA 5HRCA 4YRKA 4WZBE 5F23A 2EKDA 3DVAB 3GGPA 3ZQIA 3GRZA 5AOAA 5EWMB 1E5XA 5LN1A 3MCTA 3GEZA 2H8KA 3DE3X 3M3PA 1KF0A 1K7XB 4FHTA 4F0JA 1P81A 2XCOA 1SXGA 1UDBA 4QWQA 3ZWOA 1I1GA 2VONA 3OJOA 5DX0A 4RZ3A 1NJ8A 1ULZA 2FUEA 1ZUIA 4K6MA 3P9PA 1GNSA 3QJYA 2F64A 1H66A 2BKXA 4UM8B 2OZLA 2JRCA 2JIQA 1KK3A 2E4VA 3L0SA 3HA3A 2VWQA 3DWLE 3O74A 3WODF 5K7FA 4H4CA 4L5CA 1E62A 4RLQA 3KX2A 1ZD3A 2DC1A 2GCGA 1TCBA 4QO8A 2HMVA 3I9KA 3NHFA 2GQQA 3G8DA 5ALYA 4E4TA 1CZNA 3JD3A 4LXYA 3QOEA 4XAQA 4CM8A 3GLGA 2PKWA 2N75A 1ZN8A 1DIAA 2PKRA 2UXNA 3RYHA 2MSKA 1MF7A 1W7AA 2Q4RA 1WVIA 5FL3A 3FGPA 4O8ZA 3C4JA 1S5PA 1OF1A 2GBLC 3EAGA 3ILYA 4TTJA 4D8WA 5JZ9A 1NZFA 1ISIA 1B43A 1LFDB 1U8ZA 4Y4RA 1ECGA 4FTWA 4C0QC 3U26A 1GPNA 4H4KC 2VZ9A 3P2IA 1SD4A 2IUUA 5D4RA 1RABA 4O5OA 4KEAA 3V5NA 3ODGA 5KWVA 2JFFA 2OGUA 1IC8A 2AEMA 2WLTA 2K7LA 4A12A 3MC1A 4M0EA 4V0RA 4BBAA 4QZVA 5FWNA 1MFPA 1I3KA 3RLIA 4MGYR 1R36A 1QP0A 4QGFA 1G7TA 3B1JA 4LSWA 3VO9A 5CLSA 5CVDA 4BNDB 3DV9A 2FU4A 2CO5A 4GE0A 1KDPA 2ESNA 3O3MB 2Z9CA 3CINA 5HS7A 2OZEA 1UOPA 3ICPA 4N8DA 1QX4A 1B6SA 1ORDA 2AS5F 1Z74A 2A0KA 3D59A 1CUAA 1XRRA 3KIPA 2R6GA 2FMLA 1Y7HA 2O7RA 5BW4A 4QLBA 2NVTJ 4R98A 1N3IA 2FR8A 1NVKA 2EJRA 2K9LA 2NZJA 3FPGA 4HAVA 3QYPA 2XAJA 3BBPA