1P2TA

H-ras 166 in aqueous mother liqour, rt
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
162
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein p21/H-RAS-1
publication title Organic solvents order the dynamic switch II in Ras crystals
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 58
structure length 162
sequence length 166
ec nomenclature
pdb deposition date 2003-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p2tA00
4MRVA 3NDBB 2IS6A 1G19A 1VPLA 2QZ4A 4OHWA 3OE7A 1W7AA 5G3ZA 3K0AA 1NIJA 2R65A 2VRWA 4XSGA 4TYWA 4JVMA 4M1WA 1UM8A 2BJVA 3LVRE 2NGRA 2Z43A 2HCJB 2ZSBA 4QRHA 1ZMXA 1AA9A 4P0TA 1KZGB 1LFDB 2IYRA 2O0JA 3ZD6A 4US0R 5FBQB 4C30A 4ARZB 3FFBA 1RIFA 5UKDA 1E6CA 2D74A 3F0TA 5FTLA 2CNWD 2VYFA 4Q19A 4AKIA 4TMXA 2VEDA 4A0RA 3EZFA 5JEDA 3M4YA 3G0HA 1LW7A 1YVDA 3VX3A 2CVFA 3ZH9B 5TMPA 1S2MA 2BM1A 1W4BA 1P60A 3CWQA 3GP8A 1BMFD 4ZIRB 2XZPA 4XIGS 2OBNA 4B73A 4P4SA 3SYKA 1WBDA 5JI3E 4DUGD 3ADBA 4KFUA 4RZ2A 4DKXA 1TQ2A 1LS1A 5EXTA 3WRYC 3H2YA 1EG7A 421PA 4QJ3A 2B21A 5CDFA 1A5TA 1KI3A 1F2UB 1VYTA 3MMPA 4ERNA 3H1TA 2ZRAA 3RC3A 5FTJA 3OAAD 4A2WA 2IYZA 2ZRFA 4B33A 4QJ5A 2O8BA 2EYUA 2PL3A 3FKSD 2Z83A 5B2ZA 1SVKA 5K8IA 3GLHB 4HEJA 4DLXA 3U3RA 1E9AA 4JZKA 3IO5A 1KSHA 3ADKA 4AG6A 5BW8A 2JCSA 4M9SA 4ARZA 1OT3A 3OEEA 2GEVA 2XJ9A 2ODWA 4O25A 4LCBA 1CRQA 3TW8B 4F4JA 3U4QB 3DKVA 3KX2A 1D2MA 5K8UA 1CJUC 2F55A 3LX8A 821PA 4K8OA 3HPQA 3V00A 1XMJA 4DB2A 1M7GA 1Z0KA 1UBEA 4TT3A 4C4PA 1G1MA 1QHXA 4L5BA 4RSGA 5H70A 5JMTA 5JCPA 4Q9IA 1US8A 1E79D 1LB1B 2VF7A 5JJLA 1ZD9A 1II8B 3AF4A 2IBMA 3ZVLA 2QM8A 5FUWA 3Q5DA 1F2UA 1Z28A 4DB4A 3MFYA 1YKSA 4TQUS 4B74A 3ZYCA 2ZUCA 3GLHA 3LXRA 4Z8YA 3HYRA 4B44A 2IC5A 2A7QA 4QHSA 1DBSA 3SEAA 5JWOA 3VHLB 5CLQA 4GRAA 2R6FA 4GZLA 4S2EA 5EZ6B 2FDCA 2HLDA 1M8PA 2XSZD 4QC2A 3U4QA 1W36C 4QGHA 5KYKA 1R7RA 1Y3AA 3R20A 1J2JA 3P4YA 5HE9A 2J46A 2Q9CA 2J1LA 4MDEA 1TQDA 4QBIA 4YMUA 2XX3A 3CX7A 1E2IA 1G8PA 1XEWX 2ATXA 2RCNA 1SXJE 1VHTA 1AGRA 2UVQA 1G64A 1XTSA 4QG7A 4C0AC 2GA8A 1QF9A 5AJYA 2W00A 1Q44A 4C3ZA 2V54A 4IDQA 1OFTA 1UKYA 3U3OA 3K9NA 3GJ0A 1EFRA 5A0FA 2B92A 4EPRA 1XBTA 4MGYR 3WYGA 1M6NA 2X2EA 3QPVA 3T61A 4P4UA 4LHZA 4MQBA 3CF0A 4HDQB 1KK2A 2MSCB 3TGPA 2FZLA 3BH0A 5DISB 5GJWC 2V3CC 3IIKA 3HU2A 4DLUA 5G3YA 5KDOA 3CX8A 6Q21A 1VDZA 4FMCB 4B3FX 3LA6A 1W49A 2CL6X 4IOJA 2MMGA 4B75A 4OK5A 3WNDA 2IWRA 3WBKA 3ZVNA 1VCMA 3PIRA 3ZVMA 3K53A 5B58C 3TK1A 2KBFA 1FX0B 1W4CA 2PZFA 3IHLA 4NYMR 1QHIA 3H84A 4Q4HB 4TLDA 1W2HA 4BECA 2QP4A 2WJIA 1UADA 5L3VA 4PZZA 2WWYA 1KI8A 2BIFA 3LO5A 3SJBA 1FZQA 2JIZA 1ZU4A 2VHCA 2ZS7A 4LHXA 5BN5A 3ZS8A 3SYLA 3TUJC 2V7QA 3EW9A 3ZZTA 5HKKD 3NHAA 2G6BA 1Q1BA 2OV2A 2PX0A 3B6EA 4QFMA 5AJWA 3T35A 5D3MB 2HF8A 1QHYA 1B23P 2XTNA 2WTUA 1XX6A 1SKYB 2ZETA 1PLJA 2MSEB 4PSAA 5EE1A 1NF3A 3ZIAA 4NTZA 1KTVA 5B64A 3NIBA 1OIWA 1U81A 3C8UA 4BE7B 4D80A 2R6DA 4HZIA 3EPHA 4GOJA 3E1SA 1VKJA 5C2JB 5IF9A 4MKGA 1KNXA 2OCPA 5JWRA 2A5DA 2OXRA 2QY9A 3EA0A 2Z5FA 3BFXA 4PPFA 5AUQA 4JIMA 3DEFA 3TVDA 4A2PA 2H16A 1VHLA 4LBZA 2JLUA 5CM8B 2JLVA 2F9LA 2G83A 1FX0A 2ZI6A 4G5RA 3EPKA 3QKRB 4O3MA 4BASA 3LBHA 2CDNA 1CS4C 1G8GA 2W2TA 1R0YA 2VO1A 5DE3A 2WKRA 3DL0A 4N0DA 4Q1CA 4ZI3A 4AIIA 2WBLC 1GRRA 5JRZA 1KMQA 2HCBA 3RS4A 4C7OB 5D3MA 3C41J 4AYTA 5DI3B 1GRQA 4O0MA 3P1JA 2A5JA 2BHRA 1RYHA 3PUXA 5LBIA 1F48A 2QBYB 3UPUA 3BJIC 1U8AA 4X8LA 3H86A 3AKDA 1LVGA 3ND9A 4CT5A 1DE0A 4HLQB 4ZDJA 1OSNA 4JT2A 2XOKA 5M04A 2LCFA 3K0EA 3CNLA 3THWB 1RE0A 2O8EB 5B57C 5CB6A 5FI0B 3K1JA 2OZEA 2IYXA 2QM7A 4CEIB 4Q7KA 1CR0A 3RRYA 1NRJB 1GILA 3GLIB 4KITB 1DAEA 3A58B 2X19A 4M1MA 4Z54A 4II7A 1TUEA 1Q3HA 1Q1EA 3QKRA 3N70A 4ACAA 1G3UA 2WAYA 4H1VA 1T3SA 2CBZA 4TYQA 1VIAA 1A4RA 2GK6A 3EZ6A 2NPIA 4LJ4A 1G3RA 4LJ8A 4PO9A 3IQXA 4HI0E 4UKDA 1RRGA 3PXGA 3RS2A 3T12A 3D31A 3FKSA 3SC3A 2YKGA 3NVAA 1EGAA 4CT4B 1KI1A 2AWNA 1PUIA 3SYNA 1DO0A 1P2UA 4C7OA 4TZ6A 2C8VA 3U60B 2LKDA 5DI3A 1P9RA 3QQ5A 3REGA 1EFCA 4Z1MD 1XD8A 2QBYA 3NBYC 3B1WA 2QPAA 2ORWA 4MRNA 2G3YA 2WOOA 2W6JD 4LHVA 2CLSA 3GLFA 1E2DA 3D8BA 3DZDA 1G9XA 3THWA 2QTHA 1R10A 3ZQ6A 5HCNA 2DFNA 4V0LA 1Q12A 5JI2E 2YVUA 1TQ4A 4EPXA 3EARA 5KSOA 3GLIA 4PHGA 3DOFA 2O5VA 1E79A 3VKWA 3KJGA 2PH1A 2Z4RA 1Z8FA 2ATVA 4C0BA 5BN4A 4PXAA 1VG1A 2QENA 4C2TA 1ZNWA 3A4MA 1SHZA 1WDTA 3LAWA 5J4YA 1LF5A 2GCNA 3QBVA 2V9PA 4LC0A 4NL4H 1GWNA 4OQFA 4F93B 1JR3D 2ZM5A 1FNNA 3T1QA 3QKUA 5G53C 2KWIA 3RWMB 2JASA 4JYBA 3T5DA 2IT1A 4KYIB 4WOPA 3C5HA 2J7KA 3U3JA 5DNYB 4ESHA 1KO4A 1LF0A 2OXCA 2BEJA 1M34E 5C1BA 2HEIA 2GJKA 4UQOA 1HV8A 4DCSA 1VG9B 2DFLA 2VP5A 1KSGA 5L3QB 3A6PC 1RW4A 1GKUB 4BEJA 4BGDA 1XWIA 3GLGE 3EIQA 2CLCX 2GF9A 2P3SA 4G0NA 2C04A 1OHHA 4WXRA 4B35A 1YR9A 1R0ZA 5JSZB 1X8JA 3BOSA 1DS6A 4CEHA 2P6NA 4JSTA 4V03A 4TWZA 2XNDD 4BZPA 5EJEA 2NZ8A 1OF1A 1ANKA 1XXHB 4FWTA 1XMSA 3R8FA 2A9KA 1E1QD 1U9IC 3CBQA 3AVUA 4WZAE 2B6HA 2P6UA 1GKYA 4KXFB 4Q4LA 1YZUA 1CKEA 3BB1A 3IUYA 3LD9A 3KUCA 5EQTA 2FU5C 2H7VA 2W6ID 2AXNA 4UNQA 2REBA 3B1VA 2V6JA 2OAP1 2OEPA 2ZYUX 4DLRA 5JLJA 3B78A 2PT7A 4TLAA 1MH1A 2H92A 4RD3A 3B85A 4MH0R 2IXFA 1CTQA 5DN6A 5LPNA 2LKCA 2ZJ2A 2R6AA 4M1TA 1ESMA 1TQ6A 2G0TA 3CO5A 2A5FA 2ZE8A 2I1QA 3W6OA 4CZ2A 2BV3A 1D2EA 3N2IA 3EIEA 4MUBA 4Q1FA 1ONBA 1W4RA 1COWA 2ODBA 4MRRA 3T34A 1ZVQA 2ZE6A 5JCZA 1W36D 4TMKA 3I8SA 1OV4A 2WJGA 2XITA 1OH7A 2RAPA 3PVSA 1T8UA 1EX6A 2IXGA 1Z0IA 2A3RA 5JSZA 2JJ1A 4F7WA 4CEJB 1KAGA 4DEYA 1N6NA 4LYJA 2GZAA 4A0GA 3UANA 2YZ2A 2FFAA 4B43A 2DYKA 4MGZR 3QOFA 3MLEA 3DVLA 4GP7A 1ZM4A 3GEIA 4M1SA 4IXNA 5FL7D 3VU9A 3VX4A 1T0JB 2Y8EA 3CM0A 1XXHA 4LY6A 4UNNA 3LNCA 1D9ZA 5HZKA 2XB2A 4BLOA 4A2QA 2DWPA 4OI4A 4QXAA 2J45A 2IK8A 1DADA 3SFVA 5JRJA 3CX6A 1G8HA 1TF2A 3C15C 4C0JA 1R5NA 1G18A 2ZJYA 2Q9BA 4QHTA 3RS7A 2QP9X 3QEOA 1U98A 3FHTA 1BIFA 3DDCA 3TBKA 1C4OA 3FVQA 1NLZA 2FV8A 1GDDA 2N1BA 4BLPA 1S0UA 2OT3B 2ZRNA 3RABA 2HT1A 4A8JC 2EFHB 1WMSA 4MKIA 4B2PA 1M7HA 3MRSA 3ICEA 3CPJB 1ZINA 2ZI5A 4KLZA 1L2TA 4YONB 1OPXA 2ZRJA 3K9GA 5IT5A 5D3QA 1EESA 4TYNA 1IHUA 3DHWC 4PTLA 4CEJA 4LJYA 2OE2A 5GJVC 4IVRA 1FQKA 1Z2CA 4DCTA 3K70B 2EWVA 4FCWA 4FWIB 1GOTA 1JEDA 4PPQA 3OHMA 1N25A 2F1HA 2ERXA 2RGCA 2ZJ8A 3SJAA 2P5TB 3W9YA 2GXQA 3B60A 4A0FA 4OK3A 1N5LA 1C9KA 3Q9LA 2E87A 1VCNA 3NBFA 1EWQA 2RGDA 1IN7A 1IXZA 3RDPA 4URXR 4HAYA 2WWXA 2VL7A 4AKGA 1ZM9A 2OBMA 2QI9C 5JHGB 5E95A 1KKLA 3OIUA 4M1OA 3TQFA 1N3BA 1N6LA 4CRWB 2J7PA 1Z47A 2ZR0A 3PCRB 1AIPA 3CH4B 1JQJC 3BFVA 1OE0A 4O2LA 4PPGA 5SZKB 1G41A 1RZ3A 2C2HA 4MKFA 3SJCA 2G0NA 1K5DA 1JQLB 2IHYA 4RVCA 5H8WA 5FTMA 1JJ7A 1J8MF 5JECA 1CBUA 1U90A 2WSSD 1WXQA 2FPLA 3B13B 4PQFA 4C2UA 1CJMA 2X8AA 3S1AB 4EFNA 1JB1A 1WRBA 2RB4A 3MGCA 4LHYA 4Z1MA 3UK6A 5J4VA 4N3NA 2VBCA 3O8BA 1AKEA 2FFHA 4DCNA 1KSJA 1YHNA 2WWFA 1G6HA 1HH4A 4X8MA 2W6JA 5AUNB 1IXSB 2EU8A 1BKDR 1Z63A 2ODNA 3DMNA 1HE1C 1KI6A 3DM5A 4IDPA 2BOVA 4BPBA 4QM7A 1XDBA 3JVUA 3TH5A 3X1ZA 4IHQA 4TMWA 2D2EA 1FMJA 3L0OA 2UZIR 4P32A 1SZPA 1MO6A 4BLTA 3BH7A 1CIPA 5FBRB 4GPTA 3VR5A 1P75A 2ANBA 1IN6A 2QPOA 1FPMA 3K9HA 3SU8A 4FMCF 4FW9A 3QSYA 3AVXA 1ZNXA 2GJSA 3NC1C 1MR3F 5JHHB 1KY3A 5F9HA 3PQCA 2XAUA 4XD7A 4GMXA 5FOUA 1WQ1R 4KFSA 2FSGA 2QAGC 2R62A 2QL6A 1ZP6A 1XCPA 2BCJQ 3HR8A 1MRNA 4HAVA 4Q66C 4PPNA 5EUMA 2IEZA 4FCVA 3S1AA 3KTAA 4G1UC 3I4LA 2ZU6A 1NLYA 4P31A 4JVNA 5CM9C 5JFGA 1Q1QA 5L8VA 2OFWA 2WPDD 4IOKA 5A5GA 3HU1A 3AH8A 4D4LA 5LD2B 3L8ZA 4OHXA 2J0UB 2BMFA 3EZ7A 1CLUA 4AKEA 4NU0A 5FI1B 1T3LA 2RHMA 2V8OA 4PAQA 3MJRA 3QE0A 2ZI4A 4Q9HA 3NDPA 1E98A 2PLFA 2GNOA 3D3QA 1ETUA 4BEBA 1P3JA 1UBGA 1HT1E 4RD0A 5KPDA 1SXJB 1IN4A 1WA5A 2R6CA 1NBMD 4UJ3A 5L3RA 4JLNA 1RFLA 2JJ2A 4AYWA 5FUXA 5FFMA 1NVXQ 5FUYA 3K0FA 2OBLA 3NG1A 2O8BB 2QP3A 4TYPA 5SZIA 3T5GA 1NKTA 2ZE7A 1S3GA 2QE7A 121PA 4QJ4A 4US2R 3L82B 4P33A 1GFIA 4U5XA 1R8QA 4DDTA 4E5UA 2F1RA 1HA3A 1MO4A 1G5RA 3X2SA 1Z06A 1WP9A 1EFUA 4CIDA 1B0UA 2FX3A 2P67A 4OI1A 3C16C 3KQKA 1H8HD 3K70C 1IOZA 4Q4JB 3CUEF 3JZAA 5G40A 2GBLC 4PANA 2NOAA 4L16A 3VNVA 4KV9A 4F38A 1MO5A 2J0UA 4H9GA 1PUJA 3Q3JB 2X77A 1O87A 2WJHA 2XTMA 2CHQA 2VP0A 1RPZA 1US8B 2OHFA 2AFHE 3N5CA 1K5GA 3GPLA 3RNLA 3MSXA 4KSCA 5DYGA 1OKKA 4PC7A 4ZDWA 2Q0HA 1OXVA 2BBTA 1I4TD 2RH5A 4DSOA 1WCV1 4HUTA 2F6RA 4M0LA 1SXJA 1XJQA 3WNBA 1HQYE 1JR3E 1KO7A 2RMKA 2QSYA 4JS0A 1JAHA 3H4MA 3EWAA 3GJ8A 4JBXA 1ZM7A 3BS4A 4A0HA 2WV9A 3QVUA 4JL5A 2EFCB 4M1YA 4OI0A 1QG4A 2EFEB 4M22A 4Q03A 4GL2A 2D4HA 3PV0A 2R9VA 3EG5A 4LI0A 2UKDA 1T9HA 5EXSA 3HJNA 1T6NA 4ON9A 3HP1A 1M7BA 2JLXA 5CJPA 4YLGA 4Q18A 1ZD1A 3F5FA 5CLLA 5J4LA 1BOFA 2QRNA 4Z8XA 4ZV4A 2OCAA 4DRZA 4MYUA 3QF4B 1DAMA 2VQSA 2X2FA 2LWIA 1U0HC 1CULC 4HATA 4LPKA 4QBGB 4Q4JA 4W7SA 1P6XA 4MITA 4NZYA 4IRUB 4I1OA 4Q7MB 1FMLA 4NYJQ 1PZNA 5BYKA 3NHBA 3DOEA 4JLPA 2DR3A 3WBJA 4Q21A 4NCJA 2F9MA 1H8ED 4HB3A 1AM4D 2AK2A 4URYR 3A8TA 3CRVA 3OEHA 4OHZA 1N5KA 1QZXA 3TRFA 2YOFA 1UKZA 3AF3A 4PO1A 4TSFD 1AK2A 4KYUA 4C0KA 1E99A 1FNMA 2Q3HA 3BH6A 4RD6A 1U0JA 2IEYA 4B71A 4KI0A 1TPZA 4TLEA 2P6RA 2K5UA 2DB3A 1R5OA 4JSYA 3RRNA 1YR8A 4PHFA 3AUXA 2DY1A 3RYTC 4AYXA 3B9PA 3B7GA 1E4VA 5A4JA 3KB2A 4P3YA 3QXSA 4UNPA 4PQYA 3UKDA 4RJLA 1P61B 2ZEJA 1NSTA 4AK9A 3QF4A 2O8FA 1RRFA 1TEXA 2KB0A 3TUZC 4Q7LA 1RRPA 3TNFA 3CRQA 4XWKA 1NMZA 1W4AA 1L4YA 2IHBA 4GI7A 1I4LD 3BIFA 4P4TA 3RS0A 4X8HA 1UDWA 3IBGA 4PQRA 1MV5A 4L9SA 1R0WA 4EPWA 2V4ZA 2C96A 8OHMA 1KJWA 4NCNA 1AS3A 2RGNA 4LZZA 4QOSA 5FPYA 5FPKA 3NH6A 1CU1A 1R4AA 2NPFA 4M1KA 3IO3A 3UATA 3QIAA 1GG2A 3QPUA 3CONA 3FHCB 1U94A 3HYTA 2VHUA 3MUFA 5FL3A 1KJYA 1R5BA 4KSBA 4TMZA 1E69A 3RWOA 5KNBA 1KDRA 1GIAA 2BMJA 5TDHA 2PMKA 1E9CA 4DVGA 4YDHB 3FFAA 4LJ7A 2PCLA 2GAAA 4LPSA 2WJYA 5K8LA 3IHWA 3AVTA 1JAIA 3QF7A 5BQ5A 1CXZA 1HQCA 5FBLB 3GFTA 2P2LA 3ZJYA 3AVQA 3EIHA 3AVVA 5GJCA 4XSHA 3ZD7A 1XD2B 2ZSAA 4B2IA 2ZQ5A 1YU9A 3UMFA 2GXAA 3EPLA 3BXZA 1NLFA 4QHYA 4D0NA 2BEKA 3CNOA 4XH9B 2L0XA 2A2ZA 2OUKA 4I4LA 5HE8A 2HXSA 3ZS9A 1V43A 3Q72A 4Q1AA 4WZBE 2VLIA 3KKMA 5DO9A 1YR7A 2A30A 3IQWA 4AKHA 5IK2D 2VH5R 1NMYA 3LLUA 5FOVA 2CHVA 2ZE5A 5HPYB 3BGWA 1U8ZA 1KDTA 4JKIA 5B30A 2VHTA 4Q48A 4TTPA 4A6XA 2E9SA 4NHOA 1JR6A 2A78A 5E3HA 2OESA 4NP6A 3JVVA 1ZC3A 3F3YA 2H1LA 1GTVA 1NN3A 2Q9AA 3CF2A 2AHOA 2IYVA 1DAKA 4BFWA 2ZS8A 2FE4A 3U3MA 2YOGA 1M74A 1IY2A 4FCTA 4HUQB 2HJGA 4PC2A 1SVSA 2PX3A 3LRPA 2IYLD 4YC7A 5GADl 2PMDA 4RKEA 1OIXA 3L8YA 4HB0A 1U2RA 3A36A 1KY2A 3AB3A 1NG9A 2G1JA 4KBFA 4ZCMA 1W46A 3PUWA 3ADCA 4WA7A 3LY5A 2FFQA 3EPJA 4PHTA 1XD2A 4D25A 1Q3TA 4G3XA 4YMTA 3U44A 1E1RA 1BO6A 2WWHA 3GLGB 3HPRA 4M53A 4BUJA 5JJKA 4LYAA 2YWFA 2ZREA 1DG3A 1ZJ6A 2J5XA 3EWSA 3UG7A 1E32A 1JJVA 5GVRA 1X1SA 2C78A 3ND8A 4RFSB 1W0JD 3CZQA 4OHYA 1SVOA 1VMAA 1E2FA 1XJCA 4ASUD 1XNJA 2JATA 3U61B 3Q8XB 2GEUA 5E7IA 3KKNA 5DHFA 3VR1A 1NNEA 2CNWA 2ZR9A 1SGWA 2REOA 3QXXA 2RGBA 4U02A 5C18A 1OJLA 3JZMA 4KFTA 3ZZ0A 4HUQA 1CJVC 1GNRA 2B8WA 3R8CA 3B82A 4LJAA 3I5XA 3GLFB 1Z0JA 4I81A 1JBKA 1UEJA 1T5IA 4EUNA 4S35A 4UNRA 2EVWX 4DIEA 1KI7A 1BMFA 1VYVA 5G41A 1AGPA 4W5WA 5K8TA 3NH9A 5GVSA 2DBYA 3Q85A 1FL9A 2VP9A 3W6NA 4DT1B 1ZM3A 4DUGA 4UJ5A 1QHGA 3WHKA 2XZOA 1O3YA 2PJRA 4UXHA 3TJZA 5C4GB 1HURA 4HAZA 3VTKA 4FMDB 1R0XA 3IILA 1Z6XA 4U7DA 1Q21A 2ECKA 3GLGA 2XEXA 2MMCA 3LBNA 2QN6A 4LSGA 4LK2A 3T15A 4ZCIA 4JT4A 3A4LA 2B7BA 4IDHA 5DIFA 1G3MA 3OAAA 2GRJA 4URZR 1J8YF 2ZSEA 4RFSA 3BRWD 4YMSA 3D7MA 1NVVQ 3BB4A 2DFKB 4JLMA 4IFEA 1AJEA 1IJEA 3QXCA 2QTFA 1QHHA 4OQLA 3PUZA 4HAWA 3V4FA 2QA5A 3LQRA 5EE0A 1QG2A 1C1YA 1E3MA 1G8YA 1FTNA 1PLKA 1X8KA 2WAXA 2ZR7A 3BK7A 3CLVA 3KXIA 4L8GA 2BBOA 2V55B 1DOAA 5ANRB 3B8HA 3P20A 5CK5A 3L0IB 4TMVA 4AC9A 1P73A 3I8XA 3GMTA 4KO8A 1SVWA 4NCIA 4YXWD 3EX7C 5JBQA 3OFND 1QHSA 2IYYA 1P62B 4DT1A 2V1XA 3VAAA 1NBME 3KXLA 1W0KD 4GNKA 3THOA 1YR6A 4KBGA 3VMFA 1GRNA 4HYYA 4GOXA 3WYAA 3FKQA 4DWJA 1DPFA 4A9AA 2QT1A 1K8RA 3OIWA 4ABYA 2FH5B 2I1VB 3NBZC 4NH0A 4CEHB 1YZGA 5EZ5A 2FSIA 3R9IA 3R7WB 3LLMA 4F92B 1S8FA 4LWZA 4TSFA 5IHPA 3A1WA 1D2NA 1KNQA 2ODEA 1ZBDA 2R6GA 4I1UA 4Q7JB 1ZYUA 3KUDA 4US1R 4BFVA 1G7TA 2JLWA 3M0EA 2P65A 2V1UA 1E0KA 2GXSA 2OLKA 1XP8A 2YC2C 3P4XA 4EIWA 2C99A 1NI3A 2CE7A 3C14C 3MJHA 2AR7A 2GZHA 2JA1A 2Q21A 4N0EA 1CEEA 2GHIA 4Q5IA 2XSZA 2IXEA 2J3EA 1ZNYA 2JDID 4B3DA 2D3WA 3MWKA 2QAJA 2GVZC 2QROA 3FE2A 3IPYA 1X1RA 4IVPA 3FMOB 3PENA 3L43A 3ECCA 1D9XA 4JL8A 4JVLA 1SKYE 1Z2AA 4IDNA 2CE2X 1GVNB 3T06B 4QL3A 2VHJA 3IEVA 3FGNA 4HLUA 1S9DA 2ZSFA 4GOKA 1NG1A 2XTZA 3FMIA 1YE8A 4OQMA 3SE0A 2ZVQX 2HDNB 2ZIAA 3QENA 2ASEA 2FSFA 4TLCA 4NKRA 4V0NA 4NYJR 2HJVA 3GFOA 4NPHA 3R7WA 3TUIC 4NCHA 4BFYA 1VG8A 1S96A 2JLRA 3HR7A 4G5SA 3VU9B 2QU8A 4D0LB 3K09A 1Q20A 5HZHA 1GP2A 2GXUA 1BYUA 2FZ4A 3EXAA 4BLSA 3P26A 5KUTA 1X6VA 2UZ3A 3EC1A 3ZQJA 2RGXA 5FPHA 3KB1A 2EFDB 4HDOB 3EC2A 4UNSA 5GJBA 1E0AA 2O52A 1U99A 3KJEA 3U5ZB 1ZNZA 4Q01A 1Z29A 3C4JA 4G5QA 1E2PA 1E2MA 2P0EA 1JPJA 4YMWA 4Q9LA 1MOZA 3T1TA 3SJZA 1ZC4A 4JJZA 1IXRC 5E7MA 5TARA 3AGQA 4B47A 1WF3A 3UWOA 3NEJA 3OE7D 4WXPA 1E0SA 2D7DA 4DLYA 4MDFA 1LNZA 3SQXA 2OG2A 3GJ6A 4Q4AB 1YZNA 3BAFA 2HUPA 1IN5A 1Z22A 4JBWA 1X8LA 5FOTA 5EP1A 4R2HA 5TB5A 3WMGA 4POAA 2PEZA 4C0SA 2FA9A 3LWNA 4BLQA 5IK2A 1OXTA 5HKKA 2OCYC 4OJQA 3RAPR 1KYIA 1RVDA 1XEXB 2ORIA 4JJKA 3V4RA 4GDFA 1G3QA 3WP1B 1OLOA 4L9WA 1AS0A 4R7ZA 1Z0AA 1A1VA 2BBSA 2PBRA 4OJKA 5C46F 3ZZUA 1IN8A 1Z6TA 3AVWA 1KI2A 1UF9A 2N46A 1FFHA 1I4DD 4Q9JA 5FR1A 2E1RA 3GJ7A 3PEVA 2O8CB 2QQ0A 4D6PA 2ZRHA 2F1JA 3T1OA 521PA 4WW0A 1NVUQ 3UMSA 5AR1A 2G1KA 3TW4A 2ZU0C 5BYJA 3RRZA 3V9PA 4Q4AA 2ZJBA 2OAQ1 1SVLA 2ZRMA 3LBIA 1XU4A 4E07A 1X3SA 4RZ3A 2IS2A 3Q7PA 2D7CA 3KFXA 1E2HA 2VA8A 5AJXA 1MO3A 4CGZA 3O8RA 3WP0A 2BCGY 2OLJA 1UBFA 1YRBA 1OXUA 4HB2A 4DBLC 1W0JA 3OEED 1A2KC 1T0HB 1XEXA 5FOXA 2AN9A 2HYIC 4HLUC 4QBFA 4TTQA 2C03A 2GCPA 2YJTD 1OH6A 1JEEA 2OO7A 4TL6A 4ACBA 4OQNA 4I1VA 2GJAA 4DIDA 4IOMA 1CR4A 5CIWA 5AWFC 3K0CA 4TT3D 2YC4C 4KHZA 2ZJZA 1YZTA 3W6PA 2ZJOA 4KFRA 1OXXK 4LYHA 3KQHA 4M21A 3EAQA 2WOJA 1Z07A 4IW3B 4B3XA 4DDWA 2O8CA 2CJWB 1I2MA 5AJVB 1KI6B 2PEYA 3AP2A 4A4DA 2VP4A 3EZ2A 4JLAA 5L3SA 2HV8A 3AVYA 1UPTA 2HYDA 1JECA 2CL0X 3I3SR 3DZ8A 4RZUA 4V0OA 5KSZA 4X8OA 2GETA 1T91A 4TL8A 4FIDA 4BFUA 1GZSA 4DLZA 1E2GA 2QMOA 1G291 3D6TB 1KK0A 1SVIA 3AKCA 3TE6A 2W2VA 3QEJA 1W1WA 4QNRA 2I3BA 3CH5A 1U0LA 3WY9A 3BERA 5F2EA 4XWOA 1ZIOA 1TADA 3KKPA 2IYUA 2HLDD 1HT2E 3VR2A 4NYIQ 4F91B 2MSDB 3PITA 3AEZA 2WJJA 1OXSC 4JMPA 1ZUIA 4ZDIA 3KTAB 1NY5A 3KQLA 1JPNA 3FHOA 4IDOA 1Z83A 4OKSA 1E9BA 1Q57A 1BH2A 2Q3FA 1RRCA 4BLRA 1DARA 2ZVPX 4XVUA 2CJWA 2ZRKA 3KJIA 1TF5A 1R6BX 2IA5A 1ZCAA 3U2QA 1EFRD 3W90A 1RJ9B 4AG5A 3GCGA 3IIMA 2B7CA 1KI9A 2ZRLA 3MD0A 4MYCA 2J0QA 2XGJA 2IYWA 3IEUA 4C0LA 4EPYA 4EFMA 3HU3A 4ZPXA 5F3WB 4A36A 2IS1A 3K0FB 1YZKA 2OM2A 2XNSA 4YDSA 4LUCA 5TXGA 3G82C 5FR2A 3WHLA 2QEQA 3AP1A 4XTRA 5FUVA 1JR3A 5FOWA 1KO1A 1Z6YA 2QQEA 1DVRA 4G5GA 2Z4SA 4ILEA 4D82A 1ZUNB 5EP3A 4YMVA 4BQSA 3TAUA 1VCOA 3U7GA 3W8RA 1P5ZB 5DGXA 1JI0A 4Q02A 3DKPA 2W0MA 1NN5A 3CZPA 4RFVA 1VCIA 4F4CA 3SFZA 1NVVR 1ZRHA 1Z5ZA 2JDIA 4IFBA 3OZXA 3ZDQA 2O0HA 4MKHA 5J47A 3PEWA 2JIZD 2ZANA 1SHKA 1N6PA 4FN5A 2F1IA 5CYOA 2V7QD 3SHFA 2CXXA 3AF0A 5SZJA 4QKQA 3K8YA 2EWWA 2D06A 1RJ9A 1UDXA 3FWYA 4EKDA 1W36B 3UXMA 1EWRA 3AVPA 1MKYA 1R8SA 1XTQA 1NN0A 5EE5B 1GUAA 2CMKA 2CCJA 4LV5B 4RZXA 1T8TA 2F3TA 2FSHA 2JAQA 2WWGA 3LDAA 3ZIAD 4Q1DA 2XNDA 2BC9A 3FTQA 3VKGA 1N0WA 2FJUA 1SVMA 2AWOA 3IBYA 1IBRA 1D8TA 1ZAKA 2GF0A 3E5HA 1E1QA 2Q3MA 5ELXA 1CF4A 1XZPA 4CVNA 3TR5A 4JLVA 3DO6A 3WRXC 4CYMA 1F2TB 3WNCA 4C0HA 221PA 5FPTA 5H1YA 3PEUA 2ZRBA 2PZEA 2FOLA 4FD2A 3MWLA 3RRMA 2W6IA 2WZQA 4PHHA 1E94E 1G3IA 3CWZA 1DAGA 2OILA 3Q7QA 3IGFA 2YWGA 1L4UA 2ONKA 5FH9A 1Q22A 2FMXA 1CJKC 2VF8A 3VFDA 1GSIA 2TMKA 1KK3A 3I62A 3QG5A 1AZSC 1W5SA 2BKUA 4IXMA 3UIEA 2GCOB 4OK6A 4GSYA 4PSKA 4V0ME 3SS8A 3NBXX 2WIAA 1TAGA 2H17A 2IF2A 2SHKA 4PAMA 2YHSA 3W3ZB 3SI7A 4JLDA 1TTTA 3WXMA 1ZM2A 2GESA 1ZD8A 3DMDA 1Z0DA 3CB4A 3G5UA 4KVGA 5LB4A 3T1VA 1G5TA 1IY0A 5FL7A 5KSPA 2YNMA 4BRWA 2XOKD 4PFSA 3DM9B 2WM9B 3IPXA 4KODA 4W9MC 1II0A 2AFIE 4QNMA 1CJTC 3SR0A 4FMDF 1E9FA 4AI6A 1XZQA 4NCKA 1F2TA 2R2AA 1UBCA 1P2TA 2QPTA 2RKOA 4F4IA 2QGZA 5KU1A 4LV8B 2ORVA 2FNAA 2JJ8A 3QXHA 5FBVB 3LH5A 2JLQA 2C9YA 4A92A 1XEWY 4TL7A 4R71A 3QKTA 5TY0A 2NMVA 1N0UA 4A15A 3A1TA 1E2EA 3A1VA 3QG1A 2HT6A 2J87A 2YOHA 4PC1A 2VHQA 3NKVA 5DSZA 2C5LA 3NTUA 3VR4A 1W48A 2GCOA 2QORA 5JZVA 5H68A 2AXPA 4E22A 4CDGA 3KL4A 1AN0A 3ASZA 1E9SA 1ESNA 2GJ9A 4MRSA 4PZYA 721PA 2JLZA 3H0KA 4D26A 3PUYA 4JYCA 4I1SA 2XZLA 2ZRDA 3QXJA 1FQJA 3IDQA 2BMEA 2BKEA 4C9BA 4ZIRA 1UAAA 1HE8B 1KGDA 3CR7A 4ITRC 3WMFA 4BZXA 2QG6A 1N6HA 1E2NA 1ZCBA 4KAXA 3AVOA 3ZVRA 3B9QA 2AK3A 3I72A 3UMRA 1UEIA 1N6OA 1SULA 3IKJA 3AF2A 1Q1ZA 4K46A 1CR1A 4DEXA 5EE3A 3VHXA 2REXB 2ZYVX 3AGPA 4ZKDA 4B48A 2D2FA 2J59A 2F7SA 4AY2A 2IS4A 1E0JA 1NJFA 1P2SA 1TEVA 1KK1A 5FTKA 1IM2A 2IW3A 5E7JA 4Q00A 3OIYA 4OL0A 1PVOA 2AKAB 2IUSA 4IEEA 5IRCD 5LD2C 3SZRA 3CRW1 1EFTA 3U7FB 2W83A 4L15A 3VNUA 3I5YA 1NP6A 1IY1A 1G21E 2WSSA 5DLQC 5SZHB 4URUR 1KO8A 1V5WA 1NKSA 3AQ4A 3SDZA 4W5JA 3TQCA 3EASA 4N1AA 1D6JA 3RVBA 1SXJC 1XFAA 3KZ1E 3W5JA 2BMDA 1QVRA 1IJFA 2IYTA 3QVVA 2ZSDA 4HZUB 5CDFE 4MGKR 2XB4A 1XF9A 3CIOA 2CCGA 3NXSA 1OHHD 2NZJA 2QTVB 3PG5A 3LV8A 1A82A 1II8A 2ZRCA 4PSVA 2C9CA 2J41A 3LW8A 3P32A 3ICQB 4NE2A 2VTKA 1RC8A 1G20E 1Z3IX 3NWJA 4XJXA 1OFHA 3LVQE 3TR0A 3VQTA 1UKVY 4DSUA 4URVR 1HYQA 4PAOA 3VR6A 3AV0B 1DAIA 1TUIA 1UKEA 3TAHA 4V0KA 2G9NA 4DLVA 2CHGA 3U44B 3BBPA 4JBYA 3PJRA 2NTYC 2PT5A 2EQBA 3I73A 4DLTA 1GAJA 3RANA 2GZDA 5JWHA 4FINA 4NBSA 1E9DA 2BJWA 2AKYA 2KJQA 3SOPA 3EZ9A 1FUKA 3U6BA 4WBSA 4LJ9A 4AWXA 4ZCLA 4H1UA 4I99A 3CNNA 3U7EB 3MAAC 1WB9A 5DN6D 2O8FB 3A37A 2IF0A 2KSQA 2YINC 5AUPB 2B8TA 1II9A 1MABB 4NYIR 3TSWA 1NN1A 4ZI2A 1COWD 2XXAB 2WPDA 1QRAA 2BM0A 4HZUA 4Q1BA 1L8QA 1N6IA 4BFXA 3U3KA 1S1MA 1GITA 3HDTA 2JJ1D 1XTRA 2JLSA 4JLBA 4ZKEA 4CF7A 1S9HA 2NO9A 3RLFA 5J4KA 3GLHE 2C77A 1GL9B 1Z6GA 3IIJA 1KOFA 2WWIA 1RYFA 3BC1A 3L0PA 4GP6A 3CRRA 4TN1A 1NBMA 4BWYA 4D4MA 4DSTA 1OH8A 3N2EA 1NMXA 1YQTA 4D2IA 2H5EA 2ZI3A 4JLKA 2FGJA 3GFPA 4LBVA 3ASYA 2DWQA 4TYYA 2VPPA 2VP2A 4MA4A 2GTPA 1KIMA 5KOYA 3FDIA 4PO8A 1G4AE 3MCAA 1ZUHA 2QNRA 2IYSA 2IYQA 5DHAA 1Q0UA 1QHHB 1BS1A 4D81A 4URWR 4LBWA 3W3AA 1XRJA 4KLNA 2CK3D 1OW3B 3Q5EA 4QBHA 3RHFA 4Q4HA 3PFIA 3GJ5A 4EQ6B 1NL3A 2RGNC 2QUZA 2KBEA 4JLJA 1HUQA 1MABA 2W58A 4QGGA 1H8HA 3THYB 3GQBA 2XXAA 2FWRA 4RKFA 4YQFA 1RKBA 1R2QA 3O8CA 1W47A 4R9UC 4BRUA 4XTCS 3E2IA 4LJ6A 3AM1A 4LV6A 3A1UA 1WE2A 2PLRA 4XVRA 5BN3A 3RS3A 1GM5A 4HAXA 5EE9A 1G17A 1G5PA 1HEIA 4LJ5A 4DCVA 4HLCA 3FPAA 1DEKA 4QGFA 4TZ0A 4TL9A 2WVJA 3OESA 3REFA 4KVAA 4Q9KA 4EPVA 2ZAOA 2DCUA 3KKOA 3BB3A 2NIPA 2EW1A 2BDTA 1XCGB 1Y63A 4MGIR 1KI4A 2NO7A 2D62A 4GMDA 5FPSA 1OH5A 4TQAA 5TV2A 1HTWA 1AKYA 1E2QA 1G7SA 3RS5A 2GJ8A 4QM6A 1DTSA 3NC0C 3I61A 3QI2A 1D5CA 1DELA 1KZ7B 2BBWA 3CPEA 3SHWA 2PJZA 4B3CA 2J7PD 4WIAA 4EQ6A 5HTKA 1U9IA 1P7CA 3FOZA 4HSEA 3THYA 1N5IA 1ZU5A 1ZW6A 3A1SA 3PUVA 4G01B 4A1FA 4DJTA 1G7CA 3O8DA 5EP2A 4MYTA 5KDLA 1OYWA 3BD9A 5KNCA 3NEYA 5KNDA 4J0QA 4LGMA 3K70D 1CR2A 1KO5A 3TMKA 1J90A 1H8EA 2OFXA 4KJZA 2FEMA 1IAQA 3A4NA 2HXYA 4A8JB 1N5JA 1XD9A 1E2KA 2ZYWX 5E4FA 2KI5A 2QMUA 1AZTA 5FTNA 3MWJA 2R44A 4GFDA 1F6BA 2NO1A 3AKYA 1E9RA 3ZGXA 2O8EA 2ZITA 1A7JA 1DO2A 4FXPA 1QBKC 2O0KA 3VR3A 4Q1EA 4CEIA 5EUQB 4UXIA 1MT0A 2I4IA 3ZLJA 4RD4A 1TL7C 1S3SA 2QRZA 4V02A 4OHVA 3LXXA 5KDDA 2WJVA 1OFUX 1VTKA 2Z0MA 4O2RA 4XD7D 4A6PA 4EJSB 4Z51A 3BWDD 2GILA 3L2OB 5AK0A 2RGEA 4M2LA 4GZMA 3TSOA 2WIBA 2ZS9A 5CJ2A 4WAUA 2NQ2C 2JGNA 4QGAA 4UXJA 4JKYA 3KDSE 5KPJA 5F9FA 1TF7A 5EP4A 2YWEA 2IX3A 4A8JA 3QUSA 2ZRPA 4U00A 4B76A 2C98A 5CITA 1U8YA 2X1VA 5C4MA 2OSBA 5HCIA 2F43B 2P5SA 2WKPA 1XCMA 2YV5A 5KSYA 5KTYA 3THXB 5AJZA 1GKIA 1G7RA 1E9EA 1P9WA 3C7KA 2WMNB 1X86B 4B32A 3FMFA 3LX5A 3GJ4A 1TX4B 4Y0VA 5LB2A 1VG0B 3R9XA 4PX9A 1T4GA 1XTIA 2EYQA 5DH9A 5AUOB 4B3BA 1OFIA 1J99A 4LBYA 4D4JA 3X1XA 1PV4A 2C95A 2JJ2D 2FPKA 4KU4A 2WWWA 2CCKA 2RGAA 3UWKA 1OB5A 3ONWA 4IOLA 4EJSA 2H8KA 1AS2A 4OI2A 1JNYA 4ZO4A 2GKSA 1XTJA 4BFTA 3OIVA 4CW7A 4RD1A 4DLWA 1WBBA 2W2XA 3BORA 1AQYA 2QE7D 4M9XA 4IKEA 1GNPA 2KE5A 3TKLA 4DZZA 1JALA 1XMIA 2ZPTX 3GLFE 2QMEA 4C0QC 2ONJA 5KHOC 1M2OB 2ANCA 5CK4A 3X1WA 1Z0FA 4LHWA 4JLOA 4B34A 3X1DA 2F43A 2QGNA 3THXA 3GLIE 3B2EA 5LDDC 3I1FA 5HR5A 3RC8A 4LC1A 2IWHA 2QAGB 5L3QA 3KXKA 1KDPA 1L7VC 3CR8A 3TSZA 1PJRA 4ZDKA 1J70A 1TU3A 1P2VA 3KJHA 1NSFA 2ZROA 4MYHA 3WYFA 1OKKD 1S4QA 1QVAA 5L3SB 5DYIA 3O47A 4MRPA 1EK0A 3J81k 1FW6A 4B3GA 4L4UA 1SXJD 2H18A 1CRPA 4XWAA 5TVKA 4OBEA 2BWJA 2ZJ5A 1LV7A 1NVWQ 1Z6AA 4PC3A 1BYIA 1FTSA 5J40A 1NY6A 1XPUA 3C5CA 1VYUA 2PZGA 3QY0A 4ESVA 3FB4A 1MRSA 4WVFA 3MWYW 3BFKA 1EFHA 1YJ5A 1UJ2A 4G5OA 1K6MA 3AP3A 4DCUA 2R8RA 4B6FA 1GL7A 1HY3A 4EAQA 3CF6R 4RD2A 2FF7A 4ASUA 3RSLA 2VSOA 3TVTA 4FMBB 4HDCA 3BE4A 2WICA 2AD5A 4D4KA 2J0VA 2CK3A 4E03A 1W5TA 2DHRA 2ZYTX 1T3HA 2QAGA 2AL7A 4DDUA 1TU4A 5DI9A 1H65A 4XOIA 3W8NA 2RHDA 4WZ6A 1E2JA 4LDJA 5IDVA 2C9OA 1Z08A 2QMHA 3K0SA 2VSXA 3B1YA 4PZLA 1G8FA 2IL1A 3K09C 4RCYA 4DC9A 2ZRIA 2FGKA 1VECA 3CKLA 1YZLA 1DAHA 3X1YA 1E4YA 1JXOA 1P9NA 1XTKA 3QKSB 4GT1A 2CEAA 4NDZA 2ZTSA 2GAOA 4HB4A 4K81B 3OEHD 1XMVA 1FP6A 2OCBA 1KHTA 2GDJA 4TLBA 3UG6A 5F98A 1P72A 2AX4A 1YRAA 4HLDA 5FBWB 3GD7A 3L0SA 4JVSB 4TMTA 4AURA 2J0SA 3SNHA 3WMEA 4R98A 3SBDA 4EJSC 2CLDX 3U7HB 2VSFA 1NJGA 4EDHA 1JXMA 2G88A 4LX0A 1TMKA 3PEYA 2IUUA 3RSOA 1ZIPA 2EFGA 1S1CA 4LOAA 4NYMQ 2FN4A 3DPUA 1ELOA 3GJ3A 4IJMA 2WHXA 5BWMA 5JJIA 3HWSA 5J5CA 4DSNA 4AD8A 1A2BA 4PR0A 1XJ0A 2FFBA 1KDOA 1E96A 5FOSA 2O8DB 3I32A 3GJXC 3QNUA 5P21A 3E70C 2GK7A 4B6EA 2ZI7A 4EPTA 3U6KA 1GL6A 1N6KA 3R9WA 4DHEA 3FMPB 1G4UR 1NIPA 1J7KA 1OYYA 3FYHA 4TTRA 3SQWA 4OQXA 3B5JA 1XEFA 2WSMA 1XXHE 3QKSA 4YXWA 1UFQA 3OFNA 2NO0A 1DAFA 4IEIA 2DPXA 2W0SA 3LW7A 2JLYA 2N42A 3ETLA 1LY1A 4NMMA 1W0KA 4D0GA 4Y0AA 2A5GA 1G16A 3W34A 4E09A 2Z6VA 3KKQA 4LYFA 2GBLA 2BVNA 4EFLA 2FPMA 1E2LA 2HF9A 4B2LA 5EXPA 3TIFA 2ZAMA 4DXAA 4V0MA 5JEEA 1KSFX 5CYPA 2GVDC 1CP2A 3AKEA 1G6OA 1KJZA 2DWOA 2V6IA 4HAUA 3QBTA 4W5HA 3W5IA 5KO2A 5EXXA 1P4SA 4KCGA 1TNDA 2A5YB 3QPWA 2FG5A 2ZUDA 1SQ5A 4Q47A 1FOEB 4OYHA 1XB2A 2DFTA 1KKMA 3OF5A 3VKHA 4IVQA 3P27A 2YWHA 3CPHA 4MUAA 4A82A 5JS7A 2CL7X 3CRMA 2VP6A 1QHNA 2CVHA 3CW2A 3I92A 3LFUA 2PCJA 2G77B 1KMHB 2Q6TA 3QJYA 1AQUA 2O8DA 1FUUA 5CIQA 5BXQC 1XPRA 2NO6A 1EXMA 1SKQA 3MG9A 4DDVA 2QT0A 2VIIA 1GNQA 2FEOA 3K0AB 4LRWA 2GEDA 3SBEA 2ERYA 5JS8A 2ZXUA 5CB8A 3AF1A 3K0CC 4M8NE 1PLLA 1LS6A 2GWHA 1N6RA 2QSZA 1DG1G 1YZQA 1W44A 3B1XA 621PA 2AD1A 3B1ZA 2WKQA 5J4HA 4BFSA 2F3RA 1OB2A 3PR1A 4RCZA 4BZQA 2NG1A 1F5NA 4M9ZA 1F60A 3SN6A 4DLSA 4JL6A 1N0VC 2ZI9A 4BFZA 3K9LA 1XPOA 4R2IA 4PC6A 1EX7A 1T5LA 1OIVA 4GBMA 4NONA 1LTQA 4TQ9A 2ZRGA 3KQNA 3LQQA 1ODFA 2OFOA 2ZJAA 1VIYA 1FP7A 3TLXA 4P4SB 3AUYA 1IQPA 1QDEA 4M4SA 2J9RA 1F3OA 2RGGA 2WMOB 2H57A 4RY2A 2IUTA 1W2GA 2XJ4A 2YYZA 3F8TA 3M6AA 3EA5A 3M1IA 4FI3C 1I2DA 1IONA 1M1YE 4M9QA 3ADDA 3GEEA 1KMHA 1N2CE 1E1RD 1KAOA 4XVQA 3KFVA 2ZUBA 2JEOA 3GEHA 3KQUA
chains in the Genus database with same CATH superfamily
4MRVA 5FNVA 3V3TA 4Q24A 1E3WB 1VPLA 4BMVA 2IS6A 5A6SB 3FYTA 1XVAA 3T7DA 5G3ZA 1W7AA 1NIJA 3K1AB 3PXUA 2R65A 1TFRA 3CXUA 1W5BA 4Y2VA 3N58A 2HA2A 1ZG3A 4MQFA 2BKLA 3GUUA 4JVMA 3ETJA 4HYTA 1LSJA 1UM8A 2NUPB 3CA8A 3LVRE 4M1WA 1ZPDA 4XPIA 4YH1A 1LEHA 3KU1A 4IPTA 1PGOA 4IQ8A 1E8DA 2Y76A 3P97A 1KZGB 4KN8A 5JASA 1LFDB 3U48A 3JQDA 2IYRA 4MQ5A 4Z1OA 3CU5A 4US0R 1YDWA 3VUEA 2DKFA 2VAMA 2WTNA 3F0TA 1M8GA 1A71A 2M9MA 4Y2GA 2FPWA 4TMXA 5AM0A 3EZFA 2I6XA 2VJNA 4XX1A 2FUKA 2ORYA 1YVDA 5ECGC 2CVFA 3WWPA 3G0HA 1J06A 3AHGA 3LK7A 3OT5A 4ENTA 3VV2A 4QTYA 4EABA 1BMFD 4EO7A 4ZIRB 1UK7A 4E5MA 5GINE 4BAGA 1DO8A 1NF2A 2FRVA 4RZIA 5JI3E 1NUHA 4DUGD 2H0QA 4RH3A 3OECA 1Z7EA 5GV7A 2IEDA 4KFUA 1I36A 4RZ2A 2WSYB 3WL5A 2Y9MB 1MV8A 4W1SA 4DKXA 1HDCA 5KX5B 3H2YA 3IJEB 4GVLA 421PA 1Q0QA 3W3AH 2B21A 3H6GA 5CDFA 3VRHA 4X6LA 1A5TA 1HG1A 5DNDA 2AZMA 3RH0A 4NAUA 1FRQA 1IH8A 4W9RA 1ZHFA 4R3WA 4C7VA 1XZAA 1GLGA 2VNJA 3DYIA 2ZRAA 4RDXA 3S44A 5FTJA 3RTGA 4I9HA 4RK7A 4QJ5A 2EYUA 4NEGA 5DBOA 2Z83A 1JF8A 1Z12A 2FSUA 4MQEB 1KYVA 3N75A 3JWGA 2R5NA 4JZKA 1KSHA 2O5EA 4AG6A 5I6DA 5BW8A 1VXOA 5D6NA 1N4DA 2JCSA 1R66A 2WYVA 1DJPA 4GYJA 2NYAA 5CFPA 3HRHA 1CC1S 1RKVA 3TW8B 2BFMA 1RKUA 1WV1A 2H2HA 4L0QA 5ALLA 3N0VA 3PHJA 4NZNA 5JZOA 1GPBA 1CJUC 821PA 3VZDA 1U3GA 2ENUA 3CNEA 3TD6A 4DB2A 2P2ZA 2RKBA 1M7GA 4K9DA 4RKRA 1X3LA 2BTEA 4OY3A 1W6RA 3HUDA 1GV0A 1QHXA 5KWJA 3KQSA 2OP1A 2UDPA 4L5BA 2WMYA 4RSGA 3ZE1B 4D4IA 4ZTZB 1XYYA 5FWYA 1I2AA 1RI5A 4NIMA 4PCUA 1P31A 5JJLA 1YHZA 1DINA 1R8YA 5I7OA 1II8B 3TG2A 4C29A 3GGGA 2CSXA 3KVOA 1SBCA 1Z28A 2BYTA 1EHCA 2CXHA 3MFYA 1KYXA 1JFRA 1UOOA 4JK3A 4MP6A 2XUZA 2GYWA 3ZYCA 1A5ZA 1FRFS 3S1LA 1D03A 3FRIA 3GLHA 3H04A 3K0BA 3PP8A 4LTDA 3RAEC 4IZHA 4DCPA 3TX2A 1IEXA 2IC5A 4B44A 3T7TA 1ZZEA 2W8ZA 3WLHA 3NRCA 4CUZA 4GRAA 1WCIB 5A03A 4S2EA 1UZAA 2FDCA 3BCHA 1QANA 5C0OE 3GEBA 4FOTA 3L1JA 4N5HX 4UCWA 2XSZD 1W36C 4E4RA 3U4QA 1MB0A 2N1MA 3BDVA 4JAVC 1FPQA 3WGIA 5KYKA 2Q3LA 3O1IC 1ISPA 1J2JA 3K5IA 2ASVA 2UZ1B 2YVQA 3JRNA 2QI9F 3A6GA 4ARIA 2XX3A 4W1PA 2C07A 2J9ZB 3B38A 3F7MA 4N3AA 4A8TA 4CLHA 4KQWA 4F04A 5JCOA 2B34A 2ATXA 4NLLA 7AT1A 2HA4A 1ZVJA 3JWIA 3GMIA 1AGRA 4NF2A 1G64A 1PQUA 4M0FA 4FZRA 5DLEA 1GPKA 5ICCA 4CFSA 1Q44A 4C3ZA 3IELA 4HVAA 4MR9A 1L5GB 4NU8X 1EFRA 1WPGA 4YCCA 1QLWA 4C0WA 1BS9A 1M6NA 2OO5C 3TIXB 3QPVA 2KLBA 3T61A 3Q7TA 1N2SA 3GNLA 2Q4DA 4E6EA 4LHZA 4KK4A 4RK1A 3SFTA 4HQOA 3UGQA 2MSCB 1DI0A 4D9GA 3BH0A 4S05A 2V3CC 3LC0A 1S2NA 4F45A 3RU3A 2G1UA 1DOHA 1BCSA 1VDZA 1VJRA 3UM9A 2H1IA 3LA6A 5TS2A 1R0CA 1XQ1A 4MI3A 1W49A 1CVLA 3GLSA 3GRAA 4L0CA 2B4AA 1GUFA 1V3TA 3EXEA 4LNAA 3DE2X 4OK5A 3IDSA 3E22B 3WBKA 4E1VA 5KTTA 3TOZA 3H2ZA 3PPXA 5F98A 3ES9A 3ZVNA 1D4AA 3B3AA 3FGOA 4JC5A 3PIRA 2Q50A 3E0XA 1L7MA 1VBNA 3K53A 3LCRA 5D84A 4O02B 2G9QA 3RTAA 3AFMA 1HO3A 2KBFA 3TTTA 5B58C 5KTSA 2Q5LA 2YJ5A 3H84A 4NYMR 3SP1A 1W2HA 3EY9A 3FNIA 1Y9JA 3QUQA 4MXDA 1BQ4A 2WJIA 3SZMA 3ZGOA 4BKOA 1N92A 1IBLB 1DRUA 3A2NA 2BIFA 3LO5A 2XOXA 5THXA 2WIGA 3PC2A 4ID3A 5KTPA 1WPXA 5IJ0A 2BGKA 3K9WA 3AT1A 3U4DA 1PZXA 1JIKA 3G13A 3TYXA 3ZS8A 4DRXA 1NBWB 5D00A 3W5BA 1K08A 5TGZA 2PX0A 2Q3CA 4MYRA 2BFCA 3G0BA 5AJWA 3T35A 4F0JA 1I1QB 3F6PA 3HVIA 2WK1A 2VUIB 1F5SA 1JDBB 4WLOA 3TDNA 4AJLA 2XTNA 3AERA 1QAMA 2HK6A 3IP3A 4IINA 4OBXA 5DN9A 5IAEA 5A9SB 5MN4A 3V9AA 5LN1A 2ZETA 2MSEB 5EE1A 3U3DA 1MLDA 1V9LA 3ZIAA 1XAIA 1QTRA 4J6FA 3BGOS 4EGQA 3C43A 3NIBA 4BE7B 3WAGA 1JAYA 3QK7A 2P30A 4N3GA 1T5BA 3TIGA 1M5UA 3T38A 2NZ2A 2WB2A 4CLRA 3ZWDA 4CU2A 1YUBA 1DCFA 2OXRA 4ZREA 4PQGA 1W25A 2QIOA 2Z5FA 3OZAA 4N6GA 2VA9A 3WK5A 5AUQA 4YDRA 2P4QA 5EHZA 2H16A 5A4IS 2AQKA 4LBZA 5DT2A 6ADHA 4JFAA 1MC4A 2NO4A 3IC5A 4KWCA 2G83A 2ZDGA 1OLXA 4G5RA 3TB6A 5F35A 1Z0ZA 4O3MA 5E0OA 1AZWA 3LBHA 4R68A 1SXIA 2VT7A 5DXAA 2QJWA 1N5OX 3GV0A 4RKQA 1RADA 1DRKA 5I5GA 4AJ2A 1PJAA 2X3YA 2W2TA 1H22A 2HIHA 1R0YA 3TTSA 3OI7A 5DE3A 1FFBA 4G4GA 3DL0A 2AEJA 4ZI3A 3FFTA 1EXVA 2IPOA 4EJ6A 4YRSA 4RVDA 3F7NA 2IU0A 1NV9A 2X0EA 4EY4A 3OIFA 3E3MA 3ZBTA 1KAEA 1A98A 2I2DA 4X61A 4O0MA 5H02A 4XYMA 2C4TA 4NZMA 5K0GA 3R7DA 4TV9F 4XARA 1WLYA 4J0EA 2QBYB 1C4XA 1OZGA 2PAAA 1QGUB 3BJIC 3F8WA 3W7BA 4CKEB 4YRZA 3VISA 2OGWA 1C1HA 3MTJA 4CT5A 3KYCA 3CRNA 1IQ0A 3CN7A 1Q15A 2PWPA 1GQOA 3P0FA 3MD9A 4KXXA 1HL3A 3C5EA 5T8KA 4BNTA 1JPUA 4BMDA 4AULA 1QU3A 3N05A 2C9MA 2X0DA 3DUFA 3IP1A 4PTZA 1WV0A 3MCWA 2QM7A 4BC1A 3RRYA 3IYLW 5CLIA 4KITB 1RU3A 1DAEA 1PWXA 2JGFA 3CE6A 4MJXA 2KMLA 4ZANA 4R69A 2XDQB 4DE5A 1Z5NA 1QYWA 2WUVA 5BN4B 4II7A 4C4ZA 1TUEA 3WGGA 1Q3HA 5CAEB 4KPGA 3QKRA 1PJ4A 3L46A 3RK0A 1YB5A 2J3DA 3P5BA 1XRQA 4TYQA 4UCFA 4UDXX 1VIAA 4NZ9A 4UAGA 3KTDA 2FUG6 4IYRA 2Z3WA 2VZ0A 4J0GA 4N65A 4RHXA 3ESRA 3GIDA 1CJCA 1IQUA 2BISA 2Z58A 4HI0E 4OLHA 5GWXA 4BKRA 2PK3A 5JPDA 1RYZA 2PX2A 3COVA 1BKYA 3D3WB 2HJWA 3L1VA 4QVGA 1KI1A 1ZD2P 2P90A 3L40A 4GEKA 4QLAA 1CFJA 1UQRA 2IYAA 5DHPA 1U7WA 3W6ZA 4CQMA 4TZ6A 2C8VA 2FQQA 2DR0A 2WDZA 1UPXA 3KVVA 3NFYA 1R88A 4B0OA 1EFCA 1FNDA 4CN9A 4EKEA 5ITSA 1MPTA 4MRNA 4GOND 5LL6P 4DA8A 4ALNA 4B6RA 3JVEA 1QK5A 1R10A 5DTMA 2EC5A 2W2OA 2W11A 4KO1S 4GI1A 1PZEA 1BFUA 3KQVA 3EVCA 3GLIA 4PHGA 1FSFA 3DH0A 1ENOA 1P91A 4UEQA 3SXJA 1VG1A 1T2FA 1ZHOA 2QENA 4C2TA 1H2FA 1ZNWA 1FCJA 3JQRA 4H08A 3L8EA 3UW1A 3W5CA 1ZOOA 2BONA 3A4MA 2GD2A 5IC6A 3HYCA 1WDTA 4IMPA 4OSOA 4MQUA 1YR1A 2OYCA 1UM9B 3WGNA 5E1MA 2V9PA 1O6BA 3EN0A 4HQRA 4Q34A 1JR3D 1WUIS 2C2OA 5H16A 4FFBA 4DR6B 3M9WA 5G53C 4N8DA 3ZU3A 5C52B 4CM3A 1IHYA 3T5DA 1GAWA 2WUFA 4V24A 3JQGB 1P0FA 3EW7A 4BVLA 4RK0A 2IT1A 1NHGA 4E70A 1Z4MA 4G1EB 3UTCA 3HN2A 4I4TB 4GYYA 5DNYB 1TYZA 3PFWO 4ESHA 2P9HA 1BX3A 1LF0A 3CJTA 3C8ZA 2Z9CA 5E1OA 1DMRA 7YASA 1BRTA 1Q14A 3FGPA 2GJKA 4JQCA 4OM7A 4UQOA 1C1XB 2F3SA 3ISJA 2O2SA 3R75A 3DC7A 1EA5A 5ALUA 6NULA 2GTIA 1XWIA 3EGOA 4C4YA 1SC3A 5DN6D 4CM9A 4QATA 4GP9A 1JLLB 2P3SA 2ZKLA 4G0NA 1SOUA 1OA1A 3O1LA 4A5SA 4YRMA 3MTEA 2QD4A 3CF4G 3FXAA 5BURA 3N0TA 4BQOA 5IP5A 5K1ZA 1DS6A 2Q8PA 2PXAA 3GA0A 3R7SA 1UH5A 2J48A 4P34A 4BX8A 1JDVA 3NJRA 2XNDD 3UHJA 3VVBA 4RLQA 4BZPA 4HDAA 3R44A 2OYRA 1B0PA 1OF1A 4FWTA 4KRXA 3IJ5A 5I4IA 4CM1A 3JQFC 1AKQA 2YFHA 3T9AA 3KDAA 3LU1A 5KB3A 3V4SA 3CBQA 4DYHA 2CLHB 1ADFA 3D6HA 4H31A 2QIPA 4LDNA 5J23A 2AA3A 4FDTA 3S2UA 2WVGA 3A11A 5H83A 3FFXA 2VEOA 2W6CX 4H16A 4KGXA 2W6ID 3B52X 4YLEA 2Q99A 4HDNA 5IBQA 1RCFA 4IS2A 1UT5A 1QWOA 1R12A 2OEPA 4FE4A 4K3UA 5JLJA 5F2KA 2DT5A 3M33A 2H92A 1LDYA 1P19A 3HGMA 2OVFA 4J0HA 4MUXA 3V2HA 3KOOA 1CTQA 2WV7A 4RETA 3JYQA 3CO5A 2G0TA 1GEGA 4HEQA 1YB7A 1G0NA 3KEOA 4YPVA 2PJDA 3PLNA 3DR3A 4Q1FA 2ZWIA 3QU2A 4MRRA 1W4RA 1COWA 5FYQA 2IV3A 4DJAA 3UGJA 1Z2OX 4KKVA 2VG8A 3KEQA 1THGA 1AUXA 2O14A 3I8OA 1D4OA 4OU5A 5B1SA 4B8ZA 1INLA 1X42A 5JSZA 3H8JA 1KAGA 2VT3A 4O59O 1Q1AA 2XYHA 3AXTA 2YZ2A 3QNWA 3OQIA 1NW7A 4Y2QA 4M1SA 5FL7D 3HFGA 3GMDA 3VU9A 1T0JB 3L4EA 2BFOA 4OUDA 3NXKA 3U4GA 3ONDA 2YNMD 3T5MA 4CIVA 2DBVO 3II6X 1KWKA 3ZIUA 2J45A 5EHXA 1P81A 3QLUA 3CX6A 5AKZA 1A8QA 4KKXB 1MB2A 3C15C 1AXGA 1N77A 1PGPA 3PQ5A 5J63A 4UBJA 4AZSA 4XD2A 1M2EA 4PM4A 4CR8A 1E18A 4P0PB 2DM6A 4BRZA 4YUYA 1U98A 1V5GA 2PKWA 1RYDA 3GDGA 2H3EA 3DP7A 3HA2A 2IY8A 4U3JB 5AKXA 5FNZA 3FHTA 1Z4JA 3WA6A 1I6MA 4RTQA 3A31A 1FQWA 1SBHA 3SLRA 2BL4A 2A88A 2PUWA 3P9KA 2N1BA 4BLPA 5AW7A 1GPUA 2HPHA 3FYUB 3NC4A 2DPYA 2OT3B 2HT1A 3EXG1 2FWNA 3FDXA 3GWZA 1WMSA 3FNEA 4MKIA 2OQRA 4RLSA 4BWGA 3IQEA 3ICEA 4KLZA 4XDZA 1L2TA 4KXNA 4O6VA 2HK7A 2CLOB 3C1UA 5IT5A 2BDEA 4TYNA 2GZ3A 5GZ6A 3TGLA 2CWWA 4IH1A 2I6SA 3CEHA 3DHWC 5TC4A 4LJYA 3QE4A 3DV2A 4IVRA 2K87A 3CNQS 5JTTA 1Y33E 4FCWA 4DF3A 3GDHA 2F1HA 3SJAA 4A0FA 2P5TB 3HVKA 2GXQA 2HUNA 2O8VA 2HWXA 1B3BA 3W9YA 1YIOA 4D56A 1N5LA 5I7RA 2EZ8A 1MZVA 3RD5A 4ONEA 4PNEA 2Q0XA 3IB3A 1WMFA 1VCNA 3NBFA 2E5LB 1EWQA 5JMPA 3K71B 4HNRA 4JY7A 4QUDA 1TKRA 2AG0A 2G1AA 1E1MA 4JP8A 3OT1B 2WWXA 4IFTA 2VL7A 4PZUA 3TEJA 1ZM9A 3ABRB 3HS3A 4FEEA 1W96A 4OJNA 4WEQA 2F8TA 4YECA 3NONA 5E95A 1KKLA 3HB0A 3SR3A 1ICEA 4M1OA 3QFSA 2EGHA 5IJZA 4R0MA 4LISA 4PHCA 4CRWB 4R2JA 4E7OA 4CCYA 1JQJC 1E92A 2QRHA 2AN1A 4PPGA 4XB6B 4Y1FA 3UK0A 5ES4B 2Y1LA 5A9TA 3U9LA 4MKFA 5C32A 2IHYA 3EIXA 3OX3A 5H8WA 4X9XA 5FTMA 4MS1B 5BORA 3FBTA 1GO2A 2PD6A 4F5ZA 3GWGA 2WSSD 3USCS 3L41A 1ECGA 3LUJA 2FPLA 4Y1EA 1XZDA 2BI4A 2I2XB 3JU3A 1CJMA 3NEPX 4NH4A 5HWSA 4RTMA 4C2UA 3A6HA 3Q5GA 2RB4A 4Z1MA 3UK6A 5KNBD 2AR0A 2VBCA 2BEUB 4ZRNA 2CD7A 1ISRA 1LPSA 2HSWA 3WB1A 4JR0A 1KSJA 1YHNA 1K63A 5FCDA 2PKYX 2WHPA 4X8MA 4YR9A 4W9NA 1E2UA 2E49A 2P3LA 3FR7A 3AHIA 2XGOA 1QFZA 2ODNA 1HE1C 4FGZA 1VL5A 1L5SA 1B2LA 3RW9A 1B76A 3DM5A 3G2NA 2BOVA 1D09A 3EHEA 3UMGA 7REQB 3X1ZA 5F78A 1UKBA 2FSSA 4TMWA 4QLOA 1IG0A 1SZPA 4J0IA 1YL5A 5ALJA 1NJ5A 2BGJA 1A9XB 4PG5A 3C6ZA 3VR5A 2ANBA 5D8DA 1DKOA 1SC1A 3SU8A 2FQXA 4FW9A 1MXHA 4I5DA 4GSLA 2BMAA 3B53X 2GOYA 1KY3A 3PQCA 5JDIC 1YKFA 4XD7A 2LVBA 3CW8X 1WQ1R 2J33A 2XQGA 3F47A 2GEFA 4KR7A 2X9VA 1S2LA 1Y5NA 1WSAA 1NM5C 1QAQA 1QFJA 1K7CA 3H5NA 2VDJA 4DVJA 2R62A 2JCVA 5BVHB 3G02A 1O6FA 4JC4A 2QL6A 1E7YA 5A3QA 2JIDA 2WTEA 3LCCA 2BCJQ 3V8QA 1MRNA 2GYUA 4Q66C 3ZWBA 4PPNA 1I14A 4C14A 3S40A 4EGFA 3C7CB 4A73A 5L53A 2F8SA 3JYHA 4G5FA 1YJQA 5K3FB 4B40A 3IVAA 4I3HA 1ECCA 4G1UC 4YJHB 1ZH2A 4M60A 2BUCA 1E4EB 4LS3A 4NCBA 2HFKA 4GZ3A 5EIEA 3RUPA 1IC6A 1LK7A 2AMLA 2F48A 2OFWA 3OPYI 2NU8B 4EHFA 1TVKB 1Y7IA 4NBKA 2EIXA 1TM7E 3L8ZA 1G21B 2HD4A 3E5NA 5BOSA 3X44A 2FVYA 1UR5A 4KO2S 1CLUA 1SB8A 2PFSA 2DU8A 2RHMA 4KQFA 2V8OA 1I2ZA 4QXMA 5JPCA 2Y1KA 3QE0A 1M9NA 3L92A 2RONA 3R4CA 1Z74A 3GRVA 1NP3A 3L01A 3U09A 3OQMA 3F96A 4LDPA 1R0KA 4S1PA 2GNOA 4CCAA 4QPPA 1NU8A 2CKDA 1UPBA 2BFBA 3I12A 3LYUA 1NI4A 2J3IA 1UBGA 3OZRA 1OBCA 3LLVA 4RD0A 5KPDA 2IHNA 1L1RA 1C0EA 2R6CA 3MRTA 5L3RA 4S0ZA 4JLNA 1RFLA 3D7LA 4AYWA 3PKZA 2YV2A 4QYXA 3FIUA 4NY1A 4UHFA 5FFMA 1XKTA 3EOAI 5FUYA 4MMYB 3H3FA 3NG1A 5EIXA 2J67A 2G80A 2O8BB 1CRWG 1PUXA 3TLZA 4ENSA 1CUXA 1EFKA 2A1TR 2QP3A 4TYPA 4AJIA 5LWHA 1Q3KA 2Y4NA 1YJAA 3JRWA 3TBHA 1PJQA 3L49A 4H7EA 4P4NA 4BNUA 4CCSA 4GBJA 1DRWA 2HSZA 2F1RA 2A58A 1HA3A 2ZWOA 2YYSA 2GYVA 5ITZB 1JR2A 2NLOA 2I6QA 2VAPA 3KB6A 4UHDA 1CT9A 3KUXA 4CIDA 2O19A 1GL3A 2FX3A 2P67A 2QRVB 4CMEC 1A9ZA 3ACDA 5G40A 1V1JA 3AI1A 3P2OA 5BWBA 4QRDA 3WDMA 1A7UA 5A06A 5JCJD 4BB9A 4KV9A 4UQLA 1MO5A 4WLNA 4QAJA 2PT6A 3BZBA 5G4KB 5LBUA 3Q3JB 1O87A 2XTMA 2ZT6A 2CF6A 1HNZB 4GX5A 5IXYA 1US8B 2OHFA 1RAIA 1K5GA 3N5CA 3GPLA 3RNLA 1XUOA 1LU9A 3WOHA 3OZTA 4KSCA 4RA9A 5HIIA 3TZLA 1OKKA 4YV2A 1U2SA 4HUTA 1QTIA 3CCCA 4AZWA 1SXJA 1XJQA 2ZB8A 3MWDA 4XRGA 2O59A 1T2AA 3M82A 3AIKA 2LR0A 3G2QA 4HN9A 2P8JA 4JS0A 4MP3A 1RMQA 2IGBA 4PNPA 4YRAA 1DKLA 3QX3A 1IULA 3H4MA 3EWAA 2Q41A 3UYKA 1ZM7A 3GN1A 2C8KA 2O3UA 3KD2A 3RVDA 5LZ4A 4JL5A 3EQZA 4M1YA 1QG4A 1CY1A 1KVSA 4S1NA 3NT2A 5BUQA 4GL2A 4DCVA 2ISSD 2Q6KA 3G9ZA 3L6BA 1BC5A 3PV0A 3PFKA 4FHDA 5A0TA 4ON9A 1BS2A 3HP1A 2WDPA 1KRXA 3DCJA 1UWVA 3PXXA 4L4RA 4MS3A 5B36A 4Q18A 3ZWQA 5JNUA 1GTSA 1ZOSA 1M2VA 4GPAA 4K6FA 2QRNA 4FK8A 1KFBB 2CDBA 3B20A 1IZ0A 5I9NA 5LVAA 1ZJJA 4UHKA 1DTEA 2VQSA 2X2FA 1EFVA 1U0HC 1EUCB 5DNUA 4Q4JA 3RJ9A 3EIOA 2J07A 2K7ZA 3QTLA 3TPZA 1NQ5A 4I1OA 3UOAB 5GONA 3PQEA 1NVGA 3VZSA 1FFXA 2OHIA 2A7XA 4NYJQ 1YRHA 2XA1A 3KELA 4JLPA 2XF8A 5CXSA 2DR3A 3WBJA 2UYCA 1TT5A 2XDWA 3ZWVA 1JBEA 1JZTA 4LQLA 4AZ3A 2FCRA 3A0UA 2GR9A 2DWUA 2A9JA 2R7MA 5H82A 5L95A 1N5KA 3DBHA 1KXJA 1L8LA 1QZXA 5DTJA 3O9MA 3WYBA 4KQ1A 2QLTA 4BMNA 2WTXA 3RSHA 1J23A 3MGGA 1FNMA 4LOLA 3F6BX 2IDKA 4KAAA 2HA7A 5C81A 4YUXA 1NONA 4QXPA 4B71A 3Q41A 2HRZA 3UB4A 2J3HA 2K5UA 1YR8A 3ZY6A 2I4MA 3W0LB 1N3YA 1KRHA 3B9PA 1E4VA 4XLZA 3QXSA 2FB9A 4H6VA 1P6UA 1PX0A 1Y5MA 1UOPA 2GO7A 2O8NA 3R5HA 4EELA 1F7UA 3UKDA 4RJLA 1P61B 3IV9A 3PC4A 1SA0B 5DP2A 3TEMA 4AK9A 2NT3A 2OPHA 1X7XB 2G9RA 4UM9B 1RRFA 1TEXA 3WGMA 4E2YA 1AKNA 1T4BA 1Z7YA 2HHLA 2WYUA 4Q7LA 3TUZC 3TNFA 2FX5A 2HFJA 1W4AA 3ZE0B 2YWJA 1X8XA 4GI7A 1NOJA 4UM5A 3V8VA 5INTA 3DOJA 1PQ4A 3G85A 2FSVA 2C2MA 1PGQA 2X8JA 1YNSA 4PQRA 1MV5A 2OB2A 3DMTA 1QB7A 3DONA 4ZAXA 4IWYA 3LKBA 4LXTA 4MJ7A 3TOSA 8OHMA 4RMHA 4KR3A 4II2A 1M0EA 1AS3A 2EKPA 4LZZA 4ZDIA 2E48A 5MHTA 3GBVA 4M1KA 3IO3A 3DAFA 2Z8XA 3UATA 3VUFA 1XI2A 6PFKA 1GG2A 4BKPA 5C51B 2Q1SA 3IVGA 1U94A 1AKWA 4JYAB 4S1TA 5FL3A 3UVEA 3LYAA 1R5BA 4TMZA 4UFPA 3RWOA 2GAFA 4H0FA 1G60A 2IZ1A 4R9NA 1ZD5A 5BR1A 2PRZA 3K1TA 3T5AA 1RXVA 2RGRA 1X77A 3JVDA 3BL6A 5IDYA 1E9CA 1HDIA 1L3IA 1GRVA 4LJ7A 1JS1X 1TIBA 3RODA 4ZCTA 4YHBA 3LPNA 1PYGA 4NBVA 5C37A 5LLSA 2HREA 4JNKA 2NM0A 1T0IA 4ZQCB 1CD5A 1N2OA 1QX4A 1C7ZA 1Z6ZA 3IQIX 2QRKA 1GPH1 4BGVA 2WT4A 4UVDA 2X9NA 1ICIA 3DZBA 5ALMA 4HDRB 5AHRA 5GJCA 3UA3A 1YU9A 2J6CA 4D9FA 1IFXA 5E8RA 1NXTA 3BXZA 2W2MA 5JS2A 1O95A 4G6ZA 1KFJB 1TUBB 4WOKA 4A6EA 5DM4A 1T4MA 2I7CA 4NAHA 2A30A 4O2BB 3MBOA 3RI3A 1SC6A 3O8QA 2OK8A 4KWIA 1NMYA 3I2YX 1KYYA 2FFRA 2ZE5A 3FCXA 3DGEC 5AKKA 3WIOA 1QV7A 2XA2A 3OTWA 2JEZA 3GG2A 3E53A 3WLTA 4A6XA 5H9WA 1IXKA 5EHIA 2OESA 3A7DA 4UUBA 5BSTA 1ZC3A 1XRSB 4BJ1A 2CD9A 1UPFA 3F3YA 4MROA 2H1LA 2Q9AA 1MQ9A 3CF2A 1NQVA 2DSNA 1RE1A 1B3RA 2AHOA 2WZCA 4DY6A 1O94D 1QP0A 4EHDA 3A6FA 1NUAA 1OMOA 2FE4A 3I2JA 2JFZA 3WHIA 1M74A 1IY2A 1G59A 2K6GA 4YC7A 2PX3A 4R8RA 1AUVA 1BHSA 2E4VA 4AJ9A 2PMDA 1XZBA 3THWA 3DF9A 1IM5A 1ZEMA 4RKEA 1E7SA 4Y9DA 1PE0A 4AJPA 4G0UA 1HNWB 1Z2PX 2Q2NA 1LBIA 5ALQA 3DMHA 2XYRA 3PUWA 4RHYA 5AI9A 2H5IA 2A4MA 2RHJA 2ZJ6A 5GM1A 3HCPA 2YV4A 2FFQA 1H2EA 3L4BA 4HN4B 4O63O 1LJUA 4IILA 3U19A 4ARVA 4MINA 4I5GA 1NRXA 1E1RA 3RSZA 3GLGB 4PYMA 1DCTA 3U0VA 5CB4A 9ATCA 2VXCA 3C3DA 1ZFNA 3EDMA 2ZREA 1WMEA 2SKDA 4MGHA 2B3TA 1QQBA 3T41A 1IM8A 1E32A 2H51A 1L4KA 2D0OB 4AF7A 2C78A 4RFSB 5TF4A 3TQRA 4QECA 1VBFA 1W0JD 3SQDA 3M3HA 4WKNA 1IY9A 3KHSA 5ED0A 3ABQB 1SG0A 4KO4S 4Q15A 3RVPA 1UK8A 1E2FA 2VHVA 2WU0A 4MUGA 4A27A 1C0LA 1VKNA 2GEUA 3LQ1A 1VQ1A 4G07A 5EEGA 3PTZA 3U31A 1JDUA 3BBLA 2EKQA 3M89A 2ZCUA 4QYWA 4GWKA 2CNWA 3VR1A 5HTOA 2PHZA 3T3HA 2NTJA 4D0SA 1SD5A 5C18A 4TV8A 4IUYA 1OJLA 4FFWA 5ALPA 1TLTA 4HUQA 4ZK2A 1SU4A 3I5XA 1ISSA 1JLSA 4I81A 5AJHA 2VJDA 4KG7A 2ZLBA 1G8SA 2XQIA 5IC5A 5G41A 3O2QB 3ICPA 4RXUA 1XEAA 2VXOA 1WW8A 5F2OA 3NH9A 3AF6A 2W2LA 4BCDA 3Q85A 1ABEA 1M34A 1FL9A 1TI7A 4P5PA 4DS3A 1IPEA 1QHGA 3LQYA 5A9RA 3L8CA 3OZVA 2C61A 1Y8RB 1HURA 3VC7A 5T64A 1DT3A 4FMDB 5K3SA 3IILA 3WI7A 4QUEA 2J3JA 3JPYA 1IN1A 1E1LA 4D8YA 2QN6A 3R3SA 5BQFA 3G59A 2XR1A 2GPTA 1KY5A 3OLXA 3N2LA 4JT4A 4Z0HO 1EM8B 1PJ2A 4Y1GA 2HV9A 4L5IA 3JY6A 4NOKA 1HMPA 5CFRA 1R5JA 1AUPA 4FQ7A 1DLIA 4Y2RA 3P9YA 4UTRA 5CEEA 1O6ZA 3T5PA 3HLYA 2HAEA 3ELYA 4IFEA 1AJEA 4UDNA 2AJCA 4BIIA 1RYMA 3TXAA 2QTFA 1A5AB 5ECYA 2O5CA 3FB1A 1SZJG 1WHTA 2AOUA 2PFKA 3WLAA 1X8KA 2ZR7A 3KXIA 4WZAA 5LLTA 1UZMA 3UXHA 3WBFA 2WINI 5T3UA 2Q46A 2XUPA 3HJHA 1ZITA 1WQ3A 3CG4A 3E4DA 3L0IB 4TMVA 3ZE8A 3B51X 2FPPA 4AC9A 10MHA 4U7HA 3I8XA 4KO8A 2IEAA 5F2NA 1UPUA 2JI9A 1M6VA 5JH7F 1XLTC 1BHJA 3EX7C 2RHGB 1FXWA 3ORYA 1V45E 1P62B 5HIJA 5I7AA 4DT1A 4GNKA 4JR2A 3WYAA 3L7OA 1I1OA 1R3UA 2HY7A 2GCIA 2W6OA 1MC5A 3FKQA 3IRUA 1DPFA 3NW9A 4HYYA 4QUIA 1FDTA 2PS1A 2QT1A 1FNSA 4DWJA 2NADA 3SZOA 2I1VB 4EKYA 1R3DA 1YZGA 5EZ5A 1X19A 3H4VA 2FSIA 3R9IA 4RORA 4B3SB 5JH7A 1E3LA 1C0PA 1KZ9A 2AUNA 3LLMA 1PSWA 4BLVA 4F92B 4LWZA 3EVNA 4TSFA 2X8WA 1VBMA 4DTIA 1D2NA 1KNQA 3RQIA 1Z2DA 3I9FA 4QU8A 1RLMA 1A4XA 1SOAA 1VSQA 1FFDA 2QTNA 2UAGA 1YRLA 3BHJA 1ZYUA 3KUDA 4Q7JB 2WWTA 1G7TA 1O8BA 3VU3A 2VPZA 2P65A 3M0EA 1TW2A 4GLJA 4PX3A 4H1TA 2HCTA 3DYVA 2GXSA 3LBYA 2E5WA 3BSFA 1WP4A 2FDRA 2A9OA 2JGRA 2ZFUA 4YCJA 1J7JA 2JIPA 3G0OA 2C99A 1NI3A 4XB1A 3SHTA 1CEEA 2GHIA 4AX4A 4CMJA 3E9ZA 2QRMA 1ZWLA 5CT4A 1DP4A 4Q12A 3ETGA 2Q3DA 1F20A 1X1RA 3B6ZA 4IVPA 3WLOA 5LQNA 5CEFA 3ANSA 1F1JA 2XT0A 3ANNA 4NU5A 1W1IA 3ECCA 4TLLB 3O4HA 3VDXA 2XCSB 4K28A 4J2TA 3ETHA 4IDNA 1FU8A 4HLUA 1YJ8A 1JKMA 1NG1A 4Y8VA 5F5XA 2XTZA 5CT9A 1N32B 2Z6UA 2W8BB 2HPVA 2P6PA 4KXYA 3GZJA 1FSZA 2ASEA 3NATA 1BGVA 2AT1A 1GNVA 4ZOEA 3DBVO 3EK2A 3R3ZA 4IJKA 4NYJR 3G9XA 4TKLA 4WECA 5KI6A 3TUIC 2KQUA 4JUAA 2HA0A 4YRFA 2O2IA 5ALXA 1BE1A 4L02A 4D0LB 1YZYA 3DWIA 1AKUA 2HRRA 3UGTA 3AR9A 2PV7A 1T9DA 2C2GA 2HMWA 3DVRX 1CHDA 3JX9A 3OFKA 3QVGA 1JG6A 1YE5A 4YR7A 3ZCTA 5FPHA 1YCDA 4J90A 3H3XA 4RJJA 3EC2A 4R1UA 3LF2A 4UNSA 2O52A 4YCLA 3U26A 3HJFA 1E0AA 3U5ZB 2DQZA 1ZNZA 4BP3A 3HCOA 3C4JA 3OU7A 1MIOA 4G4JA 3V4LA 4G5QA 3O91A 3OOYA 3N86A 3R5TA 1W9HA 1YCGA 2H1FA 4J76A 4NFLA 4JJ8A 3M6XA 4MEAA 3M81A 3T7AA 3CZCA 5IBRA 4UAJA 3L5OA 2IZ0A 2BGLA 3M4ZA 3LIIA 4K1XA 4BJ5A 3Q3VA 4MDFA 3EC7A 5KVVA 3SQXA 4Q4AB 1YZNA 5DU2A 3PVZA 5THQA 3DW3X 1IN5A 3KT8A 3R7BA 3BQMB 3CKKA 3WISA 4GVXA 5CCEA 5FOTA 4EMSA 1PK8A 3DAPA 2E6UX 2PUHA 3EJWA 3LWNA 4KYVA 1ULAA 2NUTA 4BLQA 3QFRA 1BE8A 3NBQA 3AU8A 1BA3A 4QOIA 1W2WB 5AVTA 5I9TA 1JQAA 3LCVB 4S1OA 2OBBA 6REQA 3RAGA 1HQDA 1SQ0A 2X0JA 3O94A 2AMVA 3RC9A 3ILYA 4BQIA 1ZK0A 1AS0A 3OPXA 1WULS 3FETA 4R5MA 4R9RA 3UH0A 4LFAB 4YQZA 2BBSA 1QU2A 1PS0A 4NNOA 4OJKA 3TOXA 2X6TA 1KTIA 1POXA 1ZO8A 3CLSD 3ZZUA 1C7JA 1JA1A 3W7AA 4W1QA 4FYWA 1HL7A 2O4UX 4ZAZA 2PZLA 4GR5A 5KOHB 4JX8A 2EKBA 4ZMBA 2O8CB 1XK7A 1V25A 3IMEA 4NAVA 2VYVD 1BEZA 5TIIA 1NVTA 3C6BA 2K7FA 3PF9A 4Y2JA 1V11A 4NFHA 1H5NA 5D85A 4O4JA 2P62A 1NVUQ 2FG6C 5AR1A 2G1KA 1T9GS 4Q93A 1BE0A 3O9VA 4R2LA 4HPWA 1O1YA 3DUWA 5BYJA 2I3AA 5LA6B 5IYZA 3IAM6 3RC1A 1K92A 2OAQ1 1IBSA 4UVHA 5IANA 1KF0A 1SVLA 4NR0A 3HDYA 2G28A 2Y9PB 3LBIA 4RZ3A 3GW8A 3EXFB 2GEKA 3ZE6A 4RTKA 2XYGA 1MO3A 4PZPA 3H9GA 5CRIA 5D51S 1NVAA 2FRDC 5C1IA 3WP0A 3P9IA 3LPLA 3QE9Y 2QYTA 2OLJA 1UBFA 4G63A 2V03A 3FCYA 2UUCB 4GBED 1O96B 1ZX1A 2P75A 3I76A 3OEED 3R3YA 2EARA 2VSNA 4U9IS 1RJDA 4M6WA 5FQNA 4M9UA 4OLBA 2RBKA 4TTQA 2C03A 1CHNA 3EG9A 4CKWB 1SY7A 2GZ2A 5CU7A 4BBJA 2OO7A 3F4KA 1DB3A 1UEXC 4HEA1 5AWFC 4TT3D 4QQNA 1V5FA 3IT0A 1QOQB 1YZTA 3W6PA 2ZJOA 3DS8A 4KFRA 5EPOA 3N8NA 5F33A 4M21A 4KMSA 4PFJA 2WOJA 4QPJC 5JG7A 3A3PA 1RACA 2VH2A 4B3XA 2WQ6A 1HX7A 1VMIA 5AJVB 3D6MA 3HBLA 4XIIA 5DM0A 4A4DA 5AVYA 3O3MB 3OKAA 2B9EA 5L3SA 2ZYDA 3ZWCA 1DQSA 1WOM