1P2TA

H-ras 166 in aqueous mother liqour, rt
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
162
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Organic solvents order the dynamic switch II in Ras crystals
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Transforming protein p21/H-RAS-1
total genus 58
structure length 162
sequence length 166
ec nomenclature
pdb deposition date 2003-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p2tA00
3MRSA 3VX3A 1AJEA 1ZVQA 2QE7D 4MGIR 2O8FA 1YZUA 2B8WA 2F9LA 3VAAA 2OFOA 4ON9A 1GG2A 2BMFA 1SQ5A 3CZPA 4MKGA 2QAGA 3BS4A 2ZJ5A 4TT3A 1QZXA 3RS0A 4HB3A 1LB1B 2ONKA 2ATVA 5M04A 5CM8B 4C4PA 2GJKA 1Y63A 4TLEA 5AK0A 2YKGA 1XZPA 3P32A 4BLPA 1KJZA 4PSAA 3VR4A 4C0AC 2QG6A 4D2IA 1XPRA 4RD2A 3ONWA 3B1YA 4XD7A 5JWOA 5FBLB 1G1MA 1O3YA 1IXSB 2QEQA 2R65A 3R9IA 2J45A 4A36A 2EYUA 2R6AA 2CCGA 1RRFA 4PPQA 1U98A 3G0HA 4BFYA 2RGEA 3BH0A 2CVFA 4RKFA 2HCBA 5CM9C 1WP9A 2ZI5A 3B13B 1JAIA 3L0IB 3ZVLA 4AK9A 4B75A 4OHXA 3KJGA 4JLPA 4TMTA 1JR3E 1OFUX 5HE8A 4C0BA 3WHLA 2DFKB 1WQ1R 3HR7A 5IK2D 1OKKA 4U00A 5AJYA 5DYGA 1ZBDA 4JSTA 1W5TA 1N6RA 4KV9A 3EIEA 3LRPA 2WVJA 3Q7PA 4PZYA 2ZITA 5KPJA 3ZD7A 2ODBA 2ZRFA 3CPJB 3SJBA 2Q3MA 4IOLA 5L3QA 1T4GA 1W0JA 3WRXC 3QF4B 4DLTA 3PEUA 4EDHA 4HAYA 2IA5A 1SULA 3PEVA 2ZJAA 4Q9LA 1AKEA 4DLVA 1IN6A 3E1SA 3IIMA 5C4GB 3SBDA 1RPZA 2J0UA 1TQ6A 1XCGB 3B1XA 4HAVA 2QAGC 3ZJYA 1KYIA 1G5TA 2ZSBA 4ESHA 1E0JA 2OUKA 3L82B 3IHLA 1C4OA 5C2JB 4LCBA 3Q5EA 3T1OA 3TMKA 4EUNA 3IHWA 3QOFA 3S1AA 2FFHA 3VQTA 1M74A 2IF2A 2IYSA 4QGHA 4Z51A 4C2TA 2P6NA 4BQSA 1OH7A 3SJCA 1YRBA 4OBEA 3U7GA 4LJ9A 2F1HA 1KOFA 1GL9B 2LKCA 3R7WB 2QM8A 2SHKA 3QUSA 4MDEA 3H86A 1PZNA 4QC2A 5B2ZA 3BFXA 3NVAA 4IVPA 1G291 3X1ZA 4NE2A 3KL4A 5GVSA 4QXAA 4D6PA 1PLJA 1XEWY 3BWDD 3KKQA 2ORWA 2D7DA 2BV3A 2DCUA 1JALA 3UK6A 1S9DA 3UWOA 5A5GA 1R7RA 4D4MA 1AA9A 4OI2A 4PO1A 3DMNA 2GVZC 2V8OA 4B47A 4HAZA 1COWA 5BYJA 1W36C 2CNWD 1Z3IX 2WWXA 4JBXA 2JIZD 1R4AA 1FL9A 2V7QD 1R5BA 4Q4AB 4ITRC 3KUDA 4HSEA 4C0JA 4YDSA 3ZQJA 4NPHA 2VYFA 4PANA 3DPUA 4I1UA 4DDWA 2CHVA 2GEUA 4I1VA 3U5ZB 2ZJZA 2VL7A 4LBYA 2AFIE 4MGYR 1GILA 1KDOA 1ZNZA 2GBLC 2JLSA 4ESVA 3B78A 1NG9A 2VRWA 2V55B 2E87A 5FBWB 4II7A 3WBJA 4WZ6A 5GADl 4POAA 4I1OA 4DEYA 3K0SA 1AS2A 1YR8A 2W0MA 3A1TA 3PUXA 4DSTA 1IY1A 3BOSA 4RY2A 5H70A 3B9PA 1P73A 5G41A 4XTRA 5FFMA 1OFHA 2ERXA 4PC2A 4JLOA 3NHBA 1KSJA 1SKQA 5KO2A 1MO5A 4FMDF 5CB8A 4JYBA 2BC9A 2BBOA 4FIDA 2NOAA 2QP3A 2RH5A 1DAHA 1K5DA 2NO1A 4KSBA 4X8LA 5FOTA 3FFAA 5TY0A 1OH6A 2OO7A 3CNOA 5L3SA 5BWMA 3L2OB 5FTLA 3AQ4A 3I73A 3AEZA 4E07A 1JR3A 3SHWA 2CLDX 2I1QA 3K8YA 2QPOA 4BFSA 3VR3A 1U8YA 2BMJA 3RDPA 2DBYA 1FTNA 3EC2A 1XPOA 3GJ4A 3GLIB 3MCAA 3R8CA 2AK3A 2VLIA 4FMDB 3SDZA 4BPBA 3TK1A 2QROA 3NC1C 3M4YA 3EARA 4S2EA 2QORA 3U6BA 2B21A 2KB0A 1LS1A 2G83A 1HE8B 2YC4C 3QF7A 4QFMA 2CMKA 4MQBA 4KLZA 4Q4HA 2WPDA 1ZD8A 3QENA 1P4SA 5SZKB 1S9HA 1DO0A 5KOYA 1WXQA 3DKVA 2BKEA 3BB1A 1E2KA 1OHHD 1WRBA 2R2AA 1KI4A 4LJ7A 4DLSA 1CRQA 4CEJA 3CBQA 2AHOA 1PUIA 2WPDD 4G5OA 2KBFA 1RJ9A 3BIFA 5LD2C 4DJTA 2WWHA 1VCIA 4CGZA 1VHLA 2OILA 4ZIRB 4C9BA 4JS0A 5E95A 3SEAA 2CE7A 5HPYB 1Z6AA 4A0GA 4US0R 4L16A 1R0WA 4URWR 4AD8A 5JHGB 1F48A 3SQXA 4YLGA 5JRJA 3LFUA 3ICEA 2QUZA 4GMDA 1BMFD 3CNLA 1SHKA 3ZVRA 2R6DA 2JJ1D 5C46F 1UBCA 3L0SA 2ZRPA 4TQUS 1XNJA 1XXHE 2ZYVX 1EFRA 1UKEA 3U6KA 1TL7C 3LXXA 3WMEA 1F5NA 2ZU6A 2FPLA 2NPIA 5CDFE 4QM6A 2DFTA 1ELOA 2JLZA 1RW4A 5DI9A 4ZCMA 1TMKA 1ESNA 4NCJA 3NBZC 1ZUIA 4W5WA 2QMUA 4ZCLA 1XD2B 1G3RA 4DHEA 4R9UC 2FN4A 4YC7A 1RRPA 1QHGA 721PA 3CPHA 4NYIQ 3W6OA 1XD8A 2OESA 4M21A 5CJ2A 3HPQA 5B58C 1H8HD 5C18A 2LKDA 1E2MA 5E3HA 3EG5A 2IXEA 1E4VA 2ZI4A 4XSHA 4P32A 2OHFA 4UNQA 1JXOA 3U3OA 4D26A 3TSOA 3FKSD 3C15C 3KKMA 2YWFA 1LY1A 2ZREA 2R6CA 4QKQA 3QKUA 1H8HA 3RWOA 3CO5A 4Q1FA 4Q1BA 3CB4A 2KSQA 3OZXA 4LOAA 3DM5A 2VO1A 1FQJA 3TUJC 2WBLC 2GETA 1CIPA 4LHWA 1QHSA 1NLZA 2Y8EA 1T6NA 1CF4A 2OM2A 3CRRA 3KJEA 3T1QA 4KBGA 4E22A 4IDQA 1DAKA 1Z6XA 1CS4C 4IEEA 4DLXA 4A82A 3K9LA 4V0OA 1E1QD 1GRRA 2NO0A 2W2TA 1T3SA 5DI3A 4Q02A 3TAHA 3QKTA 2ZUDA 4YXWA 5FH9A 5LBIA 1D9XA 2CK3D 1S2MA 1DAIA 1BOFA 2VF7A 4W7SA 3CF0A 2XSZD 3U3MA 3LBHA 1Q1EA 4M1KA 2AL7A 2QY9A 1FP7A 2IYRA 4KO8A 1M6NA 4GOJA 2ZANA 2XZLA 3KXIA 4GNKA 4V0NA 1KY2A 3I5YA 3EZ2A 4UNSA 5KDLA 2B6HA 2FFAA 5FOWA 1IOZA 1FX0A 4FI3C 3LAWA 3K09A 5F98A 4Z1MD 1VDZA 4B6EA 2ZRNA 2IUTA 1D5CA 1OYYA 3LW8A 2WSMA 4JT2A 4Q48A 3GLHA 4GMXA 2F9MA 2OLKA 3THWB 2I4IA 1P62B 1N3BA 1SVSA 2N42A 2P6UA 3AGQA 2J0QA 5KSOA 2ZS9A 2WSSD 3CX7A 3N2IA 5DNYB 2GJ9A 5SZJA 3GP8A 1ZU4A 2F3TA 4HZUB 2ZXUA 3QBTA 3AVXA 1E2FA 2RGBA 4RCZA 2IUSA 1GP2A 4A8JB 5EE9A 3M1IA 4ZV4A 1N0WA 1E9AA 1V43A 1XRJA 5L3SB 2IXFA 4QOSA 1GM5A 4MKFA 1G7RA 1VTKA 4LGMA 4D0LB 3PUWA 4EPRA 3J81k 4TTQA 3VR5A 3OIYA 1EX7A 3W8NA 2FEMA 1TPZA 3R9XA 4LYFA 4TLDA 1YR7A 3FFBA 3LX5A 1E9RA 5IK2A 5LB4A 2KBEA 1GDDA 3K09C 2ZSAA 1E9SA 3LNCA 2FZLA 4LBZA 1D2MA 4QBGB 1Q44A 1XX6A 3LDAA 2JLUA 4QJ3A 2GJAA 2GXAA 1DPFA 1HT2E 5GJCA 3FOZA 2JLXA 4ZIRA 2J5XA 2ZRIA 2YWHA 1E9DA 3B1WA 4K46A 1KK3A 4JLBA 5ELXA 3ZVMA 4QL3A 4D81A 1AS0A 3W3AA 2GK6A 3SZRA 4HLUA 5HZHA 3LA6A 3DZ8A 4Z8XA 1UKVY 1T5LA 4URXR 1NN1A 3IO3A 3OIVA 1ZCBA 5JLJA 1NF3A 4LJYA 1XZQA 2AR7A 2ZM5A 2JJ1A 3FB4A 1NMXA 2EQBA 2QN6A 2PH1A 3KB1A 4MUAA 4ZKEA 3N2EA 4PZZA 3BK7A 4A92A 4A8JC 3QPUA 1VCOA 3AP3A 3CWZA 2ZS7A 2EFEB 1VHTA 3AVQA 1RFLA 2XNDD 2VF8A 2FA9A 3K70D 1Z83A 3RANA 5FPSA 1IAQA 3D3QA 1AZTA 3OE7A 1U90A 4XVRA 5IHPA 3DMDA 1JPNA 1DO2A 1N6NA 3BB3A 4KU4A 3EA0A 4Q4JB 5J4HA 4TL8A 4D4LA 2QSZA 2IX3A 4JLAA 1S1MA 5AUQA 5FPKA 1FNMA 2OG2A 2OBMA 2OFWA 2HJVA 5GJWC 4BFZA 4YQFA 5G3YA 5UKDA 4CEIA 1E0AA 2ZE7A 3ND8A 3O8BA 3VHXA 421PA 3UG7A 4P3YA 3U61B 1JXMA 5JBQA 3K0AA 1P7CA 4OQFA 3IBYA 1RE0A 1F6BA 3HU1A 2JLVA 1NKTA 1GOTA 4FCWA 1Q20A 4NONA 5TVKA 4PQFA 1R5NA 4MYCA 4NBSA 2ODWA 1IBRA 3A8TA 2JAQA 1U0HC 4DWJA 1MABB 2C95A 2VIIA 5HE9A 1P3JA 4A0FA 4R71A 3QI2A 2FSHA 1AQYA 1JAHA 3U7EB 2BM1A 5DI3B 3RC3A 2ONJA 1P6XA 2N46A 3QXJA 3DVLA 3AVUA 2J1LA 2WWFA 2AD5A 2XEXA 2V1XA 4PPGA 1M1YE 3LQQA 4NYJQ 4F7WA 2G9NA 2FWRA 821PA 1XEXB 3JVVA 1SVWA 1VCMA 1TF7A 1EESA 2NTYC 1HT1E 2PZEA 4IW3B 4QJ5A 2ERYA 2QA5A 4B74A 4O25A 1P9WA 1Y3AA 2XXAA 3JZAA 3AF2A 1R10A 4QBHA 1QVAA 1W1WA 4DUGA 2O0KA 5TARA 3CUEF 3QQ5A 3OIUA 3ADBA 3CR8A 1NL3A 2KJQA 2IHYA 2X2EA 1NY6A 3NBFA 1W48A 1A4RA 1AGRA 4UNNA 1Q57A 2G6BA 2WSSA 3NKVA 3QXSA 4TN1A 4A0RA 2XOKA 5GJVC 1G9XA 4PC7A 1E2LA 2RB4A 2ZR9A 1R8QA 1ZM9A 4OYHA 3PUZA 2A30A 4CIDA 1HH4A 1ZYUA 1G7SA 4DEXA 2GHIA 4L15A 2OLJA 3FHOA 1H8EA 1N6IA 4YMWA 1Z07A 5A4JA 2ZVPX 4GOXA 4DZZA 1YR6A 2CHQA 3EWAA 1GKUB 4B6FA 3NDPA 1RVDA 2CBZA 4LHVA 1UADA 2ZE6A 1FUUA 4KFTA 4YMTA 2V3CC 5JWRA 3LO5A 2HF8A 1IXRC 1KIMA 4EJSC 5FTMA 1UDXA 4W5HA 4DXAA 4PR0A 5IDVA 2W6JD 1EXMA 4RKEA 4KYUA 1TU3A 3PUYA 4TMZA 3FYHA 1L7VC 1JI0A 5B64A 4BRUA 1A82A 3GLGE 2XITA 1II0A 1AN0A 3A1SA 4TSFD 2YC2C 3VKHA 1II8B 1YRAA 2XTMA 4L4UA 2QBYB 3NDBB 2IWHA 4C7OA 3EIQA 5K8IA 3HU2A 2P67A 4F92B 4JVMA 1E1RA 4BZXA 4E03A 4R7ZA 4TWZA 1KMHB 1TEXA 3OFNA 2H16A 1KJWA 2ZRKA 1CJUC 1HA3A 1XU4A 1ZM3A 3MJRA 3QXCA 1WE2A 3A1VA 4P31A 2H18A 4FXPA 4JLJA 4C0KA 2O0JA 2YWEA 2IBMA 5JJKA 2A5YB 2BBSA 2FH5B 3THYB 4NCKA 1G4UR 2EFHB 4DIEA 4TLAA 2FG5A 1NNEA 4HB0A 4JLNA 4RSGA 1KZ7B 3W9YA 2CL7X 4Q4JA 4TSFA 2RGNC 2DWQA 1ZP6A 4BLRA 2JASA 2CEAA 1Z06A 3KKOA 4F4JA 2V7QA 4OI0A 4UXHA 2HCJB 1V5WA 3QKRA 2GCOA 1XWIA 4OI4A 1BYIA 1H65A 4CEJB 2AXPA 1W47A 2NG1A 1C9KA 4DLYA 2VP9A 2WZQA 3M0EA 1E0SA 4ARZB 2IYLD 4V0LA 1I4LD 1TQ2A 4PXAA 5AJZA 5FPHA 1NKSA 1Q3HA 4KHZA 4AG5A 1DAFA 3GJ5A 3LY5A 2E1RA 2WJGA 2EVWX 4ZDKA 4RD4A 2FDCA 3FHCB 4JVNA 4OJQA 5IT5A 1NVWQ 4HLUC 2ASEA 2W83A 1OSNA 2CHGA 2EYQA 2OV2A 4Q7KA 3RS4A 4CVNA 4BWYA 2XSZA 5H8WA 4DSUA 1Z6TA 2OSBA 4JBYA 4A6XA 1T0HB 2GEDA 1E9CA 4URYR 3N70A 1P5ZB 4B35A 1NSTA 4A6PA 1G17A 1Z22A 4ZPXA 4H1VA 4LUCA 4MGZR 3CPEA 4B2IA 1A1VA 3QPWA 5LDDC 4Q1EA 3K0AB 2JA1A 1LF0A 1M2OB 2C9OA 3TSWA 3CX6A 3DHWC 1Q12A 3Q9LA 1XD2A 3I4LA 2GJSA 4BZQA 2KWIA 4JT4A 1G8FA 4OHZA 3AKDA 3GJ6A 4DT1A 1GUAA 2PEZA 4JJZA 4RD0A 3W3ZB 2XTNA 2IW3A 4EFMA 4WOPA 3TH5A 1EFCA 2UKDA 2ODEA 2FV8A 4L9WA 4AWXA 2JLRA 2G88A 1NSFA 5KTYA 1GWNA 1CXZA 1EG7A 3HR8A 2FSFA 3M6AA 4Z1MA 3DO6A 1E3MA 2IYXA 1LTQA 1HYQA 1JNYA 2EFDB 1COWD 1AKYA 1KK0A 2CCKA 1ZCAA 2WAYA 3U7FB 3ADDA 3EX7C 4IOKA 2GXSA 2IWRA 2C5LA 3NC0C 4CT5A 3FDIA 4G0NA 2O5VA 2O8CB 2AWNA 1E2IA 3CONA 4NYJR 1XDBA 1G18A 2ZRDA 2HF9A 3QPVA 3ZD6A 1XEXA 3L0OA 3H2YA 2W6IA 2H7VA 3HP1A 4P4SB 2PCJA 1JR3D 2XZPA 2VP0A 3WNDA 3H4MA 4IDPA 3B60A 2REOA 2IF0A 2ZUBA 2QI9C 4MRRA 1U9IC 4UQOA 1ONBA 1Z63A 4KITB 1P2UA 4MYTA 1W46A 4O0MA 1E0KA 5FBVB 3ZVNA 4BEBA 2ANCA 2P65A 1NN5A 4FCVA 4OI1A 1GSIA 3V4FA 2HXSA 1X1SA 4IXNA 2BBTA 2RAPA 4W5JA 2NMVA 5IF9A 1ZJ6A 4HYYA 4M4SA 2ZJBA 4MRVA 1U0JA 4LJAA 1W4RA 2P3SA 4F93B 3BE4A 1Z0JA 1SXJB 1NN3A 1UEIA 1XTQA 1CR4A 5CLLA 2HUPA 2HXYA 2F1JA 1MO3A 4I1SA 3SI7A 3AM1A 3KFXA 2A9KA 3RVBA 4A15A 1TF2A 4GDFA 3GJ3A 6Q21A 1HTWA 4HUTA 2WJJA 5CLQA 2GZAA 2CDNA 1GNPA 1W4CA 2ZU0C 2ORVA 2XJ9A 1VCNA 5DHFA 3LH5A 3QE0A 2BHRA 4OQXA 1KAOA 5AJWA 4O3MA 4PO9A 4DCTA 3PCRB 4XVQA 1TX4B 5FUVA 3V00A 3KXLA 1II9A 4EAQA 5K8TA 2WJYA 1IM2A 3U4QB 2GTPA 2G1JA 1XB2A 2ATXA 1PJRA 1E2NA 4O2RA 4Q01A 3E5HA 3A1UA 1KTVA 1XCMA 2O0HA 4TYQA 2WWYA 1LS6A 1VG9B 3RSOA 3ETLA 1P9NA 4IFEA 1OE0A 5K8UA 5EP1A 2YINC 1YQTA 4QBFA 2A78A 1AQUA 1II8A 2VSXA 2QBYA 4V03A 3Q72A 4NYMQ 2GCOB 4C0QC 4ASUA 1G8YA 4KI0A 1SVIA 2C78A 5FOUA 1G3QA 4HB4A 3BAFA 4D82A 4IRUB 4M1MA 3GFTA 5DE3A 1OXVA 4ZCIA 5L8VA 3TQFA 2C8VA 1D6JA 3I92A 4Q5IA 3TBKA 1PLLA 4OK5A 3THXB 3Q3JB 4F91B 3UMRA 4GOKA 4PC6A 2ZSDA 2ZRAA 2ZJ8A 4DIDA 1E2HA 4E5UA 1E1QA 2YOHA 1YZLA 4L5BA 4TZ0A 3RS2A 2VSFA 4JKIA 3UXMA 3AF0A 3PJRA 2QTHA 1U8AA 2IUUA 3CR7A 2ORIA 2OBNA 1TNDA 4JBWA 1L4UA 4C30A 3W5IA 1UEJA 4TLCA 5FOVA 3AUYA 3W8RA 3AP1A 2VP4A 2VSOA 1DBSA 2G0TA 3B6EA 4LYJA 1GFIA 4IDOA 4ARZA 4XWKA 8OHMA 3ZZTA 4P0TA 4B32A 1KI9A 4OK6A 4PQYA 3W5JA 3F0TA 1I4TD 1TU4A 2C2HA 5FR2A 4LHYA 521PA 2A3RA 3IQXA 3UKDA 1R0ZA 1SZPA 1F3OA 5FL7D 5BN5A 1XTRA 4Z54A 3P27A 5KU1A 4OKSA 4G5GA 3RRMA 5DISB 4V02A 5FL3A 4IVRA 5KNBA 2VHUA 1JB1A 3GLGB 2J0UB 2HJGA 3A58B 1IN5A 4QNRA 4LPKA 5CIWA 1OYWA 3MGCA 1MRSA 1U81A 4HDCA 2IEZA 2XTZA 1FFHA 2J7PD 1KI1A 5FI1B 2QMEA 1DAGA 4Q21A 1N2CE 1VG1A 2O8CA 3RSLA 4URVR 4C3ZA 3PEYA 2J0VA 3WRYC 2V1UA 2V6JA 4A9AA 1Z0KA 4IFBA 4RD1A 1FMJA 3PEWA 3GEEA 3U44A 1ZM7A 4P4SA 1OXSC 1DOAA 1QG4A 3NHAA 4QHTA 1NMZA 3FTQA 1T91A 4LV6A 1N6PA 1FTSA 5EXTA 1IJFA 3AKCA 4R2HA 1OPXA 2J9RA 3AH8A 5J4VA 3EPLA 2IK8A 1XTSA 3K9HA 4G1UC 1TF5A 1JR6A 1Z0DA 1IHUA 1QHIA 1ZU5A 1H8ED 1JECA 2YV5A 4Q9JA 5JJIA 2P6RA 3TNFA 1UAAA 1T0JB 4GZMA 3TUZC 4AKIA 5J5CA 4Q00A 1UFQA 1JBKA 4HATA 1B23P 2H17A 2QPTA 2VHTA 4BE7B 1P61B 2ZYUX 2ZRGA 1E69A 3V9PA 5EUQB 4JL8A 4NKRA 4EPYA 1JPJA 2NZ8A 3NG1A 3QXXA 4ZI3A 2ZVQX 3B82A 2WJHA 2BEJA 4M1WA 1KI6A 1GITA 4MITA 3SYNA 4MGKR 1UM8A 2V54A 2ZIAA 2GAAA 3GD7A 4LJ6A 5EE3A 4DCNA 2VQSA 1KO4A 3X1DA 4EQ6B 2CCJA 4BFTA 3EZFA 5H68A 2XNSA 5GVRA 5JWHA 2OBLA 3VFDA 2GA8A 4NTZA 4C2UA 4LHZA 2WKRA 2ZRCA 3IDQA 4FINA 5DH9A 1FZQA 1KO8A 4NCIA 3CF6R 4DLRA 1YZQA 3H0KA 2W2XA 2OCYC 3QXHA 3QVVA 2J0SA 2R44A 4U7DA 2JEOA 4NCNA 2CVHA 5EP4A 3C16C 4BLSA 3T35A 5AUPB 3F5FA 4MKHA 2QM7A 2H1LA 2GBLA 2Q3HA 1NVUQ 1EGAA 1T8TA 2VHJA 3AVPA 4LWZA 1OJLA 3LQRA 1XTJA 5FI0B 1F2TA 2BEKA 5CK4A 3TW8B 1ZAKA 2RGDA 4LBVA 3R8FA 3TSZA 1QF9A 2IYVA 1EX6A 2PCLA 4DSNA 2R62A 4D25A 3JZMA 2OCAA 4MRNA 4DLUA 4KSCA 2BMEA 4XH9B 5DHAA 4KFSA 2F43B 5CYOA 4N1AA 2D74A 2BIFA 1YZTA 1KHTA 4GP7A 2UZ3A 1HV8A 3D31A 3HPRA 4I81A 4M1TA 5FBRB 5DIFA 3ZQ6A 2HT1A 2ZEJA 121PA 2BOVA 4A2PA 4L9SA 3CF2A 3K0EA 4B2LA 3GJ0A 3KKNA 1G8PA 1NJGA 4D4JA 3ADKA 2IYTA 1XJQA 4GI7A 2WKQA 2BKUA 5EXSA 1DELA 4R98A 4TMVA 5JS7A 1NMYA 4DDTA 1OH5A 1FW6A 4C7OB 1EFUA 4BFXA 2D4HA 2GDJA 4HDOB 3D6TB 1XP8A 2OFXA 2QT1A 4JYCA 1YZNA 3QKSB 2EFGA 5JEDA 1VYUA 2TMKA 2O8EB 4TQ9A 1G3MA 1XJCA 4KFUA 2OE2A 3WMFA 4PPFA 3THXA 2HEIA 2K5UA 3U3RA 1DTSA 2GEVA 5CDFA 3T5DA 4ACAA 3I61A 4NMMA 4PHFA 3AKEA 3EZ9A 1E9EA 3GLIE 1RYHA 1WA5A 1YE8A 1XMJA 4WBSA 2F1IA 3K0FB 4IDHA 1RIFA 2XJ4A 4HB2A 3RYTC 1KO5A 2O52A 4B2PA 1I2MA 4PC1A 2P5SA 1W36B 2MSCB 1BS1A 1ZUHA 5J40A 4AC9A 1TEVA 1NP6A 4TMXA 2IEYA 4LYHA 3LVRE 3EXAA 4MH0R 3HYRA 1MKYA 2ZS8A 4EKDA 3ASYA 5KUTA 2Z5FA 2B7BA 3K0CA 1E99A 4TTPA 2ZYWX 1KI7A 2QTVB 3CM0A 2IL1A 2AKAB 1G7CA 3TR0A 3VHLB 1BYUA 5K8LA 3Q85A 1P9RA 2PMKA 3U44B 3BRWD 1IY2A 2YNMA 3BFKA 1UKYA 4OHYA 2GZHA 1YZGA 4UXIA 2ZETA 3PQCA 2BJWA 4PAQA 3CKLA 4DLZA 2AWOA 2FGKA 2CL0X 2JJ2D 4LV8B 2IT1A 4LK2A 4Q7LA 3SOPA 3ZIAA 3H84A 1W4BA 3WP1B 4QM7A 2HT6A 5EE0A 1N5LA 1E9BA 2A5DA 3QBVA 3REFA 3Q5DA 3KQNA 4QJ4A 1GIAA 1ZNYA 3CH4B 1MH1A 1XTKA 2Q9CA 3TAUA 3WYGA 1HEIA 3E2IA 3OE7D 3AP2A 1MR3F 3C14C 3NBXX 1D2NA 2GVDC 4HDQB 2NQ2C 2JLQA 1L2TA 1RRGA 4EPXA 1MRNA 1RC8A 1IN7A 1FMLA 4MKIA 1XCPA 4KODA 4TMWA 5JS8A 1NBMD 2H8KA 1CJKC 1NVVR 5HKKA 3Q8XB 1DAMA 2C9CA 4UJ5A 2O8DA 4XD7D 2Z83A 2VP6A 4UNPA 3DOEA 3LWNA 1N6KA 1EWRA 3SJZA 3CH5A 4IDNA 4AG6A 4ASUD 2RGGA 3LD9A 5KYKA 3SU8A 1G21E 3QEJA 2FJUA 1E2DA 2FOLA 3K53A 2B92A 5D3MA 4B34A 3I5XA 4Q7JB 4B3GA 2QU8A 1DS6A 1GZSA 3TE6A 1N6OA 3DOFA 4BLQA 1B0UA 1MO4A 1HY3A 5KDOA 1IY0A 2RGXA 2JGNA 3T61A 2C03A 3PITA 1VG0B 2ZE8A 1D8TA 1CEEA 2GKSA 4G5RA 4XIGS 2VEDA 1Q3TA 1YJ5A 4G5SA 4WZBE 4EQ6A 4AYTA 1FPMA 4C0SA 2XOKD 3TLXA 5C1BA 2RHDA 3DZDA 4IXMA 1Z0AA 2REXB 1GNRA 3I8SA 1S8FA 1T3LA 1Z0FA 1OT3A 2F43A 4G01B 2JJ2A 4B3BA 4NZYA 3UATA 4GP6A 4W9MC 1DG1G 3ZDQA 4BLOA 3GEHA 4HZUA 1UF9A 1X8KA 3N5CA 4CDGA 3VU9B 2ZPTX 4DCUA 1OXUA 1GL6A 1ZRHA 4A8JA 1E94E 2G0NA 4DBLC 1IQPA 2J46A 4J0QA 1OKKD 1K5GA 3R20A 4GZLA 4EIWA 3A4LA 2WJIA 4FCTA 5HZKA 2X77A 2J87A 4NYIR 4V0KA 4Z8YA 2AX4A 3R9WA 1OXTA 1O87A 4B76A 1TTTA 3PUVA 3H1TA 4M9SA 4IOMA 1U94A 5AJVB 3QKSA 3K70B 2D2EA 3REGA 1Q1BA 2WHXA 4BFUA 3FKQA 1TQDA 1U0LA 3MWJA 4Y0VA 3LBNA 3X1WA 4P33A 4M1SA 2IS6A 4TYNA 4BGDA 2A5JA 1US8B 1XXHB 1L8QA 1JQLB 4JJKA 1E79D 4X8HA 1J70A 1ESMA 4RVCA 5TB5A 5JMTA 2FPKA 1WF3A 1OIVA 2J7PA 4TL6A 2P5TB 2WMOB 1XMIA 2OXCA 5FL7A 4F4IA 1DADA 1JJVA 1GKYA 4RJLA 3SN6A 4JIMA 1CTQA 1AIPA 5E4FA 1A2BA 2ZI3A 2QGZA 2ZRMA 1ZM2A 2B8TA 1E98A 3BH6A 3ZIAD 1PV4A 2ZJOA 2FX3A 2WV9A 2OCBA 2OAQ1 1IJEA 3T1VA 1R0YA 2O8FB 3UMFA 4LZZA 2DWOA 1OB2A 2EFCB 5CIQA 4AKHA 3I32A 2VTKA 3VKWA 2VP2A 1T3HA 4JL5A 5P21A 1PUJA 2GF9A 3SYKA 3U2QA 5CYPA 3FE2A 3K70C 1G5RA 1R8SA 2C99A 5KHOC 5SZIA 1EFHA 2CNWA 1U2RA 3LW7A 3FKSA 2QQEA 4IJMA 2YVUA 4JKYA 3AF1A 4UNRA 4DDVA 3KJHA 3LBIA 3QG1A 2Z0MA 4OK3A 2O8BB 3JVUA 2DHRA 3T15A 5AR1A 2ODNA 4DLWA 2GILA 3PR1A 1G7TA 2F3RA 3CRW1 4GRAA 2PZGA 1G6HA 3CIOA 4WXRA 4YONB 1KK1A 1P2VA 4JLMA 1VIYA 1YHNA 3OEHD 3NXSA 4ZI2A 2D2FA 3CLVA 2OZEA 3FMIA 1ZC4A 3FPAA 4M1YA 3MG9A 2NO6A 5JCPA 4PHHA 4Q4LA 3NWJA 3C4JA 2FE4A 4AURA 1FP6A 1MABA 1W4AA 3CZQA 3AVTA 1D9ZA 2AD1A 2C96A 3EW9A 1IXZA 1CKEA 1JEEA 2H5EA 2LCFA 1XMSA 3IUYA 2YWGA 3RS3A 3TJZA 1Z8FA 2ZAOA 1MO6A 5SZHB 3VR6A 1E9FA 2WM9B 3THOA 1VYTA 2CJWB 4L8GA 5KSYA 1SVLA 2HV8A 1M34E 1AGPA 1CR2A 2FSGA 5DN6A 2C77A 5E7IA 2R6FA 4URZR 1KK2A 4K8OA 3HDTA 3WBKA 3EA5A 4G5QA 1AZSC 4UXJA 2ZI7A 1OLOA 5HR5A 1DE0A 3HJNA 4MYUA 1E2PA 1G41A 4AYXA 1Q0UA 2IS1A 3IPXA 4TYWA 1NLYA 3EPKA 2D3WA 3NEYA 4AKGA 1XF9A 2O8DB 3ZYCA 1WBDA 4HAXA 2ZRJA 4D80A 1SXJE 1SHZA 3OFND 5C4MA 2A5FA 5EP2A 4ZDWA 2PT7A 1OHHA 1DAEA 4AKEA 4BUJA 3WNCA 1E6CA 4B33A 4PTLA 2XB4A 3R7WA 1TAGA 4AI6A 5LPNA 1OIXA 3BORA 5CITA 1S1CA 1U8ZA 2QT0A 1DEKA 2W0SA 3KDSE 4DCVA 2PX3A 3TGPA 5J4LA 3C5CA 4TLBA 1KI6B 4LC1A 5BXQC 3IPYA 4LDJA 1E79A 2I1VB 4Q9HA 4BFVA 4TYPA 3SR0A 4NYMR 1ZNWA 2VA8A 4RD6A 3PG5A 4XSGA 4YDHB 1ZM4A 2XZOA 4OQNA 4PQRA 1F2UB 4BECA 3PVSA 2DFNA 5EZ5A 2Q9BA 3AKYA 3AVVA 3A4MA 1MV5A 1CJVC 2WOOA 4D0GA 1TADA 2MSDB 4ZDJA 1LFDB 1A7JA 2B7CA 1JJ7A 4ZDIA 2ZYTX 4Q1AA 1ZNXA 4CF7A 4FWTA 5E7MA 1J7KA 2PMDA 2W00A 3VU9A 2ZSFA 2BM0A 1YR9A 3GJ7A 3TVTA 1F2TB 1P2TA 1G5PA 2FEOA 3UIEA 1OIWA 2QPAA 1SGWA 3W6NA 5BN3A 5F9HA 3CWQA 4AY2A 2YZ2A 5H1YA 1N6LA 1MOZA 4QNMA 3U3KA 2KI5A 1MT0A 1OXXK 2ZQ5A 3A6PC 2H57A 3P4YA 1ZC3A 3PIRA 1HURA 4N3NA 1BKDR 3MAAC 4DSOA 3L8ZA 1W7AA 2JATA 1ZIPA 4M2LA 4GBMA 4CT4B 1Z29A 3SHFA 1XXHA 2VHCA 4US2R 3LLUA 4PSKA 2GESA 1R0XA 4DDUA 1QRAA 4YMSA 4BZPA 3SE0A 3RABA 2Z43A 4QBIA 3VR1A 3NH9A 4A0HA 5CJPA 1N0VC 3TQCA 4A4DA 2WWGA 4M9ZA 4Q9IA 1ODFA 3OEEA 3X1YA 5KSZA 3IQWA 5G53C 2Q6TA 3Q7QA 3C5HA 4XJXA 2FFBA 2ECKA 2PL3A 2C9YA 1P2SA 1QDEA 4OL0A 3ZZUA 5EJEA 4C0HA 3EAQA 4ERNA 4DB4A 2WOJA 2AK2A 1CP2A 2PLRA 4DCSA 1LV7A 2X2FA 4Q4HB 1P75A 2IS2A 4NCHA 4PO8A 4X8OA 4K81B 4WZAE 2REBA 3HU3A 2I3BA 2PX0A 2WIBA 3QNUA 3ND9A 1NIJA 3K9NA 4RZUA 3KXKA 2IYYA 5DSZA 2IXGA 5G3ZA 1BH2A 2DFLA 5E7JA 4XWOA 2XX3A 3TKLA 4BEJA 3FWYA 1KNXA 3KTAA 5BN4A 4PAMA 1HQCA 4MYHA 2GWHA 1VPLA 4WIAA 2NPFA 4DB2A 1UBEA 3U60B 3IIKA 5BQ5A 3OAAD 1Z6GA 2G1KA 4FMCF 2CJWA 3WY9A 2NIPA 4N0DA 1AK2A 1FUKA 1W2GA 2BVNA 3ZH9B 2RHMA 3GMTA 1KO1A 5EXXA 1NRJB 1XMVA 1M7HA 3ZGXA 3MLEA 1E96A 1Q1QA 3FMPB 1EFTA 1S3SA 2CL6X 2ZROA 2PJRA 4OHWA 3KQUA 3VNUA 5EQTA 4Y0AA 1T9HA 3G5UA 1KDRA 2GNOA 4WA7A 4DUGD 1NVVQ 3KX2A 3IIJA 1XD9A 3BH7A 1ZIOA 2NO7A 5JEEA 1OV4A 4HLQB 1N25A 2BMDA 1RKBA 4KBFA 1ZUNB 4Q1DA 5DO9A 5AUOB 2IYUA 1L4YA 4OQMA 621PA 5JSZA 1G8GA 1G4AE 3TVDA 1UPTA 1X8LA 1UBFA 3GJXC 1RYFA 3KJIA 4M22A 2V4ZA 3IKJA 1Z0IA 2GCPA 4I4LA 4QHYA 3LV8A 1QHYA 1YU9A 3IEUA 1FNNA 4E09A 1A5TA 1GRQA 3UWKA 5FPTA 2CXXA 5LB2A 1EFRD 5DLQC 2C98A 3KZ1E 4H1UA 3B1VA 3GFOA 4QGGA 4WXPA 4GL2A 1GVNB 3EC1A 2HYIC 2RGAA 3T12A 4A2WA 2FZ4A 3RRZA 4FD2A 4XWAA 4BLTA 1NJFA 4RZXA 3O8CA 1SKYE 2GZDA 2CE2X 3L43A 4IOJA 2QP4A 4M1OA 2R9VA 3ZS9A 3T5GA 1QBKC 3ADCA 2ZSEA 1GAJA 1JEDA 3KQLA 5D3QA 4KLNA 3D8BA 5EE1A 3B7GA 3QJYA 1P60A 1Z6YA 2QNRA 4ZO4A 3UG6A 4D4KA 3RS5A 5D3MB 1OFIA 3B2EA 2HDNB 1KI2A 3HYTA 2AN9A 4KAXA 3SS8A 1Z47A 2FU5C 4KXFB 4LYAA 4LJ5A 3ECCA 2UVQA 2OAP1 221PA 1E1RD 3NEJA 1CLUA 1J99A 3RRNA 1R2QA 4HUQB 5FUWA 2QRNA 2RGNA 4N0EA 4JLDA 2MSEB 4LPSA 4B3CA 1UKZA 4BRWA 5DGXA 3RNLA 4RFSA 4PC3A 3CRQA 4MA4A 3SC3A 1NG1A 4TL7A 1T8UA 5EZ6B 3K0CC 3B5JA 2QENA 5DN6D 3O8RA 2IYZA 5HTKA 3W34A 1KZGB 3C41J 3RHFA 1ZD1A 2Q9AA 1G20E 1J90A 1R6BX 3NBYC 2FF7A 4TTRA 3RS7A 2DR3A 1E32A 3TRFA 1M8PA 2IYQA 2ZI9A 1W2HA 2ZJYA 1FX0B 2W2VA 3X2SA 1NBME 2OEPA 2DWPA 4M8NE 4URUR 2DPXA 4WVFA 2XAUA 1OH8A 2GJ8A 1W49A 3MWLA 3QVUA 3GLFB 1Q21A 3OEED 1JQJC 4BASA 1E2JA 3GLHB 4KYIB 2CLSA 4UJ3A 4V0MA 3RLFA 4AYWA 5HKKD 1CR1A 4QG7A 4MUBA 3BERA 4KVGA 3THWA 3RC8A 3QY0A 3IBGA 3O47A 4LRWA 2MMCA 4LJ8A 4NP6A 5F2EA 3IGFA 3KQHA 3FHTA 4PFSA 3L8YA 3AF3A 1E2EA 2W58A 1Z08A 4OQLA 1KI3A 3T1TA 1FOEB 1UDWA 1GL7A 3P4XA 1GNQA 3LLMA 2ZRBA 1W0KA 4B3FX 1I2DA 1GTVA 1CRPA 1Z5ZA 4LI0A 3SFZA 3MWYW 2IC5A 2ZR0A 4O2LA 1GKIA 1Z2CA 4JL6A 4HLDA 4QGAA 4F38A 4FN5A 4B71A 2EWWA 1CULC 4BFWA 3C8UA 2GAOA 4Q18A 4UKDA 2J41A 1DVRA 2P2LA 5JFGA 5JCZA 1J8MF 4I99A 1E2GA 4PPNA 5EP3A 3IILA 1C1YA 3MWKA 1VIAA 5F9FA 4HZIA 1S0UA 5KNCA 3AV0B 3GLFE 3WMGA 2NZJA 5CB6A 3EIHA 3UMSA 1SXJD 3MFYA 4M9XA 3X1XA 2BJVA 4PAOA 1LF5A 2QTFA 4XOIA 2FMXA 1P72A 2WJVA 2WWIA 2A5GA 1DARA 1Z28A 1SVOA 2Q3FA 5HCIA 3T34A 3DM9B 4LC0A 1U9IA 4Q47A 5IRCD 3GLGA 4LHXA 2EWVA 1OF1A 2IHBA 2ZE5A 2CLCX 2X19A 2O8BA 3MD0A 4PSVA 5FTNA 2QMOA 1KY3A 1BMFA 4FMBB 2CK3A 4JVSB 3W90A 1ETUA 4TMKA 2P0EA 2AKYA 4B3DA 1KO7A 1SXJC 1G19A 2WMNB 4NL4H 3DKPA 3AB3A 2DYKA 3PV0A 5B30A 5J4YA 1G16A 3KQKA 2G3YA 4EJSB 1NN0A 1QHNA 5F3WB 4LY6A 1K6MA 4Q03A 4FMCB 4IKEA 3T06B 1XTIA 1BIFA 1EK0A 3CX8A 4EFNA 5GJBA 2ANBA 2C04A 3WYFA 2GF0A 1N6HA 2R6GA 1N5KA 3RWMB 1U99A 2JJ8A 4CYMA 4CEIB 2PZFA 3KUCA 5JSZB 2QRZA 3OESA 4M9QA 1X8JA 2RGCA 3AVYA 1E2QA 1HQYE 4GFDA 2HLDA 2VHQA 2HLDD 3EASA 2RMKA 1VMAA 2JLYA 1G6OA 2AFHE 3KKPA 3OIWA 3A36A 3CRVA 3EZ7A 5EUMA 1QG2A 1W44A 4LJ4A 1OB5A 3AGPA 4FWIB 1YZKA 3F3YA 4NHOA 1T5IA 2LWIA 4GSYA 1RRCA 3CNNA 1SKYB 4U02A 2ZUCA 1RZ3A 2QAJA 1I4DD 2J7KA 3LXRA 2PEYA 1TUEA 2V6IA 3TW4A 2F6RA 4PHGA 3IO5A 2OXRA 1G64A 2A7QA 4CEHB 2F1RA 1Q22A 2VH5R 1NVXQ 1XEFA 1QHHB 3LX8A 3KB2A 4Q66C 1IN4A 1NI3A 4GPTA 5FOXA 3WNBA 4AIIA 1FQKA 5JI3E 3KFVA 3BGWA 1PVOA 5ANRB 3AUXA 1PLKA 2FGJA 3P20A 1W36D 2F55A 1KNQA 1XJ0A 2XXAB 3O8DA 4HI0E 3ICQB 3VKGA 3P26A 3NIBA 2GXUA 4U5XA 4Q9KA 5FBQB 1WB9A 1DG3A 1E4YA 5DYIA 3P1JA 3QIAA 5J4KA 3GLFA 2GXQA 1XEWX 4HAUA 2BCGY 2D06A 1LVGA 3MUFA 4TL9A 4EPTA 4YMVA 4RFSB 3SQWA 2RCNA 5FUXA 3VR2A 3V4RA 2H92A 2JCSA 1F2UA 4JMPA 1AM4D 3GEIA 2UZIR 4M53A 1TUIA 4WAUA 4PHTA 3A1WA 1HE1C 1QHXA 2OCPA 2XGJA 3W6PA 1XFAA 4XTCS 3C7KA 3BJIC 3I72A 4LV5B 4RZ2A 3E70C 2V9PA 2J3EA 4US1R 2J59A 3G82C 4KCGA 3PENA 5B57C 2D62A 1TQ4A 5CK5A 3WP0A 3GJ8A 3PFIA 4Q19A 4QHSA 3SFVA 1X3SA 1HUQA 1W0KD 5LD2B 5FTKA 3LVQE 2X8AA 1N5JA 1ZW6A 5L3VA 2DB3A 4DKXA 1D2EA 3GFPA 1J2JA 4JVLA 2IS4A 2QP9X 4Q7MB 5FTJA 2BWJA 1LW7A 1KSFX 5TV2A 3RAPR 3EPHA 3VMFA 4KJZA 1W5SA 1Q1ZA 2O8EA 1ZINA 3OHMA 2N1BA 5BYKA 1N0UA 1EWQA 2BDTA 5EXPA 1KAGA 4X8MA 3UANA 1G3UA 4LBWA 1VG8A 2PJZA 4V0ME 3NTUA 2VPPA 5FOSA 4CZ2A 1F60A 3K0FA 1WMSA 2PLFA 2W6JA 4H9GA 2ZJ2A 5TXGA 1CU1A 2R8RA 3MMPA 1UJ2A 1KMQA 2W6ID 5J47A 1NBMA 3EPJA 1KMHA 3L0PA 2NGRA 5JECA 2QQ0A 2PT5A 1CJTC 3GPLA 4TT3D 3ZS8A 1R5OA 1RJ9B 4DRZA 1KJYA 3GCGA 3THYA 2YYZA 3SBEA 4NU0A 4MDFA 4P4UA 1BO6A 2QE7A 2WWWA 2L0XA 2ZAMA 5JJLA 1IONA 2OT3B 5JHHB 3TR5A 1NLFA 5EE5B 3RRYA 4CW7A 2E9SA 2Z4SA 4KVAA 2QAGB 1KDTA 4F4CA 1WBBA 4JSYA 4LSGA 3MJHA 2GK7A 3QKRB 3AF4A 4RD3A 4QRHA 3U3JA 3ZLJA 2WICA 3MSXA 3KTAB 2VP5A 3FVQA 4S35A 3FMFA 3UPUA 1Z2AA 4ZKDA 1YVDA 1NY5A 3QG5A 4HAWA 3BD9A 1VYVA 4ILEA 3ASZA 4EPVA 3DL0A 2QL6A 5AWFC 1KI8A 4EFLA 2XB2A 2JIZA 2XNDA 2QGNA 2MMGA 4A1FA 2QMHA 4GT1A 1XBTA 3QEOA 4IEIA 4DC9A 1NIPA 4HEJA 1CBUA 4CRWB 1GRNA 1S3GA 3FGNA 3GLHE 4FW9A 3VTKA 5JI2E 2YOGA 2VBCA 3CRMA 3TIFA 1A2KC 3HWSA 1ZMXA 4EJSA 1X6VA 2Q21A 3BB4A 4TYYA 3VX4A 1LNZA 1KGDA 2KE5A 2AXNA 4RZ3A 4MRPA 1CR0A 4R2IA 3AVOA 3WXMA 2FFQA 1UBGA 2DY1A 2BCJQ 4KFRA 3B1ZA 4TQAA 1OFTA 3BC1A 2NO9A 5AUNB 2WAXA 3IEVA 1SVMA 2BBWA 2Z4RA 1VKJA 2ZRLA 2GCNA 2JLWA 4EPWA 3A37A 4NH0A 2YOFA 2WIAA 4JLKA 4B44A 3BXZA 3A4NA 5L3QB 3I8XA 3QF4A 4YXWD 4PZLA 4A2QA 1M7GA 1S4QA 2YHSA 4DT1B 1KKMA 3FMOB 1QVRA 3I1FA 2Z6VA 4YMUA 3D7MA 3QSYA 1XPUA 1CJMA 2EU8A 2PBRA 2JDIA 2QSYA 3ZZ0A 2JDID 1KSHA 1W0JD 4ABYA 4TZ6A 4QGFA 1K8RA 5G40A 2GRJA 2FSIA 4CEHA 5FR1A 5FUYA 3S1AB 4D0NA 5TDHA 1QHHA 2ZTSA 4DVGA 4B73A 3AVWA 4XVUA 3CW2A 2G77B 4B43A 1AS3A 2WKPA 5TMPA 2FNAA 4B3XA 3VNVA 3K1JA 1VECA 2D7CA 3OAAA 2IYWA 4P4TA 2RKOA 4HLCA 4NDZA 4JZKA 1SVKA 1X1RA 3OF5A 4PX9A 1ANKA 1ZD9A 4HUQA 3B9QA 2X1VA 1YKSA 5JRZA 4RCYA 5KNDA 3DDCA 2A2ZA 1IN8A 5FPYA 3F8TA 3NH6A 1WDTA 5L3RA 1G8HA 3I62A 3WYAA 2YJTD 4Q4AA 5AJXA 5BW8A 1OW3B 4G3XA 5HCNA 3BFVA 3EZ6A 3GQBA 3TUIC 5JZVA 3BBPA 5A0FA 4M0LA 2WTUA 4Q1CA 1X86B 1SXJA 3K9GA 1J8YF 2Q0HA 4IHQA 4JLVA 4WW0A 3WHKA 1US8A 4ACBA 3OEHA 2FPMA 2ZR7A 3SNHA 5KPDA 1KKLA 5KSPA 2F7SA 4MRSA 3SJAA 3B85A 1N5IA 2QZ4A 1KSGA 2HYDA 1KDPA 1M7BA 4RFVA 4C0LA 4LX0A 3PXGA 4IVQA 3U7HB 3EWSA 2EW1A 3B8HA 4B48A 1S96A 2ZRHA 1WCV1 3GLIA 3I3SR 1G3IA 5KDDA 4OHVA 3DEFA 4OJKA 2ZI6A 3U4QA 3SYLA
chains in the Genus database with same CATH superfamily
3VX3A 1SOWA 4UU8A 2QE7D 1WDKA 5ILQA 3WLPA 2B8WA 2AZXA 1VA5A 3QHQA 1DKLA 3OE1A 1GG2A 1GHTA 5FA6A 1NM5C 1SQ5A 4EBBA 1YAHA 4J75A 2CHUA 3OCZA 2QAGA 3R76A 2ZJ5A 3CFYA 3RS0A 4D3FA 3HY3A 3G2JA 5FWYA 2ONKA 2ATVA 4PNPA 3GO4A 2GJKA 2C5AA 4G67A 2WTAA 5C18A 1ZD4A 4JOSA 4KIWA 2YKGA 3P32A 4RPCA 4N82A 1KJZA 1Z5WA 3CVYA 3FZEA 5FTWA 3VR4A 3AY3A 1UMCA 2BSAA 2VC2B 4KVZA 6AT1A 2QG6A 3G2PA 1ULAA 3ONWA 3LUJA 3ZZ1A 3O4VA 2EJTA 3TNYA 4X97A 4H1WA 2RIRA 4AX8A 2Q1TA 5FBLB 2QM0A 2OLEA 4F2DA 3N2LA 3DKIA 3I2IA 3NHYA 1WPQA 1J21A 4N12A 2HNKA 3OWHA 2B94A 2CCGA 1AZWA 3BH0A 4RKFA 3ML1A 3QVWA 1G8JA 2ZCUA 4ZT5A 1XZAA 3B13B 3EGDA 3L0IB 2NV2B 4R40A 1M1ZA 3CEMA 4OHXA 3FNBA 4JLPA 1OFUX 2EXXA 1AKUA 1CR6A 2H2IA 3C8DA 1WQ1R 2ZZNA 3KM0A 4U00A 3OP4A 4B7CA 4B6JA 4LK3A 3AHFA 2ZBQA 4KV9A 1VKOA 3F6CA 1YJBA 4P4NA 3SQDA 5U9CA 4GLOA 2WVJA 4MVWA 2PO7A 1L5WA 1BAPA 4G41A 4Z4GA 2RB5A 2C5FA 3KOYA 4YAOA 5M5BA 5AFSA 3PTLA 3LRTA 1PTJA 2GN2A 1MEOA 3E3AA 5H4HA 3WRXC 3QF4B 2Q4BA 3AXSA 3JQRA 4IJKA 2DP4E 1Y8RB 3FFXA 1YVPA 1RMYA 1AKEA 2EW8A 5ALQA 2PL9A 2QL7A 4DLVA 2GSWA 1RD4A 1SUPA 3DMHA 3FOBA 3RSZA 3DXYA 4FYMA 3SBDA 3O75A 1QKJA 4YXFA 4U5QA 3HCDA 4HAVA 3PJFA 3JAMA 3QJ5A 3FWKA 3VISA 2Q2NA 3WHIA 4ESHA 5MFZA 2GUWA 4HRAA 4MPJA 4Y1FA 3SHQA 2FPSA 3IHLA 1D09A 3Q5EA 4DNXA 3QOFA 3WL8A 1VIVA 1RU3A 5ADWA 2FW0A 2XZDA 2C4HA 2IYSA 4Z51A 1ISIA 1KU6A 1YRBA 3LE8A 5F9MA 4AKSA 4LYEA 4KNVA 1G8AA 1T36A 3ZWMA 2FKNA 1JEYB 3QUSA 5HZMA 4G5XA 4LGVA 3H86A 1NLUA 2J5BA 2GN8A 4QC2A 4NS4A 4XFKA 2D13A 2SCUB 2YV4A 1PJ4A 2IKQA 2VWGA 3PB3A 4RE5A 5F51A 1GPH1 3ZUGA 4GSKA 2HREA 1V8BA 2R5NA 1HWYA 1NVKA 1L5GB 2VDWB 5GVSA 4LSWA 1PLJA 1XEWY 3BA1A 4IG4A 2ORWA 4IVNA 4D6PA 5EKXA 1A0OA 4AJJA 2DCUA 3UK6A 1GUFA 3UWOA 5A5GA 1R7RA 1V11A 4BO7A 3BWEA 2AC7A 5I9MA 2HSDA 5CH8A 2BTQB 4KO1S 4L73A 3VZPA 2GVZC 5ICEA 1QQAA 3BL6A 2BP7A 3TS1A 3BF7A 3IULA 3G1TA 3EMBA 1FL9A 2V7QD 2R8OA 2RHGB 4DLBA 1DKNA 1WLYA 3ZGNA 4WJLA 3DPUA 2CHVA 2AJ8A 5ALIA 4EJ0A 3F46A 2ZWPA 4LBYA 2AFIE 4FOSA 4S1OA 2V7TA 2NSYA 1GGFA 1GILA 4B3SB 1KDOA 2GBLC 3T7CA 3JTMA 3TB4A 5EL0A 3I6IA 9LDBA 3G2LA 2V55B 2B4KA 1M1XB 4II7A 2D8AA 5FBWB 4F3KA 4QPCA 3MAJA 4PG6A 4K05A 2BGNA 4RABA 3OZCA 2ATCA 3GRZA 4MS4B 4DEYA 3PFNA 2OZPA 5BWNA 1IZ7A 1YR8A 1MAWA 2BHTA 1PJLA 5BO5A 4NE7A 1T29A 1V5GA 3TN7A 2VNSA 1NF9A 3KQOA 3NLLA 4UUBA 1K3TA 1Y1SA 5H70A 5G41A 2HRBA 1OFHA 2QRVA 1U2QA 1NNUA 3KEGA 3T7JA 2B1IA 2EIHA 4TWJA 1R9NA 2CNOA 2HWXA 3BYZA 3KT8A 3Q3EA 1MO5A 1LSJA 2O3JA 1Q14A 3WIBA 1MHTA 3GVXA 1L5HA 2BC9A 3EBLA 1QIJA 4FIDA 4GC5A 4N40A 5DBFA 3CLTD 5FOTA 2WU8A 1XALA 3H11A 4W4TA 4Z0PA 4NXMB 2OP0A 4YPVA 5BWMA 5FTLA 3JD1A 3V55A 1GLNA 2A92A 1R27A 1FP4A 3AQ4A 3FGZA 4NPCA 3AEZA 5I9SA 4AS1A 3IR6A 2CLDX 2I1QA 3K8YA 3O8LA 3KJQA 3QYJA 4EUHA 5I4IA 1QYWA 2H07A 4L72A 3W7AA 3DOIA 4OMFG 3B5IA 3EC2A 1FXWA 4S1WA 3GLIB 3ZHXA 4L5IA 4F45A 2AK3A 2YZMA 4BIMA 1EB8A 3W9SA 1QUEA 1U2SA 4S2EA 1THZA 2OD9A 2PH5A 4M0UA 2QORA 2B21A 3ZTYA 1LS1A 3AB7A 3QF7A 4JLSA 2CMKA 4MQBA 3KCQA 2X8WA 3C7AA 3QE3A 3DOHA 4MV4A 4AF8A 2NTVA 3PNVA 4P4LA 5DGDA 4EKNB 2NZXA 3N0WA 3IOYA 4A8JA 4IQGA 2FPUA 2BKEA 4MUYA 4XX0A 3BT7A 2X5NA 1OHHD 3TDKA 2IEBA 4AMUA 3NDRA 1U02A 3HVIA 4JC5A 4MDYA 4ZC1A 4ZVLA 5CT4A 4CEJA 1JFRA 1EK2A 2AHOA 4IHKA 1PUIA 2VYNA 1JYSA 1EKXA 3SS9X 3OA0A 1UMBB 2PV0A 4RF2A 1NDHA 3HXPA 5LD2C 3CIFA 4EY8A 4DJTA 4MRMB 2X7HA 4DJEC 2QLBA 5BSEA 2P9HA 3B3JA 1KYVA 3VJRA 4GPZA 3AFNA 4JS0A 4NY1A 5GPBA 2TS1A 3SEAA 3PPVA 5ELMA 4ZEOA 4A0GA 4JYPA 5ER9A 3QITA 1R0WA 4AD8A 1L3CA 3BUSA 2IGBA 1KJJA 1Y7LA 3FF1A 4XGRA 4YLGA 4J9VA 5JHGB 5JRJA 3ICEA 1C0KA 1TTQB 1GPBA 3CNLA 4GMDA 1U0NA 3FUTA 3PZRA 4OA8A 3L7DA 4O02B 1E3IA 5ER6A 1XMOB 2JJ1D 1QFMA 1UBCA 3TQQA 3F3MA 2C58A 3AL3A 3U40A 3EOBI 3R9KA 1Q0SA 1WKVA 2ZYVX 4J03A 3DW3X 2XBUA 3HWRA 3WMEA 2FPLA 2X9LA 3IELA 2DG2A 1ELOA 1U9ZA 3P0IA 1I4EB 3KB8A 1MA0A 3HFGA 3ZVKA 1JG6A 1TMKA 5FJIA 2ZQZA 1ESNA 1SWVA 4NCJA 1C3OA 4INAA 3WIVA 4E13A 4QTTB 4YAWA 3J80A 1ODTC 2PNFA 2VDWA 3DR5A 2W6NA 3CPHA 3Q3IA 721PA 4GPAA 4JODA 1JU9A 1DIOB 4R2MA 1G8KA 5FEUA 3H1BA 1Y4SA 4HQFA 5HBRA 1V11B 3JAKB 4LRSB 1JT2A 4PTZA 3OE5A 4YEDA 3R75A 3PXXA 5ICGA 4BJ5A 1MMFB 4YRKA 4BJ3A 5HF6A 5JCOA 1IIBA 1MC5A 2WHPB 2BP7B 3EVBA 4FOOA 3OQIB 4JUIA 4IDDA 4UNQA 2ZP1A 4CLXA 3TSOA 3FKSD 4UVHA 4A10A 3M6XA 3KKMA 4XYEA 5JANA 1GADO 1N4DA 4ZAWA 5CD1A 2R1ZA 4UNIA 2YJNA 1B8OA 2UYGA 3QKUA 3DYVA 2WNIA 2XWBF 3RWOA 1HR0B 3CB4A 3OZTA 4LXGA 4LOAA 4RK6A 1UUFA 1PWHA 4NMLA 5KWIA 5H0IA 4YK7A 4YASA 5TEVA 1QYXA 1I30A 1QFJA 2Y8EA 3KD2A 3CRRA 1CDZA 4KBGA 4MLZA 3WGGA 4J29A 3KSDO 4IEEA 4A82A 2P7IA 1J24A 1EEXB 3H9CA 2WHRA 3H0CA 4BVHA 5K7SA 1DIAA 1NT4A 1RC0A 1Z4PX 2GM5A 2H48A 1GRRA 2OV3A 1RWBA 2CLHB 5ALZA 2IYEA 3IQGX 3QE4A 4GF5A 2HWYA 3KVYA 2K4MA 4WNCA 1BOFA 4TV9A 4W7SA 2NP7A 3DB1A 2XSZD 2HR1A 2LD4A 4HNGA 1FXSA 1U8FO 1IEQA 1GU1A 3E7FA 3PWZA 3RV4A 5JVDA 4FOPA 2I62A 2RC5A 1TT7A 3KT3A 4C78A 1NMQA 4Z2YA 1BXRB 1R8XA 1P74A 1L5HB 4JUCA 2ZANA 3D4PA 5LL6P 2PGXA 1J33A 3KXIA 1M33A 3HYCA 4FFPA 4WQMA 1WDWB 2WFLA 3UMJA 4Q4CA 1KOLA 1LLFA 1T9AA 3LM8A 3HDGA 5GIPE 5TLSA 3MTIA 5F98A 2O3QA 5H7XA 4MR8B 1I94B 1DDOA 1SBYA 3SZLA 4LVNA 1VDZA 2WV7A 5CFOA 1OI4A 4EHIA 4KACA 3W3AH 4L5AA 1M1NA 1V1RB 4CETA 2HA5A 2JVKA 4RORA 2NSHA 3T5TA 3EC7A 2PT6A 2N47A 3CTMA 4Q48A 3M34A 3KFLA 3GLHA 2OLKA 1P0QA 3W9BA 3THWB 1YDGA 2N42A 1C7QA 1YL5A 3QELA 3N2IA 1V5FA 4Y6PA 1AF4A 3BE6A 1QUFA 1ZU4A 4FZJA 4NR0A 5LIRA 2M1XA 4ZRDA 2HK7A 3F98A 3CLUD 3KLNA 2E4ZA 4A8JB 4K87A 3M1IA 3OO0A 3OJXA 1DQYA 1EM6A 3DWEX 1XZKA 4QUJA 2H85A 4O59O 1V43A 4UEWA 5I7UA 3DC7A 1GPLA 5D5PA 3KZXA 4HC4A 5NLLA 1G7RA 2VJQA 3C0KA 4O2BB 3KSAC 1EUCA 2KW5A 1ZN9A 2QD4A 3UBMA 3PUWA 4K1LA 4OX9B 4IRMA 3W8NA 3DTVA 1KEVA 1TAUA 3G2OA 1C3JA 5IK2A 3HWX1 4GC9A 5CX1B 5HKLA 2JCXA 5DGHA 4HVTA 3MTBA 1DINA 1NP7A 2EBFX 2W2PA 2XE6A 4HDAA 5C31A 3KSUA 3WYDA 1JWBB 3OZRA 3QFCA 1OI3A 3OX3A 3TZCA 3GYBA 2GJAA 2HO4A 1Z3CA 1HT2E 3FOZA 1JHYA 4N3CA 1ISPA 4G86A 1HL3A 1JAYA 5AI9A 4X1IA 2ZRIA 1EZZA 5JSKA 3TCXB 5AW2A 3B7PA 3KU4A 4DR6B 5JXHA 1KK3A 4JLBA 2XUIA 3ZVMA 2QLTA 4HLUA 1L7AA 3DE1X 1HDIA 3BDIA 3R3UA 3SEQA 2O1WA 2Q50A 4Z8XA 4AKTA 4E3WA 1ZUWA 3H5NA 3HB1A 1NN1A 1TC1A 4DUPA 4URXR 1WBJB 4C6TA 1NF3A 1ULTA 1XZQA 2XGGA 2JJ1A 1FS6A 3C3KA 3R3YA 4HJXA 4FFLA 1QS0A 4QUIA 4RWEA 1RXVA 4ANFA 5IHXA 1K5PA 4ZKEA 2FB9A 3ZU4A 1KYZA 3EMKA 4PZZA 4OXIA 2HA0A 4P7GA 5EVJA 4A92A 1YFJA 5FAXA 4A8JC 3C1UA 2BFWA 2HADA 4N5MA 1A69A 4B09A 3JQCA 5AW0A 3PSHA 4DGQA 1SVUA 4JXJA 5MGNA 5AM5A 2CDAA 3EFHA 1U7PA 1WETA 3H3XA 1P4RA 1Z83A 4DHWA 2WTNA 1YQXA 3ILXA 4J4BA 1NVEA 5HIJA 7AT1A 1QGZA 4HQNA 4PCLA 3O92A 5HWSA 4PFQA 4RYLA 5LM3A 1KZ4A 4XVRA 5IHPA 3SP1A 5G1PA 3EVCA 1DO2A 1G2OA 4GR5A 4PLTA 3PD0A 4HWPA 1PL7A 4Q4JB 4QPJC 2V6MA 5LA6A 1TLLA 1ZI9A 4BO6A 5FULA 3F71A 5JS2A 5TSDA 2Q6KA 1Y3HA 2QSZA 4LDNA 3EQ9A 1X38A 3JAKA 4PRZA 5AVJA 2B98A 2OR3A 3ELUA 1YCDA 5AUQA 1FNMA 4AICA 4O4IF 2OBMA 1ZMRA 4ZTBA 5GJWC 1E1CA 4TUYF 2JW5A 3EGXA 1K8QA 4WESA 1PR0A 5DT9A 3ADOA 3VNSA 3PC7A 5CXQA 3U61B 4YTEA 4O08A 1P2GA 4OQFA 1JEQB 2NLOA 4MWSA 1F6BA 3R1IA 2P1ZA 3HU1A 3BHJA 3R0XA 5INTA 4D9MA 4FCWA 3G5AA 4BMVA 4NULA 4YT4A 1PT5A 1VL2A 5B1IA 2ODWA 3CW8X 1SHUX 3PRHA 4RMGA 2JFHA 4EIWA 1U1IA 3CX3A 5BQOA 3HY6A 1OAAA 1S7GA 3DF9A 2XA9A 4AZWA 2W4MA 4DQDA 1JWLA 2FSHA 2DQSA 4WWHA 4MQFB 3A1CA 3WIOA 3IQDB 2ZCJA 3RC3A 1VJ1A 4GEKA 1MZVA 4S12A 5AM4A 1QG6A 3QXJA 2PUCA 3AX6A 2CEKA 4B46A 3ZJTA 4UUQA 4CU2A 3TRIA 3SDSA 1FDWA 4HXYA 3NVDA 4JBIA 5JVDB 3A7DA 4P92A 3Q40A 2FWRA 1YBAA 1XEXB 2J3IA 4Z0TA 2I67A 3X1XA 1JEYA 4Q3BA 2W2OA 4N8DA 2O2JA 3N07A 4KJXA 1GPWB 2PSSA 2SCUA 4PLVA 5DTMA 5KTNA 4RACA 1KTIA 4IW3B 4K28A 3K2IA 4B74A 4EB3A 3QLUC 3R3XA 3LHFA 4CM3A 3CT4A 2HA3A 1R10A 3R2JA 4QBHA 2P8SA 3NB0A 5DULA 4MR8A 1W1WA 4DUGA 3IB3A 4WN3A 3Q7RA 3HUDA 5KTOA 3CUEF 1M1NB 5CA0B 3TMAA 2FHPA 3QNMA 5TQ2B 2Q7DA 3THRA 2JGMA 2R1TB 1LGYA 5KTKA 5IT4A 5K3AA 4PQEA 1Q6YA 2IP4A 4J1QA 3FYSA 3NBFA 1T6YA 4KIUA 3ZOZA 1W48A 4B3TB 3L4EA 4AZ3A 3LPAA 1EGMB 1TIBA 2OZLA 3LKVA 3JAWA 4O1IA 2P6PA 4BMNA 5CUQA 4R1LA 3RBVA 1CK4A 5G02A 1MB9A 4MJXA 5J1TB 1QGUA 1ZMBA 1GDTA 3PUZA 5AXCA 4CIDA 1J0EA 1CVRA 1ZYUA 4AY4A 1EU1A 2JRLA 4DEXA 3GUHA 2AOUB 3OIGA 5ADUS 1Z8NA 1SG6A 3TPCA 1AD2A 2QT9A 4XJSA 1NLMA 2WM8A 4GOXA 1EUCB 2GK4A 1SUBA 2X0NA 3DJYA 2C2KA 3HBJA 4C01A 1O96B 5KREA 4LNUB 2HIGA 2ZUEA 4G0YA 1IDN1 4JJGA 4OQEA 1FU8A 4KFTA 2H59A 4DMLA 1CE8A 2D1QA 1PFVA 4KV7A 5IC6A 1KIMA 3I52A 1UDXA 3LUCA 5IDVA 1ADGA 4U7WA 4RKEA 1VP3A 5B36A 5EEHA 5B2FA 3OI7A 1ZO8A 4Q0MA 1EIWA 1JI0A 3SSMA 1VPWA 3K70C 4BRUA 5CAEA 4QTZA 2QJRA 3GLGE 3JYOA 1T1JA 2XITA 2ODPA 1MC1A 1II0A 2EQ5A 2P9ZA 1ZW1A 3GN2A 5KAMA 3RYFA 4Q3CA 4PNZA 3FYUA 2LDXA 4MQ5A 4L4UA 4BXOB 1HZZA 4G65A 1UJ4A 5K8IA 1FB5A 1TM4E 2P0AA 1E1RA 4U9IS 3CCBA 2EJCA 2V97A 3DZJA 3VDQA 1YHYA 4N6NA 4U0KA 4YRFA 5ALHA 1G59A 5KYXB 1YR3A 1X15A 1CVIA 1YA8A 3SHTA 5CDYA 3SVLA 2P4SA 2IBMA 4XUDA 2FEAA 2FH5B 4NF2A 4XM2A 6LDHA 2ZSKA 1PEKE 3KVOA 3ORSA 1P3Y1 4FCCA 4N0PA 1TTPB 4P7JA 2J6IA 3AFHA 4ZMSA 1G4UR 3ZX5A 5JQGA 1L4BA 3A6GA 4LOKA 4MV9A 4WKCA 1A2OA 1NNEA 1YOVA 4K2AA 4AN4A 1RQ7A 2EARA 1E5DA 2CL7X 4Q4JA 3OM8A 4EGJA 4ZYTA 2RGNC 2DWQA 3IQHX 4BLRA 3PUHA 1D7OA 2JASA 2CEAA 4CNQA 1FYEA 4YJHA 4UXHA 3UB3A 1JJFA 2HQ1A 3H2SA 2Y9PB 3R7NA 5HKOA 1YTLA 2GCOA 4OI4A 4QELA 3OCJA 1H65A 1OLSA 1C41A 2JANA 2AXPA 5LCXA 1UK7A 4CEJB 2NG1A 1J56A 1C9KA 1E1CB 1VE6A 1WB6A 2Q7XA 2VAMA 3LY7A 3M0EA 3EXHB 2IYLD 3ZY4A 4KKVA 4UREA 2WJAA 1LLCA 1TQ2A 3D54D 5BW4A 2AVDA 5I01A 1Y1PA 4IO1A 5FO1A 4LNHA 4KHZA 1FLDA 5D3KA 4RPHA 3HHEA 3GJ5A 3A7EA 3D02A 3E22A 3LY5A 1ADJA 1XWWA 4GKAA 2AEFA 4Q37A 4RD4A 4ZDKA 3G1WA 2VYVD 4FHGA 3BMNB 3EYAA 2G5CA 2XF8A 4HLUC 3NPAA 2A1UB 1OSNA 1FCJA 3OCVA 2XR1A 3AC0A 1T9GS 4WASA 4KZKA 1NASA 4CV1A 1CEQA 2WAAA 4UFPA 2OSBA 3IXQA 5ITVA 4QDJA 1NRWA 4MJ3A 5FP0A 1P5ZB 4PS1A 3UMYA 4OH7A 1VGVA 4XIYA 3W04A 3VOTA 4V0SA 1K86A 5ESRA 4F0JA 1WZIA 1Z22A 3BGSA 4WEOA 4KXUA 4H1VA 1M5RA 3LPLA 4MGZR 1A1VA 2GN9A 4OCZA 5LDDC 3KOZA 2IIVA 3VJMA 3EZXA 1GA1A 3K0AB 1NOJA 2Q4RA 4BB9A 3KZMA 3TSWA 2BELA 2J5KA 1PVDA 4HNQA 3I4LA 1V48A 2KWIA 4CLHA 1H2WA 1QH1B 2WIDA 3JATA 3P2KA 4IIYA 4O63O 3AKDA 3LU1A 2BFCB 3REQB 1QO9A 1R0CA 1GUAA 4A5SA 1ZAYA 2QTTA 1PK7A 3GY0A 4UBLA 1UC5B 3MELA 1B26A 5U4XA 3RSQA 3MT7A 3EFBA 3KIPA 2Y0EA 2OBXA 3A31A 2Q4EA 1MNAA 1BRMA 4JFAA 1CXZA 1E3MA 3DAPA 3DO6A 2WHPA 4FILA 3LQ4A 2IYXA 5FORA 5HUQA 1LTQA 5LP6C 3BEOA 5ERGB 3DLTA 3OLZA 2WAYA 3U7FB 3ADDA 4PN3A 2MR5A 4EG8A 3IHKA 4EO4A 3H7IA 4HDKB 2O59A 3FDIA 4AN1A 1E2IA 3JAWB 2ZRDA 5BV7A 1Y6JA 3L0OA 2W6IA 4OFZA 3ST7A 3F4KA 1CS0B 2PCJA 2JAXA 4M36A 2VP0A 5L7TA 1MRZA 2Q8PA 4QTXA 3WNDA 2DTXA 1S2LA 1IPFA 3B60A 1BHSA 2IF0A 4Z3DA 1HNWB 4DJDC 1OMOA 2Z9CA 2ZUBA 1XQ9A 3VR5H 3VSEA 4BTVA 1J1UA 2BUAA 4D4IA 3R44A 1RE1A 1ID1A 1QC5A 2V4MA 3EULA 3SU8A 4BEBA 4FIZA 1PG5A 2ONZA 4O4LB 1DMSA 1NN5A 1W1UA 4YECA 5LP6F 2HXSA 3BULA 3UHOA 2BFBA 1ZK4A 2GPBA 2BBTA 3DP9A 5K51A 2AXEA 4XUGB 5IF9A 1IATA 5C1PA 4AXXA 4DCCA 3DHVA 1KBOA 3ONEA 1WEKA 4HR7A 1EDOA 3TM4A 4MRVA 4O4HA 3FHJA 3KZCA 3LT0A 1POXA 2NXNA 4GPBA 1TZJA 5JV5A 4TQGA 4YQYA 4RS3A 3GX1A 1SXJB 3FVTA 4U2KA 2WFLB 3P5BA 2O3SA 2HY7A 4M0MA 2HXYA 1OBVA 2QD5A 4QYWA 2AG5A 4ZYVA 1XAHA 3IUSA 3KFXA 3CNQS 3GJ3A 2EKLA 1PZHA 3DE5X 6Q21A 3FBTA 2QZJA 1N8TA 3HKCB 5CLQA 4ITUA 3IEXA 1DUVG 1R4MB 2XVXA 3KKEA 1SUIA 1PR4A 3RKUA 1XRRA 2H0RA 1R12A 4JT8A 3TEFA 1WXDA 2C00A 2ORVA 2XJ9A 3L79A 3KSRA 4GMKA 1MA3A 5U1PA 1VCNA 2VHVA 1B6TA 3PU6A 4WCFC 3BWVA 4PO9A 1H66A 2YYSA 3MJVA 4YUYA 3G8DA 5ES4B 5HJ5A 2FPRA 2M6SA 3LBYA 3GFGA 4US2R 2QAIA 2ZTMA 1Z88A 5BMVF 5IWAB 1FFXB 4R41A 3U80A 1SA0A 3U4QB 2C3UA 3DQPA 1DDIA 2ATXA 2ZTUA 3WK5A 4CI9A 1PJRA 2CNDA 4WACA 4G0XA 1E2NA 2H2GA 4O2RA 4Q01A 4ER3A 1PFWA 2WABA 3A1UA 4Q05A 5HBGA 1U2DC 4AUMA 2AHRA 2GZ2A 5TS3A 4P53A 2SKCA 2H11A 3ETLA 3GRAA 4F2HA 2B3DA 3UENA 5ENVA 3QTTA 2QBYA 4V03A 2P75A 5GZ3A 3NP9A 2FUNB 2GCOB 3N74A 4FGWA 4ASUA 2WB4A 1G8YA 4QTYA 4FDMA 5TMBA 4PBTA 4BPRA 2XE7A 4NJMB 1ADBA 2X86A 1VLLA 2PQ6A 2VKQA 1OXVA 4R0VA 5K8JB 4J7UA 2GI4A 1GJRA 1YDHA 5ALRA 2XHZA 4OK5A 2GYVA 1GFSA 2F64A 3F6BX 3L0YA 3FTNA 4P7KA 2FUCA 4QFCA 3WS7A 1QR2A 3E22B 4E1VA 1HDCA 2JB9A 4LXXA 3LCUA 1AQNA 1E2HA 3COYA 3OQ6A 3N6VA 4K8RB 4TROA 3RS2A 2ENWA 1U0FA 2JAWA 2QLNA 2P68A 2XLCA 3PJRA 4QIHA 3CR7A 4RTKA 3Q5GA 1E6UA 1KZ1A 4KQKA 1EA5A 1AN9A 3UAZA 1YS9A 1JEOA 1L4UA 3DTNA 1ENPA 3K96A 3L7OA 4MRAA 3OD1A 4C30A 1UEJA 4C6TB 5EWJB 2CZCA 5FOVA 1U65A 1V2GA 2HDOA 2VP4A 2WG1A 2VSOA 2H1IA 4QECA 4UULA 3STHA 2I4TA 3B6EA 3DSRA 4YRMA 4JI7B 4BAGA 3ETCA 1GFIA 3F2IA 4IDOA 1SM4A 4TLMB 2DAPA 1GUDA 4BY9E 4RVSA 4U7GA 3NJRA 1WSWA 3O95A 4C0XA 5KZMB 4PQYA 2BF7A 1MJHA 3EIWA 3W5JA 1UWKA 3P52A 1I4TD 1TU4A 1XZMA 2VZ0A 4PWZA 3KEOA 2A3RA 3IQXA 3ODPA 3LYAA 3PDIA 2IV7A 3IKMB 4E5KA 1L5QA 3EOZA 2Y3IA 1TGYA 2BFCA 1TJ3A 2GHTA 2FW8A 1XTRA 2IDZA 2OP1A 5CT6A 5F2NA 3NWBA 3ZDRA 1MCZA 1ZJYA 3ZV5A 4U2EA 4CM9A 5FL3A 4IVRA 3DVQX 4RQBA 2VHUA 2J0UB 1WNTA 2PD4A 2HPVA 3FNFA 1NMSA 1KL7A 2HGZA 1DCTA 2P27A 3NW9A 1OYWA 2DWUA 5IKXA 1MRSA 3CEAA 1U7DA 3EGXB 4V0RA 1FFHA 3G5TA 2J7PD 1KI1A 4E21A 5FLYA 1M5UA 4YI3A 2QMEA 1XLWA 1Q17A 3PXBA 1GZ5A 1N2CE 5FBHA 2PO5A 4URVR 2C4TA 2J0VA 1JSLA 3I45A 2W6PA 5FWDA 2I2AA 4KMRA 3X1KA 4ZJZA 4U7HA 2V1UA 1FMJA 4OJMX 1V7QA 3GEEA 4MUXA 1XLUA 4Y1GA 3U44A 5KC8A 1E5VA 1RNLA 3CE6A 4FFBA 4ROTA 5E6UB 5F2OA 2V7WA 4HDNB 1XKLA 2PZMA 5A62A 1NFRA 1T91A 2B4AA 1FTSA 1PE0A 2YWDA 3JR3A 4ZT6A 1ZWLA 2A14A 3AKCA 3VHRA 1OPXA 2J9RA 4G8CA 1SJ9A 1T24A 2XCUA 5J4VA 5KCMA 1H8ED 2YV5A 2WYHA 1VJCA 5C3UA 5JJIA 3TLBA 3A11A 4OX9Y 3TUZC 4IZHA 4LJKA 3QUQA 5DT2A 1NHGA 3WIDA 2O4UX 1P8AA 1UFQA 1XZ8A 4BNHA 2H17A 2QPTA 2VHTA 3P9ZA 4BE7B 1P61B 2IYAA 2ZYUX 4O4HB 1UFVA 2OHGA 2ZRGA 3KVRA 1QF7A 5T4HA 4C05A 2WTBA 3KB6A 1MAHA 3S44A 4JL8A 3V9PA 3FSGD 1YC5A 1EDEA 3R5XA 4KQXA 1I13A 3AUAA 1PQ4A 5KJCA 1EVEA 3B82A 1ZLXA 4GYYA 1PYDA 1D04A 1EGVB 1KI6A 1YIDA 3UB2A 4FX5A 4I5EA 5HJ2A 1MGPA 3MWDB 3RADC 2V54A 2ZIAA 3GD7A 4X91A 1JDUA 2VQSA 3L9XA 5T8KC 3X1DA 1MC4A 2NUBA 1YS2X 3HKCA 4GM0A 4RGBA 1R4MA 5IVPA 4PLHA 5GVRA 2NSJA 4DNPA 2NADA 2JJMA 2OBLA 2PSDA 3G0BA 1FDTA 3PE6A 4KX5A 2IOFK 3MS7A 3ZNPA 1RYNA 2GA8A 5TQ2A 5EIAA 1FVXA 2E2WA 3IDQA 2VHZA 1C14A 3MTEA 1EFAA 1IC6A 1JKMA 1QLWA 2W2QA 1HDRA 4QUBA 5F5NA 3ZHBA 1M2FA 3F9IA 4X24A 1MN6A 2OCYC 3QXHA 2MYUA 5LA6F 1X94A 3UJ9A 2CD9A 1IBLB 2R84A 3C16C 3DAYA 2CWDA 3K1ZA 4Y6OA 3K6KA 2Q3HA 3KLMX 1EGAA 2G04A 3R3JA 4FHEA 4G4SO 4YCCA 4KOAA 3AR3A 5ECGC 4G8JA 5FI0B 5CK4A 2BEKA 2OWEA 4FLFA 1EFVB 1U0OC 2AOUA 2V7UA 3RTBA 1SQFA 4O1HA 3WR5A 4LBVA 3JQAD 3R8FA 3ROFA 3TSZA 2XNKA 2B37A 4LYDA 4IO0A 4OFWA 2PCLA 3FVRA 1RI2A 5LFAA 4D25A 5JXIA 5A6VA 1BCRB 1CZHA 1XJ5A 5CEEA 3I3OA 2B7LA 5IDXA 1D2CA 4KFSA 4QVGA 3JYPA 4G24A 3I30X 3VO1A 1QYIA 2BIFA 4GP7A 1PBTA 5FBRB 1KORA 2UZ3A 3D31A 3HPRA 3ASUA 3W5VA 1ZGGA 4HMQA 121PA 2X1HA 5FUQA 4P5EA 3K0EA 1GLGA 3BCHA 4LJSA 4W8OA 5BVGB 5IH7A 2H6EA 1G8PA 1NJGA 2BEUA 5JY1A 5LKAA 1E4OA 1N1EA 4GI7A 1UZMA 1K0FA 1DELA 3FFTA 1NDQA 4TXMA 1IXKA 3V42A 4DDTA 3DKKA 3HJBA 1BFDA 4D8XA 1YRLA 4LC9A 3D6TB 3TX2A 4F9TA 4A6EA 2NT3A 2D0PB 4JYCA 5NULA 4LAFA 2Q07A 4XDGA 4CKBB 3R24A 3DYIA 4ILKA 2TMKA 5KYWA 4OJTA 1G3MA 4N8EA 4YDQA 3UUEA 2Y76A 3ZE1B 2D8MA 2PL5A 2QMYA 2XMGA 3SF8B 1L1RA 2B8NA 1JWAB 4ETNA 5CDFA 3LFTA 2P3LA 4JSRA 4PYOA 3ZE9A 3SIRA 1E9EA 3SX2A 1RYHA 3NS7A 5HYVA 1YE8A 2EKDA 2I71A 1CRZA 4JDPA 1HKHA 1EXDA 1JT9A 3AJ8A 3R4VA 4YJ3F 1THTA 2XJ4A 3RYTC 2WHEA 1WEHA 1T8YA 2I80A 4XFDA 5HKAA 1I2MA 4YJHB 1T9ZA 3MRXA 5DHPA 1W36B 4QDZA 1R15A 4UMFA 2MSCB 3GJRA 1BS1A 1OBOA 1ZUHA 2Q2WA 5TGZA 1OLSB 2GK3A 4MINA 3FPHA 5KNCD 2LIPA 3DTYA 3D5EA 3EEQA 3EXAA 4RCVA 1HDEA 2ZS8A 4ZO8A 5MDHA 2BUBA 1K0UA 1PFUA 1UK9A 3I6QA 5EPEA 4ZJPA 1TZ2A 1Z4IA 3E05A 1E99A 4TTPA 5AOVA 3VYVA 4AY3A 4BBZA 4DYVA 3CM0A 3L8FA 4BEWA 2AZ4A 2IL1A 2A3NA 2AKAB 1KS2A 3QGMA 1ULHA 1P9RA 3OX1A 4QO8A 3U44B 1E5TA 2G7ZA 3QVKA 2YNMA 1BW9B 4FFBB 3E6AA 2AYYA 2IPXA 5KCZA 2A1UA 3U49A 3MCUA 2H5LA 3TNJA 3TIXB 3QFSA 5J2UB 2FGKA 4ZQFA 1PGJA 2DECA 1H93A 4NIMA 4LDAA 1L5SA 4LV8B 3FETA 3ZTWA 4D56A 5HIAA 1GGNA 2G1UA 2W4QA 1ZJJA 3JYNA 3L6EA 3Q3HA 3OZUA 4Q7LA 4RE6A 1X70A 4YCDA 3FD8A 3IVCA 3SOPA 4AO6A 3AR7A 3EB9A 1RI1A 1W4BA 3DE4X 3F90A 3IJRA 3ZWKA 1DPGA 1SO8A 4QM7A 3H5OA 2A5DA 4C7XA 1H69A 2QR5A 4EUKA 1AKRA 5SICE 1R4NB 2NSDA 2WD7A 1GIAA 1JXQA 1ZNYA 3UW1A 2E21A 3RK0A 1LWOA 2Q9CA 3WYGA 3A27A 1ZCZA 1MT3A 3PHCA 3WJ1A 3C14C 1D2NA 2GVDC 4TKZA 4YO7A 3M5PA 1T2DA 5KVCA 3L7AA 4S3MA 1NW9B 4NEHB 4ARCA 1FMLA 4GX0A 4P86A 5EESA 2GM4A 3F4BA 2C2BA 1USGA 1NBMD 2OC4A 3BWXA 3KALA 3OM9A 1EK6A 4QICA 2R79A 3I0MA 5K1ZA 1C80A 2E6UX 4OQPA 4V3CA 1DP4A 3OT5A 2PR7A 4XD7D 1P0IA 2VP6A 2ZB2A 3ABSB 3LWNA 1KZ6A 1U7XA 4YT2A 3UA4A 3CH5A 4HRVA 3RVPA 4AG6A 4ASUD 4ZVOA 1DZIA 1KE1A 4MVYA 5K2OA 3GFSA 5IBQA 5C8YA 4LG1A 1OZHA 2FJUA 1NOKA 2IEIA 3WYBA 3NYQA 2XUKA 4GAEA 2H5IA 3PQFA 1F0PA 1P9OA 4HDKA 4B3GA 3BRCA 3AHJA 3U4DA 1GZSA 2GPAA 5JAHA 5JT1A 1F8UA 3DOFA 1I3LA 4REQB 4KE9A 5KDOA 2DJ5A 3P5SA 1CEEA 1X8XA 3PITA 1G38A 2ZE8A 1EFVA 1ZXBA 2GKSA 4L51A 4G5RA 5AJUA 1P91A 1X7DA 1PGPA 2VEDA 4IJWA 1E0DA 2IHJA 4G5SA 4RFLA 2H4WA 4AYTA 1UQUA 1WAMA 2C0CA 4FZRA 4UAVA 5LLDA 4LZWA 4XRGA 2FVYA 2RH9B 3CW9A 2WG0A 1GNRA 2Y1FA 1Z0FA 4ZXPA 4ND1A 2PMCA 5TPWA 1FFAA 3LQFA 3WRXA 4B0OA 4TZTA 4BNUA 3ZDQA 3IEIA 4DG8A 5ESXA 5KIAA 3RUPA 4HZUA 5IJWA 1OWLA 5AI4A 4O0LA 1LJ8A 5AVZA 1M6EX 2XQKA 1R6DA 2G0NA 5CR9A 4J0QA 4I8DA 3K8ZA 3SKVA 1K5GA 3R20A 5BOSB 2PKCA 2P2DA 3A4LA 3BCUA 4BVEA 3VZBA 5HZKA 5AM3A 3R9WA 1OXTA 1YUBA 1JHOA 3TZKA 1IG0A 4F06A 3AKZA 2YJ4A 2DPMA 3H1TA 3HN6A 4D9CA 1U94A 1XAIA 4WOCA 4DF3A 4OXKA 4TYMA 1KEWA 3UV7A 4LF8B 2VNKA 2G06A 4RK7A 4BX0A 1Z74A 1U0LA 3HL0A 2O5EA 2FSSA 2JKYA 4Y0VA 1PQWA 1ZN8A 1UFRA 2V9ZA 3BWYA 1HZJA 4P3XA 4QFDA 1FFXA 4F3NA 3NAQA 5HXAA 3A3NA 4OGKA 1L8QA 4NICA 5HCUA 1O94C 4KUEA 1EDZA 4JJKA 1XOIA 2G1AA 3DV0B 1JHMA 2QI9F 1WY5A 2XXBA 3A3YA 3EDCA 1U3VA 2ZBDA 3AHGA 4DBLE 1BU8A 3NYWA 3BQMB 2CXOA 2ZVDA 3P7MA 1OIVA 4IX1A 1TKAA 1C8LA 1XMIA 2WF5A 5FL7A 5FT9A 2QN2A 3BJMA