1P34C

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
107
structure length
107
Chain Sequence
AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 107
sequence length 107
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p34C00
3B6GB 3LZ0B 1AOIB 5GSUC 1WWIA 3RELA 4WU8A 1P3GA 4H9SC 4YS3C 1JFIB 3LELB 3RELC 5AVCD 2CV5B 4QLCA 1P3FC 5GT3B 1M18D 2BYKA 1HQ3A 3A6ND 4UUZA 3KXBA 3VH6W 3AZMC 2JSSA 3AFAD 5DNMB 4QLCC 2F8NA 3WTPE 4CAYB 4WV4B 4CSRB 1HQ3C 3KUYA 3C1BB 1M1AC 5C3IC 1H3OA 5AY8D 3UTAD 1P3BD 3KUYC 3MNNB 2NQBD 3WKJB 1P3AC 5CHLB 3MGPC 4E44A 4XZQD 2HIOB 5GT0D 4LD9D 5B40D 3AZKD 4J8UA 5B1MD 4Z2MH 3X1TA 3W96B 3NQUB 4J8WD 3MGSA 1N1JB 3AV1D 3X1SA 3B6FB 4Z66B 4JJNC 3UTBC 3VH5T 1WWSA 3LZ0A 3X1TC 2PYOD 3MGSC 3WA9D 1ID3C 5AVBC 4KGCC 5B31B 3X1SC 1KX3B 1B6WA 3W97D 5B33A 4XUJD 3AZHD 2CV5A 3WAAD 3W98C 4J8VA 3AZND 5CPKA 5B0YB 3B0CW 3AZIB 3AZFD 4J8XB 1KX5D 3X1UD 5B33C 5JRGC 3B6GD 1AOID 4J8VC 5CPKC 3AN2B 5E5AB 5B32A 5AV6B 2FJ7B 4E45A 2IO5C 4KHAB 3LELD 5GT3D 3REHB 3AYWB 1ZLAC 4WNNA 5AV8B 3UT9B 4G91C 3WKJA 1EQZD 3O62D 5DNMD 1P34B 4G92C 3MVDA 2F8NH 3MNND 3B6FA 1M18B 1P3LB 1HTAA 5CPJD 1F66A 2AROC 2HIOD 4H9OB 5DNNA 3AFAB 1KX3A 1KX4A 5B2JA 5AV9B 1R4VA 5BNXA 3W99C 3W96D 3X1VB 5B0YA 3AZIA 1KX4C 1P3OD 5B2JC 3UTAB 1P3BB 4Z66D 3LJAA 1P3MC 3AZGD 1U35C 3WTPD 4ZUXA 5AV6A 3AZLC 5B31D 5GT0B 5B2IC 5B0ZC 3MGRA 1P3IA 3AZKB 4ZUXC 5B1MB 3C1CB 5B1LD 5AV8A 2RVQD 3UT9A 3B0DB 4J8XD 1M19D 4H9NA 3AN2D 5E5AD 3AZMB 2FJ7D 3W97B 4ZBJB 3KWQB 4XUJB 5AVCA 3REHD 3AYWD 1M18A 3AZNB 2LY8A 3AZFB 5FUGB 4Z2MG 4M6BA 5CPIC 3REIC 3A6NA 5F99C 4Z5TD 1P34D 3AFAA 3MGPB 3A6NC 5AV5A 3LZ1C 2YFWA 4WU9D 5AY8A 3AZJD 3UTAA 4WU8C 5JA4A 5KDMB 1P3GC 5BO0B 1P3BA 1P3LD 5AV5C 2NQBA 1EQZB 3REKD 3O62B 4EO5C 1S32B 4HGAC 3REJD 4XZQA 3UTBB 3TU4B 1TZYA 5AV9D 4X23B 4LD9A 5B40A 2YFVA 1P3KA 3AZKA 1ID3B 5AVBB 4KGCB 3KXBC 4H9QA 5GXQD 4XZQC 3X1VD 4KUDB 4J8WA 1TZYC 4LD9C 3AV1A 1P3KC 5BT1D 2NZDB 5CPJB 2PYOA 4J8WC 3WA9A 4H9PA 3VH6T 2BYMB 5GSUD 5G49B 3W97A 4XUJA 3AZHA 1TAFA 3C1CD 3WA9C 3AZEB 3WAAA 4YS3D 3AZNA 3AZFA 1P3OB 3RELD 1KX5A 1P3FD 3X1UA 4J8UC 3WAAC 3AZHC 4G91B 3AZGB 1AOIA 2F8NG 3B6GA 3WTPB 3AZMD 3VH5W 5BNVB 4QLCD 3NQJB 3B6GC 3LZ0C 1AOIC 3KWQD 1JFIA 3LELA 5KDMA 1M1AD 5GT3A 5BO0A 5B1LB 1M19B 3LELC 5DNMA 2CV5C 1P3AD 3MGPD 4CAYA 1KU5A 4CSRA 3C1BA 1P3PB 5BS7A 5B32C 3MNNA 3C1BC 4NE5A 5CPJA 1BH9B 1S32D 1P3MB 4JJND 3UTBD 4Z5TB 3TU4D 2HIOA 1ULYA 1U35B 3MNNC 4X23D 5G49A 3WKJC 1ID3D 5AVBD 4KGCD 3AZLB 4KUDD 3W96A 4WU9B 3NQUA 1P3OA 1N1JA 3AZJB 5CP6B 4R8PB 3W98D 4Z66A 3AZGA 3AV2B 2NZDD 3WTPA 5B32G 3MVDC 3REKB 3MGQB 3REJB 5BNVA 5JRGD 5B31A 3B6FC 4AWLC 2F8NK 4YM6B 3R45B 3AZED 1F66C 5B1LA 5GXQB 5DNNC 5B31C 1KX3C 4J8XA 1ZLAD 2HUEB 3REIB 3AN2A 3VH6A 5E5AA 5B0YC 3AZIC 5B24B 2FJ7A 3LJAC 4NFTA 5GSUB 4H9RB 4KHAA 4DRBA 4NE3A 3REHA 3AYWA 5AV6C 4YS3B 1P3IC 3MGRC 3RELB 1P3FB 4Z5TA 1P34A 3REHC 5AV8C 3UT9C 2L5AA 2AROD 4QLCB 2BYKB 1HQ3B 1P3PD 1BH8B 4UUZB 3AZJA 3B0BA 3W99D 1M1AB 5C3IB 1P3LA 2F8NB 4DRAA 3REKA 3KUYB 1P3MD 3REJA 1U35D 4H9OA 5AVCC 1P3AB 5AV9A 1M18C 1P3LC 1H3OB 3R45A 3X1UB 3AZLD 5B0ZD 5B2ID 5GXQA 3AFAC 3X1VA 5AV9C 5CP6D 4R8PD 3AV2D 3X1VC 3MGQD 5AY8C 4J8UB 4JJNB 5BT1C 3UTAC 5GT0A 3X1TB 1P3BC 5GSUA 4YM6D 2NQBC 4H9RA 3MGSB 4H9SA 3X1SB 5B1MA 3C1CA 5GT0C 5B40C 3AZKC 1P3FA 3W98B 5B1MC 3C1CC 3REID 5CPID 1BFMA 3B0DC 3AZMA 5B33B 5F99D 5B24D 1B67A 3AV1C 5JRGB 4J8VB 5CPKB 1F1EA 2PYOC 3KWQA 1BH8A 3LZ1D 1M1AA 1A7WA 2IO5B 5FUGA 5B32B 4WU8D 1P3GD 3W97C 4ZBJC 3KWQC 1ZLAB 5AV5D 4XUJC 1P3AA 3MGPA 3AZNC 3AZFC 1KX5C 3X1UC 4WNNB 1HQ3D 4G92B 3KXBD 3V9RB 1TZYD 2F8ND 1P3KD 1EQZA 3O62A 3KUYD 1S32A 4JJNA 3UTBA 3TU4A 5GT3C 4X23A 3MVDB 2AROB 1ID3A 5AVBA 1EQZC 3O62C 4KGCA 1S32C 4AWLB 3TU4C 4KUDA 5DNMC 4X23C 1F66B 3W98A 3W99B 1KX4B 5DNNB 2NZDA 5B2JB 4KUDC 5BNXB 3B0CT 4J8UD 5BS7C 2BYMA 5JRGA 3X1TD 4NE6A 3MGSD 2NZDC 5CPJC 3X1SD 5B0ZB 5B2IB 3LJAB 3AZEA 2HIOC 3LZ0D 4ZUXB 1ZLAA 1P3IB 3MGRB 3AZEC 3W96C 5B33D 1P3OC 2CV5D 4Z66C 4J8VD 5CPKD 3NQJA 3AZGC 3WTPC 3V9RA 4H9NB 5B32D 3C1BD 1M19A 5CPIB 5B1LC 2RVQC 4J8XC 5F99B 2AROA 5AVCB 1M19C 3WKJD 1P3PA 3AN2C 3A6NB 5E5AC 3LZ1B 3W99A 2FJ7C 1BH9A 4WU8B 1P3GB 1P3PC 1P3MA 5AV5B 5B31G 1U35A 2YFWB 3AYWC 3MVDD 4EO5B 5AY8B 4HGAB 3AZLA 3B6FD 5JA4B 5B2IA 5B0ZA 4Z5TC 1P34C 4WU9A 2NQBB 3KXBB 5CP6A 4R8PA 1F66D 4XZQB 1KX4D 5DNND 1KX3D 1TZYB 1Q9CA 5B2JD 3AV2A 4LD9B 5B40B 2YFVB 4WU9C 1P3KB 3MGQA 3AZJC 4R8PC 5CP6C 4H9QB 5B0YD 3AZID 4YM6A 4J8WB 3AV2C 3VH5A 3AV1B 3REKC 3LJAD 3MGQC 3REJC 2PYOB 4YM6C 4ZUXD 4WZSB 3WA9B 4H9PB 5AV6D 1P3ID 3MGRD 2CWEA 3REIA 5CPIA 5GXQC 5B24A 5F99A 3AZHB 1TAFB 3WAAB 5AV8D 3UT9D 3KSYA 2HUEC 1KX5B 3LZ1A 5B24C 4YS3A
chains in the Genus database with same CATH superfamily
3B6GB 3LZ0B 1AOIB 5GSUC 1WWIA 3RELA 2ZY3A 4WU8A 4H9SC 1P3GA 4YS3C 1JFIB 3LELB 3RELC 5AVCD 2CV5B 4QLCA 1P3FC 5GT3B 1M18D 2BYKA 1HQ3A 3A6ND 4UUZA 3KXBA 3VH6W 3AZMC 2JSSA 3AFAD 5DNMB 4QLCC 2F8NA 3WTPE 4CAYB 4WV4B 4CSRB 1HQ3C 3KUYA 3C1BB 1M1AC 5C3IC 1H3OA 5AY8D 3UTAD 1P3BD 3KUYC 3MNNB 2NQBD 3WKJB 1P3AC 5CHLB 3MGPC 4E44A 4XZQD 2HIOB 5GT0D 4LD9D 5B40D 3AZKD 4J8UA 5B1MD 4Z2MH 3FDDA 3X1TA 3W96B 3NQUB 4J8WD 1Z2CB 1N1JB 3MGSA 3AV1D 3X1SA 3B6FB 4Z66B 2Y2QA 4JJNC 3VH5T 1WWSA 3UTBC 3LZ0A 3X1TC 2PYOD 3MGSC 3WA9D 1ID3C 5AVBC 4KGCC 5B31B 3X1SC 1KX3B 1B6WA 3W97D 3P5JB 5B33A 4XUJD 3AZHD 2CV5A 3WAAD 3W98C 4J8VA 3AZND 5CPKA 5B0YB 3B0CW 3AZIB 3AZFD 4J8XB 1KX5D 1T3UA 3X1UD 5B33C 5JRGC 3B6GD 1AOID 4J8VC 5CPKC 3AN2B 5E5AB 5B32A 2Y2LA 5AV6B 2FJ7B 4E45A 2IO5C 4KHAB 3LELD 2Y2KA 5GT3D 3REHB 3AYWB 1ZLAC 4WNNA 5AV8B 2FFFB 2UWXA 3UT9B 4G91C 3WKJA 1EQZD 3O62D 3H0RC 5DNMD 1P34B 4G92C 2Y2OA 3MVDA 4WJ3C 2F8NH 3MNND 3B6FA 1M18B 1P3LB 1HTAA 5CPJD 1PZRA 1F66A 2AROC 2RIQA 2HIOD 4H9OB 5DNNA 3AFAB 1KX3A 1KX4A 1W2EA 5B2JA 5AV9B 1R4VA 5BNXA 3W99C 3W96D 3X1VB 5B0YA 3AZIA 1KX4C 1P3OD 5B2JC 3UTAB 1P3BB 4Z66D 3LJAA 1P3MC 3AZGD 1U35C 3WTPD 4ZUXA 5AV6A 3AZLC 5B31D 5GT0B 5B2IC 5B0ZC 3MGRA 1P3IA 3AZKB 2XD1A 4ZUXC 5B1MB 3C1CB 5B1LD 5AV8A 2RVQD 3UT9A 3B0DB 4J8XD 1M19D 4H9NA 3AN2D 5E5AD 3AL0C 3AZMB 2BG1A 2FJ7D 3W97B 4ZBJB 3KWQB 4XUJB 5AVCA 2ZY5A 3REHD 3AYWD 2DF4C 1M18A 3AZNB 2LY8A 3AZFB 5FUGB 4Z2MG 4M6BA 5CPIC 3REIC 3A6NA 5F99C 4Z5TD 1P34D 3AFAA 3MGPB 3A6NC 5AV5A 3LZ1C 2YFWA 4WU9D 5AY8A 3AZJD 3UTAA 4WU8C 5JA4A 5KDMB 1P3GC 5BO0B 1P3BA 1P3LD 5AV5C 2NQBA 1EQZB 3REKD 3O62B 4EO5C 1S32B 4HGAC 3REJD 4XZQA 3UTBB 3TU4B 1TZYA 5AV9D 4X23B 4LD9A 5B40A 2YFVA 1P3KA 3AZKA 1ID3B 5AVBB 4KGCB 3KXBC 2J8PA 4H9QA 5GXQD 4XZQC 3X1VD 4KUDB 4J8WA 1TZYC 4LD9C 3AV1A 1P3KC 5BT1D 2Y2IA 2NZDB 5CPJB 2PYOA 4J8WC 3WA9A 4H9PA 3VH6T 2BYMB 5GSUD 5G49B 3W97A 4XUJA 3AZHA 1TAFA 3C1CD 3WA9C 3AZEB 3WAAA 4YS3D 3AZNA 3AZFA 1P3OB 3RELD 1KX5A 1P3FD 3X1UA 4J8UC 3WAAC 3AZHC 4G91B 3AZGB 1AOIA 2F8NG 3B6GA 3WTPB 3AZMD 3EPJA 3VH5W 5BNVB 4QLCD 4UPKA 3NQJB 3B6GC 3LZ0C 1AOIC 3KWQD 1JFIA 3LELA 5KDMA 1M1AD 5GT3A 5BO0A 5B1LB 2Y2MA 1M19B 3LELC 5DNMA 2CV5C 3EG5B 1P3AD 3MGPD 2W8SA 4CAYA 1KU5A 4CSRA 3C1BA 1P3PB 3IP4C 5BS7A 5B32C 3MNNA 3C1BC 4NE5A 5CPJA 1BH9B 1S32D 1P3MB 4JJND 3UTBD 4Z5TB 3TU4D 2HIOA 1ULYA 1U35B 3MNNC 4X23D 3EPLA 5G49A 3WKJC 1ID3D 5AVBD 4KGCD 3AZLB 4KUDD 3W96A 4WU9B 3NQUA 1P3OA 1N1JA 3AZJB 5CP6B 4R8PB 3W98D 4Z66A 3AZGA 3AV2B 2NZDD 3WTPA 5B32G 3MVDC 3REKB 3MGQB 3REJB 5BNVA 5JRGD 5B31A 3B6FC 4AWLC 2F8NK 4YM6B 3EPKA 3R45B 3AZED 1F66C 5B1LA 5GXQB 5DNNC 5B31C 1KX3C 4J8XA 1ZLAD 2HUEB 3REIB 3AN2A 3VH6A 5E5AA 5B0YC 3AZIC 5B24B 2FJ7A 3LJAC 4NFTA 5GSUB 2Y2NA 3A1IA 4H9RB 4KHAA 4DRBA 4NE3A 3REHA 3AYWA 5AV6C 4YS3B 1P3IC 3MGRC 3RELB 1P3FB 4YS3A 2JCHA 4Z5TA 1P34A 3REHC 5AV8C 3UT9C 3F6TA 2L5AA 2AROD 2G5IC 4QLCB 2BYKB 1HQ3B 1P3PD 1BH8B 4UUZB 3AZJA 3B0BA 3W99D 1M1AB 5C3IB 1P3LA 2F8NB 4DRAA 3REKA 3KUYB 1P3MD 3REJA 1U35D 4H9OA 5AVCC 1P3AB 5AV9A 1M18C 1P3LC 1H3OB 3R45A 3X1UB 3AZLD 5B0ZD 5B2ID 3EPHA 5GXQA 3AFAC 3X1VA 5AV9C 2VQRA 5CP6D 4R8PD 3AV2D 3X1VC 2JE5A 3MGQD 5AY8C 4J8UB 4JJNB 5BT1C 3UTAC 2Y2PA 5GT0A 3X1TB 1P3BC 5GSUA 4YM6D 2NQBC 4H9RA 3MGSB 4H9SA 3X1SB 5B1MA 3C1CA 5GT0C 5B40C 3AZKC 1P3FA 3W98B 5B1MC 3C1CC 3REID 5CPID 1BFMA 3B0DC 3AZMA 5B33B 5F99D 5B24D 3KFUG 1B67A 3AV1C 5JRGB 4J8VB 5CPKB 1F1EA 2ZY2A 2PYOC 3KWQA 1BH8A 3LZ1D 1M1AA 1A7WA 2IO5B 5FUGA 5B32B 4WU8D 1P3GD 3W97C 4ZBJC 3KWQC 2ZY4A 5AV5D 4XUJC 1ZLAB 4DQYB 1P3AA 3MGPA 3AZNC 3AZFC 1KX5C 3X1UC 4WNNB 1HQ3D 4G92B 3KXBD 2F2AC 3H0LC 3V9RB 1TZYD 2F8ND 1P3KD 1EQZA 3O62A 3KUYD 1S32A 4JJNA 3UTBA 3TU4A 5GT3C 4X23A 3MVDB 3H0MC 2AROB 2Y2GA 5AVBA 1ID3A 3O62C 1EQZC 4KGCA 1S32C 4AWLB 3TU4C 4KUDA 5DNMC 4X23C 1F66B 3W98A 3W99B 1KX4B 5DNNB 2NZDA 5B2JB 4KUDC 5BNXB 3B0CT 4J8UD 5BS7C 2BYMA 5JRGA 3X1TD 3A1KA 4NE6A 3MGSD 2NZDC 5CPJC 2DQNC 3X1SD 5B0ZB 5B2IB 3LJAB 3AZEA 2HIOC 2Y2HA 3LZ0D 4ZUXB 1ZLAA 1P3IB 3MGRB 3AZEC 3W96C 5B33D 1P3OC 2CV5D 4Z66C 4J8VD 5CPKD 3NQJA 3AZGC 3WTPC 3V9RA 2Y2JA 4H9NB 5B32D 3C1BD 1M19A 5CPIB 5B1LC 2RVQC 4J8XC 5F99B 2AROA 5AVCB 1M19C 3WKJD 1P3PA 3AN2C 3A6NB 5E5AC 3LZ1B 3W99A 2FJ7C 1BH9A 4WU8B 1P3GB 1P3PC 1P3MA 5AV5B 5B31G 1U35A 2YFWB 3AYWC 3MVDD 4EO5B 5AY8B 4HGAB 3AZLA 3B6FD 5JA4B 5B2IA 5B0ZA 4Z5TC 1P34C 4WU9A 2NQBB 3KXBB 2G5HC 5CP6A 4R8PA 1F66D 4XZQB 1KX4D 5DNND 1KX3D 1TZYB 1Q9CA 5B2JD 3AV2A 4LD9B 5B40B 2YFVB 4WU9C 1P3KB 3MGQA 3AZJC 4R8PC 5CP6C 4H9QB 5B0YD 3AZID 4YM6A 4J8WB 3AV2C 3VH5A 3AV1B 3REKC 3LJAD 3MGQC 3REJC 2PYOB 4YM6C 4ZUXD 4WZSB 3WA9B 4H9PB 5AV6D 1P3ID 3MGRD 2CWEA 3REIA 5CPIA 5GXQC 5B24A 5F99A 2ZM5A 3AZHB 1TAFB 3WAAB 5AV8D 3UT9D 3KSYA 2HUEC 1KX5B 3LZ1A 5B24C 2XD5A
chains in the Genus database with same CATH topology
3B6GB 3LZ0B 1AOIB 5GSUC 1WWIA 3RELA 2ZY3A 4WU8A 4H9SC 1P3GA 4YS3C 1JFIB 3LELB 3RELC 5AVCD 2CV5B 4QLCA 1P3FC 5GT3B 1M18D 2BYKA 1HQ3A 3A6ND 4UUZA 3KXBA 3VH6W 3AZMC 2JSSA 3AFAD 5DNMB 4QLCC 2F8NA 3WTPE 4CAYB 4WV4B 4CSRB 1HQ3C 3KUYA 3C1BB 1M1AC 5C3IC 1H3OA 5AY8D 3UTAD 1P3BD 3KUYC 3MNNB 2NQBD 3WKJB 1P3AC 5CHLB 3MGPC 4E44A 4XZQD 2HIOB 5GT0D 4LD9D 5B40D 3AZKD 4J8UA 5B1MD 4Z2MH 3FDDA 3X1TA 3W96B 3NQUB 4J8WD 1Z2CB 1N1JB 3MGSA 3AV1D 3X1SA 3B6FB 4Z66B 2Y2QA 4JJNC 3VH5T 1WWSA 3UTBC 3LZ0A 3X1TC 2PYOD 3MGSC 3WA9D 1ID3C 5AVBC 4KGCC 5B31B 3X1SC 1KX3B 1B6WA 3W97D 3P5JB 5B33A 4XUJD 3AZHD 2CV5A 3WAAD 3W98C 4J8VA 3AZND 5CPKA 5B0YB 3B0CW 3AZIB 3AZFD 4J8XB 1KX5D 1T3UA 3X1UD 5B33C 5JRGC 3B6GD 1AOID 4J8VC 5CPKC 3AN2B 5E5AB 5B32A 2Y2LA 5AV6B 2FJ7B 4E45A 2IO5C 4KHAB 3LELD 2Y2KA 5GT3D 3REHB 3AYWB 1ZLAC 4WNNA 5AV8B 2FFFB 2UWXA 3UT9B 4G91C 3WKJA 1EQZD 3O62D 3H0RC 5DNMD 1P34B 4G92C 2Y2OA 3MVDA 4WJ3C 2F8NH 3MNND 3B6FA 1M18B 1P3LB 1HTAA 5CPJD 1PZRA 1F66A 2AROC 2RIQA 2HIOD 4H9OB 5DNNA 3AFAB 1KX3A 1KX4A 1W2EA 5B2JA 5AV9B 1R4VA 5BNXA 3W99C 3W96D 3X1VB 5B0YA 3AZIA 1KX4C 1P3OD 5B2JC 3UTAB 1P3BB 4Z66D 3LJAA 1P3MC 3AZGD 1U35C 3WTPD 4ZUXA 5AV6A 3AZLC 5B31D 5GT0B 5B2IC 5B0ZC 3MGRA 1P3IA 3AZKB 2XD1A 4ZUXC 5B1MB 3C1CB 5B1LD 5AV8A 2RVQD 3UT9A 3B0DB 4J8XD 1M19D 4H9NA 3AN2D 5E5AD 3AL0C 3AZMB 2BG1A 2FJ7D 3W97B 4ZBJB 3KWQB 4XUJB 5AVCA 2ZY5A 3REHD 3AYWD 2DF4C 1M18A 3AZNB 2LY8A 3AZFB 5FUGB 4Z2MG 4M6BA 5CPIC 3REIC 3A6NA 5F99C 4Z5TD 1P34D 3AFAA 3MGPB 3A6NC 5AV5A 3LZ1C 2YFWA 4WU9D 5AY8A 3AZJD 3UTAA 4WU8C 5JA4A 5KDMB 1P3GC 5BO0B 1P3BA 1P3LD 5AV5C 2NQBA 1EQZB 3REKD 3O62B 4EO5C 1S32B 4HGAC 3REJD 4XZQA 3UTBB 3TU4B 1TZYA 5AV9D 4X23B 4LD9A 5B40A 2YFVA 1P3KA 3AZKA 1ID3B 5AVBB 4KGCB 3KXBC 2J8PA 4H9QA 5GXQD 4XZQC 3X1VD 4KUDB 4J8WA 1TZYC 4LD9C 3AV1A 1P3KC 5BT1D 2Y2IA 2NZDB 5CPJB 2PYOA 4J8WC 3WA9A 4H9PA 3VH6T 2BYMB 5GSUD 5G49B 3W97A 4XUJA 3AZHA 1TAFA 3C1CD 3WA9C 3AZEB 3WAAA 4YS3D 3AZNA 3AZFA 1P3OB 3RELD 1KX5A 1P3FD 3X1UA 4J8UC 3WAAC 3AZHC 4G91B 3AZGB 1AOIA 2F8NG 3B6GA 3WTPB 3AZMD 3EPJA 3VH5W 5BNVB 4QLCD 4UPKA 3NQJB 3B6GC 3LZ0C 1AOIC 3KWQD 1JFIA 3LELA 5KDMA 1M1AD 5GT3A 5BO0A 5B1LB 2Y2MA 1M19B 3LELC 5DNMA 2CV5C 3EG5B 1P3AD 3MGPD 2W8SA 4CAYA 1KU5A 4CSRA 3C1BA 1P3PB 3IP4C 5BS7A 5B32C 3MNNA 3C1BC 4NE5A 5CPJA 1BH9B 1S32D 1P3MB 4JJND 3UTBD 4Z5TB 3TU4D 2HIOA 1ULYA 1U35B 3MNNC 4X23D 3EPLA 5G49A 3WKJC 1ID3D 5AVBD 4KGCD 3AZLB 4KUDD 3W96A 4WU9B 3NQUA 1P3OA 1N1JA 3AZJB 5CP6B 4R8PB 3W98D 4Z66A 3AZGA 3AV2B 2NZDD 3WTPA 5B32G 3MVDC 3REKB 3MGQB 3REJB 5BNVA 5JRGD 5B31A 3B6FC 4AWLC 2F8NK 4YM6B 3EPKA 3R45B 3AZED 1F66C 5B1LA 5GXQB 5DNNC 5B31C 1KX3C 4J8XA 1ZLAD 2HUEB 3REIB 3AN2A 3VH6A 5E5AA 5B0YC 3AZIC 5B24B 2FJ7A 3LJAC 4NFTA 5GSUB 2Y2NA 3A1IA 4H9RB 4KHAA 4DRBA 4NE3A 3REHA 3AYWA 5AV6C 4YS3B 1P3IC 3MGRC 3RELB 1P3FB 4YS3A 2JCHA 4Z5TA 1P34A 3REHC 5AV8C 3UT9C 3F6TA 2L5AA 2AROD 2G5IC 4QLCB 2BYKB 1HQ3B 1P3PD 1BH8B 4UUZB 3AZJA 3B0BA 3W99D 1M1AB 5C3IB 1P3LA 2F8NB 4DRAA 3REKA 3KUYB 1P3MD 3REJA 1U35D 4H9OA 5AVCC 1P3AB 5AV9A 1M18C 1P3LC 1H3OB 3R45A 3X1UB 3AZLD 5B0ZD 5B2ID 3EPHA 5GXQA 3AFAC 3X1VA 5AV9C 2VQRA 5CP6D 4R8PD 3AV2D 3X1VC 2JE5A 3MGQD 5AY8C 4J8UB 4JJNB 5BT1C 3UTAC 2Y2PA 5GT0A 3X1TB 1P3BC 5GSUA 4YM6D 2NQBC 4H9RA 3MGSB 4H9SA 3X1SB 5B1MA 3C1CA 5GT0C 5B40C 3AZKC 1P3FA 3W98B 5B1MC 3C1CC 3REID 5CPID 1BFMA 3B0DC 3AZMA 5B33B 5F99D 5B24D 3KFUG 1B67A 3AV1C 5JRGB 4J8VB 5CPKB 1F1EA 2ZY2A 2PYOC 3KWQA 1BH8A 3LZ1D 1M1AA 1A7WA 2IO5B 5FUGA 5B32B 4WU8D 1P3GD 3W97C 4ZBJC 3KWQC 2ZY4A 5AV5D 4XUJC 1ZLAB 4DQYB 1P3AA 3MGPA 3AZNC 3AZFC 1KX5C 3X1UC 4WNNB 1HQ3D 4G92B 3KXBD 2F2AC 3H0LC 3V9RB 1TZYD 2F8ND 1P3KD 1EQZA 3O62A 3KUYD 1S32A 4JJNA 3UTBA 3TU4A 5GT3C 4X23A 3MVDB 3H0MC 2AROB 2Y2GA 5AVBA 1ID3A 3O62C 1EQZC 4KGCA 1S32C 4AWLB 3TU4C 4KUDA 5DNMC 4X23C 1F66B 3W98A 3W99B 1KX4B 5DNNB 2NZDA 5B2JB 4KUDC 5BNXB 3B0CT 4J8UD 5BS7C 2BYMA 5JRGA 3X1TD 3A1KA 4NE6A 3MGSD 2NZDC 5CPJC 2DQNC 3X1SD 5B0ZB 5B2IB 3LJAB 3AZEA 2HIOC 2Y2HA 3LZ0D 4ZUXB 1ZLAA 1P3IB 3MGRB 3AZEC 3W96C 5B33D 1P3OC 2CV5D 4Z66C 4J8VD 5CPKD 3NQJA 3AZGC 3WTPC 3V9RA 2Y2JA 4H9NB 5B32D 3C1BD 1M19A 5CPIB 5B1LC 2RVQC 4J8XC 5F99B 2AROA 5AVCB 1M19C 3WKJD 1P3PA 3AN2C 3A6NB 5E5AC 3LZ1B 3W99A 2FJ7C 1BH9A 4WU8B 1P3GB 1P3PC 1P3MA 5AV5B 5B31G 1U35A 2YFWB 3AYWC 3MVDD 4EO5B 5AY8B 4HGAB 3AZLA 3B6FD 5JA4B 5B2IA 5B0ZA 4Z5TC 1P34C 4WU9A 2NQBB 3KXBB 2G5HC 5CP6A 4R8PA 1F66D 4XZQB 1KX4D 5DNND 1KX3D 1TZYB 1Q9CA 5B2JD 3AV2A 4LD9B 5B40B 2YFVB 4WU9C 1P3KB 3MGQA 3AZJC 4R8PC 5CP6C 4H9QB 5B0YD 3AZID 4YM6A 4J8WB 3AV2C 3VH5A 3AV1B 3REKC 3LJAD 3MGQC 3REJC 2PYOB 4YM6C 4ZUXD 4WZSB 3WA9B 4H9PB 5AV6D 1P3ID 3MGRD 2CWEA 3REIA 5CPIA 5GXQC 5B24A 5F99A 2ZM5A 3AZHB 1TAFB 3WAAB 5AV8D 3UT9D 3KSYA 2HUEC 1KX5B 3LZ1A 5B24C 2XD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6G B;  3LZ0 B;  1AOI B;  5GSU C;  1WWI A;  3REL A;  4WU8 A;  1P3G A;  4H9S C;  4YS3 C;  1JFI B;  3LEL B;  3REL C;  5AVC D;  2CV5 B;  4QLC A;  1P3F C;  5GT3 B;  1M18 D;  2BYK A;  1HQ3 A;  3A6N D;  4UUZ A;  3KXB A;  3VH6 W;  3AZM C;  2JSS A;  3AFA D;  5DNM B;  4QLC C;  2F8N A;  3WTP E;  4CAY B;  4WV4 B;  4CSR B;  1HQ3 C;  3KUY A;  3C1B B;  1M1A C;  5C3I C;  1H3O A;  5AY8 D;  3UTA D;  1P3B D;  3KUY C;  3MNN B;  2NQB D;  3WKJ B;  1P3A C;  5CHL B;  3MGP C;  4E44 A;  4XZQ D;  2HIO B;  5GT0 D;  4LD9 D;  5B40 D;  3AZK D;  4J8U A;  5B1M D;  4Z2M H;  3X1T A;  3W96 B;  3NQU B;  4J8W D;  3MGS A;  1N1J B;  3AV1 D;  3X1S A;  3B6F B;  4Z66 B;  4JJN C;  3UTB C;  3VH5 T;  1WWS A;  3LZ0 A;  3X1T C;  2PYO D;  3MGS C;  3WA9 D;  1ID3 C;  5AVB C;  4KGC C;  5B31 B;  3X1S C;  1KX3 B;  1B6W A;  3W97 D;  5B33 A;  4XUJ D;  3AZH D;  2CV5 A;  3WAA D;  3W98 C;  4J8V A;  3AZN D;  5CPK A;  5B0Y B;  3B0C W;  3AZI B;  3AZF D;  4J8X B;  1KX5 D;  3X1U D;  5B33 C;  5JRG C;  3B6G D;  1AOI D;  4J8V C;  5CPK C;  3AN2 B;  5E5A B;  5B32 A;  5AV6 B;  2FJ7 B;  4E45 A;  2IO5 C;  4KHA B;  3LEL D;  5GT3 D;  3REH B;  3AYW B;  1ZLA C;  4WNN A;  5AV8 B;  3UT9 B;  4G91 C;  3WKJ A;  1EQZ D;  3O62 D;  5DNM D;  1P34 B;  4G92 C;  3MVD A;  2F8N H;  3MNN D;  3B6F A;  1M18 B;  1P3L B;  1HTA A;  5CPJ D;  1F66 A;  2ARO C;  2HIO D;  4H9O B;  5DNN A;  3AFA B;  1KX3 A;  1KX4 A;  5B2J A;  5AV9 B;  1R4V A;  5BNX A;  3W99 C;  3W96 D;  3X1V B;  5B0Y A;  3AZI A;  1KX4 C;  1P3O D;  5B2J C;  3UTA B;  1P3B B;  4Z66 D;  3LJA A;  1P3M C;  3AZG D;  1U35 C;  3WTP D;  4ZUX A;  5AV6 A;  3AZL C;  5B31 D;  5GT0 B;  5B2I C;  5B0Z C;  3MGR A;  1P3I A;  3AZK B;  4ZUX C;  5B1M B;  3C1C B;  5B1L D;  5AV8 A;  2RVQ D;  3UT9 A;  3B0D B;  4J8X D;  1M19 D;  4H9N A;  3AN2 D;  5E5A D;  3AZM B;  2FJ7 D;  3W97 B;  4ZBJ B;  3KWQ B;  4XUJ B;  5AVC A;  3REH D;  3AYW D;  1M18 A;  3AZN B;  2LY8 A;  3AZF B;  5FUG B;  4Z2M G;  4M6B A;  5CPI C;  3REI C;  3A6N A;  5F99 C;  4Z5T D;  1P34 D;  3AFA A;  3MGP B;  3A6N C;  5AV5 A;  3LZ1 C;  2YFW A;  4WU9 D;  5AY8 A;  3AZJ D;  3UTA A;  4WU8 C;  5JA4 A;  5KDM B;  1P3G C;  5BO0 B;  1P3B A;  1P3L D;  5AV5 C;  2NQB A;  1EQZ B;  3REK D;  3O62 B;  4EO5 C;  1S32 B;  4HGA C;  3REJ D;  4XZQ A;  3UTB B;  3TU4 B;  1TZY A;  5AV9 D;  4X23 B;  4LD9 A;  5B40 A;  2YFV A;  1P3K A;  3AZK A;  1ID3 B;  5AVB B;  4KGC B;  3KXB C;  4H9Q A;  5GXQ D;  4XZQ C;  3X1V D;  4KUD B;  4J8W A;  1TZY C;  4LD9 C;  3AV1 A;  1P3K C;  5BT1 D;  2NZD B;  5CPJ B;  2PYO A;  4J8W C;  3WA9 A;  4H9P A;  3VH6 T;  2BYM B;  5GSU D;  5G49 B;  3W97 A;  4XUJ A;  3AZH A;  1TAF A;  3C1C D;  3WA9 C;  3AZE B;  3WAA A;  4YS3 D;  3AZN A;  3AZF A;  1P3O B;  3REL D;  1KX5 A;  1P3F D;  3X1U A;  4J8U C;  3WAA C;  3AZH C;  4G91 B;  3AZG B;  1AOI A;  2F8N G;  3B6G A;  3WTP B;  3AZM D;  3VH5 W;  5BNV B;  4QLC D;  3NQJ B;  3B6G C;  3LZ0 C;  1AOI C;  3KWQ D;  1JFI A;  3LEL A;  5KDM A;  1M1A D;  5GT3 A;  5BO0 A;  5B1L B;  1M19 B;  3LEL C;  5DNM A;  2CV5 C;  1P3A D;  3MGP D;  4CAY A;  1KU5 A;  4CSR A;  3C1B A;  1P3P B;  5BS7 A;  5B32 C;  3MNN A;  3C1B C;  4NE5 A;  5CPJ A;  1BH9 B;  1S32 D;  1P3M B;  4JJN D;  3UTB D;  4Z5T B;  3TU4 D;  2HIO A;  1ULY A;  1U35 B;  3MNN C;  4X23 D;  5G49 A;  3WKJ C;  1ID3 D;  5AVB D;  4KGC D;  3AZL B;  4KUD D;  3W96 A;  4WU9 B;  3NQU A;  1P3O A;  1N1J A;  3AZJ B;  5CP6 B;  4R8P B;  3W98 D;  4Z66 A;  3AZG A;  3AV2 B;  2NZD D;  3WTP A;  5B32 G;  3MVD C;  3REK B;  3MGQ B;  3REJ B;  5BNV A;  5JRG D;  5B31 A;  3B6F C;  4AWL C;  2F8N K;  4YM6 B;  3R45 B;  3AZE D;  1F66 C;  5B1L A;  5GXQ B;  5DNN C;  5B31 C;  1KX3 C;  4J8X A;  1ZLA D;  2HUE B;  3REI B;  3AN2 A;  3VH6 A;  5E5A A;  5B0Y C;  3AZI C;  5B24 B;  2FJ7 A;  3LJA C;  4NFT A;  5GSU B;  4H9R B;  4KHA A;  4DRB A;  4NE3 A;  3REH A;  3AYW A;  5AV6 C;  4YS3 B;  1P3I C;  3MGR C;  3REL B;  1P3F B;  4Z5T A;  1P34 A;  3REH C;  5AV8 C;  3UT9 C;  2L5A A;  2ARO D;  4QLC B;  2BYK B;  1HQ3 B;  1P3P D;  1BH8 B;  4UUZ B;  3AZJ A;  3B0B A;  3W99 D;  1M1A B;  5C3I B;  1P3L A;  2F8N B;  4DRA A;  3REK A;  3KUY B;  1P3M D;  3REJ A;  1U35 D;  4H9O A;  5AVC C;  1P3A B;  5AV9 A;  1M18 C;  1P3L C;  1H3O B;  3R45 A;  3X1U B;  3AZL D;  5B0Z D;  5B2I D;  5GXQ A;  3AFA C;  3X1V A;  5AV9 C;  5CP6 D;  4R8P D;  3AV2 D;  3X1V C;  3MGQ D;  5AY8 C;  4J8U B;  4JJN B;  5BT1 C;  3UTA C;  5GT0 A;  3X1T B;  1P3B C;  5GSU A;  4YM6 D;  2NQB C;  4H9R A;  3MGS B;  4H9S A;  3X1S B;  5B1M A;  3C1C A;  5GT0 C;  5B40 C;  3AZK C;  1P3F A;  3W98 B;  5B1M C;  3C1C C;  3REI D;  5CPI D;  1BFM A;  3B0D C;  3AZM A;  5B33 B;  5F99 D;  5B24 D;  1B67 A;  3AV1 C;  5JRG B;  4J8V B;  5CPK B;  1F1E A;  2PYO C;  3KWQ A;  1BH8 A;  3LZ1 D;  1M1A A;  1A7W A;  2IO5 B;  5FUG A;  5B32 B;  4WU8 D;  1P3G D;  3W97 C;  4ZBJ C;  3KWQ C;  1ZLA B;  5AV5 D;  4XUJ C;  1P3A A;  3MGP A;  3AZN C;  3AZF C;  1KX5 C;  3X1U C;  4WNN B;  1HQ3 D;  4G92 B;  3KXB D;  3V9R B;  1TZY D;  2F8N D;  1P3K D;  1EQZ A;  3O62 A;  3KUY D;  1S32 A;  4JJN A;  3UTB A;  3TU4 A;  5GT3 C;  4X23 A;  3MVD B;  2ARO B;  1ID3 A;  5AVB A;  1EQZ C;  3O62 C;  4KGC A;  1S32 C;  4AWL B;  3TU4 C;  4KUD A;  5DNM C;  4X23 C;  1F66 B;  3W98 A;  3W99 B;  1KX4 B;  5DNN B;  2NZD A;  5B2J B;  4KUD C;  5BNX B;  3B0C T;  4J8U D;  5BS7 C;  2BYM A;  5JRG A;  3X1T D;  4NE6 A;  3MGS D;  2NZD C;  5CPJ C;  3X1S D;  5B0Z B;  5B2I B;  3LJA B;  3AZE A;  2HIO C;  3LZ0 D;  4ZUX B;  1ZLA A;  1P3I B;  3MGR B;  3AZE C;  3W96 C;  5B33 D;  1P3O C;  2CV5 D;  4Z66 C;  4J8V D;  5CPK D;  3NQJ A;  3AZG C;  3WTP C;  3V9R A;  4H9N B;  5B32 D;  3C1B D;  1M19 A;  5CPI B;  5B1L C;  2RVQ C;  4J8X C;  5F99 B;  2ARO A;  5AVC B;  1M19 C;  3WKJ D;  1P3P A;  3AN2 C;  3A6N B;  5E5A C;  3LZ1 B;  3W99 A;  2FJ7 C;  1BH9 A;  4WU8 B;  1P3G B;  1P3P C;  1P3M A;  5AV5 B;  5B31 G;  1U35 A;  2YFW B;  3AYW C;  3MVD D;  4EO5 B;  5AY8 B;  4HGA B;  3AZL A;  3B6F D;  5JA4 B;  5B2I A;  5B0Z A;  4Z5T C;  1P34 C;  4WU9 A;  2NQB B;  3KXB B;  5CP6 A;  4R8P A;  1F66 D;  4XZQ B;  1KX4 D;  5DNN D;  1KX3 D;  1TZY B;  1Q9C A;  5B2J D;  3AV2 A;  4LD9 B;  5B40 B;  2YFV B;  4WU9 C;  1P3K B;  3MGQ A;  3AZJ C;  4R8P C;  5CP6 C;  4H9Q B;  5B0Y D;  3AZI D;  4YM6 A;  4J8W B;  3AV2 C;  3VH5 A;  3AV1 B;  3REK C;  3LJA D;  3MGQ C;  3REJ C;  2PYO B;  4YM6 C;  4ZUX D;  4WZS B;  3WA9 B;  4H9P B;  5AV6 D;  1P3I D;  3MGR D;  2CWE A;  3REI A;  5CPI A;  5GXQ C;  5B24 A;  5F99 A;  3AZH B;  1TAF B;  3WAA B;  5AV8 D;  3UT9 D;  3KSY A;  2HUE C;  1KX5 B;  3LZ1 A;  5B24 C;  4YS3 A; 
#chains in the Genus database with same CATH topology
 3B6G B;  3LZ0 B;  1AOI B;  5GSU C;  1WWI A;  3REL A;  2ZY3 A;  4WU8 A;  4H9S C;  1P3G A;  4YS3 C;  1JFI B;  3LEL B;  3REL C;  5AVC D;  2CV5 B;  4QLC A;  1P3F C;  5GT3 B;  1M18 D;  2BYK A;  1HQ3 A;  3A6N D;  4UUZ A;  3KXB A;  3VH6 W;  3AZM C;  2JSS A;  3AFA D;  5DNM B;  4QLC C;  2F8N A;  3WTP E;  4CAY B;  4WV4 B;  4CSR B;  1HQ3 C;  3KUY A;  3C1B B;  1M1A C;  5C3I C;  1H3O A;  5AY8 D;  3UTA D;  1P3B D;  3KUY C;  3MNN B;  2NQB D;  3WKJ B;  1P3A C;  5CHL B;  3MGP C;  4E44 A;  4XZQ D;  2HIO B;  5GT0 D;  4LD9 D;  5B40 D;  3AZK D;  4J8U A;  5B1M D;  4Z2M H;  3FDD A;  3X1T A;  3W96 B;  3NQU B;  4J8W D;  1Z2C B;  1N1J B;  3MGS A;  3AV1 D;  3X1S A;  3B6F B;  4Z66 B;  2Y2Q A;  4JJN C;  3VH5 T;  1WWS A;  3UTB C;  3LZ0 A;  3X1T C;  2PYO D;  3MGS C;  3WA9 D;  1ID3 C;  5AVB C;  4KGC C;  5B31 B;  3X1S C;  1KX3 B;  1B6W A;  3W97 D;  3P5J B;  5B33 A;  4XUJ D;  3AZH D;  2CV5 A;  3WAA D;  3W98 C;  4J8V A;  3AZN D;  5CPK A;  5B0Y B;  3B0C W;  3AZI B;  3AZF D;  4J8X B;  1KX5 D;  1T3U A;  3X1U D;  5B33 C;  5JRG C;  3B6G D;  1AOI D;  4J8V C;  5CPK C;  3AN2 B;  5E5A B;  5B32 A;  2Y2L A;  5AV6 B;  2FJ7 B;  4E45 A;  2IO5 C;  4KHA B;  3LEL D;  2Y2K A;  5GT3 D;  3REH B;  3AYW B;  1ZLA C;  4WNN A;  5AV8 B;  2FFF B;  2UWX A;  3UT9 B;  4G91 C;  3WKJ A;  1EQZ D;  3O62 D;  3H0R C;  5DNM D;  1P34 B;  4G92 C;  2Y2O A;  3MVD A;  4WJ3 C;  2F8N H;  3MNN D;  3B6F A;  1M18 B;  1P3L B;  1HTA A;  5CPJ D;  1PZR A;  1F66 A;  2ARO C;  2RIQ A;  2HIO D;  4H9O B;  5DNN A;  3AFA B;  1KX3 A;  1KX4 A;  1W2E A;  5B2J A;  5AV9 B;  1R4V A;  5BNX A;  3W99 C;  3W96 D;  3X1V B;  5B0Y A;  3AZI A;  1KX4 C;  1P3O D;  5B2J C;  3UTA B;  1P3B B;  4Z66 D;  3LJA A;  1P3M C;  3AZG D;  1U35 C;  3WTP D;  4ZUX A;  5AV6 A;  3AZL C;  5B31 D;  5GT0 B;  5B2I C;  5B0Z C;  3MGR A;  1P3I A;  3AZK B;  2XD1 A;  4ZUX C;  5B1M B;  3C1C B;  5B1L D;  5AV8 A;  2RVQ D;  3UT9 A;  3B0D B;  4J8X D;  1M19 D;  4H9N A;  3AN2 D;  5E5A D;  3AL0 C;  3AZM B;  2BG1 A;  2FJ7 D;  3W97 B;  4ZBJ B;  3KWQ B;  4XUJ B;  5AVC A;  2ZY5 A;  3REH D;  3AYW D;  2DF4 C;  1M18 A;  3AZN B;  2LY8 A;  3AZF B;  5FUG B;  4Z2M G;  4M6B A;  5CPI C;  3REI C;  3A6N A;  5F99 C;  4Z5T D;  1P34 D;  3AFA A;  3MGP B;  3A6N C;  5AV5 A;  3LZ1 C;  2YFW A;  4WU9 D;  5AY8 A;  3AZJ D;  3UTA A;  4WU8 C;  5JA4 A;  5KDM B;  1P3G C;  5BO0 B;  1P3B A;  1P3L D;  5AV5 C;  2NQB A;  1EQZ B;  3REK D;  3O62 B;  4EO5 C;  1S32 B;  4HGA C;  3REJ D;  4XZQ A;  3UTB B;  3TU4 B;  1TZY A;  5AV9 D;  4X23 B;  4LD9 A;  5B40 A;  2YFV A;  1P3K A;  3AZK A;  1ID3 B;  5AVB B;  4KGC B;  3KXB C;  2J8P A;  4H9Q A;  5GXQ D;  4XZQ C;  3X1V D;  4KUD B;  4J8W A;  1TZY C;  4LD9 C;  3AV1 A;  1P3K C;  5BT1 D;  2Y2I A;  2NZD B;  5CPJ B;  2PYO A;  4J8W C;  3WA9 A;  4H9P A;  3VH6 T;  2BYM B;  5GSU D;  5G49 B;  3W97 A;  4XUJ A;  3AZH A;  1TAF A;  3C1C D;  3WA9 C;  3AZE B;  3WAA A;  4YS3 D;  3AZN A;  3AZF A;  1P3O B;  3REL D;  1KX5 A;  1P3F D;  3X1U A;  4J8U C;  3WAA C;  3AZH C;  4G91 B;  3AZG B;  1AOI A;  2F8N G;  3B6G A;  3WTP B;  3AZM D;  3EPJ A;  3VH5 W;  5BNV B;  4QLC D;  4UPK A;  3NQJ B;  3B6G C;  3LZ0 C;  1AOI C;  3KWQ D;  1JFI A;  3LEL A;  5KDM A;  1M1A D;  5GT3 A;  5BO0 A;  5B1L B;  2Y2M A;  1M19 B;  3LEL C;  5DNM A;  2CV5 C;  3EG5 B;  1P3A D;  3MGP D;  2W8S A;  4CAY A;  1KU5 A;  4CSR A;  3C1B A;  1P3P B;  3IP4 C;  5BS7 A;  5B32 C;  3MNN A;  3C1B C;  4NE5 A;  5CPJ A;  1BH9 B;  1S32 D;  1P3M B;  4JJN D;  3UTB D;  4Z5T B;  3TU4 D;  2HIO A;  1ULY A;  1U35 B;  3MNN C;  4X23 D;  3EPL A;  5G49 A;  3WKJ C;  1ID3 D;  5AVB D;  4KGC D;  3AZL B;  4KUD D;  3W96 A;  4WU9 B;  3NQU A;  1P3O A;  1N1J A;  3AZJ B;  5CP6 B;  4R8P B;  3W98 D;  4Z66 A;  3AZG A;  3AV2 B;  2NZD D;  3WTP A;  5B32 G;  3MVD C;  3REK B;  3MGQ B;  3REJ B;  5BNV A;  5JRG D;  5B31 A;  3B6F C;  4AWL C;  2F8N K;  4YM6 B;  3EPK A;  3R45 B;  3AZE D;  1F66 C;  5B1L A;  5GXQ B;  5DNN C;  5B31 C;  1KX3 C;  4J8X A;  1ZLA D;  2HUE B;  3REI B;  3AN2 A;  3VH6 A;  5E5A A;  5B0Y C;  3AZI C;  5B24 B;  2FJ7 A;  3LJA C;  4NFT A;  5GSU B;  2Y2N A;  3A1I A;  4H9R B;  4KHA A;  4DRB A;  4NE3 A;  3REH A;  3AYW A;  5AV6 C;  4YS3 B;  1P3I C;  3MGR C;  3REL B;  1P3F B;  4YS3 A;  2JCH A;  4Z5T A;  1P34 A;  3REH C;  5AV8 C;  3UT9 C;  3F6T A;  2L5A A;  2ARO D;  2G5I C;  4QLC B;  2BYK B;  1HQ3 B;  1P3P D;  1BH8 B;  4UUZ B;  3AZJ A;  3B0B A;  3W99 D;  1M1A B;  5C3I B;  1P3L A;  2F8N B;  4DRA A;  3REK A;  3KUY B;  1P3M D;  3REJ A;  1U35 D;  4H9O A;  5AVC C;  1P3A B;  5AV9 A;  1M18 C;  1P3L C;  1H3O B;  3R45 A;  3X1U B;  3AZL D;  5B0Z D;  5B2I D;  3EPH A;  5GXQ A;  3AFA C;  3X1V A;  5AV9 C;  2VQR A;  5CP6 D;  4R8P D;  3AV2 D;  3X1V C;  2JE5 A;  3MGQ D;  5AY8 C;  4J8U B;  4JJN B;  5BT1 C;  3UTA C;  2Y2P A;  5GT0 A;  3X1T B;  1P3B C;  5GSU A;  4YM6 D;  2NQB C;  4H9R A;  3MGS B;  4H9S A;  3X1S B;  5B1M A;  3C1C A;  5GT0 C;  5B40 C;  3AZK C;  1P3F A;  3W98 B;  5B1M C;  3C1C C;  3REI D;  5CPI D;  1BFM A;  3B0D C;  3AZM A;  5B33 B;  5F99 D;  5B24 D;  3KFU G;  1B67 A;  3AV1 C;  5JRG B;  4J8V B;  5CPK B;  1F1E A;  2ZY2 A;  2PYO C;  3KWQ A;  1BH8 A;  3LZ1 D;  1M1A A;  1A7W A;  2IO5 B;  5FUG A;  5B32 B;  4WU8 D;  1P3G D;  3W97 C;  4ZBJ C;  3KWQ C;  2ZY4 A;  5AV5 D;  4XUJ C;  1ZLA B;  4DQY B;  1P3A A;  3MGP A;  3AZN C;  3AZF C;  1KX5 C;  3X1U C;  4WNN B;  1HQ3 D;  4G92 B;  3KXB D;  2F2A C;  3H0L C;  3V9R B;  1TZY D;  2F8N D;  1P3K D;  1EQZ A;  3O62 A;  3KUY D;  1S32 A;  4JJN A;  3UTB A;  3TU4 A;  5GT3 C;  4X23 A;  3MVD B;  3H0M C;  2ARO B;  2Y2G A;  5AVB A;  1ID3 A;  3O62 C;  1EQZ C;  4KGC A;  1S32 C;  4AWL B;  3TU4 C;  4KUD A;  5DNM C;  4X23 C;  1F66 B;  3W98 A;  3W99 B;  1KX4 B;  5DNN B;  2NZD A;  5B2J B;  4KUD C;  5BNX B;  3B0C T;  4J8U D;  5BS7 C;  2BYM A;  5JRG A;  3X1T D;  3A1K A;  4NE6 A;  3MGS D;  2NZD C;  5CPJ C;  2DQN C;  3X1S D;  5B0Z B;  5B2I B;  3LJA B;  3AZE A;  2HIO C;  2Y2H A;  3LZ0 D;  4ZUX B;  1ZLA A;  1P3I B;  3MGR B;  3AZE C;  3W96 C;  5B33 D;  1P3O C;  2CV5 D;  4Z66 C;  4J8V D;  5CPK D;  3NQJ A;  3AZG C;  3WTP C;  3V9R A;  2Y2J A;  4H9N B;  5B32 D;  3C1B D;  1M19 A;  5CPI B;  5B1L C;  2RVQ C;  4J8X C;  5F99 B;  2ARO A;  5AVC B;  1M19 C;  3WKJ D;  1P3P A;  3AN2 C;  3A6N B;  5E5A C;  3LZ1 B;  3W99 A;  2FJ7 C;  1BH9 A;  4WU8 B;  1P3G B;  1P3P C;  1P3M A;  5AV5 B;  5B31 G;  1U35 A;  2YFW B;  3AYW C;  3MVD D;  4EO5 B;  5AY8 B;  4HGA B;  3AZL A;  3B6F D;  5JA4 B;  5B2I A;  5B0Z A;  4Z5T C;  1P34 C;  4WU9 A;  2NQB B;  3KXB B;  2G5H C;  5CP6 A;  4R8P A;  1F66 D;  4XZQ B;  1KX4 D;  5DNN D;  1KX3 D;  1TZY B;  1Q9C A;  5B2J D;  3AV2 A;  4LD9 B;  5B40 B;  2YFV B;  4WU9 C;  1P3K B;  3MGQ A;  3AZJ C;  4R8P C;  5CP6 C;  4H9Q B;  5B0Y D;  3AZI D;  4YM6 A;  4J8W B;  3AV2 C;  3VH5 A;  3AV1 B;  3REK C;  3LJA D;  3MGQ C;  3REJ C;  2PYO B;  4YM6 C;  4ZUX D;  4WZS B;  3WA9 B;  4H9P B;  5AV6 D;  1P3I D;  3MGR D;  2CWE A;  3REI A;  5CPI A;  5GXQ C;  5B24 A;  5F99 A;  2ZM5 A;  3AZH B;  1TAF B;  3WAA B;  5AV8 D;  3UT9 D;  3KSY A;  2HUE C;  1KX5 B;  3LZ1 A;  5B24 C;  2XD5 A; 
#chains in the Genus database with same CATH homology
 3B6G B;  3LZ0 B;  1AOI B;  5GSU C;  1WWI A;  3REL A;  2ZY3 A;  4WU8 A;  4H9S C;  1P3G A;  4YS3 C;  1JFI B;  3LEL B;  3REL C;  5AVC D;  2CV5 B;  4QLC A;  1P3F C;  5GT3 B;  1M18 D;  2BYK A;  1HQ3 A;  3A6N D;  4UUZ A;  3KXB A;  3VH6 W;  3AZM C;  2JSS A;  3AFA D;  5DNM B;  4QLC C;  2F8N A;  3WTP E;  4CAY B;  4WV4 B;  4CSR B;  1HQ3 C;  3KUY A;  3C1B B;  1M1A C;  5C3I C;  1H3O A;  5AY8 D;  3UTA D;  1P3B D;  3KUY C;  3MNN B;  2NQB D;  3WKJ B;  1P3A C;  5CHL B;  3MGP C;  4E44 A;  4XZQ D;  2HIO B;  5GT0 D;  4LD9 D;  5B40 D;  3AZK D;  4J8U A;  5B1M D;  4Z2M H;  3FDD A;  3X1T A;  3W96 B;  3NQU B;  4J8W D;  1Z2C B;  1N1J B;  3MGS A;  3AV1 D;  3X1S A;  3B6F B;  4Z66 B;  2Y2Q A;  4JJN C;  3VH5 T;  1WWS A;  3UTB C;  3LZ0 A;  3X1T C;  2PYO D;  3MGS C;  3WA9 D;  1ID3 C;  5AVB C;  4KGC C;  5B31 B;  3X1S C;  1KX3 B;  1B6W A;  3W97 D;  3P5J B;  5B33 A;  4XUJ D;  3AZH D;  2CV5 A;  3WAA D;  3W98 C;  4J8V A;  3AZN D;  5CPK A;  5B0Y B;  3B0C W;  3AZI B;  3AZF D;  4J8X B;  1KX5 D;  1T3U A;  3X1U D;  5B33 C;  5JRG C;  3B6G D;  1AOI D;  4J8V C;  5CPK C;  3AN2 B;  5E5A B;  5B32 A;  2Y2L A;  5AV6 B;  2FJ7 B;  4E45 A;  2IO5 C;  4KHA B;  3LEL D;  2Y2K A;  5GT3 D;  3REH B;  3AYW B;  1ZLA C;  4WNN A;  5AV8 B;  2FFF B;  2UWX A;  3UT9 B;  4G91 C;  3WKJ A;  1EQZ D;  3O62 D;  3H0R C;  5DNM D;  1P34 B;  4G92 C;  2Y2O A;  3MVD A;  4WJ3 C;  2F8N H;  3MNN D;  3B6F A;  1M18 B;  1P3L B;  1HTA A;  5CPJ D;  1PZR A;  1F66 A;  2ARO C;  2RIQ A;  2HIO D;  4H9O B;  5DNN A;  3AFA B;  1KX3 A;  1KX4 A;  1W2E A;  5B2J A;  5AV9 B;  1R4V A;  5BNX A;  3W99 C;  3W96 D;  3X1V B;  5B0Y A;  3AZI A;  1KX4 C;  1P3O D;  5B2J C;  3UTA B;  1P3B B;  4Z66 D;  3LJA A;  1P3M C;  3AZG D;  1U35 C;  3WTP D;  4ZUX A;  5AV6 A;  3AZL C;  5B31 D;  5GT0 B;  5B2I C;  5B0Z C;  3MGR A;  1P3I A;  3AZK B;  2XD1 A;  4ZUX C;  5B1M B;  3C1C B;  5B1L D;  5AV8 A;  2RVQ D;  3UT9 A;  3B0D B;  4J8X D;  1M19 D;  4H9N A;  3AN2 D;  5E5A D;  3AL0 C;  3AZM B;  2BG1 A;  2FJ7 D;  3W97 B;  4ZBJ B;  3KWQ B;  4XUJ B;  5AVC A;  2ZY5 A;  3REH D;  3AYW D;  2DF4 C;  1M18 A;  3AZN B;  2LY8 A;  3AZF B;  5FUG B;  4Z2M G;  4M6B A;  5CPI C;  3REI C;  3A6N A;  5F99 C;  4Z5T D;  1P34 D;  3AFA A;  3MGP B;  3A6N C;  5AV5 A;  3LZ1 C;  2YFW A;  4WU9 D;  5AY8 A;  3AZJ D;  3UTA A;  4WU8 C;  5JA4 A;  5KDM B;  1P3G C;  5BO0 B;  1P3B A;  1P3L D;  5AV5 C;  2NQB A;  1EQZ B;  3REK D;  3O62 B;  4EO5 C;  1S32 B;  4HGA C;  3REJ D;  4XZQ A;  3UTB B;  3TU4 B;  1TZY A;  5AV9 D;  4X23 B;  4LD9 A;  5B40 A;  2YFV A;  1P3K A;  3AZK A;  1ID3 B;  5AVB B;  4KGC B;  3KXB C;  2J8P A;  4H9Q A;  5GXQ D;  4XZQ C;  3X1V D;  4KUD B;  4J8W A;  1TZY C;  4LD9 C;  3AV1 A;  1P3K C;  5BT1 D;  2Y2I A;  2NZD B;  5CPJ B;  2PYO A;  4J8W C;  3WA9 A;  4H9P A;  3VH6 T;  2BYM B;  5GSU D;  5G49 B;  3W97 A;  4XUJ A;  3AZH A;  1TAF A;  3C1C D;  3WA9 C;  3AZE B;  3WAA A;  4YS3 D;  3AZN A;  3AZF A;  1P3O B;  3REL D;  1KX5 A;  1P3F D;  3X1U A;  4J8U C;  3WAA C;  3AZH C;  4G91 B;  3AZG B;  1AOI A;  2F8N G;  3B6G A;  3WTP B;  3AZM D;  3EPJ A;  3VH5 W;  5BNV B;  4QLC D;  4UPK A;  3NQJ B;  3B6G C;  3LZ0 C;  1AOI C;  3KWQ D;  1JFI A;  3LEL A;  5KDM A;  1M1A D;  5GT3 A;  5BO0 A;  5B1L B;  2Y2M A;  1M19 B;  3LEL C;  5DNM A;  2CV5 C;  3EG5 B;  1P3A D;  3MGP D;  2W8S A;  4CAY A;  1KU5 A;  4CSR A;  3C1B A;  1P3P B;  3IP4 C;  5BS7 A;  5B32 C;  3MNN A;  3C1B C;  4NE5 A;  5CPJ A;  1BH9 B;  1S32 D;  1P3M B;  4JJN D;  3UTB D;  4Z5T B;  3TU4 D;  2HIO A;  1ULY A;  1U35 B;  3MNN C;  4X23 D;  3EPL A;  5G49 A;  3WKJ C;  1ID3 D;  5AVB D;  4KGC D;  3AZL B;  4KUD D;  3W96 A;  4WU9 B;  3NQU A;  1P3O A;  1N1J A;  3AZJ B;  5CP6 B;  4R8P B;  3W98 D;  4Z66 A;  3AZG A;  3AV2 B;  2NZD D;  3WTP A;  5B32 G;  3MVD C;  3REK B;  3MGQ B;  3REJ B;  5BNV A;  5JRG D;  5B31 A;  3B6F C;  4AWL C;  2F8N K;  4YM6 B;  3EPK A;  3R45 B;  3AZE D;  1F66 C;  5B1L A;  5GXQ B;  5DNN C;  5B31 C;  1KX3 C;  4J8X A;  1ZLA D;  2HUE B;  3REI B;  3AN2 A;  3VH6 A;  5E5A A;  5B0Y C;  3AZI C;  5B24 B;  2FJ7 A;  3LJA C;  4NFT A;  5GSU B;  2Y2N A;  3A1I A;  4H9R B;  4KHA A;  4DRB A;  4NE3 A;  3REH A;  3AYW A;  5AV6 C;  4YS3 B;  1P3I C;  3MGR C;  3REL B;  1P3F B;  4YS3 A;  2JCH A;  4Z5T A;  1P34 A;  3REH C;  5AV8 C;  3UT9 C;  3F6T A;  2L5A A;  2ARO D;  2G5I C;  4QLC B;  2BYK B;  1HQ3 B;  1P3P D;  1BH8 B;  4UUZ B;  3AZJ A;  3B0B A;  3W99 D;  1M1A B;  5C3I B;  1P3L A;  2F8N B;  4DRA A;  3REK A;  3KUY B;  1P3M D;  3REJ A;  1U35 D;  4H9O A;  5AVC C;  1P3A B;  5AV9 A;  1M18 C;  1P3L C;  1H3O B;  3R45 A;  3X1U B;  3AZL D;  5B0Z D;  5B2I D;  3EPH A;  5GXQ A;  3AFA C;  3X1V A;  5AV9 C;  2VQR A;  5CP6 D;  4R8P D;  3AV2 D;  3X1V C;  2JE5 A;  3MGQ D;  5AY8 C;  4J8U B;  4JJN B;  5BT1 C;  3UTA C;  2Y2P A;  5GT0 A;  3X1T B;  1P3B C;  5GSU A;  4YM6 D;  2NQB C;  4H9R A;  3MGS B;  4H9S A;  3X1S B;  5B1M A;  3C1C A;  5GT0 C;  5B40 C;  3AZK C;  1P3F A;  3W98 B;  5B1M C;  3C1C C;  3REI D;  5CPI D;  1BFM A;  3B0D C;  3AZM A;  5B33 B;  5F99 D;  5B24 D;  3KFU G;  1B67 A;  3AV1 C;  5JRG B;  4J8V B;  5CPK B;  1F1E A;  2ZY2 A;  2PYO C;  3KWQ A;  1BH8 A;  3LZ1 D;  1M1A A;  1A7W A;  2IO5 B;  5FUG A;  5B32 B;  4WU8 D;  1P3G D;  3W97 C;  4ZBJ C;  3KWQ C;  2ZY4 A;  5AV5 D;  4XUJ C;  1ZLA B;  4DQY B;  1P3A A;  3MGP A;  3AZN C;  3AZF C;  1KX5 C;  3X1U C;  4WNN B;  1HQ3 D;  4G92 B;  3KXB D;  2F2A C;  3H0L C;  3V9R B;  1TZY D;  2F8N D;  1P3K D;  1EQZ A;  3O62 A;  3KUY D;  1S32 A;  4JJN A;  3UTB A;  3TU4 A;  5GT3 C;  4X23 A;  3MVD B;  3H0M C;  2ARO B;  2Y2G A;  5AVB A;  1ID3 A;  3O62 C;  1EQZ C;  4KGC A;  1S32 C;  4AWL B;  3TU4 C;  4KUD A;  5DNM C;  4X23 C;  1F66 B;  3W98 A;  3W99 B;  1KX4 B;  5DNN B;  2NZD A;  5B2J B;  4KUD C;  5BNX B;  3B0C T;  4J8U D;  5BS7 C;  2BYM A;  5JRG A;  3X1T D;  3A1K A;  4NE6 A;  3MGS D;  2NZD C;  5CPJ C;  2DQN C;  3X1S D;  5B0Z B;  5B2I B;  3LJA B;  3AZE A;  2HIO C;  2Y2H A;  3LZ0 D;  4ZUX B;  1ZLA A;  1P3I B;  3MGR B;  3AZE C;  3W96 C;  5B33 D;  1P3O C;  2CV5 D;  4Z66 C;  4J8V D;  5CPK D;  3NQJ A;  3AZG C;  3WTP C;  3V9R A;  2Y2J A;  4H9N B;  5B32 D;  3C1B D;  1M19 A;  5CPI B;  5B1L C;  2RVQ C;  4J8X C;  5F99 B;  2ARO A;  5AVC B;  1M19 C;  3WKJ D;  1P3P A;  3AN2 C;  3A6N B;  5E5A C;  3LZ1 B;  3W99 A;  2FJ7 C;  1BH9 A;  4WU8 B;  1P3G B;  1P3P C;  1P3M A;  5AV5 B;  5B31 G;  1U35 A;  2YFW B;  3AYW C;  3MVD D;  4EO5 B;  5AY8 B;  4HGA B;  3AZL A;  3B6F D;  5JA4 B;  5B2I A;  5B0Z A;  4Z5T C;  1P34 C;  4WU9 A;  2NQB B;  3KXB B;  2G5H C;  5CP6 A;  4R8P A;  1F66 D;  4XZQ B;  1KX4 D;  5DNN D;  1KX3 D;  1TZY B;  1Q9C A;  5B2J D;  3AV2 A;  4LD9 B;  5B40 B;  2YFV B;  4WU9 C;  1P3K B;  3MGQ A;  3AZJ C;  4R8P C;  5CP6 C;  4H9Q B;  5B0Y D;  3AZI D;  4YM6 A;  4J8W B;  3AV2 C;  3VH5 A;  3AV1 B;  3REK C;  3LJA D;  3MGQ C;  3REJ C;  2PYO B;  4YM6 C;  4ZUX D;  4WZS B;  3WA9 B;  4H9P B;  5AV6 D;  1P3I D;  3MGR D;  2CWE A;  3REI A;  5CPI A;  5GXQ C;  5B24 A;  5F99 A;  2ZM5 A;  3AZH B;  1TAF B;  3WAA B;  5AV8 D;  3UT9 D;  3KSY A;  2HUE C;  1KX5 B;  3LZ1 A;  5B24 C;  2XD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...