1P34D

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 36
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p34D00
4NE5A 4XZQC 5B2JC 4HGAC 5E5AA 3LZ0C 3AZFC 3LELA 4R8PC 3X1SA 3UTAD 3WKJA 3LELB 3X1SB 3WKJB 5B0YC 3C1CA 1P34D 3VH6W 3MGPB 4NFTA 3C1CB 5GT3A 1P3OC 2BYMA 4WU9D 3AZKA 5GT3B 2BYMB 3B0CW 4WU8A 3LJAD 1KX3A 3WTPA 1KX3B 4WU8B 5E5AD 5GSUC 3WTPB 5CP6C 4Z2MG 1HQ3C 2FJ7A 5AVCD 3VH6T 3A6NA 2FJ7B 4X23C 3X1UA 3A6NB 3AFAC 4DRAA 5GXQC 3X1UB 3AZLC 1ZLAC 4DRBA 2F8NG 3WA9A 3B0CT 3AZKD 3VH6A 3VH5W 3WA9B 5DNMA 4WU8D 5DNMB 5B40C 1F1EA 3AZMA 5DNNA 4H9OA 1P3GD 5DNNB 4H9OB 3AV2C 2L5AA 4CSRA 3VH5T 4CSRB 4J8WD 1R4VA 3O62A 5DNMD 4YM6D 3O62B 1EQZC 3VH5A 5BS7A 3AZMD 3UT9D 3MGSA 1F66C 4KUDC 3MGSB 3WAAC 3W98D 3MGPC 4LD9A 5B1LD 3MGQC 4LD9B 4J8XA 3NQJA 4J8XB 1P3BA 4ZBJB 5AVBD 3MGRD 3NQJB 5AV5C 5AV6D 5AY8D 5AV8D 3AZNA 3REJD 1U35A 1P3FC 3AZNB 3REIC 1U35B 1P3AC 3B6FC 5CPKD 5BT1C 3AN2A 1P3BD 2PYOB 4QLCA 3AN2B 3V9RA 3V9RB 4KGCC 1AOID 3AYWC 5B1MA 1TAFA 5B32C 1KX4A 3AZND 2HUEB 5B1MB 1TAFB 1KX4B 1P3PA 1M18A 5F99A 4JJNA 3REKC 1BH9A 1P3PB 1M18B 5F99B 1TZYD 1BH9B 4QLCD 4XZQA 5B2JA 2YFVA 3LZ0A 3AZFA 4XZQB 3KWQA 4J8UC 5B2JB 2YFVB 4HGAB 4R8PA 3LZ0B 3AZFB 3AZGC 3W97C 4J8VD 4R8PB 3KXBD 5B0YB 3RELC 3W99D 1P3OA 4JJND 5CPID 1P3OB 1ID3C 5GT0C 5B33C 5GSUA 3AZEC 1P3IC 3KWQD 5CP6A 5GSUB 3B6GD 1S32D 1HQ3A 3C1BC 1HQ3B 4X23A 3AFAA 4X23B 1M1AD 5GXQA 4AWLC 3AZLA 3MNND 3AFAB 1ZLAA 5GXQB 1ZLAB 2AROD 5AV9D 2PYOC 5CPJC 4NE6A 5B31C 5B40A 5C3IC 5B2IA 2NQBC 5B40B 5CP6D 1KU5A 2F8NK 1KX5D 5B24C 3AV2A 4XUJC 3AV2B 1P3MC 3AZLD 1H3OA 4G91B 3REHB 1H3OB 3MVDA 3X1VD 5CHLB 5B2ID 1EQZA 1EQZB 5B0ZD 1F66A 4KUDA 3AZHC 1F66B 1P3LC 3WAAA 4KUDB 3AZJD 3WAAB 3W96C 3MGPA 2HIOC 3MGQA 3MVDD 3MGQB 2BYKA 3KUYC 2BYKB 2NZDC 5AV5A 2CV5C 5AV5B 3LELD 2LY8A 3X1SD 4E44A 3WKJD 4YS3C 3MGPD 5B31G 3C1CD 3X1TC 3REIA 1P3FB 3REIB 1P3AA 1P3KC 5GT3D 3B6FA 1P3AB 3B6FB 1WWSA 1KX3D 3WTPD 3AV1C 4KGCA 3AYWA 2FJ7D 4KGCB 5B32A 3A6ND 3AYWB 1M19C 5B32B 3X1UD 4G91C 4Z2MH 3REHC 2RVQD 5BNXB 3WA9D 3REKA 3REKB 4KHAA 3TU4C 4KHAB 2F8NH 4J8UA 4ZUXC 4G92C 4Z66C 4J8UB 3W97A 3AZGA 5DNND 3AZGB 3W97B 3UTBC 2CWEA 3RELA 3WTPE 3RELB 2JSSA 1HTAA 3O62D 1ID3A 3UTAC 1ID3B 5B33A 5GT0B 3AZEA 1P34C 1P3IA 3LZ1B 5B33B 3AZEB 1P3IB 3MGSD 3C1BA 4WU9C 3C1BB 5JA4A 4LD9D 3LJAC 5JA4B 4AWLB 4J8XD 2PYOA 5CPJA 5AVCC 2IO5C 5CPJB 5KDMA 3NQUA 5B31B 5C3IB 2NQBB 5KDMB 3NQUB 2F8NA 4E45A 5B24A 2F8NB 3AZKC 4XUJA 5B24B 1P3MA 4XUJB 1U35D 5JRGB 1P3MB 1N1JA 4NE3A 1N1JB 2PYOD 3AN2D 1P3GC 3AZHA 2F8ND 1P3LA 3AZHB 5B1MD 4J8WC 3W96A 5B0YA 1P3LB 2HIOA 1KX4D 4YM6C 3W96B 2HIOB 1P3PD 1M18D 3AZMC 5F99D 3UT9C 3KUYA 2NZDA 4XZQD 3KUYB 2CV5A 3LZ1C 5B2JD 3W98C 3LZ0D 3AZFD 2NZDB 2CV5B 4R8PD 5B1LC 4YS3A 5B0YD 3X1TA 4YS3B 3X1TB 5AVBC 3MGRC 1P3KA 1P3OD 5BS7C 5AV6C 1P3KB 5AY8C 4EO5C 1BH8A 5AV8C 3B0BA 5GSUD 1BH8B 3AZIC 3AV1A 3REJC 4WZSB 1HQ3D 4H9NA 3AV1B 4H9NB 4H9PA 4X23D 5CPKC 1M19B 3AFAD 4M6BA 5JRGC 4H9PB 3REHA 5GXQD 1P3BC 1ZLAD 3TU4A 1AOIC 5B40D 4WV4B 3TU4B 4ZUXA 4UUZA 4Z66A 4G92B 4ZUXB 3B0DC 4UUZB 4Z66B 3UTBA 3AV2D 3UTBB 3REHD 4H9SC 1TZYC 1JFIA 1JFIB 3UTAA 4J8VC 3UTAB 1WWIA 3KXBC 1P34A 1EQZD 1P34B 1F66D 4KUDD 4WNNB 5BNVA 3W99C 3WAAD 5BNVB 2YFWB 4JJNC 5CPIC 3LJAA 4WU9B 1P3FA 3KSYA 3LJAB 3MGQD 3KWQC 5FUGA 5E5AB 3B6GC 1S32C 5FUGB 5AVCA 5AVCB 5AV5D 1Q9CA 2IO5B 1M1AC 3MNNC 2AROC 5AV9C 3AZKB 1P3FD 3REID 5BNXA 1P3AD 3B6FD 5BT1D 4H9RA 1P3GA 1KX5C 4H9RB 1P3GB 4Z5TC 1ULYA 4KGCD 3AYWD 4J8WA 5B32D 3X1VC 4CAYA 4YM6A 4J8WB 4CAYB 4YM6B 5B2IC 3REKD 3UT9A 5B0ZC 3AZMB 3UT9B 5GT0A 1B6WA 3AZJC 3LZ1A 3W98A 4J8UD 3W98B 5B1LA 3AZGD 3W97D 5B1LB 3MVDC 3RELD 5AVBA 3MGRA 5AV6A 5AVBB 5E5AC 3MGRB 5AV6B 5AY8A 3LELC 3X1SC 1ID3D 5GT0D 3WKJC 5AV8A 5B31A 4EO5B 5AY8B 5B33D 3LZ1D 3AZED 3C1CC 5AV8B 3AZIA 1P3ID 2NQBA 3REJA 3AZIB 3REJB 3C1BD 5GT3C 5CPKA 5JRGA 1KX3C 4WU8C 5CPKB 3WTPC 1P3BB 1BFMA 3R45A 1AOIA 5CPJD 5B31D 2FJ7C 2NQBD 3R45B 1AOIB 3A6NC 3AZID 3X1UC 2RVQC 3B0DB 5B24D 3WA9C 4XUJD 5JRGD 5DNMC 4H9SA 1TZYA 1P3MD 1TZYB 4QLCB 4J8VA 5DNNC 3KXBA 4J8VB 3KXBB 3AZHD 4H9QA 3W99A 1P3LD 4H9QB 5CPIA 3W99B 3W96D 4JJNB 2HIOD 3O62C 5CPIB 3B6GA 3MGSC 3KWQB 1S32A 3KUYD 3B6GB 1S32B 2NZDD 2CV5D 1M1AA 1B67A 4LD9C 3MNNA 1M1AB 3MNNB 4YS3D 1M19A 2AROA 5AV9A 3X1TD 4J8XC 4ZBJC 2AROB 5AV9B 1P3KD 1A7WA 5CP6B 1KX5A 4Z5TA 1KX5B 3AZNC 5BO0A 4Z5TB 3AV1D 1U35C 5BO0B 3AZLB 3X1VA 1M19D 5B32G 3X1VB 3AN2C 4QLCC 5B2IB 5B0ZA 5B0ZB 3TU4D 3AZJA 2HUEC 5B1MC 4Z5TD 1KX4C 3AZJB 4ZUXD 4WNNA 4Z66D 2YFWA 1P3PC 1M18C 5G49A 5F99C 3UTBD 4WU9A 3MVDB 5G49B
chains in the Genus database with same CATH superfamily
4NE5A 4XZQC 5B2JC 4HGAC 5E5AA 3LZ0C 3AZFC 3LELA 4R8PC 3X1SA 3UTAD 3WKJA 3LELB 3X1SB 3WKJB 5B0YC 3C1CA 1P34D 2ZM5A 3VH6W 3MGPB 4NFTA 3C1CB 5GT3A 1P3OC 2BYMA 4WU9D 3AZKA 5GT3B 2BYMB 3B0CW 4WU8A 3LJAD 1KX3A 3WTPA 1KX3B 4WU8B 5E5AD 5GSUC 3WTPB 5CP6C 4Z2MG 2J8PA 1HQ3C 2FJ7A 5AVCD 3VH6T 3A6NA 2FJ7B 4X23C 3X1UA 3A6NB 3AFAC 4DRAA 5GXQC 3X1UB 3AZLC 1ZLAC 4DRBA 2F8NG 3WA9A 3B0CT 3AZKD 3VH6A 3VH5W 3WA9B 5DNMA 4WU8D 5DNMB 5B40C 1F1EA 3AZMA 2Y2MA 5DNNA 4H9OA 1P3GD 5DNNB 4H9OB 3AV2C 2L5AA 4DQYB 4CSRA 3VH5T 4CSRB 4J8WD 1R4VA 3O62A 5DNMD 4YM6D 3O62B 1EQZC 3VH5A 5BS7A 3AZMD 3UT9D 3MGSA 1F66C 4KUDC 3MGSB 3WAAC 3W98D 3MGPC 4LD9A 3FDDA 5B1LD 3MGQC 4LD9B 4J8XA 3AL0C 3NQJA 4J8XB 1P3BA 4ZBJB 5AVBD 3MGRD 3NQJB 5AV5C 5AV6D 2XD1A 5AY8D 5AV8D 3AZNA 3H0LC 3REJD 1U35A 1P3FC 3AZNB 3REIC 1U35B 2Y2GA 1P3AC 3B6FC 3EG5B 5CPKD 5BT1C 3AN2A 2DQNC 1P3BD 2PYOB 4QLCA 3AN2B 3V9RA 2VQRA 3V9RB 4KGCC 1AOID 3AYWC 5B1MA 1TAFA 5B32C 1KX4A 3AZND 2HUEB 5B1MB 1TAFB 1KX4B 1P3PA 1M18A 5F99A 4JJNA 3REKC 1BH9A 1P3PB 1M18B 5F99B 1TZYD 1BH9B 4QLCD 4XZQA 5B2JA 2YFVA 3LZ0A 3AZFA 4XZQB 3KWQA 4J8UC 5B2JB 2YFVB 4HGAB 4R8PA 3LZ0B 3AZFB 3AZGC 3W97C 4J8VD 4R8PB 3KXBD 5B0YB 3RELC 3W99D 1P3OA 4JJND 5CPID 1P3OB 1ID3C 5GT0C 5B33C 5GSUA 3AZEC 1P3IC 3KWQD 5CP6A 5GSUB 3B6GD 1S32D 1HQ3A 3C1BC 1HQ3B 4X23A 3AFAA 4X23B 1M1AD 5GXQA 4AWLC 3AZLA 3MNND 3AFAB 1ZLAA 5GXQB 1ZLAB 2AROD 5AV9D 2PYOC 5CPJC 4NE6A 5B31C 5B40A 5C3IC 5B2IA 2NQBC 5B40B 5CP6D 1KU5A 2F8NK 2ZY3A 1KX5D 5B24C 3AV2A 4XUJC 1Z2CB 3AV2B 1P3MC 3AZLD 1H3OA 4G91B 3REHB 1H3OB 3MVDA 3X1VD 5CHLB 5B2ID 1EQZA 1EQZB 5B0ZD 1F66A 4KUDA 3AZHC 1F66B 1P3LC 3WAAA 4KUDB 3AZJD 4UPKA 3W96C 3MGPA 3WAAB 2HIOC 3MGQA 2UWXA 3MVDD 3MGQB 2JE5A 2BYKA 3KUYC 2BYKB 2NZDC 5AV5A 2CV5C 5AV5B 3LELD 2LY8A 3X1SD 4E44A 3WKJD 4YS3C 3MGPD 5B31G 3C1CD 3X1TC 3REIA 1P3FB 3REIB 1P3AA 1P3KC 5GT3D 3B6FA 1P3AB 3B6FB 1WWSA 1KX3D 3WTPD 3AV1C 4KGCA 3EPKA 3AYWA 2FJ7D 4KGCB 5B32A 3A6ND 3AYWB 1M19C 5B32B 3X1UD 2ZY2A 4G91C 4Z2MH 3REHC 2RVQD 5BNXB 3WA9D 3REKA 3REKB 4KHAA 3TU4C 4KHAB 1W2EA 2F8NH 4J8UA 4ZUXC 4G92C 4Z66C 4J8UB 3W97A 3AZGA 5DNND 3AZGB 3W97B 3UTBC 2CWEA 3RELA 3WTPE 3RELB 2JSSA 1HTAA 2Y2OA 3O62D 1ID3A 3UTAC 1ID3B 5B33A 5GT0B 3AZEA 1P34C 1P3IA 3LZ1B 5B33B 3AZEB 1P3IB 3MGSD 2Y2NA 3C1BA 4WU9C 3C1BB 5JA4A 3A1KA 4LD9D 3LJAC 5JA4B 4AWLB 4J8XD 2PYOA 5CPJA 5AVCC 2IO5C 5CPJB 5KDMA 3NQUA 5B31B 5C3IB 2NQBB 5KDMB 3NQUB 2F8NA 4E45A 5B24A 2F8NB 3AZKC 4XUJA 2Y2JA 2Y2KA 5B24B 1P3MA 4XUJB 1U35D 5JRGB 1P3MB 1N1JA 4NE3A 1N1JB 2PYOD 3AN2D 1P3GC 2G5HC 3AZHA 2F8ND 3EPHA 1P3LA 3AZHB 5B1MD 4J8WC 3W96A 5B0YA 1P3LB 2HIOA 1KX4D 4YM6C 2XD5A 3W96B 2HIOB 1P3PD 1M18D 3AZMC 5F99D 3UT9C 3KUYA 2NZDA 4XZQD 3KUYB 2CV5A 3LZ1C 5B2JD 3W98C 3LZ0D 3AZFD 2NZDB 2CV5B 4R8PD 3EPJA 3H0MC 5B1LC 4YS3A 5B0YD 2W8SA 3X1TA 4YS3B 3X1TB 5AVBC 3MGRC 1P3KA 1P3OD 5BS7C 5AV6C 1P3KB 5AY8C 4EO5C 1BH8A 5AV8C 3B0BA 5GSUD 1BH8B 3AZIC 3AV1A 3REJC 4WZSB 1HQ3D 4H9NA 3AV1B 4H9NB 4H9PA 2DF4C 4X23D 5CPKC 1M19B 3AFAD 4M6BA 5JRGC 4H9PB 3REHA 5GXQD 1P3BC 1ZLAD 2FFFB 3TU4A 1AOIC 5B40D 4WV4B 3TU4B 4ZUXA 4UUZA 4WJ3C 4Z66A 4G92B 4ZUXB 3B0DC 4UUZB 4Z66B 3UTBA 3AV2D 3UTBB 3REHD 4H9SC 1TZYC 1JFIA 1JFIB 3UTAA 4J8VC 3UTAB 1WWIA 3KXBC 1P34A 1EQZD 1PZRA 1P34B 1F66D 4KUDD 4WNNB 5BNVA 3W99C 3WAAD 5BNVB 2YFWB 4JJNC 5CPIC 3LJAA 4WU9B 1P3FA 3KSYA 3LJAB 3MGQD 3KWQC 5FUGA 5E5AB 3B6GC 1S32C 5FUGB 5AVCA 5AVCB 5AV5D 1Q9CA 2IO5B 1M1AC 3MNNC 2AROC 5AV9C 1T3UA 3AZKB 1P3FD 3REID 5BNXA 1P3AD 3B6FD 5BT1D 4H9RA 1P3GA 1KX5C 4H9RB 1P3GB 2JCHA 4Z5TC 1ULYA 4KGCD 2Y2HA 3AYWD 4J8WA 5B32D 3X1VC 4CAYA 4YM6A 3H0RC 4J8WB 2BG1A 4CAYB 4YM6B 5B2IC 3REKD 3UT9A 5B0ZC 3AZMB 3UT9B 5GT0A 1B6WA 3AZJC 3LZ1A 3W98A 4J8UD 3W98B 5B1LA 3AZGD 3W97D 5B1LB 3MVDC 2Y2IA 3RELD 5AVBA 3MGRA 5AV6A 5AVBB 5E5AC 3MGRB 5AV6B 5AY8A 3LELC 3X1SC 1ID3D 5GT0D 3WKJC 5AV8A 5B31A 4EO5B 5AY8B 5B33D 3LZ1D 3AZED 3C1CC 5AV8B 3AZIA 1P3ID 2NQBA 3REJA 3AZIB 3REJB 3C1BD 5GT3C 5CPKA 5JRGA 1KX3C 4WU8C 5CPKB 3WTPC 1P3BB 1BFMA 3R45A 1AOIA 5CPJD 2Y2LA 5B31D 3F6TA 2FJ7C 2NQBD 3R45B 1AOIB 3A6NC 3AZID 3X1UC 3EPLA 2RVQC 3B0DB 5B24D 3WA9C 4XUJD 5JRGD 5DNMC 3P5JB 1TZYA 4H9SA 1P3MD 3KFUG 2Y2PA 1TZYB 4QLCB 4J8VA 5DNNC 3KXBA 4J8VB 3KXBB 3AZHD 4H9QA 3W99A 1P3LD 4H9QB 5CPIA 3W99B 3W96D 4JJNB 2HIOD 3O62C 5CPIB 2F2AC 3B6GA 3MGSC 3KWQB 1S32A 3KUYD 3B6GB 1S32B 3A1IA 2NZDD 2CV5D 2ZY5A 1M1AA 1B67A 4LD9C 3MNNA 1M1AB 3MNNB 4YS3D 1M19A 2AROA 5AV9A 3X1TD 4J8XC 4ZBJC 2AROB 5AV9B 1P3KD 1A7WA 5CP6B 1KX5A 4Z5TA 1KX5B 3AZNC 5BO0A 4Z5TB 3AV1D 1U35C 5BO0B 3AZLB 3X1VA 2Y2QA 1M19D 5B32G 3X1VB 3AN2C 4QLCC 5B2IB 2ZY4A 5B0ZA 3IP4C 5B0ZB 3TU4D 3AZJA 2HUEC 5B1MC 4Z5TD 1KX4C 2G5IC 3AZJB 4ZUXD 2RIQA 4WNNA 4Z66D 2YFWA 1P3PC 1M18C 5G49A 5F99C 3UTBD 4WU9A 3MVDB 5G49B
chains in the Genus database with same CATH topology
4NE5A 4XZQC 5B2JC 4HGAC 5E5AA 3LZ0C 3AZFC 3LELA 4R8PC 3X1SA 3UTAD 3WKJA 3LELB 3X1SB 3WKJB 5B0YC 3C1CA 1P34D 2ZM5A 3VH6W 3MGPB 4NFTA 3C1CB 5GT3A 1P3OC 2BYMA 4WU9D 3AZKA 5GT3B 2BYMB 3B0CW 4WU8A 3LJAD 1KX3A 3WTPA 1KX3B 4WU8B 5E5AD 5GSUC 3WTPB 5CP6C 4Z2MG 2J8PA 1HQ3C 2FJ7A 5AVCD 3VH6T 3A6NA 2FJ7B 4X23C 3X1UA 3A6NB 3AFAC 4DRAA 5GXQC 3X1UB 3AZLC 1ZLAC 4DRBA 2F8NG 3WA9A 3B0CT 3AZKD 3VH6A 3VH5W 3WA9B 5DNMA 4WU8D 5DNMB 5B40C 1F1EA 3AZMA 2Y2MA 5DNNA 4H9OA 1P3GD 5DNNB 4H9OB 3AV2C 2L5AA 4DQYB 4CSRA 3VH5T 4CSRB 4J8WD 1R4VA 3O62A 5DNMD 4YM6D 3O62B 1EQZC 3VH5A 5BS7A 3AZMD 3UT9D 3MGSA 1F66C 4KUDC 3MGSB 3WAAC 3W98D 3MGPC 4LD9A 3FDDA 5B1LD 3MGQC 4LD9B 4J8XA 3AL0C 3NQJA 4J8XB 1P3BA 4ZBJB 5AVBD 3MGRD 3NQJB 5AV5C 5AV6D 2XD1A 5AY8D 5AV8D 3AZNA 3H0LC 3REJD 1U35A 1P3FC 3AZNB 3REIC 1U35B 2Y2GA 1P3AC 3B6FC 3EG5B 5CPKD 5BT1C 3AN2A 2DQNC 1P3BD 2PYOB 4QLCA 3AN2B 3V9RA 2VQRA 3V9RB 4KGCC 1AOID 3AYWC 5B1MA 1TAFA 5B32C 1KX4A 3AZND 2HUEB 5B1MB 1TAFB 1KX4B 1P3PA 1M18A 5F99A 4JJNA 3REKC 1BH9A 1P3PB 1M18B 5F99B 1TZYD 1BH9B 4QLCD 4XZQA 5B2JA 2YFVA 3LZ0A 3AZFA 4XZQB 3KWQA 4J8UC 5B2JB 2YFVB 4HGAB 4R8PA 3LZ0B 3AZFB 3AZGC 3W97C 4J8VD 4R8PB 3KXBD 5B0YB 3RELC 3W99D 1P3OA 4JJND 5CPID 1P3OB 1ID3C 5GT0C 5B33C 5GSUA 3AZEC 1P3IC 3KWQD 5CP6A 5GSUB 3B6GD 1S32D 1HQ3A 3C1BC 1HQ3B 4X23A 3AFAA 4X23B 1M1AD 5GXQA 4AWLC 3AZLA 3MNND 3AFAB 1ZLAA 5GXQB 1ZLAB 2AROD 5AV9D 2PYOC 5CPJC 4NE6A 5B31C 5B40A 5C3IC 5B2IA 2NQBC 5B40B 5CP6D 1KU5A 2F8NK 2ZY3A 1KX5D 5B24C 3AV2A 4XUJC 1Z2CB 3AV2B 1P3MC 3AZLD 1H3OA 4G91B 3REHB 1H3OB 3MVDA 3X1VD 5CHLB 5B2ID 1EQZA 1EQZB 5B0ZD 1F66A 4KUDA 3AZHC 1F66B 1P3LC 3WAAA 4KUDB 3AZJD 4UPKA 3W96C 3MGPA 3WAAB 2HIOC 3MGQA 2UWXA 3MVDD 3MGQB 2JE5A 2BYKA 3KUYC 2BYKB 2NZDC 5AV5A 2CV5C 5AV5B 3LELD 2LY8A 3X1SD 4E44A 3WKJD 4YS3C 3MGPD 5B31G 3C1CD 3X1TC 3REIA 1P3FB 3REIB 1P3AA 1P3KC 5GT3D 3B6FA 1P3AB 3B6FB 1WWSA 1KX3D 3WTPD 3AV1C 4KGCA 3EPKA 3AYWA 2FJ7D 4KGCB 5B32A 3A6ND 3AYWB 1M19C 5B32B 3X1UD 2ZY2A 4G91C 4Z2MH 3REHC 2RVQD 5BNXB 3WA9D 3REKA 3REKB 4KHAA 3TU4C 4KHAB 1W2EA 2F8NH 4J8UA 4ZUXC 4G92C 4Z66C 4J8UB 3W97A 3AZGA 5DNND 3AZGB 3W97B 3UTBC 2CWEA 3RELA 3WTPE 3RELB 2JSSA 1HTAA 2Y2OA 3O62D 1ID3A 3UTAC 1ID3B 5B33A 5GT0B 3AZEA 1P34C 1P3IA 3LZ1B 5B33B 3AZEB 1P3IB 3MGSD 2Y2NA 3C1BA 4WU9C 3C1BB 5JA4A 3A1KA 4LD9D 3LJAC 5JA4B 4AWLB 4J8XD 2PYOA 5CPJA 5AVCC 2IO5C 5CPJB 5KDMA 3NQUA 5B31B 5C3IB 2NQBB 5KDMB 3NQUB 2F8NA 4E45A 5B24A 2F8NB 3AZKC 4XUJA 2Y2JA 2Y2KA 5B24B 1P3MA 4XUJB 1U35D 5JRGB 1P3MB 1N1JA 4NE3A 1N1JB 2PYOD 3AN2D 1P3GC 2G5HC 3AZHA 2F8ND 3EPHA 1P3LA 3AZHB 5B1MD 4J8WC 3W96A 5B0YA 1P3LB 2HIOA 1KX4D 4YM6C 2XD5A 3W96B 2HIOB 1P3PD 1M18D 3AZMC 5F99D 3UT9C 3KUYA 2NZDA 4XZQD 3KUYB 2CV5A 3LZ1C 5B2JD 3W98C 3LZ0D 3AZFD 2NZDB 2CV5B 4R8PD 3EPJA 3H0MC 5B1LC 4YS3A 5B0YD 2W8SA 3X1TA 4YS3B 3X1TB 5AVBC 3MGRC 1P3KA 1P3OD 5BS7C 5AV6C 1P3KB 5AY8C 4EO5C 1BH8A 5AV8C 3B0BA 5GSUD 1BH8B 3AZIC 3AV1A 3REJC 4WZSB 1HQ3D 4H9NA 3AV1B 4H9NB 4H9PA 2DF4C 4X23D 5CPKC 1M19B 3AFAD 4M6BA 5JRGC 4H9PB 3REHA 5GXQD 1P3BC 1ZLAD 2FFFB 3TU4A 1AOIC 5B40D 4WV4B 3TU4B 4ZUXA 4UUZA 4WJ3C 4Z66A 4G92B 4ZUXB 3B0DC 4UUZB 4Z66B 3UTBA 3AV2D 3UTBB 3REHD 4H9SC 1TZYC 1JFIA 1JFIB 3UTAA 4J8VC 3UTAB 1WWIA 3KXBC 1P34A 1EQZD 1PZRA 1P34B 1F66D 4KUDD 4WNNB 5BNVA 3W99C 3WAAD 5BNVB 2YFWB 4JJNC 5CPIC 3LJAA 4WU9B 1P3FA 3KSYA 3LJAB 3MGQD 3KWQC 5FUGA 5E5AB 3B6GC 1S32C 5FUGB 5AVCA 5AVCB 5AV5D 1Q9CA 2IO5B 1M1AC 3MNNC 2AROC 5AV9C 1T3UA 3AZKB 1P3FD 3REID 5BNXA 1P3AD 3B6FD 5BT1D 4H9RA 1P3GA 1KX5C 4H9RB 1P3GB 2JCHA 4Z5TC 1ULYA 4KGCD 2Y2HA 3AYWD 4J8WA 5B32D 3X1VC 4CAYA 4YM6A 3H0RC 4J8WB 2BG1A 4CAYB 4YM6B 5B2IC 3REKD 3UT9A 5B0ZC 3AZMB 3UT9B 5GT0A 1B6WA 3AZJC 3LZ1A 3W98A 4J8UD 3W98B 5B1LA 3AZGD 3W97D 5B1LB 3MVDC 2Y2IA 3RELD 5AVBA 3MGRA 5AV6A 5AVBB 5E5AC 3MGRB 5AV6B 5AY8A 3LELC 3X1SC 1ID3D 5GT0D 3WKJC 5AV8A 5B31A 4EO5B 5AY8B 5B33D 3LZ1D 3AZED 3C1CC 5AV8B 3AZIA 1P3ID 2NQBA 3REJA 3AZIB 3REJB 3C1BD 5GT3C 5CPKA 5JRGA 1KX3C 4WU8C 5CPKB 3WTPC 1P3BB 1BFMA 3R45A 1AOIA 5CPJD 2Y2LA 5B31D 3F6TA 2FJ7C 2NQBD 3R45B 1AOIB 3A6NC 3AZID 3X1UC 3EPLA 2RVQC 3B0DB 5B24D 3WA9C 4XUJD 5JRGD 5DNMC 3P5JB 1TZYA 4H9SA 1P3MD 3KFUG 2Y2PA 1TZYB 4QLCB 4J8VA 5DNNC 3KXBA 4J8VB 3KXBB 3AZHD 4H9QA 3W99A 1P3LD 4H9QB 5CPIA 3W99B 3W96D 4JJNB 2HIOD 3O62C 5CPIB 2F2AC 3B6GA 3MGSC 3KWQB 1S32A 3KUYD 3B6GB 1S32B 3A1IA 2NZDD 2CV5D 2ZY5A 1M1AA 1B67A 4LD9C 3MNNA 1M1AB 3MNNB 4YS3D 1M19A 2AROA 5AV9A 3X1TD 4J8XC 4ZBJC 2AROB 5AV9B 1P3KD 1A7WA 5CP6B 1KX5A 4Z5TA 1KX5B 3AZNC 5BO0A 4Z5TB 3AV1D 1U35C 5BO0B 3AZLB 3X1VA 2Y2QA 1M19D 5B32G 3X1VB 3AN2C 4QLCC 5B2IB 2ZY4A 5B0ZA 3IP4C 5B0ZB 3TU4D 3AZJA 2HUEC 5B1MC 4Z5TD 1KX4C 2G5IC 3AZJB 4ZUXD 2RIQA 4WNNA 4Z66D 2YFWA 1P3PC 1M18C 5G49A 5F99C 3UTBD 4WU9A 3MVDB 5G49B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NE5 A;  4XZQ C;  5B2J C;  4HGA C;  5E5A A;  3LZ0 C;  3AZF C;  3LEL A;  4R8P C;  3X1S A;  3UTA D;  3WKJ A;  3LEL B;  3X1S B;  3WKJ B;  5B0Y C;  3C1C A;  1P34 D;  3VH6 W;  3MGP B;  4NFT A;  3C1C B;  5GT3 A;  1P3O C;  2BYM A;  4WU9 D;  3AZK A;  5GT3 B;  2BYM B;  3B0C W;  4WU8 A;  3LJA D;  1KX3 A;  3WTP A;  1KX3 B;  4WU8 B;  5E5A D;  5GSU C;  3WTP B;  5CP6 C;  4Z2M G;  1HQ3 C;  2FJ7 A;  5AVC D;  3VH6 T;  3A6N A;  2FJ7 B;  4X23 C;  3X1U A;  3A6N B;  3AFA C;  4DRA A;  5GXQ C;  3X1U B;  3AZL C;  1ZLA C;  4DRB A;  2F8N G;  3WA9 A;  3B0C T;  3AZK D;  3VH6 A;  3VH5 W;  3WA9 B;  5DNM A;  4WU8 D;  5DNM B;  5B40 C;  1F1E A;  3AZM A;  5DNN A;  4H9O A;  1P3G D;  5DNN B;  4H9O B;  3AV2 C;  2L5A A;  4CSR A;  3VH5 T;  4CSR B;  4J8W D;  1R4V A;  3O62 A;  5DNM D;  4YM6 D;  3O62 B;  1EQZ C;  3VH5 A;  5BS7 A;  3AZM D;  3UT9 D;  3MGS A;  1F66 C;  4KUD C;  3MGS B;  3WAA C;  3W98 D;  3MGP C;  4LD9 A;  5B1L D;  3MGQ C;  4LD9 B;  4J8X A;  3NQJ A;  4J8X B;  1P3B A;  4ZBJ B;  5AVB D;  3MGR D;  3NQJ B;  5AV5 C;  5AV6 D;  5AY8 D;  5AV8 D;  3AZN A;  3REJ D;  1U35 A;  1P3F C;  3AZN B;  3REI C;  1U35 B;  1P3A C;  3B6F C;  5CPK D;  5BT1 C;  3AN2 A;  1P3B D;  2PYO B;  4QLC A;  3AN2 B;  3V9R A;  3V9R B;  4KGC C;  1AOI D;  3AYW C;  5B1M A;  1TAF A;  5B32 C;  1KX4 A;  3AZN D;  2HUE B;  5B1M B;  1TAF B;  1KX4 B;  1P3P A;  1M18 A;  5F99 A;  4JJN A;  3REK C;  1BH9 A;  1P3P B;  1M18 B;  5F99 B;  1TZY D;  1BH9 B;  4QLC D;  4XZQ A;  5B2J A;  2YFV A;  3LZ0 A;  3AZF A;  4XZQ B;  3KWQ A;  4J8U C;  5B2J B;  2YFV B;  4HGA B;  4R8P A;  3LZ0 B;  3AZF B;  3AZG C;  3W97 C;  4J8V D;  4R8P B;  3KXB D;  5B0Y B;  3REL C;  3W99 D;  1P3O A;  4JJN D;  5CPI D;  1P3O B;  1ID3 C;  5GT0 C;  5B33 C;  5GSU A;  3AZE C;  1P3I C;  3KWQ D;  5CP6 A;  5GSU B;  3B6G D;  1S32 D;  1HQ3 A;  3C1B C;  1HQ3 B;  4X23 A;  3AFA A;  4X23 B;  1M1A D;  5GXQ A;  4AWL C;  3AZL A;  3MNN D;  3AFA B;  1ZLA A;  5GXQ B;  1ZLA B;  2ARO D;  5AV9 D;  2PYO C;  5CPJ C;  4NE6 A;  5B31 C;  5B40 A;  5C3I C;  5B2I A;  2NQB C;  5B40 B;  5CP6 D;  1KU5 A;  2F8N K;  1KX5 D;  5B24 C;  3AV2 A;  4XUJ C;  3AV2 B;  1P3M C;  3AZL D;  1H3O A;  4G91 B;  3REH B;  1H3O B;  3MVD A;  3X1V D;  5CHL B;  5B2I D;  1EQZ A;  1EQZ B;  5B0Z D;  1F66 A;  4KUD A;  3AZH C;  1F66 B;  1P3L C;  3WAA A;  4KUD B;  3AZJ D;  3WAA B;  3W96 C;  3MGP A;  2HIO C;  3MGQ A;  3MVD D;  3MGQ B;  2BYK A;  3KUY C;  2BYK B;  2NZD C;  5AV5 A;  2CV5 C;  5AV5 B;  3LEL D;  2LY8 A;  3X1S D;  4E44 A;  3WKJ D;  4YS3 C;  3MGP D;  5B31 G;  3C1C D;  3X1T C;  3REI A;  1P3F B;  3REI B;  1P3A A;  1P3K C;  5GT3 D;  3B6F A;  1P3A B;  3B6F B;  1WWS A;  1KX3 D;  3WTP D;  3AV1 C;  4KGC A;  3AYW A;  2FJ7 D;  4KGC B;  5B32 A;  3A6N D;  3AYW B;  1M19 C;  5B32 B;  3X1U D;  4G91 C;  4Z2M H;  3REH C;  2RVQ D;  5BNX B;  3WA9 D;  3REK A;  3REK B;  4KHA A;  3TU4 C;  4KHA B;  2F8N H;  4J8U A;  4ZUX C;  4G92 C;  4Z66 C;  4J8U B;  3W97 A;  3AZG A;  5DNN D;  3AZG B;  3W97 B;  3UTB C;  2CWE A;  3REL A;  3WTP E;  3REL B;  2JSS A;  1HTA A;  3O62 D;  1ID3 A;  3UTA C;  1ID3 B;  5B33 A;  5GT0 B;  3AZE A;  1P34 C;  1P3I A;  3LZ1 B;  5B33 B;  3AZE B;  1P3I B;  3MGS D;  3C1B A;  4WU9 C;  3C1B B;  5JA4 A;  4LD9 D;  3LJA C;  5JA4 B;  4AWL B;  4J8X D;  2PYO A;  5CPJ A;  5AVC C;  2IO5 C;  5CPJ B;  5KDM A;  3NQU A;  5B31 B;  5C3I B;  2NQB B;  5KDM B;  3NQU B;  2F8N A;  4E45 A;  5B24 A;  2F8N B;  3AZK C;  4XUJ A;  5B24 B;  1P3M A;  4XUJ B;  1U35 D;  5JRG B;  1P3M B;  1N1J A;  4NE3 A;  1N1J B;  2PYO D;  3AN2 D;  1P3G C;  3AZH A;  2F8N D;  1P3L A;  3AZH B;  5B1M D;  4J8W C;  3W96 A;  5B0Y A;  1P3L B;  2HIO A;  1KX4 D;  4YM6 C;  3W96 B;  2HIO B;  1P3P D;  1M18 D;  3AZM C;  5F99 D;  3UT9 C;  3KUY A;  2NZD A;  4XZQ D;  3KUY B;  2CV5 A;  3LZ1 C;  5B2J D;  3W98 C;  3LZ0 D;  3AZF D;  2NZD B;  2CV5 B;  4R8P D;  5B1L C;  4YS3 A;  5B0Y D;  3X1T A;  4YS3 B;  3X1T B;  5AVB C;  3MGR C;  1P3K A;  1P3O D;  5BS7 C;  5AV6 C;  1P3K B;  5AY8 C;  4EO5 C;  1BH8 A;  5AV8 C;  3B0B A;  5GSU D;  1BH8 B;  3AZI C;  3AV1 A;  3REJ C;  4WZS B;  1HQ3 D;  4H9N A;  3AV1 B;  4H9N B;  4H9P A;  4X23 D;  5CPK C;  1M19 B;  3AFA D;  4M6B A;  5JRG C;  4H9P B;  3REH A;  5GXQ D;  1P3B C;  1ZLA D;  3TU4 A;  1AOI C;  5B40 D;  4WV4 B;  3TU4 B;  4ZUX A;  4UUZ A;  4Z66 A;  4G92 B;  4ZUX B;  3B0D C;  4UUZ B;  4Z66 B;  3UTB A;  3AV2 D;  3UTB B;  3REH D;  4H9S C;  1TZY C;  1JFI A;  1JFI B;  3UTA A;  4J8V C;  3UTA B;  1WWI A;  3KXB C;  1P34 A;  1EQZ D;  1P34 B;  1F66 D;  4KUD D;  4WNN B;  5BNV A;  3W99 C;  3WAA D;  5BNV B;  2YFW B;  4JJN C;  5CPI C;  3LJA A;  4WU9 B;  1P3F A;  3KSY A;  3LJA B;  3MGQ D;  3KWQ C;  5FUG A;  5E5A B;  3B6G C;  1S32 C;  5FUG B;  5AVC A;  5AVC B;  5AV5 D;  1Q9C A;  2IO5 B;  1M1A C;  3MNN C;  2ARO C;  5AV9 C;  3AZK B;  1P3F D;  3REI D;  5BNX A;  1P3A D;  3B6F D;  5BT1 D;  4H9R A;  1P3G A;  1KX5 C;  4H9R B;  1P3G B;  4Z5T C;  1ULY A;  4KGC D;  3AYW D;  4J8W A;  5B32 D;  3X1V C;  4CAY A;  4YM6 A;  4J8W B;  4CAY B;  4YM6 B;  5B2I C;  3REK D;  3UT9 A;  5B0Z C;  3AZM B;  3UT9 B;  5GT0 A;  1B6W A;  3AZJ C;  3LZ1 A;  3W98 A;  4J8U D;  3W98 B;  5B1L A;  3AZG D;  3W97 D;  5B1L B;  3MVD C;  3REL D;  5AVB A;  3MGR A;  5AV6 A;  5AVB B;  5E5A C;  3MGR B;  5AV6 B;  5AY8 A;  3LEL C;  3X1S C;  1ID3 D;  5GT0 D;  3WKJ C;  5AV8 A;  5B31 A;  4EO5 B;  5AY8 B;  5B33 D;  3LZ1 D;  3AZE D;  3C1C C;  5AV8 B;  3AZI A;  1P3I D;  2NQB A;  3REJ A;  3AZI B;  3REJ B;  3C1B D;  5GT3 C;  5CPK A;  5JRG A;  1KX3 C;  4WU8 C;  5CPK B;  3WTP C;  1P3B B;  1BFM A;  3R45 A;  1AOI A;  5CPJ D;  5B31 D;  2FJ7 C;  2NQB D;  3R45 B;  1AOI B;  3A6N C;  3AZI D;  3X1U C;  2RVQ C;  3B0D B;  5B24 D;  3WA9 C;  4XUJ D;  5JRG D;  5DNM C;  4H9S A;  1TZY A;  1P3M D;  1TZY B;  4QLC B;  4J8V A;  5DNN C;  3KXB A;  4J8V B;  3KXB B;  3AZH D;  4H9Q A;  3W99 A;  1P3L D;  4H9Q B;  5CPI A;  3W99 B;  3W96 D;  4JJN B;  2HIO D;  3O62 C;  5CPI B;  3B6G A;  3MGS C;  3KWQ B;  1S32 A;  3KUY D;  3B6G B;  1S32 B;  2NZD D;  2CV5 D;  1M1A A;  1B67 A;  4LD9 C;  3MNN A;  1M1A B;  3MNN B;  4YS3 D;  1M19 A;  2ARO A;  5AV9 A;  3X1T D;  4J8X C;  4ZBJ C;  2ARO B;  5AV9 B;  1P3K D;  1A7W A;  5CP6 B;  1KX5 A;  4Z5T A;  1KX5 B;  3AZN C;  5BO0 A;  4Z5T B;  3AV1 D;  1U35 C;  5BO0 B;  3AZL B;  3X1V A;  1M19 D;  5B32 G;  3X1V B;  3AN2 C;  4QLC C;  5B2I B;  5B0Z A;  5B0Z B;  3TU4 D;  3AZJ A;  2HUE C;  5B1M C;  4Z5T D;  1KX4 C;  3AZJ B;  4ZUX D;  4WNN A;  4Z66 D;  2YFW A;  1P3P C;  1M18 C;  5G49 A;  5F99 C;  3UTB D;  4WU9 A;  3MVD B;  5G49 B; 
#chains in the Genus database with same CATH topology
 4NE5 A;  4XZQ C;  5B2J C;  4HGA C;  5E5A A;  3LZ0 C;  3AZF C;  3LEL A;  4R8P C;  3X1S A;  3UTA D;  3WKJ A;  3LEL B;  3X1S B;  3WKJ B;  5B0Y C;  3C1C A;  1P34 D;  2ZM5 A;  3VH6 W;  3MGP B;  4NFT A;  3C1C B;  5GT3 A;  1P3O C;  2BYM A;  4WU9 D;  3AZK A;  5GT3 B;  2BYM B;  3B0C W;  4WU8 A;  3LJA D;  1KX3 A;  3WTP A;  1KX3 B;  4WU8 B;  5E5A D;  5GSU C;  3WTP B;  5CP6 C;  4Z2M G;  2J8P A;  1HQ3 C;  2FJ7 A;  5AVC D;  3VH6 T;  3A6N A;  2FJ7 B;  4X23 C;  3X1U A;  3A6N B;  3AFA C;  4DRA A;  5GXQ C;  3X1U B;  3AZL C;  1ZLA C;  4DRB A;  2F8N G;  3WA9 A;  3B0C T;  3AZK D;  3VH6 A;  3VH5 W;  3WA9 B;  5DNM A;  4WU8 D;  5DNM B;  5B40 C;  1F1E A;  3AZM A;  2Y2M A;  5DNN A;  4H9O A;  1P3G D;  5DNN B;  4H9O B;  3AV2 C;  2L5A A;  4DQY B;  4CSR A;  3VH5 T;  4CSR B;  4J8W D;  1R4V A;  3O62 A;  5DNM D;  4YM6 D;  3O62 B;  1EQZ C;  3VH5 A;  5BS7 A;  3AZM D;  3UT9 D;  3MGS A;  1F66 C;  4KUD C;  3MGS B;  3WAA C;  3W98 D;  3MGP C;  4LD9 A;  3FDD A;  5B1L D;  3MGQ C;  4LD9 B;  4J8X A;  3AL0 C;  3NQJ A;  4J8X B;  1P3B A;  4ZBJ B;  5AVB D;  3MGR D;  3NQJ B;  5AV5 C;  5AV6 D;  2XD1 A;  5AY8 D;  5AV8 D;  3AZN A;  3H0L C;  3REJ D;  1U35 A;  1P3F C;  3AZN B;  3REI C;  1U35 B;  2Y2G A;  1P3A C;  3B6F C;  3EG5 B;  5CPK D;  5BT1 C;  3AN2 A;  2DQN C;  1P3B D;  2PYO B;  4QLC A;  3AN2 B;  3V9R A;  2VQR A;  3V9R B;  4KGC C;  1AOI D;  3AYW C;  5B1M A;  1TAF A;  5B32 C;  1KX4 A;  3AZN D;  2HUE B;  5B1M B;  1TAF B;  1KX4 B;  1P3P A;  1M18 A;  5F99 A;  4JJN A;  3REK C;  1BH9 A;  1P3P B;  1M18 B;  5F99 B;  1TZY D;  1BH9 B;  4QLC D;  4XZQ A;  5B2J A;  2YFV A;  3LZ0 A;  3AZF A;  4XZQ B;  3KWQ A;  4J8U C;  5B2J B;  2YFV B;  4HGA B;  4R8P A;  3LZ0 B;  3AZF B;  3AZG C;  3W97 C;  4J8V D;  4R8P B;  3KXB D;  5B0Y B;  3REL C;  3W99 D;  1P3O A;  4JJN D;  5CPI D;  1P3O B;  1ID3 C;  5GT0 C;  5B33 C;  5GSU A;  3AZE C;  1P3I C;  3KWQ D;  5CP6 A;  5GSU B;  3B6G D;  1S32 D;  1HQ3 A;  3C1B C;  1HQ3 B;  4X23 A;  3AFA A;  4X23 B;  1M1A D;  5GXQ A;  4AWL C;  3AZL A;  3MNN D;  3AFA B;  1ZLA A;  5GXQ B;  1ZLA B;  2ARO D;  5AV9 D;  2PYO C;  5CPJ C;  4NE6 A;  5B31 C;  5B40 A;  5C3I C;  5B2I A;  2NQB C;  5B40 B;  5CP6 D;  1KU5 A;  2F8N K;  2ZY3 A;  1KX5 D;  5B24 C;  3AV2 A;  4XUJ C;  1Z2C B;  3AV2 B;  1P3M C;  3AZL D;  1H3O A;  4G91 B;  3REH B;  1H3O B;  3MVD A;  3X1V D;  5CHL B;  5B2I D;  1EQZ A;  1EQZ B;  5B0Z D;  1F66 A;  4KUD A;  3AZH C;  1F66 B;  1P3L C;  3WAA A;  4KUD B;  3AZJ D;  4UPK A;  3W96 C;  3MGP A;  3WAA B;  2HIO C;  3MGQ A;  2UWX A;  3MVD D;  3MGQ B;  2JE5 A;  2BYK A;  3KUY C;  2BYK B;  2NZD C;  5AV5 A;  2CV5 C;  5AV5 B;  3LEL D;  2LY8 A;  3X1S D;  4E44 A;  3WKJ D;  4YS3 C;  3MGP D;  5B31 G;  3C1C D;  3X1T C;  3REI A;  1P3F B;  3REI B;  1P3A A;  1P3K C;  5GT3 D;  3B6F A;  1P3A B;  3B6F B;  1WWS A;  1KX3 D;  3WTP D;  3AV1 C;  4KGC A;  3EPK A;  3AYW A;  2FJ7 D;  4KGC B;  5B32 A;  3A6N D;  3AYW B;  1M19 C;  5B32 B;  3X1U D;  2ZY2 A;  4G91 C;  4Z2M H;  3REH C;  2RVQ D;  5BNX B;  3WA9 D;  3REK A;  3REK B;  4KHA A;  3TU4 C;  4KHA B;  1W2E A;  2F8N H;  4J8U A;  4ZUX C;  4G92 C;  4Z66 C;  4J8U B;  3W97 A;  3AZG A;  5DNN D;  3AZG B;  3W97 B;  3UTB C;  2CWE A;  3REL A;  3WTP E;  3REL B;  2JSS A;  1HTA A;  2Y2O A;  3O62 D;  1ID3 A;  3UTA C;  1ID3 B;  5B33 A;  5GT0 B;  3AZE A;  1P34 C;  1P3I A;  3LZ1 B;  5B33 B;  3AZE B;  1P3I B;  3MGS D;  2Y2N A;  3C1B A;  4WU9 C;  3C1B B;  5JA4 A;  3A1K A;  4LD9 D;  3LJA C;  5JA4 B;  4AWL B;  4J8X D;  2PYO A;  5CPJ A;  5AVC C;  2IO5 C;  5CPJ B;  5KDM A;  3NQU A;  5B31 B;  5C3I B;  2NQB B;  5KDM B;  3NQU B;  2F8N A;  4E45 A;  5B24 A;  2F8N B;  3AZK C;  4XUJ A;  2Y2J A;  2Y2K A;  5B24 B;  1P3M A;  4XUJ B;  1U35 D;  5JRG B;  1P3M B;  1N1J A;  4NE3 A;  1N1J B;  2PYO D;  3AN2 D;  1P3G C;  2G5H C;  3AZH A;  2F8N D;  3EPH A;  1P3L A;  3AZH B;  5B1M D;  4J8W C;  3W96 A;  5B0Y A;  1P3L B;  2HIO A;  1KX4 D;  4YM6 C;  2XD5 A;  3W96 B;  2HIO B;  1P3P D;  1M18 D;  3AZM C;  5F99 D;  3UT9 C;  3KUY A;  2NZD A;  4XZQ D;  3KUY B;  2CV5 A;  3LZ1 C;  5B2J D;  3W98 C;  3LZ0 D;  3AZF D;  2NZD B;  2CV5 B;  4R8P D;  3EPJ A;  3H0M C;  5B1L C;  4YS3 A;  5B0Y D;  2W8S A;  3X1T A;  4YS3 B;  3X1T B;  5AVB C;  3MGR C;  1P3K A;  1P3O D;  5BS7 C;  5AV6 C;  1P3K B;  5AY8 C;  4EO5 C;  1BH8 A;  5AV8 C;  3B0B A;  5GSU D;  1BH8 B;  3AZI C;  3AV1 A;  3REJ C;  4WZS B;  1HQ3 D;  4H9N A;  3AV1 B;  4H9N B;  4H9P A;  2DF4 C;  4X23 D;  5CPK C;  1M19 B;  3AFA D;  4M6B A;  5JRG C;  4H9P B;  3REH A;  5GXQ D;  1P3B C;  1ZLA D;  2FFF B;  3TU4 A;  1AOI C;  5B40 D;  4WV4 B;  3TU4 B;  4ZUX A;  4UUZ A;  4WJ3 C;  4Z66 A;  4G92 B;  4ZUX B;  3B0D C;  4UUZ B;  4Z66 B;  3UTB A;  3AV2 D;  3UTB B;  3REH D;  4H9S C;  1TZY C;  1JFI A;  1JFI B;  3UTA A;  4J8V C;  3UTA B;  1WWI A;  3KXB C;  1P34 A;  1EQZ D;  1PZR A;  1P34 B;  1F66 D;  4KUD D;  4WNN B;  5BNV A;  3W99 C;  3WAA D;  5BNV B;  2YFW B;  4JJN C;  5CPI C;  3LJA A;  4WU9 B;  1P3F A;  3KSY A;  3LJA B;  3MGQ D;  3KWQ C;  5FUG A;  5E5A B;  3B6G C;  1S32 C;  5FUG B;  5AVC A;  5AVC B;  5AV5 D;  1Q9C A;  2IO5 B;  1M1A C;  3MNN C;  2ARO C;  5AV9 C;  1T3U A;  3AZK B;  1P3F D;  3REI D;  5BNX A;  1P3A D;  3B6F D;  5BT1 D;  4H9R A;  1P3G A;  1KX5 C;  4H9R B;  1P3G B;  2JCH A;  4Z5T C;  1ULY A;  4KGC D;  2Y2H A;  3AYW D;  4J8W A;  5B32 D;  3X1V C;  4CAY A;  4YM6 A;  3H0R C;  4J8W B;  2BG1 A;  4CAY B;  4YM6 B;  5B2I C;  3REK D;  3UT9 A;  5B0Z C;  3AZM B;  3UT9 B;  5GT0 A;  1B6W A;  3AZJ C;  3LZ1 A;  3W98 A;  4J8U D;  3W98 B;  5B1L A;  3AZG D;  3W97 D;  5B1L B;  3MVD C;  2Y2I A;  3REL D;  5AVB A;  3MGR A;  5AV6 A;  5AVB B;  5E5A C;  3MGR B;  5AV6 B;  5AY8 A;  3LEL C;  3X1S C;  1ID3 D;  5GT0 D;  3WKJ C;  5AV8 A;  5B31 A;  4EO5 B;  5AY8 B;  5B33 D;  3LZ1 D;  3AZE D;  3C1C C;  5AV8 B;  3AZI A;  1P3I D;  2NQB A;  3REJ A;  3AZI B;  3REJ B;  3C1B D;  5GT3 C;  5CPK A;  5JRG A;  1KX3 C;  4WU8 C;  5CPK B;  3WTP C;  1P3B B;  1BFM A;  3R45 A;  1AOI A;  5CPJ D;  2Y2L A;  5B31 D;  3F6T A;  2FJ7 C;  2NQB D;  3R45 B;  1AOI B;  3A6N C;  3AZI D;  3X1U C;  3EPL A;  2RVQ C;  3B0D B;  5B24 D;  3WA9 C;  4XUJ D;  5JRG D;  5DNM C;  3P5J B;  1TZY A;  4H9S A;  1P3M D;  3KFU G;  2Y2P A;  1TZY B;  4QLC B;  4J8V A;  5DNN C;  3KXB A;  4J8V B;  3KXB B;  3AZH D;  4H9Q A;  3W99 A;  1P3L D;  4H9Q B;  5CPI A;  3W99 B;  3W96 D;  4JJN B;  2HIO D;  3O62 C;  5CPI B;  2F2A C;  3B6G A;  3MGS C;  3KWQ B;  1S32 A;  3KUY D;  3B6G B;  1S32 B;  3A1I A;  2NZD D;  2CV5 D;  2ZY5 A;  1M1A A;  1B67 A;  4LD9 C;  3MNN A;  1M1A B;  3MNN B;  4YS3 D;  1M19 A;  2ARO A;  5AV9 A;  3X1T D;  4J8X C;  4ZBJ C;  2ARO B;  5AV9 B;  1P3K D;  1A7W A;  5CP6 B;  1KX5 A;  4Z5T A;  1KX5 B;  3AZN C;  5BO0 A;  4Z5T B;  3AV1 D;  1U35 C;  5BO0 B;  3AZL B;  3X1V A;  2Y2Q A;  1M19 D;  5B32 G;  3X1V B;  3AN2 C;  4QLC C;  5B2I B;  2ZY4 A;  5B0Z A;  3IP4 C;  5B0Z B;  3TU4 D;  3AZJ A;  2HUE C;  5B1M C;  4Z5T D;  1KX4 C;  2G5I C;  3AZJ B;  4ZUX D;  2RIQ A;  4WNN A;  4Z66 D;  2YFW A;  1P3P C;  1M18 C;  5G49 A;  5F99 C;  3UTB D;  4WU9 A;  3MVD B;  5G49 B; 
#chains in the Genus database with same CATH homology
 4NE5 A;  4XZQ C;  5B2J C;  4HGA C;  5E5A A;  3LZ0 C;  3AZF C;  3LEL A;  4R8P C;  3X1S A;  3UTA D;  3WKJ A;  3LEL B;  3X1S B;  3WKJ B;  5B0Y C;  3C1C A;  1P34 D;  2ZM5 A;  3VH6 W;  3MGP B;  4NFT A;  3C1C B;  5GT3 A;  1P3O C;  2BYM A;  4WU9 D;  3AZK A;  5GT3 B;  2BYM B;  3B0C W;  4WU8 A;  3LJA D;  1KX3 A;  3WTP A;  1KX3 B;  4WU8 B;  5E5A D;  5GSU C;  3WTP B;  5CP6 C;  4Z2M G;  2J8P A;  1HQ3 C;  2FJ7 A;  5AVC D;  3VH6 T;  3A6N A;  2FJ7 B;  4X23 C;  3X1U A;  3A6N B;  3AFA C;  4DRA A;  5GXQ C;  3X1U B;  3AZL C;  1ZLA C;  4DRB A;  2F8N G;  3WA9 A;  3B0C T;  3AZK D;  3VH6 A;  3VH5 W;  3WA9 B;  5DNM A;  4WU8 D;  5DNM B;  5B40 C;  1F1E A;  3AZM A;  2Y2M A;  5DNN A;  4H9O A;  1P3G D;  5DNN B;  4H9O B;  3AV2 C;  2L5A A;  4DQY B;  4CSR A;  3VH5 T;  4CSR B;  4J8W D;  1R4V A;  3O62 A;  5DNM D;  4YM6 D;  3O62 B;  1EQZ C;  3VH5 A;  5BS7 A;  3AZM D;  3UT9 D;  3MGS A;  1F66 C;  4KUD C;  3MGS B;  3WAA C;  3W98 D;  3MGP C;  4LD9 A;  3FDD A;  5B1L D;  3MGQ C;  4LD9 B;  4J8X A;  3AL0 C;  3NQJ A;  4J8X B;  1P3B A;  4ZBJ B;  5AVB D;  3MGR D;  3NQJ B;  5AV5 C;  5AV6 D;  2XD1 A;  5AY8 D;  5AV8 D;  3AZN A;  3H0L C;  3REJ D;  1U35 A;  1P3F C;  3AZN B;  3REI C;  1U35 B;  2Y2G A;  1P3A C;  3B6F C;  3EG5 B;  5CPK D;  5BT1 C;  3AN2 A;  2DQN C;  1P3B D;  2PYO B;  4QLC A;  3AN2 B;  3V9R A;  2VQR A;  3V9R B;  4KGC C;  1AOI D;  3AYW C;  5B1M A;  1TAF A;  5B32 C;  1KX4 A;  3AZN D;  2HUE B;  5B1M B;  1TAF B;  1KX4 B;  1P3P A;  1M18 A;  5F99 A;  4JJN A;  3REK C;  1BH9 A;  1P3P B;  1M18 B;  5F99 B;  1TZY D;  1BH9 B;  4QLC D;  4XZQ A;  5B2J A;  2YFV A;  3LZ0 A;  3AZF A;  4XZQ B;  3KWQ A;  4J8U C;  5B2J B;  2YFV B;  4HGA B;  4R8P A;  3LZ0 B;  3AZF B;  3AZG C;  3W97 C;  4J8V D;  4R8P B;  3KXB D;  5B0Y B;  3REL C;  3W99 D;  1P3O A;  4JJN D;  5CPI D;  1P3O B;  1ID3 C;  5GT0 C;  5B33 C;  5GSU A;  3AZE C;  1P3I C;  3KWQ D;  5CP6 A;  5GSU B;  3B6G D;  1S32 D;  1HQ3 A;  3C1B C;  1HQ3 B;  4X23 A;  3AFA A;  4X23 B;  1M1A D;  5GXQ A;  4AWL C;  3AZL A;  3MNN D;  3AFA B;  1ZLA A;  5GXQ B;  1ZLA B;  2ARO D;  5AV9 D;  2PYO C;  5CPJ C;  4NE6 A;  5B31 C;  5B40 A;  5C3I C;  5B2I A;  2NQB C;  5B40 B;  5CP6 D;  1KU5 A;  2F8N K;  2ZY3 A;  1KX5 D;  5B24 C;  3AV2 A;  4XUJ C;  1Z2C B;  3AV2 B;  1P3M C;  3AZL D;  1H3O A;  4G91 B;  3REH B;  1H3O B;  3MVD A;  3X1V D;  5CHL B;  5B2I D;  1EQZ A;  1EQZ B;  5B0Z D;  1F66 A;  4KUD A;  3AZH C;  1F66 B;  1P3L C;  3WAA A;  4KUD B;  3AZJ D;  4UPK A;  3W96 C;  3MGP A;  3WAA B;  2HIO C;  3MGQ A;  2UWX A;  3MVD D;  3MGQ B;  2JE5 A;  2BYK A;  3KUY C;  2BYK B;  2NZD C;  5AV5 A;  2CV5 C;  5AV5 B;  3LEL D;  2LY8 A;  3X1S D;  4E44 A;  3WKJ D;  4YS3 C;  3MGP D;  5B31 G;  3C1C D;  3X1T C;  3REI A;  1P3F B;  3REI B;  1P3A A;  1P3K C;  5GT3 D;  3B6F A;  1P3A B;  3B6F B;  1WWS A;  1KX3 D;  3WTP D;  3AV1 C;  4KGC A;  3EPK A;  3AYW A;  2FJ7 D;  4KGC B;  5B32 A;  3A6N D;  3AYW B;  1M19 C;  5B32 B;  3X1U D;  2ZY2 A;  4G91 C;  4Z2M H;  3REH C;  2RVQ D;  5BNX B;  3WA9 D;  3REK A;  3REK B;  4KHA A;  3TU4 C;  4KHA B;  1W2E A;  2F8N H;  4J8U A;  4ZUX C;  4G92 C;  4Z66 C;  4J8U B;  3W97 A;  3AZG A;  5DNN D;  3AZG B;  3W97 B;  3UTB C;  2CWE A;  3REL A;  3WTP E;  3REL B;  2JSS A;  1HTA A;  2Y2O A;  3O62 D;  1ID3 A;  3UTA C;  1ID3 B;  5B33 A;  5GT0 B;  3AZE A;  1P34 C;  1P3I A;  3LZ1 B;  5B33 B;  3AZE B;  1P3I B;  3MGS D;  2Y2N A;  3C1B A;  4WU9 C;  3C1B B;  5JA4 A;  3A1K A;  4LD9 D;  3LJA C;  5JA4 B;  4AWL B;  4J8X D;  2PYO A;  5CPJ A;  5AVC C;  2IO5 C;  5CPJ B;  5KDM A;  3NQU A;  5B31 B;  5C3I B;  2NQB B;  5KDM B;  3NQU B;  2F8N A;  4E45 A;  5B24 A;  2F8N B;  3AZK C;  4XUJ A;  2Y2J A;  2Y2K A;  5B24 B;  1P3M A;  4XUJ B;  1U35 D;  5JRG B;  1P3M B;  1N1J A;  4NE3 A;  1N1J B;  2PYO D;  3AN2 D;  1P3G C;  2G5H C;  3AZH A;  2F8N D;  3EPH A;  1P3L A;  3AZH B;  5B1M D;  4J8W C;  3W96 A;  5B0Y A;  1P3L B;  2HIO A;  1KX4 D;  4YM6 C;  2XD5 A;  3W96 B;  2HIO B;  1P3P D;  1M18 D;  3AZM C;  5F99 D;  3UT9 C;  3KUY A;  2NZD A;  4XZQ D;  3KUY B;  2CV5 A;  3LZ1 C;  5B2J D;  3W98 C;  3LZ0 D;  3AZF D;  2NZD B;  2CV5 B;  4R8P D;  3EPJ A;  3H0M C;  5B1L C;  4YS3 A;  5B0Y D;  2W8S A;  3X1T A;  4YS3 B;  3X1T B;  5AVB C;  3MGR C;  1P3K A;  1P3O D;  5BS7 C;  5AV6 C;  1P3K B;  5AY8 C;  4EO5 C;  1BH8 A;  5AV8 C;  3B0B A;  5GSU D;  1BH8 B;  3AZI C;  3AV1 A;  3REJ C;  4WZS B;  1HQ3 D;  4H9N A;  3AV1 B;  4H9N B;  4H9P A;  2DF4 C;  4X23 D;  5CPK C;  1M19 B;  3AFA D;  4M6B A;  5JRG C;  4H9P B;  3REH A;  5GXQ D;  1P3B C;  1ZLA D;  2FFF B;  3TU4 A;  1AOI C;  5B40 D;  4WV4 B;  3TU4 B;  4ZUX A;  4UUZ A;  4WJ3 C;  4Z66 A;  4G92 B;  4ZUX B;  3B0D C;  4UUZ B;  4Z66 B;  3UTB A;  3AV2 D;  3UTB B;  3REH D;  4H9S C;  1TZY C;  1JFI A;  1JFI B;  3UTA A;  4J8V C;  3UTA B;  1WWI A;  3KXB C;  1P34 A;  1EQZ D;  1PZR A;  1P34 B;  1F66 D;  4KUD D;  4WNN B;  5BNV A;  3W99 C;  3WAA D;  5BNV B;  2YFW B;  4JJN C;  5CPI C;  3LJA A;  4WU9 B;  1P3F A;  3KSY A;  3LJA B;  3MGQ D;  3KWQ C;  5FUG A;  5E5A B;  3B6G C;  1S32 C;  5FUG B;  5AVC A;  5AVC B;  5AV5 D;  1Q9C A;  2IO5 B;  1M1A C;  3MNN C;  2ARO C;  5AV9 C;  1T3U A;  3AZK B;  1P3F D;  3REI D;  5BNX A;  1P3A D;  3B6F D;  5BT1 D;  4H9R A;  1P3G A;  1KX5 C;  4H9R B;  1P3G B;  2JCH A;  4Z5T C;  1ULY A;  4KGC D;  2Y2H A;  3AYW D;  4J8W A;  5B32 D;  3X1V C;  4CAY A;  4YM6 A;  3H0R C;  4J8W B;  2BG1 A;  4CAY B;  4YM6 B;  5B2I C;  3REK D;  3UT9 A;  5B0Z C;  3AZM B;  3UT9 B;  5GT0 A;  1B6W A;  3AZJ C;  3LZ1 A;  3W98 A;  4J8U D;  3W98 B;  5B1L A;  3AZG D;  3W97 D;  5B1L B;  3MVD C;  2Y2I A;  3REL D;  5AVB A;  3MGR A;  5AV6 A;  5AVB B;  5E5A C;  3MGR B;  5AV6 B;  5AY8 A;  3LEL C;  3X1S C;  1ID3 D;  5GT0 D;  3WKJ C;  5AV8 A;  5B31 A;  4EO5 B;  5AY8 B;  5B33 D;  3LZ1 D;  3AZE D;  3C1C C;  5AV8 B;  3AZI A;  1P3I D;  2NQB A;  3REJ A;  3AZI B;  3REJ B;  3C1B D;  5GT3 C;  5CPK A;  5JRG A;  1KX3 C;  4WU8 C;  5CPK B;  3WTP C;  1P3B B;  1BFM A;  3R45 A;  1AOI A;  5CPJ D;  2Y2L A;  5B31 D;  3F6T A;  2FJ7 C;  2NQB D;  3R45 B;  1AOI B;  3A6N C;  3AZI D;  3X1U C;  3EPL A;  2RVQ C;  3B0D B;  5B24 D;  3WA9 C;  4XUJ D;  5JRG D;  5DNM C;  3P5J B;  1TZY A;  4H9S A;  1P3M D;  3KFU G;  2Y2P A;  1TZY B;  4QLC B;  4J8V A;  5DNN C;  3KXB A;  4J8V B;  3KXB B;  3AZH D;  4H9Q A;  3W99 A;  1P3L D;  4H9Q B;  5CPI A;  3W99 B;  3W96 D;  4JJN B;  2HIO D;  3O62 C;  5CPI B;  2F2A C;  3B6G A;  3MGS C;  3KWQ B;  1S32 A;  3KUY D;  3B6G B;  1S32 B;  3A1I A;  2NZD D;  2CV5 D;  2ZY5 A;  1M1A A;  1B67 A;  4LD9 C;  3MNN A;  1M1A B;  3MNN B;  4YS3 D;  1M19 A;  2ARO A;  5AV9 A;  3X1T D;  4J8X C;  4ZBJ C;  2ARO B;  5AV9 B;  1P3K D;  1A7W A;  5CP6 B;  1KX5 A;  4Z5T A;  1KX5 B;  3AZN C;  5BO0 A;  4Z5T B;  3AV1 D;  1U35 C;  5BO0 B;  3AZL B;  3X1V A;  2Y2Q A;  1M19 D;  5B32 G;  3X1V B;  3AN2 C;  4QLC C;  5B2I B;  2ZY4 A;  5B0Z A;  3IP4 C;  5B0Z B;  3TU4 D;  3AZJ A;  2HUE C;  5B1M C;  4Z5T D;  1KX4 C;  2G5I C;  3AZJ B;  4ZUX D;  2RIQ A;  4WNN A;  4Z66 D;  2YFW A;  1P3P C;  1M18 C;  5G49 A;  5F99 C;  3UTB D;  4WU9 A;  3MVD B;  5G49 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...