1P2TA

H-ras 166 in aqueous mother liqour, rt
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
162
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Organic solvents order the dynamic switch II in Ras crystals
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Transforming protein p21/H-RAS-1
total genus 58
structure length 162
sequence length 166
ec nomenclature
pdb deposition date 2003-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p2tA00
4OI1A 4A0GA 4GDFA 1II9A 3ZQJA 1Q1BA 3LX5A 3T12A 2IBMA 4JLMA 4Z51A 2ZROA 1XX6A 4B6FA 1XMSA 2DFTA 4QBIA 1ZBDA 3C8UA 1GL9B 4JL8A 1YR6A 2NO1A 1XJCA 2H17A 2W6ID 2WJIA 3EA5A 1OV4A 3C7KA 3OAAA 4Q4AB 4NP6A 4ZKDA 3EPKA 1BKDR 4LY6A 2DY1A 1GKUB 3UIEA 2PEZA 2YINC 2WWXA 2E9SA 421PA 5AJZA 4A0FA 4TMTA 4ESHA 2H18A 1T0JB 4F38A 5DO9A 3MFYA 1EGAA 1XDBA 2FSGA 2C9OA 4CT4B 3A4NA 2PMDA 1XMJA 4Q1BA 4BZQA 2VL7A 1CR0A 1Z6XA 2ORVA 2R9VA 3LA6A 1SVSA 5DYGA 4F91B 5KPJA 5G41A 1VCOA 1E9BA 3BH7A 4QNRA 3SYNA 2R62A 2PBRA 3WMFA 5JCPA 2A78A 1ELOA 1HYQA 1AKEA 3T15A 5EE5B 5J4YA 1YZNA 3VQTA 2WKQA 2PZGA 3BWDD 3G82C 3TVDA 4IVPA 3KKOA 3UXMA 2FG5A 3IQWA 4Q4HA 2NOAA 4G5RA 4UNNA 1DG1G 2GJ8A 1ZNXA 4E5UA 4DSUA 4FXPA 2ZRGA 2ZSAA 4LHVA 5FL7A 4D26A 1OB2A 5J4LA 2NGRA 4ACBA 1SGWA 2ZYTX 4D6PA 1S96A 3H2YA 2PLFA 4OHVA 1VG0B 4Y0VA 3RS7A 1U0JA 3WXMA 4GL2A 2B21A 2JJ8A 1EWQA 3RVBA 1QF9A 2ZUDA 3CUEF 1KDTA 3RABA 4OI0A 1GL6A 1Q44A 2ECKA 2W58A 1DOAA 2Z83A 3A58B 3SNHA 1Q1EA 2OT3B 2R6CA 1FUKA 3B1XA 3G5UA 4NCJA 2ZYUX 4TLBA 1P4SA 1OHHA 1E99A 3SU8A 1P73A 5E7IA 3V00A 1NRJB 1BMFA 2XITA 4MITA 4L16A 5FUVA 3RSOA 3K70C 2GEVA 1YU9A 1FL9A 1E2MA 1W0JA 4BEBA 4ZO4A 3NDBB 1SVLA 3LW8A 3QEOA 4WZAE 2GCNA 2IEYA 3THXA 1S2MA 1EFUA 1YR9A 2F9MA 1KMQA 3B1ZA 5DHFA 3MGCA 4BLSA 4URVR 1IONA 3TQFA 3PUVA 1KI7A 4B43A 4DCVA 3QF4B 4LYHA 1ZVQA 1NVVR 2YVUA 5LB4A 4C0LA 2FU5C 4MRRA 3KXLA 1ZNYA 2IYXA 3U7FB 3PUXA 3Q8XB 1GIAA 3QI2A 3GD7A 1XEWY 1X1RA 1N5JA 4PFSA 2KE5A 4PZZA 1X1SA 4B33A 2Q3FA 3K0EA 5EXSA 2GJSA 2CK3A 3NH9A 4HB0A 4NCNA 1T6NA 4QXAA 4Q7JB 4JJZA 2PCLA 3KTAA 2BM0A 4L5BA 3UG6A 3ONWA 4Q1EA 4TSFD 1ESNA 2P5SA 2ZRHA 2QSYA 1TTTA 1NIPA 1E79D 1Z0IA 3DZ8A 4MYCA 5DHAA 1OHHD 3UMFA 5KU1A 4AKEA 1JPNA 3GLIB 1AKYA 4LJAA 2WMOB 2FFBA 2QA5A 2Q3MA 4IW3B 1KK1A 3B85A 3AUYA 5HZHA 1ZM9A 3RC3A 2ORWA 3ZS8A 2HF8A 4TTRA 3MWLA 2GJKA 5FR1A 4QJ4A 1G6OA 3WYFA 1HT2E 4POAA 2ZVQX 5CK5A 1NBMA 4EQ6A 2BMJA 3H0KA 1J8MF 4DKXA 3DM5A 5JCZA 3CLVA 2C2HA 1AK2A 1NKTA 5IRCD 1M2OB 3W8RA 1F2TA 5CYPA 4XD7D 3BJIC 1OFTA 3B2EA 4AI6A 3KDSE 4IJMA 4RZXA 2JDIA 3RDPA 1Z3IX 3A37A 1P5ZB 4QFMA 1ZUHA 4ZKEA 2ONKA 3A6PC 5DN6D 4C9BA 1KI6A 3EPJA 4GMXA 4HEJA 4HAUA 4HLUA 4AC9A 2ZRBA 3T35A 5CM9C 4WBSA 5JRJA 2BMFA 1ZYUA 2PEYA 1CEEA 1QG4A 4A8JC 2ANBA 1E0AA 2ZQ5A 3GJ8A 4TMVA 1KMHA 3E5HA 4H1VA 4HB3A 1W2GA 4MGKR 4KVGA 1OW3B 2JAQA 4LI0A 3THYB 3DZDA 5K8UA 2D2EA 3MWKA 3PUWA 1ZC4A 3GLHB 4HDCA 1ZIOA 4RFSA 3PEYA 4K81B 3I61A 1Z63A 1IOZA 2F7SA 3T61A 1KO1A 2BEKA 2QU8A 3HU1A 3OE7D 2XAUA 3MG9A 5KNDA 1HTWA 3FKSD 3QXCA 1YRAA 1SVMA 5FI1B 4URZR 2QL6A 3GMTA 5L3SB 1ZNWA 4M1WA 1HA3A 2DWPA 1ZCAA 4MUAA 1Q22A 2HUPA 1E0KA 2EFDB 1S3GA 3U7GA 2W2TA 2WAYA 1XZQA 3K70D 3QUSA 2WWGA 4ZDJA 1A2BA 3CX8A 3KJEA 2Q6TA 3DKVA 3X1WA 5HZKA 4JKIA 5KYKA 2VLIA 2HLDA 2JLSA 3ND9A 1CXZA 1C1YA 2W6JA 1KI1A 3FVQA 1ZC3A 1M7GA 4PPQA 4EPRA 1XTRA 3QE0A 4FIDA 2ZRLA 4QHSA 4LHXA 4HLUC 2JDID 3M4YA 5AUQA 4O2RA 1OXXK 4C0QC 1BYIA 1G7CA 2GXQA 1XTIA 1UBFA 1IXZA 1KO5A 1G64A 4Q4LA 2NQ2C 3LQQA 4X8OA 4QHYA 2BOVA 2ZPTX 2BJWA 4PQFA 2WWFA 1OSNA 4CZ2A 1LFDB 4B2PA 4HUQA 4OL0A 2RGBA 2QPAA 3T1QA 1R0WA 1GP2A 3NIBA 3R7WB 1OIXA 1LY1A 1NN3A 2IF0A 1C4OA 3ZIAD 1CJTC 1SVIA 1UADA 1ZP6A 4HZIA 4TYYA 4U7DA 3A4LA 2VF7A 3SHWA 4F93B 3TVTA 3IKJA 1QHSA 1WQ1R 2QMUA 1DAFA 4PC1A 4BPBA 4IVRA 2XNDA 4D0GA 1V5WA 4K46A 1KKMA 1ZM3A 5UKDA 2OM2A 1W36D 3DOEA 4EPVA 2BVNA 4YLGA 2WTUA 4Q1FA 4M21A 2GJ9A 2J41A 2QRNA 3MSXA 5F98A 1G3RA 2EQBA 4C4PA 4DSTA 1XEFA 2J46A 4R2IA 4LX0A 4XSGA 4YMWA 5KSOA 1FW6A 4EPYA 3OIVA 1Q3TA 1XP8A 1N6OA 2FA9A 3FMIA 4XWAA 2WJVA 1K5GA 1HUQA 2VBCA 4KVAA 1CJKC 2QROA 4L9SA 5B30A 3EXAA 1YZGA 3U4QB 1GKIA 3I8XA 1QHNA 3KX2A 5K8TA 2CL7X 2VHJA 1ETUA 2FV8A 1T8TA 2AFHE 2PLRA 2QG6A 4CF7A 2BDTA 5IHPA 4I1OA 1E96A 1I4DD 1G8YA 5FFMA 2J59A 2C04A 2B92A 3AP2A 3AVQA 2ZYWX 1E0JA 1GILA 4TMWA 1VYUA 2IUTA 4BLPA 221PA 4G5GA 2YWHA 4FCVA 2QEQA 1JBKA 4H9GA 1MH1A 1U99A 4U02A 4AKIA 3K0SA 3SYLA 1TUIA 1NN5A 1M74A 2CCJA 1YZLA 2GAAA 2HT6A 3CWZA 3T5DA 4M9ZA 2OG2A 4O3MA 2VP0A 4HAZA 4PQYA 1GITA 4RCYA 5FTNA 1E4YA 2V55B 1HY3A 4C7OB 1K6MA 2QP4A 4G01B 4EUNA 5LDDC 2ODBA 1E2PA 2IXFA 1GWNA 3LY5A 3AVPA 2C5LA 1GTVA 3R8CA 4C0SA 4PHTA 5SZKB 2D4HA 3DEFA 4CEIB 5JJKA 3CO5A 3GFPA 3W3ZB 4XVUA 1U9IA 2PH1A 3LWNA 1L4UA 1UEJA 1UKVY 3AVTA 2FGJA 2AR7A 2KWIA 3QOFA 2WWYA 2PT5A 1KSFX 5BQ5A 1DO2A 2H57A 4DLZA 3I5XA 2QMOA 1II8A 1IY2A 1N6NA 3M6AA 3TSZA 3GJ5A 3BRWD 1NVWQ 5CB6A 2QQEA 3OIUA 1A4RA 5J4HA 2RHMA 4ASUA 1NVUQ 4EFMA 3ZIAA 2V3CC 2RGGA 3Q72A 2W6IA 1SXJC 1X8LA 3K8YA 3IPYA 4Z1MA 1LF0A 3FE2A 3QVUA 4Q7KA 3WBKA 1CBUA 4ASUD 4DBLC 1RKBA 3QKSA 4PZYA 4LJ6A 2OSBA 1Z0DA 1GVNB 2B8WA 4OQMA 2YWGA 4OK3A 4QJ5A 2ZETA 2RB4A 3QKRA 1ZRHA 2OZEA 4NH0A 4HZUA 3VR6A 4F4CA 1XCGB 1E2DA 5JS8A 3MJRA 4CRWB 3BH0A 5TDHA 4JL5A 3TKLA 4PZLA 3X1YA 2DBYA 2ZSDA 4TMKA 1YZUA 4Q1DA 5CYOA 1FQJA 1OH6A 2RMKA 2GESA 1G8PA 5G3ZA 3NBXX 5LPNA 1SVKA 2ZJYA 3X1DA 3DM9B 3MAAC 3RS3A 1FTNA 3VR5A 2JA1A 1GRNA 4PTLA 3WBJA 2I1QA 3LXRA 4A92A 2QNRA 1E1QA 1TX4B 3FB4A 3HR7A 4IDOA 2CDNA 3CR7A 3P1JA 1F2UB 2Q9BA 2J45A 3CX7A 3I92A 3MLEA 5P21A 1Q0UA 4DC9A 3VKHA 3O8BA 5FL3A 2VHTA 721PA 4EIWA 4UNPA 1P9WA 3HPQA 1AGRA 1TU4A 2BBSA 2VHUA 4RD0A 4QHTA 3I5YA 3EWAA 1KSHA 4LK2A 3QEJA 1M6NA 3OEHD 5JMTA 4UNSA 2JJ2A 1P62B 1IJEA 1KJZA 3PENA 2FSHA 4BZPA 4EJSB 2FFHA 4S35A 1KI4A 1G18A 3KKMA 3P27A 1JQJC 3HU2A 2B8TA 3KKNA 3TAHA 4A2PA 1T91A 1GDDA 3M0EA 1DAEA 3HDTA 1M1YE 4FD2A 3KQUA 2O8CA 1P2UA 3U3RA 1OH8A 4YXWA 3VR4A 4YMSA 1NMZA 3WHKA 1E2EA 1E2GA 4JLNA 4AG5A 1F2UA 1N5IA 1HURA 2B7BA 2OO7A 4TL9A 3TW4A 2ODNA 4MKGA 5H8WA 2CHVA 4BECA 4PC3A 3U6KA 3ADCA 4M0LA 1Z0AA 1NI3A 2XZPA 2A2ZA 3BB4A 2YOFA 3I72A 3BFKA 1KK3A 5FUWA 2QY9A 3AF2A 5FOTA 2JLWA 3L8YA 1G20E 3OEHA 4QM7A 2A5FA 1OE0A 5F9FA 3LLUA 2AFIE 3C15C 1KI9A 1W47A 2FH5B 1NKSA 3LD9A 1G21E 1UFQA 4HZUB 1G17A 2IEZA 3PG5A 3FTQA 3CF6R 1JQLB 4TT3A 3NDPA 5EP3A 2FEOA 1EXMA 2GA8A 3OEED 1KDOA 1G8GA 3BOSA 1IN8A 2ZI6A 5CIQA 4Q03A 1XF9A 4LC0A 621PA 4TYNA 5GJBA 2REXB 2QZ4A 1VTKA 2OLJA 2F3RA 2WJJA 3QKSB 4HB4A 1DAGA 3PJRA 1U2RA 1XXHB 1RJ9A 4RCZA 3GJ6A 4HLCA 4ERNA 2HLDD 1MT0A 3QIAA 4KBFA 1P2SA 4JLDA 2YOHA 1XCPA 4DCSA 3RLFA 4LWZA 3ASYA 1J2JA 1NY6A 3IUYA 5EE1A 1VDZA 3FPAA 2VTKA 3VTKA 1R6BX 1OB5A 4QM6A 1XB2A 1II8B 2ATXA 3HWSA 2OUKA 4AKHA 2GRJA 1T9HA 3KQNA 2NIPA 5FPHA 2JATA 4JBYA 1KDPA 1EX6A 1DAHA 2OBMA 1FTSA 3FHTA 1IY0A 1YR8A 4DWJA 5E7MA 1LW7A 2TMKA 2A9KA 3FHOA 1J7KA 3VNUA 3TSOA 4B74A 3THOA 1GAJA 1Z5ZA 3EWSA 2LKDA 3QKUA 3BGWA 4OHZA 4DLYA 1P9NA 1YRBA 4ZDIA 1JI0A 4EAQA 2H1LA 2HV8A 4IXNA 3U44B 3KXIA 4A6XA 4A9AA 4JLKA 4PSAA 2GNOA 1G9XA 1OH7A 5SZJA 4DCUA 1A1VA 4A1FA 2YWEA 4PC7A 4R2HA 1E2KA 4I1VA 1KOFA 4HAVA 4NZYA 4RD1A 4XVQA 5C4MA 4JKYA 1BIFA 1C9KA 2GZHA 2SHKA 5FBRB 3QG1A 3EASA 2QP9X 4D80A 2IWHA 1S9DA 4JLJA 3RRZA 2BIFA 3WYAA 3BC1A 2ZIAA 3ICQB 1E1RA 1ANKA 4P0TA 3KB1A 3R9IA 5JBQA 1NN0A 2IHYA 1ZUIA 1D8TA 2XJ9A 2CXXA 1N0UA 3F3YA 1CRQA 1M7HA 4B3BA 3BS4A 4HLQB 2GEDA 4GP6A 2W00A 2A30A 1W4AA 2QTFA 3QKTA 2YYZA 2ZE6A 5BYJA 4MDFA 1HQYE 2IUSA 1Z83A 3AV0B 4EDHA 4FWTA 5FPKA 5EUMA 2C77A 3IGFA 1OXUA 3C16C 4Q48A 3REGA 1KJYA 2BMDA 3IBYA 1IN7A 3A36A 1F60A 2QQ0A 2WJYA 3TK1A 4HUTA 2EFEB 4TMXA 2E87A 2ZRFA 1G3QA 4DRZA 2FN4A 2GWHA 1ZD9A 4V0LA 1PLJA 2IS4A 2G9NA 1E9FA 2IYSA 3CONA 3UWKA 3U60B 1G16A 1LNZA 2UZ3A 3PVSA 1UM8A 2RCNA 3KXKA 4F4IA 3H1TA 1U8YA 3LO5A 1E79A 4LJ5A 3QY0A 1MO4A 5DE3A 1HE8B 3U3JA 1WB9A 3EZ6A 4MRSA 3JZAA 2NTYC 1CKEA 2ZREA 4LPSA 2D74A 5EP1A 3ZQ6A 4HUQB 3EPLA 4XIGS 3I62A 2QPOA 2IYQA 4KODA 5GVSA 2WJHA 1G291 5DLQC 4MUBA 4Q4JA 4N1AA 2OCPA 3U6BA 2AKYA 3CX6A 3AVYA 4TL7A 2CEAA 1W4CA 2ORIA 4RZ3A 4XOIA 4I4LA 4R7ZA 1E9EA 4Q66C 2OCBA 3UPUA 2ZJBA 3HPRA 4R98A 2H16A 4KITB 2VF8A 4JLOA 2PT7A 2ZR0A 4D4LA 2QT1A 1T3LA 3O47A 4URWR 3B7GA 1CRPA 2GHIA 1D2MA 1K5DA 1ZW6A 2HCJB 4MYTA 1YZQA 3DPUA 4LBZA 2VQSA 3WMEA 2VHQA 3QBVA 2WKRA 4M1OA 1F3OA 1GZSA 1TMKA 1Z0FA 3UKDA 2BMEA 4F7WA 5KNBA 1UPTA 4RJLA 1RFLA 2AXNA 4RD6A 5FBLB 4TTPA 5BN4A 2GCOB 1SHZA 5L3SA 4OK6A 1N6HA 1JAHA 5D3MA 2DWQA 3H4MA 3NBYC 4TLEA 4MA4A 4UXJA 4B73A 2P0EA 3V4RA 5C2JB 3K0CC 4OKSA 1TF2A 5CJ2A 1A2KC 1EESA 1OFHA 5CK4A 3BAFA 1XTKA 4V02A 3LNCA 4F4JA 1TL7C 2JEOA 4PX9A 5L8VA 3K09C 5TY0A 4DEXA 2QT0A 2QBYB 4W9MC 4NCKA 4WIAA 1NBME 1QRAA 2F55A 3NHBA 3THYA 2V54A 1UEIA 2OXRA 3EW9A 4H1UA 4I81A 1J70A 4WAUA 1GSIA 3RNLA 1HV8A 2KI5A 3RYTC 4HAWA 2XB2A 2EFGA 4Q1AA 4DLWA 1K8RA 3A1WA 4LDJA 3CZPA 5J47A 3R9XA 3Q9LA 1JXMA 4MYHA 2GKSA 5DI9A 3QF7A 1S4QA 1D6JA 1WMSA 5G53C 2REOA 2ZI4A 2ZJ5A 4M22A 1IM2A 1KDRA 1CJUC 4GOJA 2VYFA 1AA9A 3K0FA 2C78A 1ZIPA 3ETLA 3KL4A 3O8DA 4BFVA 2K5UA 1RZ3A 1G8FA 2RGDA 5FI0B 1VECA 1NY5A 5M04A 1GRRA 5C18A 3K53A 1E69A 2ZJ2A 4B47A 3K9HA 2ZUBA 4PHFA 1OIWA 5JHGB 4QGAA 2FDCA 2CLDX 4EQ6B 3SJZA 3I3SR 3AVWA 4NYJR 2Q21A 4YMUA 4HLDA 4HYYA 4URXR 1SVWA 1UBCA 4Q02A 2BBOA 2WPDA 3SEAA 3SZRA 3GJ7A 3AKEA 3IIJA 1OYWA 2AXPA 4NE2A 4P4UA 2EW1A 4GFDA 3LAWA 4B76A 3GLIA 5KSZA 2J1LA 3CRRA 5FTJA 1XU4A 1TF5A 2XXAA 2BWJA 3CF0A 4OI2A 1ONBA 1T8UA 5C4GB 5DH9A 3NKVA 3I32A 4EFNA 3LFUA 2Z4SA 3I1FA 2XOKA 1HE1C 3KTAB 4YONB 2C95A 3SC3A 3AUXA 4AYTA 1W46A 4LJ7A 1OKKD 3ZZTA 5FUXA 4PXAA 2G3YA 1OF1A 2V7QD 3Q7QA 4KSCA 3HU3A 4DLTA 3CKLA 3BORA 4G5SA 4W5HA 1G5TA 1J90A 4NU0A 5EE3A 4KU4A 1WA5A 1T0HB 1KY2A 4US2R 1N0VC 1E1RD 1MO6A 2JCSA 4WXPA 1WCV1 4IHQA 4TMZA 3TNFA 2NPIA 3GEEA 5CLLA 1W5SA 1LVGA 3AVVA 5CDFE 3RRMA 3ZVRA 3KUDA 3W3AA 4UQOA 5FUYA 3IO3A 4JLVA 3QF4A 2H8KA 1CULC 4OK5A 1PLLA 1F5NA 3OZXA 2ZVPX 4C2TA 1W7AA 4XJXA 2JGNA 1I2DA 4DJTA 3W9YA 4Q21A 3GLIE 1TAGA 2YC2C 3FKQA 4HI0E 2WIBA 4B3FX 1B23P 4Z1MD 4KSBA 4E07A 2WWWA 1AS3A 2PL3A 3C14C 4P33A 4QJ3A 2VSFA 3RSLA 1QHXA 2IX3A 2ANCA 2VSXA 1E0SA 3B1WA 3JVVA 3GP8A 3ZVNA 2XSZA 1JNYA 4W5JA 2IYTA 5B57C 4BRUA 1LS6A 3AEZA 3AVUA 1VHLA 5HPYB 4V0KA 1H8HD 2FPMA 4DDVA 1NJGA 2QE7A 4QL3A 5DISB 1J8YF 1KNQA 3QENA 2O5VA 5KOYA 3MUFA 1G4UR 4DDTA 2GZDA 1YZKA 2O8DB 5JFGA 1F6BA 2OILA 5HE8A 1SHKA 3SBDA 1OLOA 4JLPA 821PA 3IIKA 4JLBA 1BOFA 2NZ8A 4LV8B 1G1MA 3CRQA 1KTVA 1PUIA 3SFZA 3K9NA 2QAGC 4KLZA 2J7PA 1YZTA 4Q4HB 3ECCA 1N3BA 3FMOB 1O87A 4DCNA 4IRUB 4D2IA 2QMEA 4II7A 4DVGA 2QMHA 3IEUA 2AK3A 2ZU6A 2GILA 4NKRA 3TR0A 5KUTA 1LF5A 1KZGB 3H86A 2J0VA 2VHCA 2X8AA 3C41J 3LW7A 3WMGA 1R2QA 2QTHA 2A7QA 3BBPA 2XXAB 4A36A 3R8FA 2WSMA 1E2IA 3QXHA 4KV9A 1RRPA 3WY9A 5JWHA 4Z8YA 1XJ0A 3TUIC 5GJCA 3Q7PA 2FJUA 2QTVB 2A5YB 1T5LA 4JSYA 4UKDA 2RHDA 3U3OA 4BLOA 5FTLA 2RGXA 1II0A 1GG2A 4L9WA 1KY3A 2GVDC 5FOUA 4DDUA 5BN3A 3LRPA 1G3UA 1XMVA 4Q4AA 2FF7A 1IJFA 2NO9A 1OXSC 5FBVB 1E98A 3V9PA 3GEIA 3L0SA 4G3XA 3KKPA 1KI8A 4FCWA 5FTKA 1OIVA 1GNPA 3GQBA 2ERYA 2CCGA 1TADA 4JVSB 2BKEA 1KNXA 4Q18A 2WBLC 3P32A 3G0HA 2JLYA 2AKAB 5DGXA 1ZAKA 2BV3A 2HXSA 3TW8B 5DSZA 3Q3JB 2AD5A 3OFNA 1N6PA 4M8NE 1XPRA 2ZR7A 1U8AA 4CEJA 4GRAA 1XTSA 1NVVQ 4MGIR 1D9ZA 2RAPA 3EG5A 4Q1CA 1KK2A 2WOOA 3NWJA 1F48A 2CHGA 3K0FB 1H65A 4B75A 2QM7A 4ARZB 3CW2A 3NC0C 3C4JA 2GF0A 4TL6A 3TRFA 1S3SA 3VNVA 3EC1A 3L2OB 2AL7A 1Q20A 3W5IA 8OHMA 5LBIA 3K0CA 2OHFA 1VPLA 4OHXA 3A1VA 4KAXA 4PPFA 1UKEA 2A5JA 2J7PD 2R6GA 4NYJQ 3B8HA 4UXHA 5EE0A 4BFXA 2VP2A 3SR0A 2ZI7A 2J0UA 2JLXA 5TXGA 1W0KD 2PMKA 1Q12A 3TMKA 4DB2A 1NNEA 1JB1A 2CL0X 2PX0A 3GJ4A 1KAOA 2ASEA 2ZS8A 2KBEA 2N42A 3HJNA 2QBYA 2GBLA 4A2QA 3O8CA 4JT2A 1UAAA 1ODFA 2IYVA 4V03A 2EWVA 1QVRA 1HEIA 3LV8A 1SVOA 4KJZA 1IQPA 1D5CA 4UNRA 4J0QA 3QPUA 2RH5A 3D8BA 1Z6AA 3MWJA 4O25A 3U3MA 5EXTA 4ZCLA 5D3MB 5J4VA 3O8RA 1S0UA 5EXXA 1G7SA 2GCOA 3DMNA 4JIMA 4Q7LA 2G0TA 3F8TA 1W2HA 1TQ6A 1AM4D 3KUCA 4AG6A 4C0BA 2ZUCA 1TPZA 5K8LA 4V0OA 1WF3A 3I73A 3GLGB 2BJVA 1W36B 2R44A 2JLQA 1A82A 2W2VA 4JBWA 1ZCBA 4WZBE 3AF1A 2H92A 3B9QA 4BLTA 1OJLA 1KHTA 4RD4A 3SBEA 1DAKA 2O8EA 1U9IC 1A5TA 2VP9A 4PAQA 3FKSA 1Z08A 3VR1A 3AB3A 1CP2A 2ZANA 5J5CA 2NPFA 2ZEJA 1US8B 3NVAA 4Z8XA 1Z2CA 1MOZA 4QC2A 3I8SA 2RGEA 1AQUA 2YC4C 3CNOA 5DN6A 2DWOA 4W7SA 2ATVA 3NBZC 5AJXA 3NEJA 4L4UA 4DSOA 4Q4JB 5AUPB 1KGDA 2IS6A 4O0MA 5EXPA 3PEUA 2YJTD 2DR3A 1OKKA 4LBYA 3EA0A 4UJ5A 4C0JA 1XD8A 1EFRA 2JJ1A 2MMGA 1Q1ZA 2PJZA 2WV9A 2X2EA 3KB2A 4LV5B 4DT1B 5KNCA 2Z43A 1TQ2A 3K09A 2XB4A 2ZRNA 3KKQA 5TMPA 3ZZ0A 4E22A 4IOKA 1MABA 4MDEA 2GEUA 3QNUA 1TUEA 4XWOA 1FMLA 1G3IA 1N6KA 2EYUA 3LXXA 1PVOA 4LPKA 3TH5A 4HAXA 1E94E 2YWFA 1X86B 4LHYA 3SJAA 3UANA 4RVCA 3T5GA 2WPDD 4MRPA 4AY2A 1NP6A 3B5JA 4CEHB 3S1AB 2V8OA 3U5ZB 3L0OA 2Z6VA 4LJ4A 3W6PA 2OLKA 2ZRCA 3OIWA 4JVMA 2ODWA 2W2XA 3EX7C 2F43A 4N3NA 4TSFA 5KPDA 3R9WA 3K9GA 2ZRPA 3PR1A 1JEDA 1ZJ6A 2FNAA 4LHWA 4G1UC 2BC9A 4P4SA 3PITA 4FINA 4GZMA 3FOZA 1GNQA 1XFAA 1SQ5A 3MMPA 3U61B 4YMVA 4LSGA 1CIPA 2B6HA 2IK8A 3LH5A 2FGKA 2R8RA 4RKFA 3EAQA 1A7JA 2OAP1 3X1XA 1JXOA 4RZ2A 1FMJA 2J87A 3K1JA 5JI3E 2NMVA 1R0ZA 1JJVA 2HXYA 5JWOA 1H8HA 1QHHB 4LUCA 3T06B 1U81A 5FTMA 4JBXA 2HCBA 3I4LA 3QXXA 1G3MA 2JIZD 4QGFA 2QSZA 3EIEA 5KTYA 3KFXA 4P32A 4LHZA 3AF0A 3QG5A 4TZ6A 2IS1A 4TYQA 3P4YA 1NMXA 3DL0A 3CZQA 4PO1A 4JS0A 5EP2A 3U44A 1PJRA 4M2LA 1RW4A 4LCBA 1FNNA 1KO7A 5JS7A 5AUOB 3TGPA 5TVKA 1U0LA 1XJQA 4B3DA 2YNMA 2HF9A 4DEYA 4LZZA 4G0NA 1UF9A 2EU8A 2ZI5A 1XTJA 2C9CA 2R2AA 2IWRA 3U3KA 4ZI3A 1M8PA 5KDDA 2QGNA 1DBSA 1HT1E 5KSPA 3PEWA 5LD2C 4B71A 1BH2A 2UZIR 5FBQB 1W4RA 1S8FA 4M53A 5IDVA 1UKYA 2BCGY 2O8BB 4C0HA 1AIPA 3CPHA 1W0JD 3AP3A 2BCJQ 1VHTA 2OXCA 4WVFA 4LJ8A 4PC6A 4Q9JA 5JSZA 1PV4A 1JEEA 3CIOA 4JVLA 4YC7A 4ZIRA 1JR6A 3L82B 1P61B 2V7QA 1XBTA 1EFRD 1CF4A 2OFOA 1MRNA 3W90A 3TUZC 3IHWA 2DHRA 2OCAA 1GOTA 3KZ1E 1RJ9B 5TB5A 2FE4A 1XXHA 2XTZA 1XEXB 3ASZA 4FN5A 3PUYA 4WZ6A 2ZITA 1P60A 2GTPA 4YDSA 4TWZA 3ZGXA 3CPEA 3BFVA 4IFBA 3EZ2A 1CJVC 2JASA 5JZVA 3IBGA 2Q9CA 1RIFA 3T1TA 2MMCA 2IA5A 5FPYA 3W34A 5C1BA 1E2LA 2GXSA 2GF9A 5E3HA 2WZQA 3IO5A 4M9XA 1JR3A 2BEJA 4QBHA 2CBZA 2QORA 5J40A 3GPLA 4S2EA 4Q9LA 1PZNA 2P3SA 2V6IA 1XMIA 4OQNA 1GL7A 1RYFA 1E9AA 1YJ5A 3AKDA 1R8SA 1Z2AA 2G0NA 3E2IA 2IC5A 2CNWD 5AWFC 1COWA 1JR3D 4V0MA 3AGPA 1DAMA 3A1UA 1Q1QA 1TEXA 4KHZA 1ESMA 4N0DA 4NCIA 4A82A 2BBTA 3B60A 4FMDF 3VR3A 5G40A 4LYFA 2Y8EA 1N5LA 1UDWA 2X1VA 1E32A 3CWQA 1VCNA 3N2EA 4M1YA 2WOJA 2CNWA 1DS6A 2O8CB 3TBKA 1R5NA 3PEVA 4CGZA 4PC2A 4KLNA 2AX4A 3QJYA 4L8GA 2ZRAA 2OE2A 4KCGA 4QNMA 3K9LA 4HDOB 2KBFA 1NJFA 4TQ9A 2QGZA 1E2JA 1SXJB 2FPLA 1EG7A 1PLKA 2LKCA 2R6AA 2J5XA 3LBIA 4KXFB 4EJSA 3L8ZA 1BS1A 2P65A 4BQSA 1EFCA 5L3QB 2CHQA 4BZXA 1W49A 4CW7A 3U7EB 1DEKA 1VIYA 2F1JA 1L2TA 4B32A 4AURA 1Z28A 1JJ7A 1N0WA 1P2VA 2MSCB 3BIFA 3B1VA 3AQ4A 3AH8A 3LVRE 5GJWC 3VFDA 1WE2A 3L43A 5E95A 1D2NA 4C2UA 4ZV4A 1L8QA 4Y0AA 2O0JA 2FSIA 4LJYA 4A8JB 1MV5A 1R5BA 4EPTA 4PR0A 1OFIA 4WA7A 4D81A 3Q85A 1UKZA 1TF7A 2P6UA 1JAIA 4KFUA 1MR3F 4LOAA 5DIFA 4BFUA 4AKGA 4LRWA 2O0HA 2HDNB 1EFTA 3IILA 4FCTA 4BASA 4IDHA 2BM1A 1E2NA 3GJ0A 2ZRKA 2PJRA 2RGAA 1NL3A 5AK0A 2ZTSA 5BYKA 3J81k 4JJKA 1Z6YA 1EWRA 3FFAA 3VHLB 3H84A 4LYJA 2HT1A 1IXSB 1RRCA 2ONJA 4DIDA 3F0TA 1T5IA 3ZVLA 3ZJYA 2AWNA 3AKYA 1TQDA 5IK2D 3OFND 4KFRA 5JECA 5EZ6B 3SJCA 3QKRB 2I3BA 2I4IA 1XPOA 2Z5FA 5GVRA 4JLAA 1E9DA 4FI3C 3DVLA 2CJWB 2DCUA 1DAIA 1DE0A 5EE9A 1WBBA 4M1MA 2LCFA 1SXJE 2OBLA 2ZRMA 4NYMQ 3NTUA 1KO8A 2D62A 2Q9AA 3CM0A 1X3SA 4BFWA 5CB8A 3LBHA 2VO1A 1EK0A 3SN6A 4PO9A 2IYUA 3FMPB 3AP1A 3OEEA 1ZUNB 4HDQB 4TLAA 2RGNA 4TLCA 1KIMA 2C98A 1OYYA 2FWRA 4WW0A 1ZU4A 3WHLA 3UATA 2O52A 1KI2A 1E3MA 1PUJA 1Q57A 3RS2A 1BO6A 2AK2A 2VSOA 4KFTA 3CH5A 3E1SA 3IDQA 1GKYA 2D2FA 2XNSA 4CEIA 2ZE5A 1NLZA 1AS0A 5GJVC 4JVNA 1E9CA 1N6LA 1R0YA 3TE6A 4ZPXA 3T34A 2J0QA 4AK9A 2EVWX 4GMDA 3DOFA 3QXJA 4C7OA 2PZEA 2XSZD 3DDCA 1WXQA 3B82A 4GBMA 4NYIQ 4WXRA 1XRJA 3F5FA 4CVNA 4B34A 4JZKA 2DFLA 4MKFA 4F92B 5BXQC 5AJVB 1QBKC 2F9LA 2GZAA 4LV6A 2FZLA 4M9SA 3LDAA 3SHFA 3B9PA 1KSJA 2W83A 2F6RA 4E09A 5DNYB 2YZ2A 1XD2B 4DSNA 1IN6A 5CIWA 3WNCA 2VEDA 4DDWA 2N1BA 3ZVMA 4ZDKA 2IHBA 1N6IA 1I4LD 1XCMA 5L3VA 3WP1B 1ZM2A 5FOVA 2FFQA 3CRW1 2JJ2D 1XNJA 5DYIA 5JLJA 2AHOA 521PA 1GFIA 4URUR 4M9QA 1ZD1A 2RGCA 3NBFA 5SZHB 2CLSA 3U4QA 1L7VC 3B13B 2FFAA 1D9XA 4GI7A 1L4YA 2FPKA 1S1CA 3VHXA 5KDLA 3TJZA 1X6VA 5JWRA 1FP6A 2CE2X 2JLRA 4TYWA 2D7CA 4W5WA 4OQXA 3W8NA 2ZJOA 3K0AA 2W6JD 3AVOA 2WMNB 4V0NA 4Q7MB 4A4DA 1MRSA 2VA8A 4O2LA 1YE8A 3M1IA 2QAGB 1U90A 3BERA 1T3SA 1GUAA 3N2IA 2ZRJA 3MCAA 1HH4A 3BB1A 1OFUX 4C3ZA 2WSSD 2XX3A 1KYIA 2YOGA 3VU9A 4DLRA 1W4BA 2GCPA 3GFOA 1AZSC 2XZLA 3A1SA 2XOKD 3R7WA 4RFVA 1XTQA 3SOPA 3B6EA 3NEYA 2WJGA 4JYBA 4Q00A 2G6BA 3PUZA 4TL8A 4A2WA 5ELXA 1H8EA 1NF3A 4N0EA 2P5TB 4IOLA 1U98A 1RYHA 4US0R 4ZI2A 4QGGA 4OQLA 3EIHA 4IOMA 3OE7A 4TT3D 2XGJA 4FMCB 2F1RA 3CNLA 2Q3HA 5FPTA 2J7KA 4I1SA 4YMTA 3KQKA 4IDPA 4PSKA 5TARA 4EKDA 4ITRC 3VKWA 1CR2A 2KSQA 5ANRB 1RPZA 4QG7A 3TAUA 4OYHA 4M1SA 1KI3A 1X8JA 1KK0A 2IYRA 2P6RA 2NZJA 4LJ9A 2IXGA 1IN4A 4UNQA 3BXZA 3CRMA 4GSYA 5JJLA 3DMDA 4MKIA 2WVJA 3TR5A 3Q5DA 4XSHA 2C8VA 3W6NA 1QDEA 4PANA 2B7CA 2ZAMA 1W48A 4FMBB 4MRNA 3BFXA 4FWIB 5EUQB 2ZU0C 1EX7A 3FMFA 4RY2A 4RKEA 2WWHA 3ZS9A 2WICA 1NSTA 4LYAA 1YQTA 2V1UA 3KFVA 4Q9HA 2HEIA 5FH9A 1KKLA 3WRXC 4DLSA 3KQHA 3LQRA 1KAGA 3AVXA 2OV2A 1M34E 5FPSA 1V43A 5HR5A 3GCGA 3RAPR 2Z0MA 4FMCF 4RFSB 1JECA 3GLHA 5TV2A 4KI0A 5BWMA 3IQXA 4NYMR 4Q19A 3VU9B 2R65A 4NONA 3GLHE 4CIDA 1LS1A 1KMHB 1KZ7B 2GBLC 4PO8A 1TEVA 5FOWA 3IPXA 1QHYA 3UK6A 2QAGA 2IYYA 3OESA 4UJ3A 1WBDA 4KO8A 2V6JA 4BFYA 4QBFA 1XWIA 1S1MA 1E2QA 5A4JA 2QI9C 1SXJD 4DIEA 2O8DA 3K0AB 3ADBA 2JLZA 1Z0JA 3VKGA 4B2IA 1AJEA 1U0HC 2IYWA 2PZFA 1VCMA 2PCJA 4PAOA 3GLGE 2REBA 2G1KA 1CJMA 1KI6B 3RS0A 3BB3A 3QPVA 3VR2A 1DARA 1H8ED 1T4GA 4RD3A 4QRHA 3ND8A 3ZLJA 1HQCA 2EFHB 3UMRA 1NIJA 4DLXA 5F3WB 2ZXUA 3D3QA 2DFNA 4NBSA 4Q5IA 3DHWC 3IIMA 4GNKA 1F2TB 3SFVA 4AIIA 4Z54A 4E03A 1FPMA 1RE0A 5HCNA 4DUGD 2ZE8A 4TQAA 1AQYA 2WAXA 3CRVA 2WSSA 4RSGA 2ZS9A 3RRNA 4BRWA 4US1R 2GETA 2JIZA 3TUJC 4C0AC 1W1WA 3AM1A 3OHMA 3CPJB 3CH4B 1G19A 5J4KA 4URYR 1JPJA 1NN1A 2OFWA 2EWWA 1XD2A 4D4KA 1NLFA 2GJAA 5D3QA 3PCRB 1P7CA 3V4FA 4CYMA 1VYTA 2IL1A 3DO6A 4I99A 2X2FA 1E2HA 1RRGA 1Q3HA 4BFSA 3CNNA 3SYKA 4DLVA 2ZYVX 1IXRC 2AN9A 4B3GA 3LVQE 4OHWA 1EFHA 4KBGA 3PXGA 3RC8A 2IF2A 4OI4A 1WP9A 1G8HA 3WP0A 2CE7A 2ZSEA 1Z6GA 2OESA 2N46A 3WNDA 3KJHA 4XWKA 1BMFD 4AYXA 1G5RA 2BKUA 2PX3A 3EZ7A 1NVXQ 2DFKB 4GOKA 4JSTA 2R6FA 2L0XA 4P31A 2A3RA 3W6OA 5JEDA 2A5DA 2XTNA 1G4AE 1LTQA 1IBRA 1ZNZA 3RRYA 2G83A 2GK6A 2IT1A 4GOXA 1CLUA 3FWYA 5JHHB 1S9HA 2QUZA 3OF5A 4PPNA 4TLDA 4ILEA 1VIAA 1P75A 4MGZR 1QG2A 3N70A 5JEEA 3GFTA 4R9UC 5G3YA 3THXB 3ZYCA 2UVQA 1NSFA 2I1VB 1CTQA 3TSWA 3VX4A 1XZPA 4XD7A 3T1OA 4Q47A 1DELA 2MSEB 3NH6A 4LBWA 4QKQA 4BFZA 2RKOA 3P4XA 1I2MA 2JLUA 1N5KA 2CJWA 2J3EA 1YVDA 1CS4C 2QENA 2NO7A 5FOSA 1O3YA 4XTRA 5CITA 3PQCA 1IY1A 3AGQA 5JJIA 1NLYA 2ZAOA 4XVRA 3VX3A 1JALA 4JYCA 5EP4A 4TYPA 2Q0HA 2XJ4A 1VKJA 5KDOA 4OJKA 2OAQ1 1RVDA 3SDZA 1D2EA 3IEVA 4HATA 3BE4A 1E4VA 3N5CA 3QBTA 4QOSA 5KHOC 1VG9B 5B64A 5B58C 3SQWA 1IN5A 1ZMXA 2C99A 3B1YA 1NG1A 4B2LA 3ZD7A 1Y63A 2CVFA 2IUUA 2RGNC 4D0LB 3EARA 4TZ0A 1R7RA 3U7HB 3EPHA 2GXUA 2EYQA 5K8IA 1WRBA 1FNMA 3JVUA 4IEIA 4ZDWA 3X1ZA 4GZLA 4D25A 1Y3AA 5HCIA 2WKPA 2XZOA 4A8JA 5L3RA 1SULA 3HR8A 3RS4A 1DTSA 4BGDA 3WNBA 4IKEA 4G5OA 3RWMB 6Q21A 1R0XA 1OPXA 3ADKA 4L15A 1Z22A 2F1HA 3KJGA 3Q5EA 2ODEA 5L3QA 2QP3A 4KFSA 1G7TA 4GPTA 4D82A 1W0KA 2XNDD 1R8QA 1OXTA 2VP6A 3E70C 1NBMD 1JR3E 1SXJA 2OFXA 4HSEA 2Z4RA 1Z0KA 4PAMA 4TTQA 2R6DA 1FUUA 1QVAA 4DUGA 3PIRA 1OXVA 4MQBA 2GAOA 1Z06A 4BUJA 4OQFA 4AD8A 1P9RA 2VH5R 3TQCA 2P6NA 1XD9A 4U5XA 2G88A 3A8TA 5CJPA 1DADA 3SJBA 3ZD6A 4UXIA 1UDXA 1XXHE 3SS8A 1R4AA 4X8LA 2NO6A 4A0RA 1GNRA 5H70A 3PFIA 3L0PA 2ZRIA 4RD2A 1QHIA 2O0KA 4NHOA 4TN1A 4DZZA 4EFLA 1N2CE 2KB0A 1I4TD 4YDHB 4IEEA 1AGPA 2EFCB 5DI3B 3NHAA 1AN0A 4NDZA 1E6CA 2CK3D 4X8HA 4B44A 3PV0A 3T1VA 1N6RA 2ZI3A 2HJVA 1B0UA 2YV5A 3EC2A 2IYZA 1FOEB 4PPGA 1CU1A 2DB3A 1MKYA 1ZINA 4I1UA 1QHGA 4IXMA 3GEHA 3WRYC 4MRVA 1R10A 3C5CA 4M4SA 3SQXA 2HYIC 2IYLD 3FDIA 2VP4A 2BBWA 3UWOA 2FSFA 4IOJA 2XTMA 4EPWA 1NMYA 1CR1A 2NO0A 3CB4A 4ZCMA 4HAYA 4YXWD 4ZCIA 4MGYR 1Z07A 3UMSA 2HYDA 1XEXA 1YR7A 2MSDB 1SZPA 1VG8A 2C9YA 1COWD 5H68A 5LB2A 4WOPA 2FOLA 4ON9A 4G5QA 4ZIRB 3BD9A 2O8FA 5JSZB 3MRSA 1E9RA 1FP7A 1E1QD 1NG9A 1W36C 2O8BA 1QZXA 2ZJ8A 5E4FA 1W5TA 1DVRA 1W44A 1GM5A 3OAAD 1FQKA 4B3CA 1YHNA 4NL4H 1YKSA 4YQFA 1T3HA 2CLCX 2OEPA 1G41A 2V9PA 1P2TA 3QQ5A 4OHYA 5F2EA 3FFBA 1KO4A 5CLQA 2GDJA 3RHFA 1AZTA 1UBEA 5A0FA 1FZQA 3NG1A 1DPFA 3HYRA 4B48A 2JJ1D 5HE9A 4FW9A 4ABYA 4JL6A 2J9RA 2WM9B 2NG1A 2QRZA 3AKCA 3QPWA 1UJ2A 1Q21A 3D7MA 4NYIR 3THWB 2YHSA 4Q9KA 1SKQA 2HJGA 4A6PA 1OT3A 3FGNA 2W0MA 1U8ZA 5CM8B 4NMMA 4HB2A 1BYUA 4IFEA 2ZJZA 1DG3A 4XTCS 4CT5A 3HYTA 4GT1A 5AR1A 4PHHA 1QHHA 4DLUA 3AF3A 4BWYA 3C5HA 5KSYA 3GLFB 2OCYC 2P67A 2ZSFA 3ZH9B 2DYKA 3EZ9A 4PQRA 5HTKA 2A5GA 4NPHA 2AD1A 3LX8A 5JI2E 5AUNB 1KJWA 4Q01A 2VP5A 1RC8A 3U2QA 2ZSBA 1FX0B 1XPUA 1TU3A 1Z6TA 2CCKA 3NC1C 2CL6X 3MD0A 1LV7A 3UG7A 4P4SB 3KQLA 1VCIA 4B6EA 2V4ZA 1CR4A 1IHUA 2P2LA 2F43B 3CBQA 2FEMA 3QXSA 2CMKA 1M7BA 4X8MA 4D4MA 1VMAA 1OH5A 4OBEA 1P6XA 1R5OA 4NCHA 3S1AA 2F1IA 5E7JA 3X2SA 1MO3A 5EJEA 4CEHA 1FX0A 3ZZUA 1FFHA 2DPXA 3QVVA 1LB1B 5F9HA 4FMDB 3D31A 1ZM4A 2CVHA 4IVQA 5CDFA 4NTZA 1TQ4A 2QM8A 2UKDA 1TNDA 2WIAA 3DKPA 5IF9A 2LWIA 3GLFE 1MABB 1ZM7A 4D4JA 2QPTA 3GJXC 3GLFA 2WWIA 1MO5A 1G6HA 1XEWX 4M1KA 1J99A 3HP1A 5HKKD 5C46F 2W0SA 3LBNA 4CDGA 4DT1A 4MKHA 1Z8FA 4GP7A 5FOXA 2C96A 3WYGA 1RRFA 4P4TA 2C03A 3P20A 4DCTA 4DXAA 4M1TA 1G5PA 3THWA 2GXAA 3FHCB 4B3XA 1SKYE 4PSVA 4EPXA 3EZFA 2ZI9A 3MWYW 2WHXA 3JZMA 2FMXA 3VMFA 2E1RA 1G7RA 3FYHA 4LBVA 5A5GA 2X19A 3B78A 5EZ5A 2ERXA 4BE7B 1US8A 2GK7A 3RS5A 3TLXA 4ESVA 2JLVA 2D06A 5LD2B 1VG1A 1U94A 3IHLA 2O8EB 4LC1A 2ZM5A 5IK2A 5KO2A 3L0IB 2V1XA 4DHEA 2GVZC 2QE7D 3REFA 2J0SA 2YKGA 5FL7D 3SI7A 1Z29A 2AWOA 2OBNA 1P72A 2VRWA 2IS2A 2QAJA 3GLGA 2VIIA 2IXEA 4ACAA 5H1YA 4K8OA 2G1JA 5EQTA 2ZRDA 2G77B 2QN6A 4C0KA 1E2FA 5IT5A 2O8FB 1DO0A 4IDQA 4R71A 2VPPA 1VYVA 3AF4A 4Q9IA 3SE0A 3KJIA 3R20A 5JRZA 4BFTA 2IW3A 3RWOA 5B2ZA 4AYWA 3ICEA 4IDNA 4JT4A 3MJHA 4U00A 1SKYB 3CR8A 4XH9B 4A0HA 3ADDA 1ZU5A 3CF2A 4LGMA 2D7DA 3QSYA 2ZJAA 4OJQA 4BEJA 4D0NA 3W5JA 3EIQA 3ZDQA 2FZ4A 5GADl 4BLRA 1N25A 4RZUA 3K70B 1AS2A 1GRQA 121PA 3GJ3A 2H5EA 4KYUA 2XEXA 2J0UB 1WDTA 3A1TA 3BK7A 5SZIA 4EJSC 3VAAA 3TIFA 4P3YA 1IAQA 4JMPA 5AJWA 4A15A 2X77A 2FX3A 5HKKA 4BLQA 2BHRA 4MH0R 5FBWB 3RANA 3LLMA 2ZR9A 3OIYA 4DB4A 1ZD8A 4AWXA 3A4MA 2F3TA 4KYIB 2ZS7A 4ARZA 5DI3A 2KJQA 3D6TB 1X8KA 1UBGA 4PHGA 3BH6A 5BW8A 1P3JA 4MYUA 2ZE7A 4QGHA 4V0ME 5BN5A 1Z47A 2H7VA 1E9SA 3P26A 5AJYA 5FR2A 4B35A 4C30A 1KSGA 4CEJB 2D3WA 4TQUS 4QBGB 3NXSA
chains in the Genus database with same CATH superfamily
4A0GA 4LG1A 4MI6A 3JQ9A 1RXIA 1Q1BA 5JYDA 2IBMA 3M1LA 3LA8A 4QE3A 4BX8A 4YDRA 3RYFB 2XCOA 2BP7B 2CHUA 1SXGA 1B00A 4TV9F 5EQFA 1GL9B 2A88A 4ZQIA 2B69A 1MQSA 2WJIA 1LI7A 3IVGA 2X1LA 3GFGA 4QRIA 4LY6A 2C00A 4QQ8A 1MHTA 2PUJA 2I55A 1GTG1 1FLNA 1R9JA 2PXXA 5AKIA 3ODGA 1XDDA 3LVFO 3DDHA 4G0VA 1DCKA 3CX3A 3OWOA 2GFHA 4GVPA 4ESHA 1CDOA 1AHHA 3O4FA 2QX4A 4YQZA 3ZDEA 2A9OA 2GBPA 3MFYA 4REMA 1CJBA 5DO9A 3RBXA 4X62B 1Z36A 4BOYA 1NP7A 2CFIA 3SE7A 3JX9A 3G5MA 1XMJA 2J07A 5KPJA 2E49A 3NCTA 1XLVA 3RUCA 2BELA 2YNMC 3WMFA 4RPHA 1RXUA 4KV7A 5HGJA 3RIMA 2OYCA 3E9QA 4JD5A 1HX7A 1CIVA 1U9JA 3DMFA 3VQTA 3WKBA 3QEMA 3BWDD 3G82C 1KYTA 4G67A 4Z9AA 5JAMA 2A9VA 3MMSA 3NQ41 3IB6A 4ZVKA 3GRRA 4BAZA 2NOAA 2BFCB 3TZHA 1C3XA 1EGVB 2GJ8A 3GUUA 3N53A 1KAMA 1ZNXA 3RVKA 5A0TA 4J4BA 4Z53A 1HE2A 3DHVA 2CXOA 1Z4NA 3PTAA 1WIWA 3OEWA 4BDTA 4ACBA 2C4KA 3WC4A 4YRMA 1TM2A 4OHVA 1EYZA 4Y0VA 4QJBA 4QOHA 3B3JA 2B83A 1QV6A 3D6HA 2IPAB 3FGOA 4I3FA 1NF8A 4H3HB 3UT5B 5L6LB 1EWQA 2XUGA 4D4GA 2XHZA 1QF9A 1XZEA 2VJAA 2AN4A 2RI1A 4IHAA 1GL6A 1Q44A 4QOGA 1T0PA 5EMLA 1Q1EA 2PFGA 1QO0D 2WTBA 3MOGA 4IJQA 3ELUA 2C83A 3H5LA 4OUKX 2WFLB 2ZCVA 4TLBA 5IKOA 5HJ7A 4R9VA 3IDSA 1CY8A 2R1TB 3EVEA 5EIBD 1J0AA 1NRJB 4QVKA 2GEVA 1AQ6A 2YDXA 5IC5A 2I8CA 2PMCA 4ZO4A 2BF4A 4YJFA 3RBZA 1DWPA 3NDBB 1W6UA 1SVLA 4ONEA 1URPA 2X7JA 4WZAE 3UHOA 2IEYA 1C1HA 2FEKA 2VDQB 3IXQA 3UUWA 5DHFA 3ZIDA 4URVR 2HW8A 3BXFA 3K6KA 3MIZA 3IOBA 4DCVA 1HWYA 1I2CA 1HYGA 3RHTA 1YHZA 1KFKB 4PX3A 4D6YA 2RBGA 4LYHA 1SVUA 4ZALA 4DMLA 1ZVQA 4PVDA 1DJQA 1JJIA 1VE7A 2YZNA 3OZCA 3I52A 1M73E 4C0LA 2VC2B 1PTJA 2FU5C 3DTVD 1NSYA 3IEIA 1ZNYA 2PQ6A 2Y3IA 3LLCA 4FFLA 1JFTA 1U9ZA 1Q0PA 2IPLA 5ALEA 1AHIA 3B3QA 3N86A 4LOJA 5F4BA 1UZLA 3MBIA 4BMVA 1A95A 3J7TA 3GBSA 3B2NA 4PZZA 4DMHA 1IHDA 2WHEA 5CHYA 3K0EA 3WYCA 2V5VA 2GJSA 3NH9A 1K92A 1HYHA 3WZ2A 5IKMA 2HA3A 4O02B 3GOQA 2BM0A 3IOCA 4L5BA 3A3YA 1WETA 3J81A 3OM9A 3ONWA 4HDSA 4Q1EA 1BN6A 4TSFD 3MS4A 4U2DA 4RADA 3WLSA 1ESNA 1A9XB 2P5SA 4WXEA 3I4CA 1I3OA 5KU1A 4CM1A 4F2WA 2H1SA 1YVEI 3EMKA 5HUHA 1SOUA 1P0FA 4MI1A 4AKEA 2NV0A 4P84A 5AK5A 3V4PB 3MYRA 6REQA 4LJAA 2WMOB 3OZUA 2Q3MA 5DW0A 3AUYA 5J2UF 4A5OA 4M0DA 1LZKA 1R6VA 2ORWA 3ZS8A 2HF8A 3DBLA 3I42A 3Q3HA 4R7TA 3HKEB 3M9LA 4POAA 3VI4B 3H0KA 1J8MF 1U8FO 5FBKA 6NULA 3HGTA 2X13A 4B8YA 1UPXA 5I7RA 1SELA 1DLJA 2C2HA 4IJ6A 1GU7A 2BCEA 5CAEB 4RLSA 3W8RA 3PXEA 4O63O 4PLZA 2PNFA 2PRKA 4JNKA 4XD7D 3KEOA 2QVCA 3B2EA 4JB2A 3BMQB 4IJMA 3LHIA 4ZJPA 1S2GA 3P2OA 4N6NA 5AI0A 4P1ZA 1QGAA 3I45A 3RDPA 4BY9E 2QN1A 4ND7A 2XKKA 4X20A 3A04A 4ZKEA 3VO8A 3O4RA 2DH5A 2QIPA 2X3YA 3GBVA 1KI6A 3GGPA 5IH3A 4KO4S 3G0IA 4C9BA 4DDHA 2QN9A 4HLUA 2PVCA 2Y99A 2XOEA 3LL4A 2OECA 1QIMA 2ZRBA 3T35A 2ZWAA 2WV7A 3CRZA 4WBSA 3CJRA 5AMXA 4E1AA 1N36B 5JNVA 2WSYB 2BJHA 4JI0B 3BZWA 1RSZA 4ZJZA 1DC7A 1N8TA 2MU1A 1E0AA 2YFKA 2V9CA 3DDZX 2O7NA 3PTZA 4ARUA 3GJ8A 5LR6A 1LQTA 3NWOA 4NESA 4TMVA 4MW5A 5K0LA 4LI0A 2D2EA 2HB6A 4R5HA 1T4MA 1ZIYA 3MCWA 4DZRA 4UUBA 4DCPA 3GZ4A 3PEYA 1UH5A 3A6DA 4K81B 1QBGA 1A69A 1HBJA 2HRBA 1UZUA 2A0YA 1A1SA 3I9NA 5BP7A 3QVKA 2HDHA 2P2ZA 1B0PA 1A77A 2EQAA 3MG9A 1OLXA 1XP5A 4UBNA 4QX6A 1DC4A 5KI6A 1D4ZA 4JYPA 4Y8VA 2FCRA 2QVBA 1Z8HA 1YRAA 1KEPA 2P9BA 2V5AA 2QL6A 3GMTA 1GQFA 4PZPA 2PLNA 1U2PA 4QRDA 4J0FA 4AKTA 1ZCAA 2CUKA 2QJTA 4RKRA 5IXYA 2HUPA 1S2DA 4LMBA 5AIBA 1Y8QB 3PI6A 3QZUA 3Q5GA 1K8XB 4GX2A 5I4IA 1TYAE 1ZL0A 4YMLA 3AILA 3K5PA 5D1NA 4P08A 3FM9A 5JVDB 3X1WA 3BPSA 5HZMA 5KC9A 1EJ0A 4JKIA 3TBHA 3WB0A 3AZOA 1JHXA 3MHTA 1IDOA 2ZXEA 3BJZA 1NV9A 4GO1A 1CXZA 1C1YA 3D6JA 3E22A 1KI1A 5E7QA 3DT9A 2J8ZA 4RH3A 3QE0A 1LDGA 3DR3A 1X1TA 2ZUWA 1W5FA 4FT2A 3QSGA 1VGRA 2NSDA 1L4MA 2O5CA 1XTIA 1ZSYA 1P1FA 1KO5A 2OKGA 2FPPA 4HH4A 3SZ3A 1TEZA 3LQQA 2BJWA 1Z0ZA 3KT6A 3OE4A 1FRNA 4A26A 1ZA2A 2Z6UA 2EF1A 1HDEA 4OL0A 2Q5OA 2RGBA 3PJDA 2G82A 2QPAA 3EVGA 4MK4A 4PCUA 1SEPA 2QTRA 1ISSA 3R7WB 3G17A 3HCWA 3UO8B 4CDRA 1NN3A 1YCHA 2IF0A 1ENPA 5DBEX 1Y6JA 4KR9A 2QU7A 1M8JA 1CJTC 4JEMA 2BMVA 3A4LA 5FQNA 4HX9A 2VF7A 3TB6A 3SHWA 3TVTA 1DT5A 2V9ZA 3V32A 5K6AC 3IUJA 3IHKA 2HWXA 1ML4A 4OH1A 1O94C 1V5WA 4LZOA 4M86A 3UK1A 2JD2A 3WGKA 1PJCA 4BTEA 2IUYA 4EPVA 2IH4A 4UVGA 3QKIA 3GEDA 3M1YA 4RCVA 1ZEMA 4M21A 5M5BA 5KYXB 1Z39A 2PKRA 1VSBA 3IP7A 2J46A 4FYXA 4R2IA 2WYVA 2JKYA 1IXKA 3GGDA 2AKEA 1EWTA 4NEGA 4PCVA 1W8DA 2OAGA 1Q3TA 1FFCA 1N6OA 3FMIA 2WJVA 5CLHA 4X41A 5AH0A 2PSSA 3IAS6 5K2MA 1KOJA 1D6MA 2JHFA 2UVDA 1KBZA 4G81A 4KIGA 2JHGA 3VHXB 5C53B 3U4QB 4M55A 3I8XA 2ZDHA 2C9BA 1PQWA 1Y7HA 3HB5X 5K8TA 2CL7X 1PT8A 4UEJA 2DULA 4O4HF 4CF7A 1P7YA 3HN2A 3FAKA 1G9SA 4WLNA 2KM1A 4G1EB 3MOIA 3LT2A 5CLIA 4ETWA 3GZJA 4BJ6A 4FN4A 4CU2A 3RQSA 3QLEA 2AJTA 2NZXA 1N1EA 2AB0A 2ZYWX 3EGDB 1GILA 1ZH4A 2JIQA 4EJFA 2IEGA 1N9ZA 1XCBA 4Z4HA 1VYUA 2G17A 2I6GA 1B3RA 2J3QA 2VTEA 1K6EA 2VBFA 4OQ4A 5CXSA 3PEFA 1JAZA 2Z04A 2QEQA 2WR8A 3GJRA 4W9NA 3FPBA 5A06A 1MH1A 2BPOA 1NRXA 4JCOA 4U02A 1N77A 4AKIA 1NWHA 3SYLA 5TGZA 4CL8A 1NNLA 2CCJA 3EOZA 4XDHA 2HT6A 3TZLA 8GPBA 3QVOA 1M2HA 1E92A 1DOZA 4A16A 1GITA 4RCYA 2FMUA 1UP7A 2C61A 5T4HA 4FFNA 1XZLA 3UW3A 1AGXA 1HY3A 2FW1A 3ITNA 1E3TA 4J1QA 4P9NA 4XARA 4YS6A 4EHDA 2COKA 5JZMA 1AA6A 1H5UA 1BU5A 4EUNA 5CDHA 2A0KA 1E2PA 1BRMA 3HJUA 4AJ2A 1PV2A 2TYSB 3GGJA 3GN2A 4PHTA 3DEFA 4CKWA 5JJKA 3EVZA 2LNDA 3FRHA 2QK4A 2BDUA 1C9JA 2PH1A 3DTTA 3LWNA 3UC5A 3AVTA 1TGVA 4L3OA 4PSDA 5KYTA 1QYVA 3S0JA 4BO9A 1DX6A 1DO2A 4YWJA 3UEOA 3I5XA 3PGJA 1XL1A 4GRIA 2X9LA 1N6NA 1VJ5A 3FR7A 3N7AA 4U3JA 3V2IA 1T2VA 2H0AA 3BRWD 1FDRA 2HA5A 3CH6A 3RW9A 3FFTA 4KOAA 4UATA 2Z2IA 1Y5LA 4XWTA 3OIUA 1TVCA 1A4RA 3D1VA 1V8ZA 4EG3A 4ER0A 1VXRA 1MIOA 5JLAA 4BWFB 2W6IA 4BX9A 1XK7A 2QI9F 2H85A 4WN9A 3IPYA 5E6UA 4PYOA 2PXHA 4Z1MA 4CM9D 1Y8RB 2CNOA 5KYWB 4WBXC 1OYOA 2P4SA 4ASUD 4DBLC 1RKBA 2XCSB 1M1YA 1GVNB 1VL8A 1EVIA 1D3AA 3D8RA 4OK3A 4C5AA 2D5BA 4L9RA 4S2UA 2QMZA 5TQ0B 1PJ2A 5I4KA 3BIJA 4LISA 5IC6A 4B40A 2BEWB 3HA3A 4Q9NA 1A2OA 4QTTB 1V8FA 1J56A 4M38A 2G67A 4WERA 1Z5OA 4JI4B 3MJRA 4CRWB 2B7LA 3E03A 4MW0A 2PYIA 2CHEA 2RHLA 1YZUA 4YB8A 4CHTA 3A4TA 4K26A 4F2DA 1OH6A 3VTFA 4AVYA 1O95D 1OMOA 3WLLA 2CFSA 3K9WA 3RVLA 5LPNA 3ZDFA 3NBXX 3QU2A 1GUFA 3QWBA 1SVKA 1SIBE 3AQIA 3QJ5A 1OLUA 4JGIA 4N7BA 5JE8A 2ZB7A 4PTLA 1R4MB 1CEXA 1ZQ9A 2I1QA 2YY7A 3A9TA 3IODA 3L7MA 3DB2A 3LQKA 3WDMA 2B94A 4UE2A 4WZBA 3TJRA 3WL4A 1U0NA 3WG9A 4KXNA 3CR7A 1Z9BA 1QZTA 2PIDA 1YO6A 3INRA 5MFZA 3TECE 1LPSA 4J4TA 4L5AA 3UH1A 2Q9BA 4E13A 2GN8A 2X41A 5DMXA 3CX7A 3NYRA 5FBZA 3WO0A 1R5JA 2FN9A 3GFRA 3MLEA 2J3HA 1PWHA 1AHPA 1KVSA 2Z8ZA 1V7CA 3S2GA 3E7XA 2ODPA 3JRXA 4X6LA 3LE8A 4G26A 1Y6ZA 1EUCA 4HGQA 2WHQA 1OI4A 3AHJA 3E3LA 1TU4A 3H9GA 2VHUA 4RD0A 4XUGB 4AS3A 3KOYA 3I5YA 1KSHA 5EIBC 4ZVUA 5ALRA 3W77A 3K9QO 3QEJA 1U2ZA 3R5KA 2JJ2A 4PBRA 3IOYA 2C9DA 1KI4A 1KMIY 2HREA 3OD1A 1N3LA 2Z9BA 1EFKA 1I7DA 1CUBA 2QTAA 4TUYA 5JUWA 1EUCB 4IIBA 2B8TA 2P2NA 1QIJA 4JC5A 3M0EA 4L0CA 4ZHQA 1DAEA 1LJ8A 1M1YE 1XZFA 1L3IA 2OV6A 3JY6A 3N05A 1HMYA 4OLFA 5K3BA 2AVDA 2GO7A 2V45A 5P8WA 3ACCA 5EPEA 4MW7A 1NMZA 1ZBQA 1RQNA 4OHOA 4YMSA 3U4HA 3Q41A 3WBFA 2P30A 2HV9A 2B7BA 4TL9A 4B7CA 4N8DA 1RKVA 5FCDA 3AHIA 3IP6A 2CHVA 1PT5A 2R6R1 4BECA 1M72A 3IP9A 3D6AA 4R0VA 2YMMA 2XZPA 3EBOA 4EKYA 4YY3B 2JGKA 4KQKA 3CW9A 5EIWA 3ONFA 1USIA 3PNYA 1X15A 3OPYB 4U7HA 4UAGA 2QOEA 3S4YA 4CI9A 1KK3A 2J31A 2EEPA 2X8WA 5FUWA 2JIOA 3DHEA 4GC9A 5FOTA 2JLWA 2B8NA 1RTTA 5KNBD 1G20E 3KV3O 3ILYA 3N39C 4RPKA 4LE1A 3S8MA 1OE0A 4QM7A 2QZSA 3EDMA 3LLUA 1F4VA 2AFIE 3C15C 4G8CA 5BNWA 1NKSA 2NZUG 1IVYA 3OY2A 1UFQA 5IM4A 4RY0A 5LYJF 4HZUB 4P38A 3PG5A 1YKGA 5DT9A 5K5EA 1BTOA 3I12A 4ARAA 1FS4A 1JQLB 1EQUA 3LUCA 4J3NA 4AY4A 4JQSA 1G8GA 4PYIA 1IN8A 2JFYA 4GPAA 4OOEA 4M0PA 4QPJC 3X44A 4IBOA 1IUNA 1HDZA 2CWDA 2WJJA 1WEHA 2C2OA 2YRFA 1DAGA 4IH9A 2HMYB 3B1JA 3MTQA 4LYEA 5T4FA 1M5TA 1TLTA 1XXHB 3P9IA 3A1EA 1PD0A 1RJ9A 2CNDA 3E1GA 1YONA 2JKVA 3AB7A 1I7LA 3GJ6A 3IQIX 5FV7A 1T10A 3ZC3A 4CTJA 4ERNA 3DTYA 3E6AA 1KE2A 1MIOB 5HGXA 4Y6GB 5JAHA 1XCPA 4EB3A 3RLFA 1FYDA 3C24A 4HFMA 1O5IA 2G63A 3MFQA 3RYIB 1UAGA 1EB9A 5DPMA 1N3YA 1IWOA 2ZQZA 1YK0A 3IAAA 5GM2A 3VTKA 3K1ZA 4B8WA 3N8DA 1II8B 1SUFA 4AMVA 2GRJA 4LW8A 3S1SA 3DTVA 4UE6A 5E6SA 4D0SA 3RU3A 2JATA 3IC5A 3M9WA 5IZCC 3BF7A 3K4HA 1JU9A 1M0SA 1ULHA 1FTSA 4ZU3A 4YX9A 2O2EA 1C14A 2ZYIA 5EEGA 4BB0A 4XM1A 4KIWA 4DWJA 2IP1A 3WRXA 4E2ZA 3HKDA 4R1MA 3KXPA 2TMKA 4XUEA 5BQFA 3LWZA 4BX0A 2Y67A 1EVLA 1XU9A 1CEYA 2W8ZA 1Z5ZA 1XWWA 1N9GB 2LKDA 3BGWA 5F51A 4OHZA 3QLVA 4ZDIA 2OOSA 1JI0A 2J48A 3NRJA 2PH7A 3U44B 5J5AA 1NT4A 1SU7A 2O3SA 2WNSA 3L9WA 4U6QA 5CGQB 5JDCC 4A6XA 2VG8A 3OC0A 4RBNA 1QH0A 1XTPA 3HLKA 3DO5A 1OH7A 1FMFA 4DCUA 4UTZA 4B5LA 3OOJA 2VK4A 2XA9A 3D3EA 1Z4OA 2PN1A 3L7NA 1Y82A 1QKJA 2H9IA 1KOFA 2XRMA 5HBGA 5JROA 4JKYA 4P58A 3ICVA 1JYSA 5B7QA 3G2IA 1C9KA 3RK4A 2GZHA 3PNMA 4N0MA 1GFZA 1A9ZA 1K88A 1SUBA 5AVJA 3IT0A 4Y18A 1R8YA 4NMWA 2QP9X 1NDUA 3SIWA 4R16A 3RRZA 3FSRA 3ICQB 2PJDA 1UT6A 4P0TA 2WG1A 3SMQA 5ADWA 1O96B 1WNTA 3AUSA 3MS7A 1D8TA 2CVQA 5HFJA 3P0IA 1XAJA 2CXXA 3G9ZA 2WP0A 1GU1A 1M7HA 3L0DA 2WU8A 2PL5A 4XUDA 4NIMA 1DXYA 3TXXA 1GZ6A 4ZU1X 4UARA 2HSZA 3JASB 3OZVA 1XJ5A 1MHPA 2H7XA 3GJYA 3H17A 3N8KA 2QTFA 3AYZB 2Q2VA 3QKTA 4XAQA 4EA9A 1T6XA 2WINI 1QCZA 1I0ZA 2WIFA 2IUSA 3A4YA 2OA0A 4FVTA 3ROTA 4CV1A 4QULA 2VPZA 1AO3A 3A6KA 4RXMA 1M5UA 3IBYA 3E3NA 1IN7A 1H2YA 1M2KA 2G0AA 3P9SA 1KGSA 3TK1A 1U3WA 4HUTA 2EFEB 3GJSA 1ZA1A 4TMXA 3LIPA 4BVFA 2QRPA 4YRBA 3DDNA 1F4LA 2X5JO 3ZXSA 3UUEA 1A7AA 1LU9A 4V0LA 4I36A 3HEAA 3D6UA 2G9NA 2DY0A 5A2QA 1OXKB 4GOLD 1RMQA 2RCNA 1DQSA 4QGSA 1I1NA 2WMDA 5KKAA 1U8YA 1QH8A 2MHCA 3AJEA 2BFNA 1MBZA 2RFLA 3IAS1 4P6VF 4QYSA 5DEIA 3U3JA 1WB9A 4JV5B 1TZMA 3RREA 3UMYA 3L01A 1FNCA 4R1PA 2C4NA 4FNMA 5A5DA 1XDZA 1CKEA 1O2DA 1UBHS 1W85B 2H5IA 2QW0X 2D74A 3IBTA 1OC2A 4LPSA 4QARA 5EP1A 4XIGS 1VLLA 4D8WA 5KC8A 4KODA 5GVSA 2WJHA 1Y8CA 4O4LA 2WM2A 3OBBA 4N1AA 2OCPA 5ALYA 4Z6KA 1USGA 4G5XA 1SNYA 3KEGA 1NZJA 3U6BA 3PDIA 1E5DA 4MVJI 5JNWA 1JYEA 3LVBA 1HDCA 4YMHA 4WX2B 1V47A 4H6PA 3OWXA 3UPUA 2GCIA 1IATA 2ZJBA 1Q0TA 5FJJA 2P2GA 3GDWA 4X85A 5E8JA 3NS7A 4LXQA 3VZRA 3PFWO 3E0QA 2K7ZA 2VF8A 3I9KA 3UAVA 2PT7A 2QGFA 3X1DA 2PD4A 2HZBA 4D4LA 3W9BA 3IPRA 4H18A 2IGTA 1ZN7A 3EAGA 1D2MA 1WCIA 2VF4X 3I53A 3PGLA 3WGYA 4MYTA 4ZAXA 3CUKA 3MT7A 5HKLA 5K1ZA 4DF3A 2HCFA 2AMYA 2VQSA 4QFCA 2AG5A 4OO3A 3QBVA 2WKRA 4TKVB 5CP8A 1GZSA 2GEBA 3D3NA 1JVNA 1J0CA 1UPTA 2FRXA 4RJLA 3M6MD 2WUDA 2XE4A 1UMKA 4RD6A 1D5WA 1FRVA 1WDLA 2HHAA 4L6CA 2GCOB 2XUOA 2HM7A 2Z98A 4OK6A 1WZEA 4CODB 1SUEA 1TIPA 1ADCA 1Z3CA 2DWQA 5D3MA 2X0KA 1JX6A 1RHMA 2C5GA 2PR7A 4H1WA 1OWMA 1VIMA 4UXJA 4CF6A 2FZCA 1ECBA 1XAHA 5C2JB 4OKSA 3LWBA 1I13A 1OFHA 3OPVA 1SRRA 4MEAA 2QTCA 4DXDA 1XTKA 1JG4A 1SBHA 4V02A 3RTAA 5A2GA 4H31A 4A7PA 4PX9A 1Q0LA 1IRIA 4OJMX 3JPYA 5L8VA 2V7VA 3C3EA 1T4BA 3CT4A 4QSMA 5AVKA 1XTBA 1E77A 4MWBA 3L0BA 1WS6A 4E0BA 1GSIA 3QM1A 4J2TA 4XJSA 3W0LB 3E5NA 1HFKA 2KI5A 3AINA 3UVEA 4HAWA 3VPAA 4ZGBA 2E1PA 2RC6A 4PNEA 4C6HA 4R1NA 4RANA 5KOIA 1GZUA 3EFEA 5J47A 2JH8A 3Q9LA 5KKNB 1NW4A 3QF7A 4HWRA 4AZ3A 2B0CA 2REOA 1XNHA 1NWCA 2ZI4A 3CXRA 1YA6A 1KDRA 3F1LA 1CJUC 2YHUA 1AA9A 3ZTYA 4GS5A 1ZSNA 3K0FA 1FBTA 3UXEA 3TTWA 2C78A 3ETLA 1U9YA 2FRDA 3WLIA 3K0KA 3O8DA 5FI0B 4P86A 1ULSA 3VR3D 1L5ZA 3TW8A 5AQ1A 1GRRA 4BO2A 1QZZA 3HEMA 3K53A 3RUEA 1QJCA 2NUTB 3FDJA 5F1KA 3K9HA 1OGYA 3AL3A 4EKNB 1T0UA 4NPAA 1VSTA 5C35A 4CXMA 5C8ZA 3LQ1A 1RLUA 2DT5A 5GONA 4QGAA 5U1PA 2FDCA 3ELDA 4FHCA 1UXKA 1C50A 3ORYA 4KPYA 2I6SA 4W9RA 4C4XA 3DWGA 1GNVA 4HLDA 4NAUA 3VR6H 1ZZEA 1SVWA 2DBZA 4Q02A 2BBOA 3SEAA 1C7IA 3PFBA 3UYKA 4RETA 3GFBA 4IPTA 5JZSA 1X7ZA 2R84A 3BSSA 4PXSA 3DVAB 2AXPA 5C8YB 2AQ8A 4NE2A 3IMEA 3SLKA 3ASVA 4WFJA 2XT9A 1E4EB 2D0IA 4GFDA 4B76A 4EO4A 4AF6A 3ESXA 1T0BA 2L19A 2FW8A 5LQCA 4G41A 4EUSA 1X0VA 1W75A 2X2PA 1W30A 3KLMX 2GLUA 5JD5A 1IZZA 1XZDA 3DJFA 4YRZA 1BJTA 5F4ZA 4LN1A 5K51A 4UUPA 5ADHA 1WG8A 4UTOA 3VJMA 4NOLA 3ABIA 3BWXA 1RXYA 4Q7EA 1TEHA 3LFUA 2P5UA 1YXMA 5ALVA 1Q15A 4Q05A 3VMMA 3CVVA 2ZKIA 3AUXA 1XQ6A 4HEA1 4O1MA 3W5SA 3ZZTA 2YBEA 3AEUA 4F3NA 3Q7QA 5LLTA 2PUHA 4DLTA 1TK2A 4KQ1A 1ZVVA 1O94D 5FEMA 4C05A 2W2PA 2GTIA 2WF6A 4DYVA 2C7QA 4NU0A 3HFSA 4YR9A 4YMIA 4UHKA 3EY4A 1L8OA 4KU4A 1WA5A 4MRAA 1KY2A 1UT8A 3O03A 1N0VC 1HF3A 4JJ8A 5DLPA 4QXPA 4P3KA 4JB8A 4IHQA 2ZBQA 3WGHA 1ZK2A 3AM3A 5CLLA 1MQ9A 1W5SA 1DBQA 1E7YA 2VUTA 4GM4A 3E9MA 5LOVB 3HDQA 4MW6A 1QDUA 3VU8A 5IKPA 2A1IA 1MJNA 3ZVRA 4ND8B 5FUYA 1JHMA 1JKXA 2IEIA 4JB0A 4ZODA 3SQMA 4CV2A 1KY4A 3QLUA 1PLLA 5HS4A 1F8YA 1IC6A 2Q2WA 3C8ZA 3R0XA 4KIFA 3F5SA 4Q21A 2PS0A 2DUMA 3IDZA 2G8NA 4B3FX 1SD2A 2F67A 4Z1MD 4ENVA 5JQGB 3WFJA 2HXGA 2YWJA 3BTSA 5ECDA 4E07A 1X38A 2VJMA 3FGPA 4IWYA 1FK8A 1Y1RA 3C14C 3QW4B 4JJ6A 3K8ZA 4P33A 3H2JA 4QJ3A 3RSLA 4C7VA 5L95A 4NMHA 2VSXA 3B1WA 1E0SA 1W34A 3JWHA 5TC4A 1IFXA 3LG2A 3TS1A 5JNSA 4L5IA 3ZVNA 5IVKA 3M5WA 2XSZA 5IVDA 4XWYA 3TPCA 1L3CA 4Q4DA 5B57C 3EOAI 3PQ2A 5I48A 1LS6A 1RWKA 3AEZA 4ZA2A 4UU0A 2F4NA 3ADOA 3JD1A 5A7GA 3F6EX 2YWRA 1LWNA 2V0CA 3FJOA 1ZKMA 4HRAA 3SPXA 1QVWA 3MWEA 3SKXA 4EYGA 4DDVA 3P2YA 1JL3A 4YRNA 5EVCA 1GZ3A 1KZ9A 5KOYA 3MUFA 1G5FA 3EWNA 4HWGA 2O8DB 2QN2A 1MJFA 2D1RA 2OILA 3B2QA 2NXCA 1QE5A 3SBDA 2QVGA 2UVPB 2Z3VA 5FI5A 5HXAA 4JLBA 2D2XA 1YH3A 3IJ5A 4C29A 4M98A 1HE5A 1KTVA 3ZE0B 2HLNA 3FYSA 1LUAA 2ETVA 4YLEA 1M2JA 1THZA 2BFCA 1WSDA 2J7PA 4Q4HB 3F1KA 3SG0A 3ECCA 5LDHA 3FMOB 5CVTA 1J25A 2GN9A 3QEMB 2VR1A 4AZTA 4D2IA 4P2BA 1DCMA 1JT2A 5CMLA 1V3VA 2I8AA 1OASA 3AEUB 4MAAA 5ICMA 3CNEA 4RTQA 4NKRA 5KUTA 3GEMA 1UWVA 2VHCA 4N5IX 2XMQA 1RKUA 4EFDA 2OC4A 3BSWA 1I1HA 1NZFA 1J21A 1SBZA 3QLJA 4DRXB 1U2GC 3H3FA 2W6ZA 1RWNA 3UGJA 2WSMA 3QXHA 4FCCA 4WXYB 1MX5A 2GUWA 5JWHA 4II3A 2NU6A 1XJ0A 2WI8A 3V42A 3O0DA 3D0QA 2V7PA 4Z4EA 1V9LA 1T5LA 1MJHA 2DKFA 4JSYA 5C8YA 2G08A 1Y3FE 2VHZA 2ZUVA 3U3OA 3VPHA 3LXUX 4JT9A 3VTZA 4B3RB 1II0A 1C3JA 1GG2A 5BN3A 4R3UC 3HH8A 1W87A 2QTGA 1G3UA 3KL2A 4LXHA 2FF7A 2XCTB 1E98A 4S1NA 2C2BA 3V7FA 1YS1X 4KXYA 5FTKA 1OIVA 3UWPA 5GONB 4MR7A 1QQAA 1TD1A 2BR4A 1KNXA 2IXTA 1KMNA 3BDIA 3ZU4A 4EW2A 3CVYA 3S2IA 3P32A 2M98A 1AXEA 5DGXA 2EZ8A 1P8AA 4L4YA 1EWKA 2AD5A 3TYXA 5BURA 3KSAC 1VLJA 1KXJA 1RYEA 4TSRA 3HV2A 3OOEA 3T7TA 1ECCA 2GS9A 4RTMA 2RAPA 1T2FA 1X7YB 3EG5A 4RE6A 4WEQA 1P1RA 1VKRA 3DEJA 3K0FB 4CV0A 1H65A 3VO2A 1T9BA 5G4KA 3IVCA 3H4IA 4ARZB 5CFPA 4UEKA 3D2LA 4OGWA 3TQRA 3EC1A 3L2OB 4NY1A 2QD5A 3UA4A 4QUJA 1HOXA 5BWNA 3VVBA 1FE8A 1VPLA 1JTEA 3IUPA 4KAXA 2QRMA 4PPFA 5KTTA 2R6GA 4RQAA 5M29A 1EA5A 1ZG3A 5ALKA 3B8HA 1NUAA 2I3GA 4K87A 1P1IA 3UMMA 2YUIA 3KC2A 4KE7A 5IM4F 2ZI7A 3ULKA 4MCAA 5TXGA 4XIIA 2OQ2A 1JSZA 5C31A 4H7PA 3RV3A 3TMKA 1LBTA 1NM5C 4UM5A 1KAOA 3IVAA 3LUPA 2X0NA 2ZS8A 2OZVA 5ENDA 3I6QA 4S0ZA 1LBSA 2QBYA 2V0GA 3TRHA 1B2LA 4HH0A 5F2NA 4X6XA 4ARCA 3PL5A 1QVRA 1HEIA 4KJZA 4LGCA 4MA5A 5AP9A 2G40A 3BGDA 3VOBA 2FUNB 2C7OA 3QPUA 2ADOA 2WSBA 3FLAA 4BLUA 3PXXA 3MWJA 3ZCPA 2PUFA 4GQIA 2ALJA 1GPNA 4W63A 5K0FA 5BY2A 1GAWA 1P1JA 1VRWA 3HMQA 5C4IA 5J4VA 3R3XA 3O8RA 2CXHA 4DUPA 3RC9A 4CQLA 4GG1A 3ZQKA 3AZQA 4JIMA 2P1DA 1RLOA 1H0KA 3AJ8A 2ZUCA 3QMVA 4UHHA 2IV2X 1KAHA 5K09A 5K8LA 2KS6A 1W36B 4J07A 3UWMA 3ZI4A 3PX7A 4WUVA 3LT4A 1A82A 4B5KA 4BNYA 1XZGA 1S2LA 2W2VA 1SN7A 4GPD1 4PLWA 1IMOA 2ZFUA 3SJ7A 4AJ1A 4TKVA 4HQNA 4WOKA 2H1VA 2J3MA 2FUKA 1M6HA 1TRKA 2JBWA 3B9QA 2I7XA 3O9MA 3DBHA 4ZCTA 3CE6A 1DAKA 3ELYA 5H81A 3STXA 1A5TA 3LUKA 4YCSA 3H2KA 3FKSA 2VDOB 1Z08A 1AXRA 4XGQA 3AB3A 2AW3A 1WMFA 2NPFA 3P2JA 1ZXBA 1O5OA 2QS9A 5ALSA 4OGGA 3VZBA 2VDNB 3M4XA 3MT0A 4KXXA 5HX7A 4QC2A 3EXHB 1JHZA 3I8SA 1AQUA 4H0FA 3DV2A 2XA1A 2JGDA 1JP7A 3GJZA 4ZRDA 4W7SA 1HEYA 2ATVA 1Y4DE 3TINA 4FX2A 3OCWA 1JAXA 3IP1A 1U8UA 3ZGVA 4O4LF 1OKKA 4LBYA 4EGAA 2BD0A 2JIRA 1JXAA 2MJLA 3EA0A 1LEHA 4UJ5A 1DWQA 4C0JA 1XD8A 3RAEC 2WF5A 4J2OA 2MMGA 1Y6QA 2PJZA 2X2EA 3KB2A 3OMXA 4R84A 3VZPA 1L8XA 3RUDA 3H8WA 5KNCA 4E31A 1QQ6A 2Z43A 3HJTA 2XMSA 1TQ2A 3C3WA 3PQ3A 1QH8B 4L0MA 1LXCA 4R0NA 3R3WA 3M82A 3ZZ0A 4FOTA 3PP8A 4MDEA 4RH0A 1EFDN 2D8AA 3ZUPA 2PU5A 5H02A 2R2GA 1CVLA 1Z8DA 1DRWA 1N6KA 1NYQA 3DFKA 3CXUA 1OFGA 3HDVA 3IHTA 1LX6A 1PVOA 2IHTA 1T3GA 4I55B 4B80A 2SNIE 4LWPA 2ZJ0A 3L4BC 4PE5B 1L5WA 3ZV6A 4RPIA 3CB2A 3GO4A 4OL9A 5BSEA 2B4AA 1SZJG 4R6XA 3U5ZB 2WNHA 5EJ7A 3I6BA 4BYMA 4LEIA 4P3PA 4LXIA 2Z6VA 4I5FA 2OLKA 1A97A 1B43A 2PBZA 4LY0A 2C3OA 1V7ZA 3EIUA 4B0PA 1QR2A 4LZWA 3AYXB 3KYIB 2XRZA 3R9WA 1JEDA 1K3UB 3O73A 4G1UC 4FKMA 3TCNA 3PITA 1JJFA 1A4UA 1CUUA 1XRMA 3H13A 3PQFA 4GPZA 1RLIA 3AY0A 3H9EO 3MJEA 1U4OA 1BX0A 1GADO 2DTEA 1WU8A 1H6AA 4RQUA 5L4NA 3DWIA 4RKFA 2B6HA 3HKCB 3TKYA 1RABA 2AOTA 3F9RA 3ZDXB 3EAQA 2D59A 4ZAYA 1SOWA 1O96A 2PGAA 1E5QA 1WOYA 4Q82A 4WFKA 5HQTA 1USVA 3V8MA 2ZTMA 4RZ2A 3GDFA 2J87A 3HXPA 1JE0A 4M0MA 4PG7A 4DMFA 1H8HA 1USUA 1Y33E 2DF8A 5EIOA 1QG6A 2RHTA 3BQMB 4YO8A 2XVMA 3FJYA 2JIZD 5FKJA 3SC2B 3AIIA 2EX4A 1AVTA 2OO3A 1NATA 5KTYA 4RZIA 4LHZA 3U7JA 4B7ZA 3KYDA 3AF0A 4TZ6A 4AUMA 1CCWA 2IS1A 3ZNNA 3DL0A 1QS0A 2GM5A 4PO1A 4W8OA 1VJDA 3JPWA 4Q4CA 1PJRA 1XNRB 1FFEA 1CUZA 5LSAA 1FNNA 2IU6A 3IAXA 3IAHA 4TROA 4BNTA 1LPNA 1AKTA 1XHFA 1FRFS 5JTTA 4EUKA 5ADUS 1C9MA 1Q5PA 5EC8A 5F1YA 3PXCX 1Q3KA 2R2AA 4IDFA 1UQTA 1FYXA 1TM5E 5KDDA 3HDGA 3DLIA 1CUVA 2PAAA 4B71A 2HHJA 2JFOA 1BH2A 4ZYLA 1XQWA 4KTVE 2UZIR 5K0TA 1W4RA 5K4HA 2XLCA 3I37X 4FDUA 3ANMA 1X92A 2MYPA 1AIPA 4HEA6 3BWVA 4WVFA 4PC6A 4Q9JA 4W5TA 3H5VA 4D8YA 3SX2A 3NIGB 3QNMA 5BVGA 1P5JA 9ABPA 4MHTA 1TYEB 3UJAA 2F3UA 5JU6A 3EVFA 3KE8A 1CF4A 3OCYA 3I9V6 3BCUA 4FR2A 1UBMS 3CJQA 1NQUA 1O57A 1JVBA 1UMBB 2W98A 5TB5A 2LCIA 1O97C 1YDFA 1XXHA 5IUJC 7GPBA 4FWBA 1XEXB 1OI2A 2AFVA 4IH1A 4FKBA 3CVOA 1DL5A 1K7YA 3AR9A 1G8AA 2C0CA 1FU8A 2GTPA 2H07A 2NO4A 3S70A 4BN0A 5CB0A 1ZMRA 3FKJA 2JASA 5JTUA 1B1CA 1L4HA 3IBGA 3IEPA 4L4XA 4MVWA 1TVMA 3T1TA 2CGEA 2YS6A 2MMCA 5IJZA 4BBAA 5FPYA 5LCXA 3E18A 1FLDA 1CY0A 1DKMA 1VL6A 1BS2A 3PD7A 1E2LA 4YHBA 5IX8A