1P34D

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
92
structure length
92
Chain Sequence
b'RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 36
structure length 92
sequence length 92
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p34D00
5B0YD 5CPIB 5AV9B 3LELD 3V9RB 3MVDA 3KUYA 1M1AC 3NQUA 2IO5B 2NZDD 3AZIA 5B32A 4YM6A 1JFIB 3MNNC 3KXBC 2NQBA 4J8VC 4J8XB 1U35C 4Z5TC 3VH5W 5AV9D 3TU4B 3A6NB 3W98C 3W96A 4XUJC 4J8XD 1M19C 5F99A 1A7WA 5AVBB 4YS3C 5CPKC 3B6FC 3WAAA 3AYWD 3TU4D 5B24C 1F66C 3UTBA 1P3ID 4JJNA 3REJD 3X1TA 5AY8B 3AZKA 3W97B 5AV6C 2AROB 3AZGC 2F8NK 5CPJC 3KWQC 3LZ0A 1ZLAD 3REIC 3MGSB 1P3LD 2HIOA 3MVDC 3AZJB 5AY8D 4Z2MH 3MGRA 3W97D 3AZIC 4G92B 4YM6C 4EO5B 4KGCB 5JRGC 5E5AA 1P3OB 3C1BB 3AFAB 2NQBC 3C1CA 3X1SB 5B0ZB 1B6WA 5B40C 4E44A 2LY8A 5AV5B 3MGSD 3AZLB 3AZJD 1P3GD 3REHA 3KSYA 4WU9A 4H9PB 3X1UA 5GT0A 3AZNA 3B6GB 4R8PA 1ULYA 1P3OD 3C1BD 3AFAD 4WU8B 3R45A 1KX4A 4X23A 3X1SD 1KX5A 5B33B 5B0YA 3REKA 5F99C 4NE5A 5AV8A 5BT1D 4AWLC 1P3AB 3W99A 5BO0A 3LJAD 4JJNC 3X1TC 1M18D 3AZKC 3B6GD 4XZQD 4G91C 5B33D 3AV1B 5CPIA 3B0BA 2CV5A 2YFWB 5B31B 3LZ0C 4J8UB 5B2IB 1AOIB 1P3MA 1HQ3D 2HIOC 4ZUXB 3MGRC 4NE3A 1JFIA 1EQZA 4KUDB 1P34B 5CP6B 3AV1D 4J8XA 3C1CC 4Z66B 3O62C 5B31D 5B2ID 3RELA 3A6NA 2FJ7B 4ZUXD 1S32D 3B0CW 3REHC 4QLCB 4WU9C 3X1UC 3AZNC 1P34D 1Q9CA 4R8PC 3AZED 5GT3C 1KX4C 4Z2MG 4X23C 1KX5C 2YFVB 4Z66D 3AZFB 5AVBA 3REKC 5AV8C 2FJ7D 3MGPA 3W99C 3W97A 1P3KA 4E45A 5AVCB 2PYOB 1P3FC 1F1EA 2AROA 3WKJD 3AZHB 3AZFD 5CPIC 2CV5C 3NQJB 4H9SA 5B1LA 1P3MC 4UUZB 3LELB 5GXQB 4ZBJB 5B1MD 3AV2B 4KGCA 5AVCD 2PYOD 1EQZC 1P3OA 3C1BA 3AFAA 3AZHD 4H9NB 3X1SA 5GSUD 5B0ZA 4CAYB 5AV5A 4WNNB 3AZLA 3RELC 3AN2B 3UTAA 3A6NC 1ID3B 5GXQD 5BS7A 4H9PA 2F8NH 3AV2D 1P3PB 3X1VB 4WU8A 3MGQA 2BYKB 5AVBC 1N1JB 4HGAB 5JA4B 5B2JD 5DNMD 3AN2D 1P3AA 3AYWB 1ID3D 4LD9B 3MGPC 4H9RB 3VH6A 1P3IB 1P3BA 3REJB 1P3PD 3UT9B 3LZ1B 3X1VD 1P3KC 3WA9B 1TAFB 2AROC 3AV1A 3WTPD 2BYMA 5FUGA 4J8UA 1ZLAB 1AOIA 5DNND 4J8WD 4LD9D 5B1LC 1P3LB 1BH8B 5BNXA 1TZYC 2F8NA 3UT9D 3LZ1D 4KGCC 3WA9D 4KUDA 1P34A 3B0CT 5CP6A 1KX3A 5B32G 4Z66A 5B0ZC 1M1AB 5AV5C 3AZLC 3UTAC 1HTAA 3MNNB 5BS7C 3KUYC 1P3GB 4QLCA 3KXBB 1H3OA 3AZMD 5B32C 1U35B 4WU8C 4Z5TB 2YFVA 3MGQC 2RVQC 1M1AD 3W98B 1P3AC 3MNND 3KXBD 1BH9A 1P3BC 3W96C 3LJAB 4J8VD 1M18B 1M19B 2PYOA 4XZQB 1U35D 5CPKB 3AZHA 4Z5TD 3B6FB 5BNVB 3AV1C 2F8NG 5B24B 3W98D 4J8UC 3WAAC 1AOIC 1KU5A 5AV6B 4XUJD 3LELA 3UTBC 1HQ3B 2NZDA 3AZGB 1M19D 5CPJB 4KUDC 3KWQB 5CPKD 3B6FD 5CP6C 4H9NA 5C3IC 5B24D 3REIB 1F66D 4H9QB 1KX3C 4CAYA 3AN2A 5AV9A 5AV6D 3V9RA 5JRGB 1S32B 4QLCC 3AZGD 3VH5T 2NQBB 4DRBA 5CPJD 3KWQD 5B40B 5E5AC 3REID 3AZEB 2BYKA 3MVDD 5JA4A 4KHAB 3AYWA 3TU4A 3AZID 4LD9A 4YM6D 1P3IA 5JRGD 3REJA 2NQBD 5GT0C 3LZ1A 5B40D 3WKJB 2L5AA 2HUEC 5B0YC 1ZLAA 3X1TB 1P3LA 3LELC 5AY8A 2NZDC 5B1MB 5F99D 5KDMB 5GSUB 4JJND 3X1TD 3MGSA 3AZKD 5AV9C 3B0DB 3AZJA 1P3GA 3KXBA 2IO5C 3C1CB 4NFTA 1U35A 3O62B 3LZ0D 4J8XC 3W98A 2HIOD 3MGRD 3REHB 4WU9B 3X1UB 5B2JB 5DNMB 3TU4C 3AZNB 3AYWC 4R8PB 1P3IC 5GT3B 3LJAA 3REJC 1M18A 3C1CD 3B6GA 1KX5B 4XZQA 3O62D 4NE6A 5CPKA 3B6FA 5BNVA 5B33A 3WTPB 3REHD 4WU9D 1ZLAC 3X1UD 3AZND 1R4VA 5AV6A 5DNNB 4J8WB 4R8PD 1P3LC 1HQ3A 4WZSB 5GT3D 1P3FB 1KX4D 5AY8C 4CSRB 4X23D 1KX5D 3W97C 3REKD 2CV5B 5AV8D 3REIA 4H9QA 1P3MB 2YFWA 5B31A 3W99D 5B2IA 4H9SC 3MGSC 1EQZB 5JRGA 3AZJC 4ZUXA 1S32A 1P3GC 1P3FD 4G92C 3AZMB 5CPID 4EO5C 2CV5D 5B40A 1P3OC 3AZEA 3C1BC 3AFAC 3RELB 1P3MD 3X1SC 4KHAA 5BT1C 2FJ7A 1EQZD 3LJAC 1M18C 4J8VB 5G49B 3B6GC 4XZQC 3WKJA 3RELD 3A6ND 5B33C 3AZFA 3VH6W 3MGPB 1P3KB 1HQ3C 4XUJB 5B31G 5B1MA 4WV4B 5AVCA 5KDMA 5AVBD 4YS3B 3MGPD 5B1LB 5GSUA 1F66B 3NQJA 5B31C 5B2IC 1TZYB 4UUZA 1P3KD 5GXQA 4H9OB 4ZUXC 2AROD 1S32C 3AV2A 3O62A 4YS3D 1P34C 3AZEC 2CWEA 5B1LD 3UTAB 4Z66C 3MVDB 3KUYB 1TZYD 4WNNA 3NQUB 5B2JA 5DNMA 3AZIB 1ID3A 2FJ7C 5B32B 4KGCD 4YM6B 5GT3A 5CHLB 1P3PA 3MGQB 3X1VA 5B0ZD 5AV5D 3AZLD 3WKJC 3UTAD 3WTPA 3AZFC 3KUYD 1N1JA 1P3BB 5DNNA 4J8WA 5B32D 3W96B 4H9RA 3WTPE 1P3FA 4WU8D 4CSRA 3MGQD 5B1MC 3UT9A 2RVQD 5AVCC 2BYMB 5FUGB 2PYOC 3WA9A 1TAFA 5F99B 1P3AD 4AWLB 3AZHC 3WAAB 5GSUC 3UTBB 5BNXB 1P3BD 4JJNB 3W96D 3AZKB 2F8NB 3B0DC 1BH8A 5GXQC 4G91B 4ZBJC 5C3IB 3AZMA 3AV2C 1KX3B 4J8UD 4M6BA 3LZ0B 1AOID 3WAAD 3UTBD 1M1AA 1WWIA 2HIOB 3MGRB 5B2JC 5DNMC 1H3OB 3AN2C 2F8ND 3VH6T 1ID3C 4KUDD 3MNNA 5CP6D 1B67A 5E5AB 4J8VA 5G49A 1P3PC 1KX3D 3X1VC 4Z5TA 1WWSA 3WTPC 4DRAA 4QLCD 4HGAC 1BFMA 1BH9B 5DNNC 5GT0B 3VH5A 4J8WC 4LD9C 4XUJA 5E5AD 1KX4B 3R45B 1M19A 4X23B 3UT9C 3LZ1C 3WA9C 2HUEB 5B0YB 4YS3A 3REKB 5AV8B 5B24A 1F66A 1TZYA 3W99B 5BO0B 5GT0D 2NZDB 4H9OA 3AZGA 3AZMC 2JSSA 5CPJA 3KWQA
chains in the Genus database with same CATH superfamily
5B0YD 5CPIB 2DF4C 1Z2CB 5AV9B 3LELD 3V9RB 3MVDA 3KUYA 1M1AC 3NQUA 2IO5B 2NZDD 2VQRA 3AZIA 3KFUG 5B32A 4YM6A 1JFIB 3MNNC 3KXBC 2NQBA 4J8VC 4J8XB 4WJ3C 1U35C 4Z5TC 2F2AC 3VH5W 5AV9D 3TU4B 3A1IA 3A6NB 3W98C 3W96A 2J8PA 4XUJC 4J8XD 1M19C 5F99A 1A7WA 5AVBB 4YS3C 5CPKC 3B6FC 3WAAA 3AYWD 3TU4D 5B24C 1F66C 3UTBA 1P3ID 4JJNA 3REJD 3X1TA 5AY8B 3AZKA 2Y2PA 3W97B 5AV6C 3EPHA 4DQYB 2AROB 3AZGC 2F8NK 5CPJC 3KWQC 3LZ0A 1ZLAD 3REIC 3H0LC 3MGSB 1P3LD 2HIOA 3MVDC 3AZJB 5AY8D 4Z2MH 3MGRA 3W97D 3AZIC 4G92B 4YM6C 4EO5B 4KGCB 5JRGC 5E5AA 1P3OB 3C1BB 3AFAB 2NQBC 3C1CA 3X1SB 3P5JB 5B0ZB 1B6WA 5B40C 4E44A 2LY8A 5AV5B 3MGSD 3AZLB 3AZJD 1P3GD 3REHA 3KSYA 4WU9A 4H9PB 3X1UA 5GT0A 3AZNA 2JCHA 3B6GB 4R8PA 1ULYA 1P3OD 3C1BD 1PZRA 3AFAD 4WU8B 3R45A 1KX4A 4X23A 3X1SD 1KX5A 5B33B 5B0YA 3REKA 2Y2IA 5F99C 4NE5A 5AV8A 5BT1D 4AWLC 1P3AB 3W99A 5BO0A 3LJAD 4JJNC 3X1TC 1M18D 3AZKC 3B6GD 4XZQD 4G91C 5B33D 3AV1B 5CPIA 3B0BA 2CV5A 2YFWB 5B31B 3LZ0C 4J8UB 5B2IB 1AOIB 1P3MA 1HQ3D 2HIOC 4ZUXB 3MGRC 4NE3A 1JFIA 1EQZA 4KUDB 1P34B 5CP6B 3AV1D 4J8XA 3C1CC 4Z66B 3O62C 5B31D 5B2ID 3RELA 2ZY5A 3A6NA 2FJ7B 4ZUXD 1S32D 3B0CW 2G5HC 3REHC 4QLCB 4WU9C 3X1UC 2Y2JA 3AZNC 1P34D 1Q9CA 4R8PC 3AZED 5GT3C 1KX4C 4Z2MG 4X23C 1KX5C 2YFVB 4Z66D 3AZFB 5AVBA 3REKC 2ZY4A 5AV8C 2FJ7D 3MGPA 3W99C 3W97A 1P3KA 4E45A 5AVCB 2PYOB 3H0MC 1P3FC 1F1EA 2AROA 3WKJD 3AZHB 2XD1A 3AZFD 5CPIC 2CV5C 3NQJB 4H9SA 5B1LA 1P3MC 4UUZB 3LELB 5GXQB 4ZBJB 5B1MD 3AV2B 4KGCA 5AVCD 2PYOD 1EQZC 1P3OA 3C1BA 3AFAA 3AZHD 4H9NB 3X1SA 5GSUD 5B0ZA 4CAYB 5AV5A 4WNNB 3AZLA 3RELC 3AN2B 3UTAA 3A6NC 1ID3B 5GXQD 5BS7A 4H9PA 2F8NH 3AV2D 1P3PB 3X1VB 4WU8A 3MGQA 2BYKB 3EPLA 5AVBC 1N1JB 4HGAB 5JA4B 5B2JD 5DNMD 3AN2D 1P3AA 3AYWB 1ID3D 4LD9B 3MGPC 4H9RB 3VH6A 1P3IB 1P3BA 3REJB 1P3PD 3UT9B 3LZ1B 3X1VD 1P3KC 3WA9B 1TAFB 2AROC 3AV1A 3WTPD 2BYMA 5FUGA 4J8UA 1ZLAB 1AOIA 5DNND 4J8WD 4LD9D 5B1LC 1P3LB 1BH8B 5BNXA 1TZYC 2XD5A 2F8NA 3UT9D 3LZ1D 4KGCC 3WA9D 4KUDA 1P34A 3B0CT 5CP6A 3AL0C 1KX3A 5B32G 4Z66A 2Y2OA 5B0ZC 1M1AB 5AV5C 3AZLC 3UTAC 1HTAA 3MNNB 5BS7C 3KUYC 1P3GB 4QLCA 3KXBB 1H3OA 3AZMD 5B32C 2Y2NA 1U35B 4WU8C 4Z5TB 2YFVA 3MGQC 2RVQC 1M1AD 3W98B 1T3UA 1P3AC 3MNND 3KXBD 1BH9A 1P3BC 3W96C 3LJAB 4J8VD 1M18B 1M19B 2PYOA 4XZQB 1U35D 5CPKB 3AZHA 4Z5TD 2Y2LA 3B6FB 5BNVB 3AV1C 2F8NG 5B24B 3W98D 4J8UC 3WAAC 1AOIC 1KU5A 5AV6B 4XUJD 3LELA 3UTBC 1HQ3B 2NZDA 3AZGB 1M19D 5CPJB 4KUDC 3KWQB 5CPKD 3B6FD 5CP6C 4H9NA 5C3IC 5B24D 3EPKA 3REIB 4H9QB 1KX3C 1F66D 4CAYA 2ZY3A 3AN2A 5AV9A 5AV6D 3V9RA 5JRGB 1S32B 4QLCC 3AZGD 3VH5T 2NQBB 4DRBA 5CPJD 3KWQD 1W2EA 5B40B 5E5AC 3REID 3AZEB 2BYKA 3MVDD 5JA4A 4KHAB 3AYWA 3TU4A 3AZID 4LD9A 4YM6D 1P3IA 5JRGD 3REJA 2NQBD 5GT0C 3LZ1A 5B40D 3WKJB 3EPJA 2L5AA 2HUEC 5B0YC 1ZLAA 3X1TB 2Y2QA 1P3LA 3LELC 5AY8A 2NZDC 5B1MB 5F99D 5KDMB 3F6TA 5GSUB 4JJND 3X1TD 2RIQA 3MGSA 3AZKD 5AV9C 3B0DB 3AZJA 1P3GA 2Y2HA 3KXBA 2IO5C 3C1CB 4NFTA 1U35A 3O62B 3LZ0D 2W8SA 4J8XC 3W98A 2HIOD 2G5IC 3MGRD 3REHB 4WU9B 3X1UB 5B2JB 5DNMB 3TU4C 3AZNB 3AYWC 4R8PB 1P3IC 5GT3B 2Y2MA 4UPKA 3LJAA 2Y2GA 3C1CD 3IP4C 3REJC 1M18A 3A1KA 1KX5B 4XZQA 3B6GA 3O62D 4NE6A 5CPKA 3B6FA 5BNVA 5B33A 3WTPB 3REHD 4WU9D 1ZLAC 3X1UD 3AZND 1R4VA 5AV6A 5DNNB 4J8WB 4R8PD 1P3LC 1HQ3A 4WZSB 5GT3D 1P3FB 1KX4D 5AY8C 4CSRB 4X23D 1KX5D 3W97C 3REKD 2CV5B 5AV8D 3REIA 4H9QA 1P3MB 2YFWA 5B31A 3W99D 5B2IA 4H9SC 2JE5A 3MGSC 1EQZB 5JRGA 3AZJC 4ZUXA 1S32A 1P3GC 1P3FD 4G92C 3AZMB 5CPID 4EO5C 2CV5D 5B40A 1P3OC 3AZEA 3C1BC 3AFAC 3RELB 1P3MD 3X1SC 4KHAA 5BT1C 2FJ7A 1EQZD 3LJAC 1M18C 4J8VB 5G49B 3B6GC 4XZQC 3WKJA 2DQNC 3RELD 3A6ND 5B33C 3AZFA 3VH6W 3MGPB 1P3KB 1HQ3C 4XUJB 5B31G 5B1MA 4WV4B 5AVCA 5KDMA 5AVBD 4YS3B 3MGPD 5B1LB 5GSUA 1F66B 3NQJA 5B31C 5B2IC 1TZYB 4UUZA 1P3KD 5GXQA 4H9OB 4ZUXC 2AROD 1S32C 3AV2A 3O62A 4YS3D 1P34C 3AZEC 2CWEA 5B1LD 3UTAB 4Z66C 3MVDB 3KUYB 1TZYD 4WNNA 3NQUB 5B2JA 5DNMA 3AZIB 1ID3A 2FJ7C 5B32B 4KGCD 4YM6B 5GT3A 5CHLB 1P3PA 3MGQB 3X1VA 5B0ZD 5AV5D 3AZLD 3FDDA 3WKJC 3UTAD 3WTPA 3AZFC 3KUYD 1N1JA 1P3BB 5DNNA 4J8WA 5B32D 3W96B 4H9RA 3WTPE 1P3FA 4WU8D 2UWXA 4CSRA 3MGQD 5B1MC 3UT9A 2RVQD 5AVCC 2BYMB 5FUGB 2PYOC 3WA9A 1TAFA 5F99B 2ZM5A 1P3AD 4AWLB 3AZHC 3WAAB 5GSUC 3UTBB 5BNXB 1P3BD 4JJNB 3W96D 3AZKB 2F8NB 3B0DC 1BH8A 5GXQC 4G91B 4ZBJC 5C3IB 3AZMA 3AV2C 1KX3B 4J8UD 3H0RC 4M6BA 3LZ0B 1AOID 3WAAD 2BG1A 3UTBD 1M1AA 1WWIA 2HIOB 3MGRB 5B2JC 2ZY2A 1H3OB 5DNMC 3AN2C 2FFFB 3VH6T 1ID3C 3MNNA 2F8ND 4KUDD 5CP6D 1B67A 5E5AB 4J8VA 5G49A 1P3PC 1KX3D 3X1VC 4Z5TA 1WWSA 3WTPC 2Y2KA 4DRAA 4QLCD 4HGAC 1BFMA 1BH9B 5DNNC 5GT0B 3VH5A 4J8WC 4LD9C 4XUJA 3EG5B 5E5AD 1KX4B 3R45B 1M19A 4X23B 3UT9C 3LZ1C 3WA9C 2HUEB 5B0YB 4YS3A 3REKB 5AV8B 5B24A 1F66A 1TZYA 3W99B 5BO0B 5GT0D 2NZDB 4H9OA 3AZGA 3AZMC 2JSSA 5CPJA 3KWQA
chains in the Genus database with same CATH topology
5B0YD 5CPIB 2DF4C 1Z2CB 5AV9B 3LELD 3V9RB 3MVDA 3KUYA 1M1AC 3NQUA 2IO5B 2NZDD 2VQRA 3AZIA 3KFUG 5B32A 4YM6A 1JFIB 3MNNC 3KXBC 2NQBA 4J8VC 4J8XB 4WJ3C 1U35C 4Z5TC 2F2AC 3VH5W 5AV9D 3TU4B 3A1IA 3A6NB 3W98C 3W96A 2J8PA 4XUJC 4J8XD 1M19C 5F99A 1A7WA 5AVBB 4YS3C 5CPKC 3B6FC 3WAAA 3AYWD 3TU4D 5B24C 1F66C 3UTBA 1P3ID 4JJNA 3REJD 3X1TA 5AY8B 3AZKA 2Y2PA 3W97B 5AV6C 3EPHA 4DQYB 2AROB 3AZGC 2F8NK 5CPJC 3KWQC 3LZ0A 1ZLAD 3REIC 3H0LC 3MGSB 1P3LD 2HIOA 3MVDC 3AZJB 5AY8D 4Z2MH 3MGRA 3W97D 3AZIC 4G92B 4YM6C 4EO5B 4KGCB 5JRGC 5E5AA 1P3OB 3C1BB 3AFAB 2NQBC 3C1CA 3X1SB 3P5JB 5B0ZB 1B6WA 5B40C 4E44A 2LY8A 5AV5B 3MGSD 3AZLB 3AZJD 1P3GD 3REHA 3KSYA 4WU9A 4H9PB 3X1UA 5GT0A 3AZNA 2JCHA 3B6GB 4R8PA 1ULYA 1P3OD 3C1BD 1PZRA 3AFAD 4WU8B 3R45A 1KX4A 4X23A 3X1SD 1KX5A 5B33B 5B0YA 3REKA 2Y2IA 5F99C 4NE5A 5AV8A 5BT1D 4AWLC 1P3AB 3W99A 5BO0A 3LJAD 4JJNC 3X1TC 1M18D 3AZKC 3B6GD 4XZQD 4G91C 5B33D 3AV1B 5CPIA 3B0BA 2CV5A 2YFWB 5B31B 3LZ0C 4J8UB 5B2IB 1AOIB 1P3MA 1HQ3D 2HIOC 4ZUXB 3MGRC 4NE3A 1JFIA 1EQZA 4KUDB 1P34B 5CP6B 3AV1D 4J8XA 3C1CC 4Z66B 3O62C 5B31D 5B2ID 3RELA 2ZY5A 3A6NA 2FJ7B 4ZUXD 1S32D 3B0CW 2G5HC 3REHC 4QLCB 4WU9C 3X1UC 2Y2JA 3AZNC 1P34D 1Q9CA 4R8PC 3AZED 5GT3C 1KX4C 4Z2MG 4X23C 1KX5C 2YFVB 4Z66D 3AZFB 5AVBA 3REKC 2ZY4A 5AV8C 2FJ7D 3MGPA 3W99C 3W97A 1P3KA 4E45A 5AVCB 2PYOB 3H0MC 1P3FC 1F1EA 2AROA 3WKJD 3AZHB 2XD1A 3AZFD 5CPIC 2CV5C 3NQJB 4H9SA 5B1LA 1P3MC 4UUZB 3LELB 5GXQB 4ZBJB 5B1MD 3AV2B 4KGCA 5AVCD 2PYOD 1EQZC 1P3OA 3C1BA 3AFAA 3AZHD 4H9NB 3X1SA 5GSUD 5B0ZA 4CAYB 5AV5A 4WNNB 3AZLA 3RELC 3AN2B 3UTAA 3A6NC 1ID3B 5GXQD 5BS7A 4H9PA 2F8NH 3AV2D 1P3PB 3X1VB 4WU8A 3MGQA 2BYKB 3EPLA 5AVBC 1N1JB 4HGAB 5JA4B 5B2JD 5DNMD 3AN2D 1P3AA 3AYWB 1ID3D 4LD9B 3MGPC 4H9RB 3VH6A 1P3IB 1P3BA 3REJB 1P3PD 3UT9B 3LZ1B 3X1VD 1P3KC 3WA9B 1TAFB 2AROC 3AV1A 3WTPD 2BYMA 5FUGA 4J8UA 1ZLAB 1AOIA 5DNND 4J8WD 4LD9D 5B1LC 1P3LB 1BH8B 5BNXA 1TZYC 2XD5A 2F8NA 3UT9D 3LZ1D 4KGCC 3WA9D 4KUDA 1P34A 3B0CT 5CP6A 3AL0C 1KX3A 5B32G 4Z66A 2Y2OA 5B0ZC 1M1AB 5AV5C 3AZLC 3UTAC 1HTAA 3MNNB 5BS7C 3KUYC 1P3GB 4QLCA 3KXBB 1H3OA 3AZMD 5B32C 2Y2NA 1U35B 4WU8C 4Z5TB 2YFVA 3MGQC 2RVQC 1M1AD 3W98B 1T3UA 1P3AC 3MNND 3KXBD 1BH9A 1P3BC 3W96C 3LJAB 4J8VD 1M18B 1M19B 2PYOA 4XZQB 1U35D 5CPKB 3AZHA 4Z5TD 2Y2LA 3B6FB 5BNVB 3AV1C 2F8NG 5B24B 3W98D 4J8UC 3WAAC 1AOIC 1KU5A 5AV6B 4XUJD 3LELA 3UTBC 1HQ3B 2NZDA 3AZGB 1M19D 5CPJB 4KUDC 3KWQB 5CPKD 3B6FD 5CP6C 4H9NA 5C3IC 5B24D 3EPKA 3REIB 4H9QB 1KX3C 1F66D 4CAYA 2ZY3A 3AN2A 5AV9A 5AV6D 3V9RA 5JRGB 1S32B 4QLCC 3AZGD 3VH5T 2NQBB 4DRBA 5CPJD 3KWQD 1W2EA 5B40B 5E5AC 3REID 3AZEB 2BYKA 3MVDD 5JA4A 4KHAB 3AYWA 3TU4A 3AZID 4LD9A 4YM6D 1P3IA 5JRGD 3REJA 2NQBD 5GT0C 3LZ1A 5B40D 3WKJB 3EPJA 2L5AA 2HUEC 5B0YC 1ZLAA 3X1TB 2Y2QA 1P3LA 3LELC 5AY8A 2NZDC 5B1MB 5F99D 5KDMB 3F6TA 5GSUB 4JJND 3X1TD 2RIQA 3MGSA 3AZKD 5AV9C 3B0DB 3AZJA 1P3GA 2Y2HA 3KXBA 2IO5C 3C1CB 4NFTA 1U35A 3O62B 3LZ0D 2W8SA 4J8XC 3W98A 2HIOD 2G5IC 3MGRD 3REHB 4WU9B 3X1UB 5B2JB 5DNMB 3TU4C 3AZNB 3AYWC 4R8PB 1P3IC 5GT3B 2Y2MA 4UPKA 3LJAA 2Y2GA 3C1CD 3IP4C 3REJC 1M18A 3A1KA 1KX5B 4XZQA 3B6GA 3O62D 4NE6A 5CPKA 3B6FA 5BNVA 5B33A 3WTPB 3REHD 4WU9D 1ZLAC 3X1UD 3AZND 1R4VA 5AV6A 5DNNB 4J8WB 4R8PD 1P3LC 1HQ3A 4WZSB 5GT3D 1P3FB 1KX4D 5AY8C 4CSRB 4X23D 1KX5D 3W97C 3REKD 2CV5B 5AV8D 3REIA 4H9QA 1P3MB 2YFWA 5B31A 3W99D 5B2IA 4H9SC 2JE5A 3MGSC 1EQZB 5JRGA 3AZJC 4ZUXA 1S32A 1P3GC 1P3FD 4G92C 3AZMB 5CPID 4EO5C 2CV5D 5B40A 1P3OC 3AZEA 3C1BC 3AFAC 3RELB 1P3MD 3X1SC 4KHAA 5BT1C 2FJ7A 1EQZD 3LJAC 1M18C 4J8VB 5G49B 3B6GC 4XZQC 3WKJA 2DQNC 3RELD 3A6ND 5B33C 3AZFA 3VH6W 3MGPB 1P3KB 1HQ3C 4XUJB 5B31G 5B1MA 4WV4B 5AVCA 5KDMA 5AVBD 4YS3B 3MGPD 5B1LB 5GSUA 1F66B 3NQJA 5B31C 5B2IC 1TZYB 4UUZA 1P3KD 5GXQA 4H9OB 4ZUXC 2AROD 1S32C 3AV2A 3O62A 4YS3D 1P34C 3AZEC 2CWEA 5B1LD 3UTAB 4Z66C 3MVDB 3KUYB 1TZYD 4WNNA 3NQUB 5B2JA 5DNMA 3AZIB 1ID3A 2FJ7C 5B32B 4KGCD 4YM6B 5GT3A 5CHLB 1P3PA 3MGQB 3X1VA 5B0ZD 5AV5D 3AZLD 3FDDA 3WKJC 3UTAD 3WTPA 3AZFC 3KUYD 1N1JA 1P3BB 5DNNA 4J8WA 5B32D 3W96B 4H9RA 3WTPE 1P3FA 4WU8D 2UWXA 4CSRA 3MGQD 5B1MC 3UT9A 2RVQD 5AVCC 2BYMB 5FUGB 2PYOC 3WA9A 1TAFA 5F99B 2ZM5A 1P3AD 4AWLB 3AZHC 3WAAB 5GSUC 3UTBB 5BNXB 1P3BD 4JJNB 3W96D 3AZKB 2F8NB 3B0DC 1BH8A 5GXQC 4G91B 4ZBJC 5C3IB 3AZMA 3AV2C 1KX3B 4J8UD 3H0RC 4M6BA 3LZ0B 1AOID 3WAAD 2BG1A 3UTBD 1M1AA 1WWIA 2HIOB 3MGRB 5B2JC 2ZY2A 1H3OB 5DNMC 3AN2C 2FFFB 3VH6T 1ID3C 3MNNA 2F8ND 4KUDD 5CP6D 1B67A 5E5AB 4J8VA 5G49A 1P3PC 1KX3D 3X1VC 4Z5TA 1WWSA 3WTPC 2Y2KA 4DRAA 4QLCD 4HGAC 1BFMA 1BH9B 5DNNC 5GT0B 3VH5A 4J8WC 4LD9C 4XUJA 3EG5B 5E5AD 1KX4B 3R45B 1M19A 4X23B 3UT9C 3LZ1C 3WA9C 2HUEB 5B0YB 4YS3A 3REKB 5AV8B 5B24A 1F66A 1TZYA 3W99B 5BO0B 5GT0D 2NZDB 4H9OA 3AZGA 3AZMC 2JSSA 5CPJA 3KWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0Y D;  5CPI B;  5AV9 B;  3LEL D;  3V9R B;  3MVD A;  3KUY A;  1M1A C;  3NQU A;  2IO5 B;  2NZD D;  3AZI A;  5B32 A;  4YM6 A;  1JFI B;  3MNN C;  3KXB C;  2NQB A;  4J8V C;  4J8X B;  1U35 C;  4Z5T C;  3VH5 W;  5AV9 D;  3TU4 B;  3A6N B;  3W98 C;  3W96 A;  4XUJ C;  4J8X D;  1M19 C;  5F99 A;  1A7W A;  5AVB B;  4YS3 C;  5CPK C;  3B6F C;  3WAA A;  3AYW D;  3TU4 D;  5B24 C;  1F66 C;  3UTB A;  1P3I D;  4JJN A;  3REJ D;  3X1T A;  5AY8 B;  3AZK A;  3W97 B;  5AV6 C;  2ARO B;  3AZG C;  2F8N K;  5CPJ C;  3KWQ C;  3LZ0 A;  1ZLA D;  3REI C;  3MGS B;  1P3L D;  2HIO A;  3MVD C;  3AZJ B;  5AY8 D;  4Z2M H;  3MGR A;  3W97 D;  3AZI C;  4G92 B;  4YM6 C;  4EO5 B;  4KGC B;  5JRG C;  5E5A A;  1P3O B;  3C1B B;  3AFA B;  2NQB C;  3C1C A;  3X1S B;  5B0Z B;  1B6W A;  5B40 C;  4E44 A;  2LY8 A;  5AV5 B;  3MGS D;  3AZL B;  3AZJ D;  1P3G D;  3REH A;  3KSY A;  4WU9 A;  4H9P B;  3X1U A;  5GT0 A;  3AZN A;  3B6G B;  4R8P A;  1ULY A;  1P3O D;  3C1B D;  3AFA D;  4WU8 B;  3R45 A;  1KX4 A;  4X23 A;  3X1S D;  1KX5 A;  5B33 B;  5B0Y A;  3REK A;  5F99 C;  4NE5 A;  5AV8 A;  5BT1 D;  4AWL C;  1P3A B;  3W99 A;  5BO0 A;  3LJA D;  4JJN C;  3X1T C;  1M18 D;  3AZK C;  3B6G D;  4XZQ D;  4G91 C;  5B33 D;  3AV1 B;  5CPI A;  3B0B A;  2CV5 A;  2YFW B;  5B31 B;  3LZ0 C;  4J8U B;  5B2I B;  1AOI B;  1P3M A;  1HQ3 D;  2HIO C;  4ZUX B;  3MGR C;  4NE3 A;  1JFI A;  1EQZ A;  4KUD B;  1P34 B;  5CP6 B;  3AV1 D;  4J8X A;  3C1C C;  4Z66 B;  3O62 C;  5B31 D;  5B2I D;  3REL A;  3A6N A;  2FJ7 B;  4ZUX D;  1S32 D;  3B0C W;  3REH C;  4QLC B;  4WU9 C;  3X1U C;  3AZN C;  1P34 D;  1Q9C A;  4R8P C;  3AZE D;  5GT3 C;  1KX4 C;  4Z2M G;  4X23 C;  1KX5 C;  2YFV B;  4Z66 D;  3AZF B;  5AVB A;  3REK C;  5AV8 C;  2FJ7 D;  3MGP A;  3W99 C;  3W97 A;  1P3K A;  4E45 A;  5AVC B;  2PYO B;  1P3F C;  1F1E A;  2ARO A;  3WKJ D;  3AZH B;  3AZF D;  5CPI C;  2CV5 C;  3NQJ B;  4H9S A;  5B1L A;  1P3M C;  4UUZ B;  3LEL B;  5GXQ B;  4ZBJ B;  5B1M D;  3AV2 B;  4KGC A;  5AVC D;  2PYO D;  1EQZ C;  1P3O A;  3C1B A;  3AFA A;  3AZH D;  4H9N B;  3X1S A;  5GSU D;  5B0Z A;  4CAY B;  5AV5 A;  4WNN B;  3AZL A;  3REL C;  3AN2 B;  3UTA A;  3A6N C;  1ID3 B;  5GXQ D;  5BS7 A;  4H9P A;  2F8N H;  3AV2 D;  1P3P B;  3X1V B;  4WU8 A;  3MGQ A;  2BYK B;  5AVB C;  1N1J B;  4HGA B;  5JA4 B;  5B2J D;  5DNM D;  3AN2 D;  1P3A A;  3AYW B;  1ID3 D;  4LD9 B;  3MGP C;  4H9R B;  3VH6 A;  1P3I B;  1P3B A;  3REJ B;  1P3P D;  3UT9 B;  3LZ1 B;  3X1V D;  1P3K C;  3WA9 B;  1TAF B;  2ARO C;  3AV1 A;  3WTP D;  2BYM A;  5FUG A;  4J8U A;  1ZLA B;  1AOI A;  5DNN D;  4J8W D;  4LD9 D;  5B1L C;  1P3L B;  1BH8 B;  5BNX A;  1TZY C;  2F8N A;  3UT9 D;  3LZ1 D;  4KGC C;  3WA9 D;  4KUD A;  1P34 A;  3B0C T;  5CP6 A;  1KX3 A;  5B32 G;  4Z66 A;  5B0Z C;  1M1A B;  5AV5 C;  3AZL C;  3UTA C;  1HTA A;  3MNN B;  5BS7 C;  3KUY C;  1P3G B;  4QLC A;  3KXB B;  1H3O A;  3AZM D;  5B32 C;  1U35 B;  4WU8 C;  4Z5T B;  2YFV A;  3MGQ C;  2RVQ C;  1M1A D;  3W98 B;  1P3A C;  3MNN D;  3KXB D;  1BH9 A;  1P3B C;  3W96 C;  3LJA B;  4J8V D;  1M18 B;  1M19 B;  2PYO A;  4XZQ B;  1U35 D;  5CPK B;  3AZH A;  4Z5T D;  3B6F B;  5BNV B;  3AV1 C;  2F8N G;  5B24 B;  3W98 D;  4J8U C;  3WAA C;  1AOI C;  1KU5 A;  5AV6 B;  4XUJ D;  3LEL A;  3UTB C;  1HQ3 B;  2NZD A;  3AZG B;  1M19 D;  5CPJ B;  4KUD C;  3KWQ B;  5CPK D;  3B6F D;  5CP6 C;  4H9N A;  5C3I C;  5B24 D;  3REI B;  1F66 D;  4H9Q B;  1KX3 C;  4CAY A;  3AN2 A;  5AV9 A;  5AV6 D;  3V9R A;  5JRG B;  1S32 B;  4QLC C;  3AZG D;  3VH5 T;  2NQB B;  4DRB A;  5CPJ D;  3KWQ D;  5B40 B;  5E5A C;  3REI D;  3AZE B;  2BYK A;  3MVD D;  5JA4 A;  4KHA B;  3AYW A;  3TU4 A;  3AZI D;  4LD9 A;  4YM6 D;  1P3I A;  5JRG D;  3REJ A;  2NQB D;  5GT0 C;  3LZ1 A;  5B40 D;  3WKJ B;  2L5A A;  2HUE C;  5B0Y C;  1ZLA A;  3X1T B;  1P3L A;  3LEL C;  5AY8 A;  2NZD C;  5B1M B;  5F99 D;  5KDM B;  5GSU B;  4JJN D;  3X1T D;  3MGS A;  3AZK D;  5AV9 C;  3B0D B;  3AZJ A;  1P3G A;  3KXB A;  2IO5 C;  3C1C B;  4NFT A;  1U35 A;  3O62 B;  3LZ0 D;  4J8X C;  3W98 A;  2HIO D;  3MGR D;  3REH B;  4WU9 B;  3X1U B;  5B2J B;  5DNM B;  3TU4 C;  3AZN B;  3AYW C;  4R8P B;  1P3I C;  5GT3 B;  3LJA A;  3REJ C;  1M18 A;  3C1C D;  3B6G A;  1KX5 B;  4XZQ A;  3O62 D;  4NE6 A;  5CPK A;  3B6F A;  5BNV A;  5B33 A;  3WTP B;  3REH D;  4WU9 D;  1ZLA C;  3X1U D;  3AZN D;  1R4V A;  5AV6 A;  5DNN B;  4J8W B;  4R8P D;  1P3L C;  1HQ3 A;  4WZS B;  5GT3 D;  1P3F B;  1KX4 D;  5AY8 C;  4CSR B;  4X23 D;  1KX5 D;  3W97 C;  3REK D;  2CV5 B;  5AV8 D;  3REI A;  4H9Q A;  1P3M B;  2YFW A;  5B31 A;  3W99 D;  5B2I A;  4H9S C;  3MGS C;  1EQZ B;  5JRG A;  3AZJ C;  4ZUX A;  1S32 A;  1P3G C;  1P3F D;  4G92 C;  3AZM B;  5CPI D;  4EO5 C;  2CV5 D;  5B40 A;  1P3O C;  3AZE A;  3C1B C;  3AFA C;  3REL B;  1P3M D;  3X1S C;  4KHA A;  5BT1 C;  2FJ7 A;  1EQZ D;  3LJA C;  1M18 C;  4J8V B;  5G49 B;  3B6G C;  4XZQ C;  3WKJ A;  3REL D;  3A6N D;  5B33 C;  3AZF A;  3VH6 W;  3MGP B;  1P3K B;  1HQ3 C;  4XUJ B;  5B31 G;  5B1M A;  4WV4 B;  5AVC A;  5KDM A;  5AVB D;  4YS3 B;  3MGP D;  5B1L B;  5GSU A;  1F66 B;  3NQJ A;  5B31 C;  5B2I C;  1TZY B;  4UUZ A;  1P3K D;  5GXQ A;  4H9O B;  4ZUX C;  2ARO D;  1S32 C;  3AV2 A;  3O62 A;  4YS3 D;  1P34 C;  3AZE C;  2CWE A;  5B1L D;  3UTA B;  4Z66 C;  3MVD B;  3KUY B;  1TZY D;  4WNN A;  3NQU B;  5B2J A;  5DNM A;  3AZI B;  1ID3 A;  2FJ7 C;  5B32 B;  4KGC D;  4YM6 B;  5GT3 A;  5CHL B;  1P3P A;  3MGQ B;  3X1V A;  5B0Z D;  5AV5 D;  3AZL D;  3WKJ C;  3UTA D;  3WTP A;  3AZF C;  3KUY D;  1N1J A;  1P3B B;  5DNN A;  4J8W A;  5B32 D;  3W96 B;  4H9R A;  3WTP E;  1P3F A;  4WU8 D;  4CSR A;  3MGQ D;  5B1M C;  3UT9 A;  2RVQ D;  5AVC C;  2BYM B;  5FUG B;  2PYO C;  3WA9 A;  1TAF A;  5F99 B;  1P3A D;  4AWL B;  3AZH C;  3WAA B;  5GSU C;  3UTB B;  5BNX B;  1P3B D;  4JJN B;  3W96 D;  3AZK B;  2F8N B;  3B0D C;  1BH8 A;  5GXQ C;  4G91 B;  4ZBJ C;  5C3I B;  3AZM A;  3AV2 C;  1KX3 B;  4J8U D;  4M6B A;  3LZ0 B;  1AOI D;  3WAA D;  3UTB D;  1M1A A;  1WWI A;  2HIO B;  3MGR B;  5B2J C;  5DNM C;  1H3O B;  3AN2 C;  2F8N D;  3VH6 T;  1ID3 C;  4KUD D;  3MNN A;  5CP6 D;  1B67 A;  5E5A B;  4J8V A;  5G49 A;  1P3P C;  1KX3 D;  3X1V C;  4Z5T A;  1WWS A;  3WTP C;  4DRA A;  4QLC D;  4HGA C;  1BFM A;  1BH9 B;  5DNN C;  5GT0 B;  3VH5 A;  4J8W C;  4LD9 C;  4XUJ A;  5E5A D;  1KX4 B;  3R45 B;  1M19 A;  4X23 B;  3UT9 C;  3LZ1 C;  3WA9 C;  2HUE B;  5B0Y B;  4YS3 A;  3REK B;  5AV8 B;  5B24 A;  1F66 A;  1TZY A;  3W99 B;  5BO0 B;  5GT0 D;  2NZD B;  4H9O A;  3AZG A;  3AZM C;  2JSS A;  5CPJ A;  3KWQ A; 
#chains in the Genus database with same CATH topology
 5B0Y D;  5CPI B;  2DF4 C;  1Z2C B;  5AV9 B;  3LEL D;  3V9R B;  3MVD A;  3KUY A;  1M1A C;  3NQU A;  2IO5 B;  2NZD D;  2VQR A;  3AZI A;  3KFU G;  5B32 A;  4YM6 A;  1JFI B;  3MNN C;  3KXB C;  2NQB A;  4J8V C;  4J8X B;  4WJ3 C;  1U35 C;  4Z5T C;  2F2A C;  3VH5 W;  5AV9 D;  3TU4 B;  3A1I A;  3A6N B;  3W98 C;  3W96 A;  2J8P A;  4XUJ C;  4J8X D;  1M19 C;  5F99 A;  1A7W A;  5AVB B;  4YS3 C;  5CPK C;  3B6F C;  3WAA A;  3AYW D;  3TU4 D;  5B24 C;  1F66 C;  3UTB A;  1P3I D;  4JJN A;  3REJ D;  3X1T A;  5AY8 B;  3AZK A;  2Y2P A;  3W97 B;  5AV6 C;  3EPH A;  4DQY B;  2ARO B;  3AZG C;  2F8N K;  5CPJ C;  3KWQ C;  3LZ0 A;  1ZLA D;  3REI C;  3H0L C;  3MGS B;  1P3L D;  2HIO A;  3MVD C;  3AZJ B;  5AY8 D;  4Z2M H;  3MGR A;  3W97 D;  3AZI C;  4G92 B;  4YM6 C;  4EO5 B;  4KGC B;  5JRG C;  5E5A A;  1P3O B;  3C1B B;  3AFA B;  2NQB C;  3C1C A;  3X1S B;  3P5J B;  5B0Z B;  1B6W A;  5B40 C;  4E44 A;  2LY8 A;  5AV5 B;  3MGS D;  3AZL B;  3AZJ D;  1P3G D;  3REH A;  3KSY A;  4WU9 A;  4H9P B;  3X1U A;  5GT0 A;  3AZN A;  2JCH A;  3B6G B;  4R8P A;  1ULY A;  1P3O D;  3C1B D;  1PZR A;  3AFA D;  4WU8 B;  3R45 A;  1KX4 A;  4X23 A;  3X1S D;  1KX5 A;  5B33 B;  5B0Y A;  3REK A;  2Y2I A;  5F99 C;  4NE5 A;  5AV8 A;  5BT1 D;  4AWL C;  1P3A B;  3W99 A;  5BO0 A;  3LJA D;  4JJN C;  3X1T C;  1M18 D;  3AZK C;  3B6G D;  4XZQ D;  4G91 C;  5B33 D;  3AV1 B;  5CPI A;  3B0B A;  2CV5 A;  2YFW B;  5B31 B;  3LZ0 C;  4J8U B;  5B2I B;  1AOI B;  1P3M A;  1HQ3 D;  2HIO C;  4ZUX B;  3MGR C;  4NE3 A;  1JFI A;  1EQZ A;  4KUD B;  1P34 B;  5CP6 B;  3AV1 D;  4J8X A;  3C1C C;  4Z66 B;  3O62 C;  5B31 D;  5B2I D;  3REL A;  2ZY5 A;  3A6N A;  2FJ7 B;  4ZUX D;  1S32 D;  3B0C W;  2G5H C;  3REH C;  4QLC B;  4WU9 C;  3X1U C;  2Y2J A;  3AZN C;  1P34 D;  1Q9C A;  4R8P C;  3AZE D;  5GT3 C;  1KX4 C;  4Z2M G;  4X23 C;  1KX5 C;  2YFV B;  4Z66 D;  3AZF B;  5AVB A;  3REK C;  2ZY4 A;  5AV8 C;  2FJ7 D;  3MGP A;  3W99 C;  3W97 A;  1P3K A;  4E45 A;  5AVC B;  2PYO B;  3H0M C;  1P3F C;  1F1E A;  2ARO A;  3WKJ D;  3AZH B;  2XD1 A;  3AZF D;  5CPI C;  2CV5 C;  3NQJ B;  4H9S A;  5B1L A;  1P3M C;  4UUZ B;  3LEL B;  5GXQ B;  4ZBJ B;  5B1M D;  3AV2 B;  4KGC A;  5AVC D;  2PYO D;  1EQZ C;  1P3O A;  3C1B A;  3AFA A;  3AZH D;  4H9N B;  3X1S A;  5GSU D;  5B0Z A;  4CAY B;  5AV5 A;  4WNN B;  3AZL A;  3REL C;  3AN2 B;  3UTA A;  3A6N C;  1ID3 B;  5GXQ D;  5BS7 A;  4H9P A;  2F8N H;  3AV2 D;  1P3P B;  3X1V B;  4WU8 A;  3MGQ A;  2BYK B;  3EPL A;  5AVB C;  1N1J B;  4HGA B;  5JA4 B;  5B2J D;  5DNM D;  3AN2 D;  1P3A A;  3AYW B;  1ID3 D;  4LD9 B;  3MGP C;  4H9R B;  3VH6 A;  1P3I B;  1P3B A;  3REJ B;  1P3P D;  3UT9 B;  3LZ1 B;  3X1V D;  1P3K C;  3WA9 B;  1TAF B;  2ARO C;  3AV1 A;  3WTP D;  2BYM A;  5FUG A;  4J8U A;  1ZLA B;  1AOI A;  5DNN D;  4J8W D;  4LD9 D;  5B1L C;  1P3L B;  1BH8 B;  5BNX A;  1TZY C;  2XD5 A;  2F8N A;  3UT9 D;  3LZ1 D;  4KGC C;  3WA9 D;  4KUD A;  1P34 A;  3B0C T;  5CP6 A;  3AL0 C;  1KX3 A;  5B32 G;  4Z66 A;  2Y2O A;  5B0Z C;  1M1A B;  5AV5 C;  3AZL C;  3UTA C;  1HTA A;  3MNN B;  5BS7 C;  3KUY C;  1P3G B;  4QLC A;  3KXB B;  1H3O A;  3AZM D;  5B32 C;  2Y2N A;  1U35 B;  4WU8 C;  4Z5T B;  2YFV A;  3MGQ C;  2RVQ C;  1M1A D;  3W98 B;  1T3U A;  1P3A C;  3MNN D;  3KXB D;  1BH9 A;  1P3B C;  3W96 C;  3LJA B;  4J8V D;  1M18 B;  1M19 B;  2PYO A;  4XZQ B;  1U35 D;  5CPK B;  3AZH A;  4Z5T D;  2Y2L A;  3B6F B;  5BNV B;  3AV1 C;  2F8N G;  5B24 B;  3W98 D;  4J8U C;  3WAA C;  1AOI C;  1KU5 A;  5AV6 B;  4XUJ D;  3LEL A;  3UTB C;  1HQ3 B;  2NZD A;  3AZG B;  1M19 D;  5CPJ B;  4KUD C;  3KWQ B;  5CPK D;  3B6F D;  5CP6 C;  4H9N A;  5C3I C;  5B24 D;  3EPK A;  3REI B;  4H9Q B;  1KX3 C;  1F66 D;  4CAY A;  2ZY3 A;  3AN2 A;  5AV9 A;  5AV6 D;  3V9R A;  5JRG B;  1S32 B;  4QLC C;  3AZG D;  3VH5 T;  2NQB B;  4DRB A;  5CPJ D;  3KWQ D;  1W2E A;  5B40 B;  5E5A C;  3REI D;  3AZE B;  2BYK A;  3MVD D;  5JA4 A;  4KHA B;  3AYW A;  3TU4 A;  3AZI D;  4LD9 A;  4YM6 D;  1P3I A;  5JRG D;  3REJ A;  2NQB D;  5GT0 C;  3LZ1 A;  5B40 D;  3WKJ B;  3EPJ A;  2L5A A;  2HUE C;  5B0Y C;  1ZLA A;  3X1T B;  2Y2Q A;  1P3L A;  3LEL C;  5AY8 A;  2NZD C;  5B1M B;  5F99 D;  5KDM B;  3F6T A;  5GSU B;  4JJN D;  3X1T D;  2RIQ A;  3MGS A;  3AZK D;  5AV9 C;  3B0D B;  3AZJ A;  1P3G A;  2Y2H A;  3KXB A;  2IO5 C;  3C1C B;  4NFT A;  1U35 A;  3O62 B;  3LZ0 D;  2W8S A;  4J8X C;  3W98 A;  2HIO D;  2G5I C;  3MGR D;  3REH B;  4WU9 B;  3X1U B;  5B2J B;  5DNM B;  3TU4 C;  3AZN B;  3AYW C;  4R8P B;  1P3I C;  5GT3 B;  2Y2M A;  4UPK A;  3LJA A;  2Y2G A;  3C1C D;  3IP4 C;  3REJ C;  1M18 A;  3A1K A;  1KX5 B;  4XZQ A;  3B6G A;  3O62 D;  4NE6 A;  5CPK A;  3B6F A;  5BNV A;  5B33 A;  3WTP B;  3REH D;  4WU9 D;  1ZLA C;  3X1U D;  3AZN D;  1R4V A;  5AV6 A;  5DNN B;  4J8W B;  4R8P D;  1P3L C;  1HQ3 A;  4WZS B;  5GT3 D;  1P3F B;  1KX4 D;  5AY8 C;  4CSR B;  4X23 D;  1KX5 D;  3W97 C;  3REK D;  2CV5 B;  5AV8 D;  3REI A;  4H9Q A;  1P3M B;  2YFW A;  5B31 A;  3W99 D;  5B2I A;  4H9S C;  2JE5 A;  3MGS C;  1EQZ B;  5JRG A;  3AZJ C;  4ZUX A;  1S32 A;  1P3G C;  1P3F D;  4G92 C;  3AZM B;  5CPI D;  4EO5 C;  2CV5 D;  5B40 A;  1P3O C;  3AZE A;  3C1B C;  3AFA C;  3REL B;  1P3M D;  3X1S C;  4KHA A;  5BT1 C;  2FJ7 A;  1EQZ D;  3LJA C;  1M18 C;  4J8V B;  5G49 B;  3B6G C;  4XZQ C;  3WKJ A;  2DQN C;  3REL D;  3A6N D;  5B33 C;  3AZF A;  3VH6 W;  3MGP B;  1P3K B;  1HQ3 C;  4XUJ B;  5B31 G;  5B1M A;  4WV4 B;  5AVC A;  5KDM A;  5AVB D;  4YS3 B;  3MGP D;  5B1L B;  5GSU A;  1F66 B;  3NQJ A;  5B31 C;  5B2I C;  1TZY B;  4UUZ A;  1P3K D;  5GXQ A;  4H9O B;  4ZUX C;  2ARO D;  1S32 C;  3AV2 A;  3O62 A;  4YS3 D;  1P34 C;  3AZE C;  2CWE A;  5B1L D;  3UTA B;  4Z66 C;  3MVD B;  3KUY B;  1TZY D;  4WNN A;  3NQU B;  5B2J A;  5DNM A;  3AZI B;  1ID3 A;  2FJ7 C;  5B32 B;  4KGC D;  4YM6 B;  5GT3 A;  5CHL B;  1P3P A;  3MGQ B;  3X1V A;  5B0Z D;  5AV5 D;  3AZL D;  3FDD A;  3WKJ C;  3UTA D;  3WTP A;  3AZF C;  3KUY D;  1N1J A;  1P3B B;  5DNN A;  4J8W A;  5B32 D;  3W96 B;  4H9R A;  3WTP E;  1P3F A;  4WU8 D;  2UWX A;  4CSR A;  3MGQ D;  5B1M C;  3UT9 A;  2RVQ D;  5AVC C;  2BYM B;  5FUG B;  2PYO C;  3WA9 A;  1TAF A;  5F99 B;  2ZM5 A;  1P3A D;  4AWL B;  3AZH C;  3WAA B;  5GSU C;  3UTB B;  5BNX B;  1P3B D;  4JJN B;  3W96 D;  3AZK B;  2F8N B;  3B0D C;  1BH8 A;  5GXQ C;  4G91 B;  4ZBJ C;  5C3I B;  3AZM A;  3AV2 C;  1KX3 B;  4J8U D;  3H0R C;  4M6B A;  3LZ0 B;  1AOI D;  3WAA D;  2BG1 A;  3UTB D;  1M1A A;  1WWI A;  2HIO B;  3MGR B;  5B2J C;  2ZY2 A;  1H3O B;  5DNM C;  3AN2 C;  2FFF B;  3VH6 T;  1ID3 C;  3MNN A;  2F8N D;  4KUD D;  5CP6 D;  1B67 A;  5E5A B;  4J8V A;  5G49 A;  1P3P C;  1KX3 D;  3X1V C;  4Z5T A;  1WWS A;  3WTP C;  2Y2K A;  4DRA A;  4QLC D;  4HGA C;  1BFM A;  1BH9 B;  5DNN C;  5GT0 B;  3VH5 A;  4J8W C;  4LD9 C;  4XUJ A;  3EG5 B;  5E5A D;  1KX4 B;  3R45 B;  1M19 A;  4X23 B;  3UT9 C;  3LZ1 C;  3WA9 C;  2HUE B;  5B0Y B;  4YS3 A;  3REK B;  5AV8 B;  5B24 A;  1F66 A;  1TZY A;  3W99 B;  5BO0 B;  5GT0 D;  2NZD B;  4H9O A;  3AZG A;  3AZM C;  2JSS A;  5CPJ A;  3KWQ A; 
#chains in the Genus database with same CATH homology
 5B0Y D;  5CPI B;  2DF4 C;  1Z2C B;  5AV9 B;  3LEL D;  3V9R B;  3MVD A;  3KUY A;  1M1A C;  3NQU A;  2IO5 B;  2NZD D;  2VQR A;  3AZI A;  3KFU G;  5B32 A;  4YM6 A;  1JFI B;  3MNN C;  3KXB C;  2NQB A;  4J8V C;  4J8X B;  4WJ3 C;  1U35 C;  4Z5T C;  2F2A C;  3VH5 W;  5AV9 D;  3TU4 B;  3A1I A;  3A6N B;  3W98 C;  3W96 A;  2J8P A;  4XUJ C;  4J8X D;  1M19 C;  5F99 A;  1A7W A;  5AVB B;  4YS3 C;  5CPK C;  3B6F C;  3WAA A;  3AYW D;  3TU4 D;  5B24 C;  1F66 C;  3UTB A;  1P3I D;  4JJN A;  3REJ D;  3X1T A;  5AY8 B;  3AZK A;  2Y2P A;  3W97 B;  5AV6 C;  3EPH A;  4DQY B;  2ARO B;  3AZG C;  2F8N K;  5CPJ C;  3KWQ C;  3LZ0 A;  1ZLA D;  3REI C;  3H0L C;  3MGS B;  1P3L D;  2HIO A;  3MVD C;  3AZJ B;  5AY8 D;  4Z2M H;  3MGR A;  3W97 D;  3AZI C;  4G92 B;  4YM6 C;  4EO5 B;  4KGC B;  5JRG C;  5E5A A;  1P3O B;  3C1B B;  3AFA B;  2NQB C;  3C1C A;  3X1S B;  3P5J B;  5B0Z B;  1B6W A;  5B40 C;  4E44 A;  2LY8 A;  5AV5 B;  3MGS D;  3AZL B;  3AZJ D;  1P3G D;  3REH A;  3KSY A;  4WU9 A;  4H9P B;  3X1U A;  5GT0 A;  3AZN A;  2JCH A;  3B6G B;  4R8P A;  1ULY A;  1P3O D;  3C1B D;  1PZR A;  3AFA D;  4WU8 B;  3R45 A;  1KX4 A;  4X23 A;  3X1S D;  1KX5 A;  5B33 B;  5B0Y A;  3REK A;  2Y2I A;  5F99 C;  4NE5 A;  5AV8 A;  5BT1 D;  4AWL C;  1P3A B;  3W99 A;  5BO0 A;  3LJA D;  4JJN C;  3X1T C;  1M18 D;  3AZK C;  3B6G D;  4XZQ D;  4G91 C;  5B33 D;  3AV1 B;  5CPI A;  3B0B A;  2CV5 A;  2YFW B;  5B31 B;  3LZ0 C;  4J8U B;  5B2I B;  1AOI B;  1P3M A;  1HQ3 D;  2HIO C;  4ZUX B;  3MGR C;  4NE3 A;  1JFI A;  1EQZ A;  4KUD B;  1P34 B;  5CP6 B;  3AV1 D;  4J8X A;  3C1C C;  4Z66 B;  3O62 C;  5B31 D;  5B2I D;  3REL A;  2ZY5 A;  3A6N A;  2FJ7 B;  4ZUX D;  1S32 D;  3B0C W;  2G5H C;  3REH C;  4QLC B;  4WU9 C;  3X1U C;  2Y2J A;  3AZN C;  1P34 D;  1Q9C A;  4R8P C;  3AZE D;  5GT3 C;  1KX4 C;  4Z2M G;  4X23 C;  1KX5 C;  2YFV B;  4Z66 D;  3AZF B;  5AVB A;  3REK C;  2ZY4 A;  5AV8 C;  2FJ7 D;  3MGP A;  3W99 C;  3W97 A;  1P3K A;  4E45 A;  5AVC B;  2PYO B;  3H0M C;  1P3F C;  1F1E A;  2ARO A;  3WKJ D;  3AZH B;  2XD1 A;  3AZF D;  5CPI C;  2CV5 C;  3NQJ B;  4H9S A;  5B1L A;  1P3M C;  4UUZ B;  3LEL B;  5GXQ B;  4ZBJ B;  5B1M D;  3AV2 B;  4KGC A;  5AVC D;  2PYO D;  1EQZ C;  1P3O A;  3C1B A;  3AFA A;  3AZH D;  4H9N B;  3X1S A;  5GSU D;  5B0Z A;  4CAY B;  5AV5 A;  4WNN B;  3AZL A;  3REL C;  3AN2 B;  3UTA A;  3A6N C;  1ID3 B;  5GXQ D;  5BS7 A;  4H9P A;  2F8N H;  3AV2 D;  1P3P B;  3X1V B;  4WU8 A;  3MGQ A;  2BYK B;  3EPL A;  5AVB C;  1N1J B;  4HGA B;  5JA4 B;  5B2J D;  5DNM D;  3AN2 D;  1P3A A;  3AYW B;  1ID3 D;  4LD9 B;  3MGP C;  4H9R B;  3VH6 A;  1P3I B;  1P3B A;  3REJ B;  1P3P D;  3UT9 B;  3LZ1 B;  3X1V D;  1P3K C;  3WA9 B;  1TAF B;  2ARO C;  3AV1 A;  3WTP D;  2BYM A;  5FUG A;  4J8U A;  1ZLA B;  1AOI A;  5DNN D;  4J8W D;  4LD9 D;  5B1L C;  1P3L B;  1BH8 B;  5BNX A;  1TZY C;  2XD5 A;  2F8N A;  3UT9 D;  3LZ1 D;  4KGC C;  3WA9 D;  4KUD A;  1P34 A;  3B0C T;  5CP6 A;  3AL0 C;  1KX3 A;  5B32 G;  4Z66 A;  2Y2O A;  5B0Z C;  1M1A B;  5AV5 C;  3AZL C;  3UTA C;  1HTA A;  3MNN B;  5BS7 C;  3KUY C;  1P3G B;  4QLC A;  3KXB B;  1H3O A;  3AZM D;  5B32 C;  2Y2N A;  1U35 B;  4WU8 C;  4Z5T B;  2YFV A;  3MGQ C;  2RVQ C;  1M1A D;  3W98 B;  1T3U A;  1P3A C;  3MNN D;  3KXB D;  1BH9 A;  1P3B C;  3W96 C;  3LJA B;  4J8V D;  1M18 B;  1M19 B;  2PYO A;  4XZQ B;  1U35 D;  5CPK B;  3AZH A;  4Z5T D;  2Y2L A;  3B6F B;  5BNV B;  3AV1 C;  2F8N G;  5B24 B;  3W98 D;  4J8U C;  3WAA C;  1AOI C;  1KU5 A;  5AV6 B;  4XUJ D;  3LEL A;  3UTB C;  1HQ3 B;  2NZD A;  3AZG B;  1M19 D;  5CPJ B;  4KUD C;  3KWQ B;  5CPK D;  3B6F D;  5CP6 C;  4H9N A;  5C3I C;  5B24 D;  3EPK A;  3REI B;  4H9Q B;  1KX3 C;  1F66 D;  4CAY A;  2ZY3 A;  3AN2 A;  5AV9 A;  5AV6 D;  3V9R A;  5JRG B;  1S32 B;  4QLC C;  3AZG D;  3VH5 T;  2NQB B;  4DRB A;  5CPJ D;  3KWQ D;  1W2E A;  5B40 B;  5E5A C;  3REI D;  3AZE B;  2BYK A;  3MVD D;  5JA4 A;  4KHA B;  3AYW A;  3TU4 A;  3AZI D;  4LD9 A;  4YM6 D;  1P3I A;  5JRG D;  3REJ A;  2NQB D;  5GT0 C;  3LZ1 A;  5B40 D;  3WKJ B;  3EPJ A;  2L5A A;  2HUE C;  5B0Y C;  1ZLA A;  3X1T B;  2Y2Q A;  1P3L A;  3LEL C;  5AY8 A;  2NZD C;  5B1M B;  5F99 D;  5KDM B;  3F6T A;  5GSU B;  4JJN D;  3X1T D;  2RIQ A;  3MGS A;  3AZK D;  5AV9 C;  3B0D B;  3AZJ A;  1P3G A;  2Y2H A;  3KXB A;  2IO5 C;  3C1C B;  4NFT A;  1U35 A;  3O62 B;  3LZ0 D;  2W8S A;  4J8X C;  3W98 A;  2HIO D;  2G5I C;  3MGR D;  3REH B;  4WU9 B;  3X1U B;  5B2J B;  5DNM B;  3TU4 C;  3AZN B;  3AYW C;  4R8P B;  1P3I C;  5GT3 B;  2Y2M A;  4UPK A;  3LJA A;  2Y2G A;  3C1C D;  3IP4 C;  3REJ C;  1M18 A;  3A1K A;  1KX5 B;  4XZQ A;  3B6G A;  3O62 D;  4NE6 A;  5CPK A;  3B6F A;  5BNV A;  5B33 A;  3WTP B;  3REH D;  4WU9 D;  1ZLA C;  3X1U D;  3AZN D;  1R4V A;  5AV6 A;  5DNN B;  4J8W B;  4R8P D;  1P3L C;  1HQ3 A;  4WZS B;  5GT3 D;  1P3F B;  1KX4 D;  5AY8 C;  4CSR B;  4X23 D;  1KX5 D;  3W97 C;  3REK D;  2CV5 B;  5AV8 D;  3REI A;  4H9Q A;  1P3M B;  2YFW A;  5B31 A;  3W99 D;  5B2I A;  4H9S C;  2JE5 A;  3MGS C;  1EQZ B;  5JRG A;  3AZJ C;  4ZUX A;  1S32 A;  1P3G C;  1P3F D;  4G92 C;  3AZM B;  5CPI D;  4EO5 C;  2CV5 D;  5B40 A;  1P3O C;  3AZE A;  3C1B C;  3AFA C;  3REL B;  1P3M D;  3X1S C;  4KHA A;  5BT1 C;  2FJ7 A;  1EQZ D;  3LJA C;  1M18 C;  4J8V B;  5G49 B;  3B6G C;  4XZQ C;  3WKJ A;  2DQN C;  3REL D;  3A6N D;  5B33 C;  3AZF A;  3VH6 W;  3MGP B;  1P3K B;  1HQ3 C;  4XUJ B;  5B31 G;  5B1M A;  4WV4 B;  5AVC A;  5KDM A;  5AVB D;  4YS3 B;  3MGP D;  5B1L B;  5GSU A;  1F66 B;  3NQJ A;  5B31 C;  5B2I C;  1TZY B;  4UUZ A;  1P3K D;  5GXQ A;  4H9O B;  4ZUX C;  2ARO D;  1S32 C;  3AV2 A;  3O62 A;  4YS3 D;  1P34 C;  3AZE C;  2CWE A;  5B1L D;  3UTA B;  4Z66 C;  3MVD B;  3KUY B;  1TZY D;  4WNN A;  3NQU B;  5B2J A;  5DNM A;  3AZI B;  1ID3 A;  2FJ7 C;  5B32 B;  4KGC D;  4YM6 B;  5GT3 A;  5CHL B;  1P3P A;  3MGQ B;  3X1V A;  5B0Z D;  5AV5 D;  3AZL D;  3FDD A;  3WKJ C;  3UTA D;  3WTP A;  3AZF C;  3KUY D;  1N1J A;  1P3B B;  5DNN A;  4J8W A;  5B32 D;  3W96 B;  4H9R A;  3WTP E;  1P3F A;  4WU8 D;  2UWX A;  4CSR A;  3MGQ D;  5B1M C;  3UT9 A;  2RVQ D;  5AVC C;  2BYM B;  5FUG B;  2PYO C;  3WA9 A;  1TAF A;  5F99 B;  2ZM5 A;  1P3A D;  4AWL B;  3AZH C;  3WAA B;  5GSU C;  3UTB B;  5BNX B;  1P3B D;  4JJN B;  3W96 D;  3AZK B;  2F8N B;  3B0D C;  1BH8 A;  5GXQ C;  4G91 B;  4ZBJ C;  5C3I B;  3AZM A;  3AV2 C;  1KX3 B;  4J8U D;  3H0R C;  4M6B A;  3LZ0 B;  1AOI D;  3WAA D;  2BG1 A;  3UTB D;  1M1A A;  1WWI A;  2HIO B;  3MGR B;  5B2J C;  2ZY2 A;  1H3O B;  5DNM C;  3AN2 C;  2FFF B;  3VH6 T;  1ID3 C;  3MNN A;  2F8N D;  4KUD D;  5CP6 D;  1B67 A;  5E5A B;  4J8V A;  5G49 A;  1P3P C;  1KX3 D;  3X1V C;  4Z5T A;  1WWS A;  3WTP C;  2Y2K A;  4DRA A;  4QLC D;  4HGA C;  1BFM A;  1BH9 B;  5DNN C;  5GT0 B;  3VH5 A;  4J8W C;  4LD9 C;  4XUJ A;  3EG5 B;  5E5A D;  1KX4 B;  3R45 B;  1M19 A;  4X23 B;  3UT9 C;  3LZ1 C;  3WA9 C;  2HUE B;  5B0Y B;  4YS3 A;  3REK B;  5AV8 B;  5B24 A;  1F66 A;  1TZY A;  3W99 B;  5BO0 B;  5GT0 D;  2NZD B;  4H9O A;  3AZG A;  3AZM C;  2JSS A;  5CPJ A;  3KWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...