1P3BD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
94
structure length
94
Chain Sequence
SRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 38
structure length 94
sequence length 94
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3bD00
5AV6A 4J8WD 4JJNC 3AZFB 3NQUB 1P3IA 1M18D 4R8PD 5AY8C 5CPJC 4YM6C 3WTPD 5B32B 5JRGC 4EO5C 5F99B 3AZLD 3B6GD 1KX4C 1BH8B 5DNMA 3C1CD 5C3IC 4Z2MH 3REJB 3MGRC 4J8VB 3WAAC 2AROA 5B2IB 5AVCC 4KUDC 4E44A 5E5AB 3X1UC 3W98A 1KX3B 1BH9B 1TZYA 5CPKB 1P3PC 3AV2C 5B1LC 3REKB 3RELD 1M1AB 1M19B 4R8PB 5DNND 3WKJC 4XZQC 4QLCB 4X23A 3MGSD 4ZUXC 3B6GB 3MGQC 1F1EA 3O62A 5AV9D 3LZ1C 3MGPA 4YS3A 2NQBA 3KXBA 4H9RA 1U35D 5AV5A 4CSRB 1P3AD 3REIA 3VH6A 4G91C 3W96A 4H9SA 4H9QB 3AZJC 1S32A 5BNXA 5GT3D 2FJ7C 5BNVB 3X1VC 3UTBA 3X1SC 3MNND 4J8XC 3B6FA 2F8NB 5B1MA 3MGSB 3LZ0C 2F8NG 4KGCC 3A6ND 5B0ZD 3VH5T 3UT9C 3AZKA 1R4VA 1P3OD 1ID3D 5GT0D 5CHLB 5B0YA 3AZMC 5B31A 3AZEC 5JA4B 3AYWD 4H9NA 1P34C 5G49B 2HIOD 1ZLAD 5B40D 1P3MC 4KHAA 3KSYA 5CPID 5AV6C 1P3BB 4WU9A 1P3IC 2PYOA 3MNNB 1Q9CA 4H9OB 5GXQB 1P3LB 3MVDA 1F66A 1WWSA 1HQ3B 3A6NB 3X1TB 5DNMC 1P3KD 2NZDD 3B0CW 3AZFA 3AZIB 3NQUA 2AROC 4LD9D 1KX5D 3AYWB 5AVBB 3W98C 2HIOB 5B32A 5B40B 1ZLAB 3UTAC 3AV1D 1TZYC 3AZNB 5F99A 5CPIB 5B2JD 1BH8A 3REJA 5B24B 4J8VA 5CP6D 3LJAC 2CV5D 5GSUD 4X23C 5E5AA 2HUEC 5KDMB 5B1MB 1KX3A 1BH9A 1AOIB 3AZGD 3O62C 4HGAC 3WA9C 5CPKA 4YS3C 3MGPC 2NZDB 2NQBC 3KXBC 3REKA 5AV5C 1M1AA 3REIC 1M19A 4R8PA 3AZHD 1P3GC 1KX5B 3W97D 4LD9B 3W96C 3KUYB 2LY8A 5B31B 4H9SC 4NE3A 5B31G 3B6GA 1EQZB 5CPJD 3C1CA 4XUJB 1S32C 5CP6B 3C1BD 3UTBC 4CSRA 3B6FC 3MGRD 5AV8D 4H9QA 3AZKC 2BYMB 4Z5TB 3X1UD 5B0YC 5BNVA 3W97B 5B1LD 2F8NA 3MGSA 4DRAA 4M6BA 3AN2D 3V9RB 5B32G 4WU9C 3TU4B 3C1BB 2PYOC 4WV4B 3MVDC 1F66C 5JA4A 1KU5A 5G49A 5AV8B 3LELD 1P3BA 3AZFC 1P3FB 4J8WB 3MNNA 4H9OA 5GXQA 4J8UD 1M18B 1P3LA 5B32C 4NE6A 2FJ7D 3WTPB 1HQ3A 5F99C 3X1VD 3A6NA 3X1TA 3AN2B 4J8XD 5BT1C 3REJC 3AZLB 3C1CB 3KWQD 4J8VC 4KGCD 3AZIA 5B2IC 3VH5A 5E5AC 3AYWA 5AVBA 2HIOA 3LELB 1ZLAA 5B40A 3AFAD 1KX3C 2IO5B 3AZMD 3AZNA 3AZED 5CPIA 5CPKC 3B0CT 3REKC 5B24A 1M1AC 3REHD 1M19C 4R8PC 1P3MD 4J8UB 3RELB 4QLCC 5AV6D 5DNNB 4Z66D 1B67A 4ZBJB 5KDMA 3B6GC 1AOIA 2JSSA 2NZDA 3KWQB 5AV9B 4Z2MG 2L5AA 4G92B 1KX5A 2RVQD 4LD9A 1U35B 1P3AB 3KUYA 3AFAB 4H9PB 5B33D 1EQZA 4XUJA 3W98D 3REHB 3UTAD 5CP6A 5GT3B 4Z66B 3MGSC 3LJAD 3W99D 4X23D 2BYMA 5B0ZB 4Z5TA 4WU8D 1P3OB 3O62D 3W97A 3B0DB 5GT0B 1ID3B 3WA9D 3KXBD 5B33B 1P3GD 1P3BC 3V9RA 3TU4A 3C1BA 3MNNC 4E45A 5GXQC 1P3LC 1HQ3C 1H3OB 3A6NC 3X1TC 5AV8A 3W99B 3B6FD 3AZIC 1P3FA 4DRBA 1P3KB 4WU8B 4J8WA 3B0BA 3AYWC 5AVBC 1M18A 2HIOC 1ZLAC 5B40C 1WWIA 3WTPA 3AZNC 5CPIC 4JJND 3AN2A 3AV1B 5B24C 3AZLA 5B2JB 4AWLB 5AY8D 4YM6D 5JRGD 2CV5B 2YFWB 5GSUB 1KX4D 5B1MC 3LELA 3VH6W 1AOIC 1F66D 1N1JB 2NZDC 3WAAD 3AZGB 5AVCD 4KUDD 4LD9C 1KX5C 4J8UA 3RELA 3KUYC 5B31C 3AZHB 5DNNA 3AZFD 1P3PD 3AV2D 4JJNB 1EQZC 4XUJC 5AY8B 5CPJB 4YM6B 1TAFB 5CP6C 4XZQD 3KWQA 5AV9A 5F99D 3WKJD 5JRGB 4EO5B 1BFMA 4ZUXD 1U35A 1P3AA 1KX4B 3MGQD 5C3IB 3AFAA 3LZ1D 3MGRB 5B2ID 4H9PA 5BS7A 3WAAB 4Z5TC 5E5AD 5AVCB 4KUDB 3REHA 3W97C 3X1UB 5CPKD 4NE5A 5GT3A 4Z66A 3REKD 2CWEA 1ULYA 1P3PB 3AV2B 5B1LB 1M1AD 1M19D 3AZJD 4QLCD 3TU4C 2F8NH 3WKJB 3X1SD 5B0ZA 4XZQB 2YFVB 3C1BC 3NQJB 4ZUXB 3LZ0D 1P3OA 1ID3A 5GT0A 1JFIB 3MGQB 3UT9D 3LZ1B 5AV8C 3R45B 2BYKB 5B33A 5FUGB 1P3FC 4WNNB 3UTAA 4J8WC 4G91B 1P34D 1M18C 3WTPC 3AZJB 1H3OA 3LJAA 3AN2C 1P3ID 4CAYB 2FJ7B 3W99A 2F8ND 3X1VB 3AZLC 3X1SB 4J8XB 3C1CC 1P3KA 4WU8A 3LZ0B 4WZSB 3WA9A 4KGCB 4UUZB 5BO0B 1HTAA 3UT9B 5DNMD 3LELC 1B6WA 2IO5C 1P3GA 2AROD 3AV1A 3AZMB 3AZEB 5B2JA 1P34B 4J8UC 3RELC 1P3BD 1P3MB 5DNNC 1TZYD 4ZBJC 2CV5A 2YFWA 5GSUA 5AV6B 1P3IB 5GXQD 1P3LD 1N1JA 3KWQC 3AZGA 1HQ3D 5AV9C 3X1TD 4G92C 1U35C 1P3AC 3VH6T 5DNMB 3AFAC 3AZHA 3AZID 4YS3D 4NFTA 3MGPD 5BS7C 4JJNA 2NQBD 2AROB 5AV5D 5AVBD 3REID 5AY8A 3REHC 5CPJA 4YM6A 1TAFA 3W98B 3AZND 3W96D 5JRGA 5GT3C 3UTAB 4Z66C 1TZYB 5B24D 1KX4A 1S32D 3MGRA 3LJAB 3UTBD 3WAAA 5B0ZC 5B1MD 5AVCA 4X23B 4KUDA 1AOID 1P3OC 2RVQC 1ID3C 2HUEB 3B0DC 5GT0C 3X1UA 2F8NK 3WA9B 3O62B 4HGAB 3AZKD 3MGPB 4YS3B 1P3PA 5B33C 5B1LA 3AV2A 2NQBB 3KXBB 4H9RB 1A7WA 5AV5B 5B0YD 3KUYD 3REIB 5B31D 1P3GB 3WKJA 4XZQA 2YFVA 3W96B 1EQZD 3NQJA 4ZUXA 4XUJD 1JFIA 3MGQA 3LZ1A 1S32B 4WU9D 3VH5W 5B2IA 3R45A 5BNXB 3W99C 3WTPE 2BYKA 1P3MA 3UTBB 2PYOD 3B6FB 5FUGA 3MVDD 1P3KC 4WNNA 4WU8C 4Z5TD 3AZKB 3AZJA 5B0YB 4QLCA 3AV1C 4CAYA 2FJ7A 3X1VA 3X1SA 5B2JC 4J8XA 4AWLC 4H9NB 5B32D 3LZ0A 4KGCA 4KHAB 4UUZA 3TU4D 2CV5C 5BO0A 5GSUC 3UT9A 5BT1D 4WU9B 3REJD 2PYOB 4J8VD 3AZGC 3AZMA 3MVDB 1F66B 3AZEA 1P34A 1KX3D 3AZHC 1P3FD
chains in the Genus database with same CATH superfamily
5AV6A 4J8WD 4JJNC 3AZFB 3NQUB 1P3IA 1M18D 4R8PD 5AY8C 5CPJC 4YM6C 3WTPD 5B32B 5JRGC 4EO5C 5F99B 3AZLD 3B6GD 1KX4C 1BH8B 5DNMA 3C1CD 5C3IC 4Z2MH 3REJB 3MGRC 4J8VB 3WAAC 2AROA 5B2IB 5AVCC 4KUDC 4E44A 5E5AB 3X1UC 3W98A 2Y2GA 1KX3B 1BH9B 1TZYA 5CPKB 1P3PC 3AV2C 5B1LC 3REKB 3RELD 1M1AB 1M19B 4R8PB 5DNND 3WKJC 4XZQC 4QLCB 4X23A 3MGSD 4ZUXC 3B6GB 3MGQC 1F1EA 3O62A 5AV9D 3LZ1C 3MGPA 4YS3A 2NQBA 3KXBA 4H9RA 1U35D 5AV5A 4CSRB 1P3AD 3REIA 3VH6A 2ZM5A 4G91C 3W96A 4H9SA 4H9QB 3AZJC 1S32A 5BNXA 5GT3D 2FJ7C 5BNVB 3X1VC 3UTBA 3X1SC 3MNND 4J8XC 3B6FA 2F8NB 5B1MA 3MGSB 3LZ0C 2F8NG 4KGCC 3A6ND 5B0ZD 3VH5T 3UT9C 3AZKA 1R4VA 1P3OD 1ID3D 5GT0D 5CHLB 5B0YA 3AZMC 5B31A 4WJ3C 3AZEC 2Y2QA 5JA4B 3AYWD 4H9NA 1P34C 5G49B 2HIOD 1ZLAD 5B40D 1P3MC 4KHAA 3KSYA 5CPID 5AV6C 1P3BB 3H0MC 4WU9A 1P3IC 3EG5B 2PYOA 3MNNB 1Q9CA 2Y2IA 4H9OB 5GXQB 1P3LB 3MVDA 1F66A 1WWSA 1HQ3B 3A6NB 3X1TB 5DNMC 2JCHA 1P3KD 3IP4C 2NZDD 3B0CW 3AZFA 3AZIB 3NQUA 2AROC 4LD9D 1KX5D 3AYWB 5AVBB 3W98C 2HIOB 5B32A 5B40B 1ZLAB 2Y2KA 3UTAC 3AV1D 1TZYC 3AZNB 5F99A 5CPIB 5B2JD 1BH8A 3REJA 5B24B 2G5IC 4J8VA 5CP6D 3LJAC 2CV5D 5GSUD 4X23C 2BG1A 5E5AA 2HUEC 5KDMB 5B1MB 2XD5A 1KX3A 1BH9A 1AOIB 3AZGD 3O62C 4HGAC 3WA9C 5CPKA 4YS3C 3MGPC 2NZDB 2NQBC 3KXBC 3REKA 5AV5C 1M1AA 3REIC 1M19A 4R8PA 3AZHD 1P3GC 1KX5B 3W97D 4LD9B 3W96C 3KUYB 1Z2CB 2LY8A 5B31B 4H9SC 4NE3A 2Y2HA 5B31G 3B6GA 1EQZB 5CPJD 3C1CA 4XUJB 1S32C 5CP6B 3C1BD 3UTBC 4CSRA 3B6FC 3MGRD 3KFUG 2J8PA 5AV8D 4H9QA 3AZKC 2BYMB 4Z5TB 3X1UD 5B0YC 5BNVA 3W97B 5B1LD 2F8NA 3MGSA 4DRAA 4M6BA 3AN2D 3V9RB 5B32G 4WU9C 3TU4B 3C1BB 2PYOC 4WV4B 3MVDC 1F66C 5JA4A 1KU5A 5G49A 5AV8B 3LELD 3EPKA 1P3BA 3AZFC 1P3FB 4J8WB 3MNNA 4H9OA 5GXQA 4J8UD 1M18B 1P3LA 5B32C 4NE6A 2FJ7D 3WTPB 1HQ3A 5F99C 3X1VD 3A6NA 3X1TA 3AN2B 4J8XD 5BT1C 2VQRA 3REJC 3AZLB 3C1CB 3KWQD 4J8VC 4KGCD 3AZIA 2Y2NA 5B2IC 3VH5A 3P5JB 5E5AC 3AYWA 5AVBA 2HIOA 3LELB 2Y2PA 5B40A 3AFAD 1KX3C 1ZLAA 2IO5B 3AZMD 3AZNA 3AZED 5CPIA 5CPKC 3B0CT 3REKC 5B24A 1M1AC 3REHD 1M19C 4R8PC 4UPKA 1P3MD 4J8UB 3RELB 4QLCC 5AV6D 2Y2OA 5DNNB 4Z66D 1B67A 4ZBJB 5KDMA 3B6GC 1AOIA 2G5HC 2JSSA 3EPHA 3KWQB 2NZDA 5AV9B 4Z2MG 3H0RC 2L5AA 4G92B 1KX5A 2RVQD 4LD9A 1U35B 1P3AB 3KUYA 3AFAB 4H9PB 5B33D 1EQZA 4XUJA 2ZY4A 3W98D 1PZRA 3REHB 3UTAD 2Y2MA 5CP6A 2DF4C 5GT3B 4Z66B 3MGSC 3LJAD 3W99D 4X23D 2BYMA 3A1KA 5B0ZB 4Z5TA 4WU8D 1P3OB 3O62D 3W97A 3B0DB 5GT0B 1ID3B 3WA9D 1W2EA 3KXBD 3EPJA 5B33B 1P3GD 1P3BC 3V9RA 3TU4A 3C1BA 3MNNC 4E45A 5GXQC 1P3LC 1HQ3C 1H3OB 3A6NC 3X1TC 5AV8A 3W99B 3B6FD 3AZIC 1P3FA 4DRBA 1P3KB 4WU8B 4J8WA 3B0BA 3AYWC 5AVBC 1M18A 1T3UA 2HIOC 1ZLAC 5B40C 1WWIA 2UWXA 3WTPA 3AZNC 5CPIC 4JJND 3AN2A 3AV1B 5B24C 3AZLA 5B2JB 4AWLB 5AY8D 4YM6D 5JRGD 2CV5B 2YFWB 5GSUB 1KX4D 5B1MC 3LELA 3VH6W 1AOIC 1F66D 1N1JB 2NZDC 3WAAD 3AZGB 5AVCD 4KUDD 4LD9C 1KX5C 4J8UA 3RELA 3KUYC 5B31C 3AZHB 5DNNA 3AZFD 3EPLA 1P3PD 3AV2D 4JJNB 1EQZC 4XUJC 2ZY3A 5AY8B 5CPJB 4YM6B 1TAFB 5CP6C 4XZQD 3KWQA 5AV9A 5F99D 3WKJD 5JRGB 4EO5B 1BFMA 4ZUXD 1U35A 1P3AA 1KX4B 3MGQD 5C3IB 3AFAA 3LZ1D 3MGRB 5B2ID 4H9PA 3A1IA 5BS7A 3WAAB 4Z5TC 5E5AD 3F6TA 5AVCB 4KUDB 3REHA 3W97C 3X1UB 5CPKD 4NE5A 5GT3A 4Z66A 3REKD 2CWEA 1ULYA 1P3PB 3AV2B 5B1LB 1M1AD 1M19D 3AZJD 4QLCD 3TU4C 2F8NH 3WKJB 3X1SD 5B0ZA 4XZQB 2YFVB 3C1BC 3NQJB 4ZUXB 3LZ0D 1P3OA 1ID3A 2FFFB 5GT0A 1JFIB 3MGQB 2JE5A 3LZ1B 3UT9D 5AV8C 3R45B 2BYKB 5B33A 5FUGB 2W8SA 1P3FC 4WNNB 3UTAA 2XD1A 4J8WC 4G91B 1P34D 1M18C 3WTPC 3AZJB 1H3OA 3LJAA 3AN2C 1P3ID 4CAYB 2FJ7B 3W99A 2F8ND 3X1VB 2RIQA 3AZLC 3X1SB 4J8XB 3C1CC 1P3KA 4WU8A 3LZ0B 4WZSB 3WA9A 4KGCB 4UUZB 5BO0B 1HTAA 3UT9B 5DNMD 3LELC 1B6WA 2IO5C 1P3GA 2AROD 3AV1A 3AZMB 3AZEB 5B2JA 1P34B 4J8UC 3RELC 1P3BD 1P3MB 5DNNC 1TZYD 4ZBJC 2CV5A 2YFWA 5GSUA 5AV6B 1P3IB 5GXQD 1P3LD 1N1JA 3KWQC 3AZGA 1HQ3D 5AV9C 3X1TD 4G92C 1U35C 1P3AC 3VH6T 5DNMB 3AFAC 3AZHA 3AZID 4YS3D 4NFTA 3MGPD 5BS7C 4JJNA 2NQBD 2AROB 5AV5D 5AVBD 3REID 5AY8A 3REHC 5CPJA 4YM6A 1TAFA 3W98B 3AZND 3W96D 5JRGA 5GT3C 3UTAB 4Z66C 4DQYB 1TZYB 2DQNC 5B24D 1KX4A 1S32D 3MGRA 3LJAB 3UTBD 3WAAA 5B0ZC 5B1MD 5AVCA 4X23B 4KUDA 1AOID 1P3OC 2RVQC 1ID3C 2HUEB 3B0DC 5GT0C 3X1UA 2F8NK 3H0LC 3WA9B 3O62B 4HGAB 2Y2JA 3AZKD 2ZY2A 3MGPB 4YS3B 5B33C 5B1LA 3AV2A 1P3PA 3KXBB 4H9RB 2NQBB 1A7WA 5AV5B 5B0YD 3KUYD 3REIB 5B31D 1P3GB 3WKJA 4XZQA 2YFVA 3W96B 1EQZD 3NQJA 4ZUXA 4XUJD 1JFIA 3MGQA 3LZ1A 1S32B 4WU9D 3VH5W 2Y2LA 5B2IA 3R45A 5BNXB 3W99C 3WTPE 2BYKA 1P3MA 3UTBB 2PYOD 3B6FB 5FUGA 3MVDD 3AL0C 1P3KC 4WNNA 4WU8C 2F2AC 3FDDA 4Z5TD 3AZKB 3AZJA 5B0YB 4QLCA 3AV1C 4CAYA 2FJ7A 3X1VA 3X1SA 5B2JC 4J8XA 4AWLC 4H9NB 5B32D 3LZ0A 4KGCA 4KHAB 4UUZA 3TU4D 2CV5C 5BO0A 5GSUC 3UT9A 5BT1D 4WU9B 3REJD 2ZY5A 2PYOB 4J8VD 3AZGC 3AZMA 3MVDB 1F66B 3AZEA 1P34A 1KX3D 3AZHC 1P3FD
chains in the Genus database with same CATH topology
5AV6A 4J8WD 4JJNC 3AZFB 3NQUB 1P3IA 1M18D 4R8PD 5AY8C 5CPJC 4YM6C 3WTPD 5B32B 5JRGC 4EO5C 5F99B 3AZLD 3B6GD 1KX4C 1BH8B 5DNMA 3C1CD 5C3IC 4Z2MH 3REJB 3MGRC 4J8VB 3WAAC 2AROA 5B2IB 5AVCC 4KUDC 4E44A 5E5AB 3X1UC 3W98A 2Y2GA 1KX3B 1BH9B 1TZYA 5CPKB 1P3PC 3AV2C 5B1LC 3REKB 3RELD 1M1AB 1M19B 4R8PB 5DNND 3WKJC 4XZQC 4QLCB 4X23A 3MGSD 4ZUXC 3B6GB 3MGQC 1F1EA 3O62A 5AV9D 3LZ1C 3MGPA 4YS3A 2NQBA 3KXBA 4H9RA 1U35D 5AV5A 4CSRB 1P3AD 3REIA 3VH6A 2ZM5A 4G91C 3W96A 4H9SA 4H9QB 3AZJC 1S32A 5BNXA 5GT3D 2FJ7C 5BNVB 3X1VC 3UTBA 3X1SC 3MNND 4J8XC 3B6FA 2F8NB 5B1MA 3MGSB 3LZ0C 2F8NG 4KGCC 3A6ND 5B0ZD 3VH5T 3UT9C 3AZKA 1R4VA 1P3OD 1ID3D 5GT0D 5CHLB 5B0YA 3AZMC 5B31A 4WJ3C 3AZEC 2Y2QA 5JA4B 3AYWD 4H9NA 1P34C 5G49B 2HIOD 1ZLAD 5B40D 1P3MC 4KHAA 3KSYA 5CPID 5AV6C 1P3BB 3H0MC 4WU9A 1P3IC 3EG5B 2PYOA 3MNNB 1Q9CA 2Y2IA 4H9OB 5GXQB 1P3LB 3MVDA 1F66A 1WWSA 1HQ3B 3A6NB 3X1TB 5DNMC 2JCHA 1P3KD 3IP4C 2NZDD 3B0CW 3AZFA 3AZIB 3NQUA 2AROC 4LD9D 1KX5D 3AYWB 5AVBB 3W98C 2HIOB 5B32A 5B40B 1ZLAB 2Y2KA 3UTAC 3AV1D 1TZYC 3AZNB 5F99A 5CPIB 5B2JD 1BH8A 3REJA 5B24B 2G5IC 4J8VA 5CP6D 3LJAC 2CV5D 5GSUD 4X23C 2BG1A 5E5AA 2HUEC 5KDMB 5B1MB 2XD5A 1KX3A 1BH9A 1AOIB 3AZGD 3O62C 4HGAC 3WA9C 5CPKA 4YS3C 3MGPC 2NZDB 2NQBC 3KXBC 3REKA 5AV5C 1M1AA 3REIC 1M19A 4R8PA 3AZHD 1P3GC 1KX5B 3W97D 4LD9B 3W96C 3KUYB 1Z2CB 2LY8A 5B31B 4H9SC 4NE3A 2Y2HA 5B31G 3B6GA 1EQZB 5CPJD 3C1CA 4XUJB 1S32C 5CP6B 3C1BD 3UTBC 4CSRA 3B6FC 3MGRD 3KFUG 2J8PA 5AV8D 4H9QA 3AZKC 2BYMB 4Z5TB 3X1UD 5B0YC 5BNVA 3W97B 5B1LD 2F8NA 3MGSA 4DRAA 4M6BA 3AN2D 3V9RB 5B32G 4WU9C 3TU4B 3C1BB 2PYOC 4WV4B 3MVDC 1F66C 5JA4A 1KU5A 5G49A 5AV8B 3LELD 3EPKA 1P3BA 3AZFC 1P3FB 4J8WB 3MNNA 4H9OA 5GXQA 4J8UD 1M18B 1P3LA 5B32C 4NE6A 2FJ7D 3WTPB 1HQ3A 5F99C 3X1VD 3A6NA 3X1TA 3AN2B 4J8XD 5BT1C 2VQRA 3REJC 3AZLB 3C1CB 3KWQD 4J8VC 4KGCD 3AZIA 2Y2NA 5B2IC 3VH5A 3P5JB 5E5AC 3AYWA 5AVBA 2HIOA 3LELB 2Y2PA 5B40A 3AFAD 1KX3C 1ZLAA 2IO5B 3AZMD 3AZNA 3AZED 5CPIA 5CPKC 3B0CT 3REKC 5B24A 1M1AC 3REHD 1M19C 4R8PC 4UPKA 1P3MD 4J8UB 3RELB 4QLCC 5AV6D 2Y2OA 5DNNB 4Z66D 1B67A 4ZBJB 5KDMA 3B6GC 1AOIA 2G5HC 2JSSA 3EPHA 3KWQB 2NZDA 5AV9B 4Z2MG 3H0RC 2L5AA 4G92B 1KX5A 2RVQD 4LD9A 1U35B 1P3AB 3KUYA 3AFAB 4H9PB 5B33D 1EQZA 4XUJA 2ZY4A 3W98D 1PZRA 3REHB 3UTAD 2Y2MA 5CP6A 2DF4C 5GT3B 4Z66B 3MGSC 3LJAD 3W99D 4X23D 2BYMA 3A1KA 5B0ZB 4Z5TA 4WU8D 1P3OB 3O62D 3W97A 3B0DB 5GT0B 1ID3B 3WA9D 1W2EA 3KXBD 3EPJA 5B33B 1P3GD 1P3BC 3V9RA 3TU4A 3C1BA 3MNNC 4E45A 5GXQC 1P3LC 1HQ3C 1H3OB 3A6NC 3X1TC 5AV8A 3W99B 3B6FD 3AZIC 1P3FA 4DRBA 1P3KB 4WU8B 4J8WA 3B0BA 3AYWC 5AVBC 1M18A 1T3UA 2HIOC 1ZLAC 5B40C 1WWIA 2UWXA 3WTPA 3AZNC 5CPIC 4JJND 3AN2A 3AV1B 5B24C 3AZLA 5B2JB 4AWLB 5AY8D 4YM6D 5JRGD 2CV5B 2YFWB 5GSUB 1KX4D 5B1MC 3LELA 3VH6W 1AOIC 1F66D 1N1JB 2NZDC 3WAAD 3AZGB 5AVCD 4KUDD 4LD9C 1KX5C 4J8UA 3RELA 3KUYC 5B31C 3AZHB 5DNNA 3AZFD 3EPLA 1P3PD 3AV2D 4JJNB 1EQZC 4XUJC 2ZY3A 5AY8B 5CPJB 4YM6B 1TAFB 5CP6C 4XZQD 3KWQA 5AV9A 5F99D 3WKJD 5JRGB 4EO5B 1BFMA 4ZUXD 1U35A 1P3AA 1KX4B 3MGQD 5C3IB 3AFAA 3LZ1D 3MGRB 5B2ID 4H9PA 3A1IA 5BS7A 3WAAB 4Z5TC 5E5AD 3F6TA 5AVCB 4KUDB 3REHA 3W97C 3X1UB 5CPKD 4NE5A 5GT3A 4Z66A 3REKD 2CWEA 1ULYA 1P3PB 3AV2B 5B1LB 1M1AD 1M19D 3AZJD 4QLCD 3TU4C 2F8NH 3WKJB 3X1SD 5B0ZA 4XZQB 2YFVB 3C1BC 3NQJB 4ZUXB 3LZ0D 1P3OA 1ID3A 2FFFB 5GT0A 1JFIB 3MGQB 2JE5A 3LZ1B 3UT9D 5AV8C 3R45B 2BYKB 5B33A 5FUGB 2W8SA 1P3FC 4WNNB 3UTAA 2XD1A 4J8WC 4G91B 1P34D 1M18C 3WTPC 3AZJB 1H3OA 3LJAA 3AN2C 1P3ID 4CAYB 2FJ7B 3W99A 2F8ND 3X1VB 2RIQA 3AZLC 3X1SB 4J8XB 3C1CC 1P3KA 4WU8A 3LZ0B 4WZSB 3WA9A 4KGCB 4UUZB 5BO0B 1HTAA 3UT9B 5DNMD 3LELC 1B6WA 2IO5C 1P3GA 2AROD 3AV1A 3AZMB 3AZEB 5B2JA 1P34B 4J8UC 3RELC 1P3BD 1P3MB 5DNNC 1TZYD 4ZBJC 2CV5A 2YFWA 5GSUA 5AV6B 1P3IB 5GXQD 1P3LD 1N1JA 3KWQC 3AZGA 1HQ3D 5AV9C 3X1TD 4G92C 1U35C 1P3AC 3VH6T 5DNMB 3AFAC 3AZHA 3AZID 4YS3D 4NFTA 3MGPD 5BS7C 4JJNA 2NQBD 2AROB 5AV5D 5AVBD 3REID 5AY8A 3REHC 5CPJA 4YM6A 1TAFA 3W98B 3AZND 3W96D 5JRGA 5GT3C 3UTAB 4Z66C 4DQYB 1TZYB 2DQNC 5B24D 1KX4A 1S32D 3MGRA 3LJAB 3UTBD 3WAAA 5B0ZC 5B1MD 5AVCA 4X23B 4KUDA 1AOID 1P3OC 2RVQC 1ID3C 2HUEB 3B0DC 5GT0C 3X1UA 2F8NK 3H0LC 3WA9B 3O62B 4HGAB 2Y2JA 3AZKD 2ZY2A 3MGPB 4YS3B 5B33C 5B1LA 3AV2A 1P3PA 3KXBB 4H9RB 2NQBB 1A7WA 5AV5B 5B0YD 3KUYD 3REIB 5B31D 1P3GB 3WKJA 4XZQA 2YFVA 3W96B 1EQZD 3NQJA 4ZUXA 4XUJD 1JFIA 3MGQA 3LZ1A 1S32B 4WU9D 3VH5W 2Y2LA 5B2IA 3R45A 5BNXB 3W99C 3WTPE 2BYKA 1P3MA 3UTBB 2PYOD 3B6FB 5FUGA 3MVDD 3AL0C 1P3KC 4WNNA 4WU8C 2F2AC 3FDDA 4Z5TD 3AZKB 3AZJA 5B0YB 4QLCA 3AV1C 4CAYA 2FJ7A 3X1VA 3X1SA 5B2JC 4J8XA 4AWLC 4H9NB 5B32D 3LZ0A 4KGCA 4KHAB 4UUZA 3TU4D 2CV5C 5BO0A 5GSUC 3UT9A 5BT1D 4WU9B 3REJD 2ZY5A 2PYOB 4J8VD 3AZGC 3AZMA 3MVDB 1F66B 3AZEA 1P34A 1KX3D 3AZHC 1P3FD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AV6 A;  4J8W D;  4JJN C;  3AZF B;  3NQU B;  1P3I A;  1M18 D;  4R8P D;  5AY8 C;  5CPJ C;  4YM6 C;  3WTP D;  5B32 B;  5JRG C;  4EO5 C;  5F99 B;  3AZL D;  3B6G D;  1KX4 C;  1BH8 B;  5DNM A;  3C1C D;  5C3I C;  4Z2M H;  3REJ B;  3MGR C;  4J8V B;  3WAA C;  2ARO A;  5B2I B;  5AVC C;  4KUD C;  4E44 A;  5E5A B;  3X1U C;  3W98 A;  1KX3 B;  1BH9 B;  1TZY A;  5CPK B;  1P3P C;  3AV2 C;  5B1L C;  3REK B;  3REL D;  1M1A B;  1M19 B;  4R8P B;  5DNN D;  3WKJ C;  4XZQ C;  4QLC B;  4X23 A;  3MGS D;  4ZUX C;  3B6G B;  3MGQ C;  1F1E A;  3O62 A;  5AV9 D;  3LZ1 C;  3MGP A;  4YS3 A;  2NQB A;  3KXB A;  4H9R A;  1U35 D;  5AV5 A;  4CSR B;  1P3A D;  3REI A;  3VH6 A;  4G91 C;  3W96 A;  4H9S A;  4H9Q B;  3AZJ C;  1S32 A;  5BNX A;  5GT3 D;  2FJ7 C;  5BNV B;  3X1V C;  3UTB A;  3X1S C;  3MNN D;  4J8X C;  3B6F A;  2F8N B;  5B1M A;  3MGS B;  3LZ0 C;  2F8N G;  4KGC C;  3A6N D;  5B0Z D;  3VH5 T;  3UT9 C;  3AZK A;  1R4V A;  1P3O D;  1ID3 D;  5GT0 D;  5CHL B;  5B0Y A;  3AZM C;  5B31 A;  3AZE C;  5JA4 B;  3AYW D;  4H9N A;  1P34 C;  5G49 B;  2HIO D;  1ZLA D;  5B40 D;  1P3M C;  4KHA A;  3KSY A;  5CPI D;  5AV6 C;  1P3B B;  4WU9 A;  1P3I C;  2PYO A;  3MNN B;  1Q9C A;  4H9O B;  5GXQ B;  1P3L B;  3MVD A;  1F66 A;  1WWS A;  1HQ3 B;  3A6N B;  3X1T B;  5DNM C;  1P3K D;  2NZD D;  3B0C W;  3AZF A;  3AZI B;  3NQU A;  2ARO C;  4LD9 D;  1KX5 D;  3AYW B;  5AVB B;  3W98 C;  2HIO B;  5B32 A;  5B40 B;  1ZLA B;  3UTA C;  3AV1 D;  1TZY C;  3AZN B;  5F99 A;  5CPI B;  5B2J D;  1BH8 A;  3REJ A;  5B24 B;  4J8V A;  5CP6 D;  3LJA C;  2CV5 D;  5GSU D;  4X23 C;  5E5A A;  2HUE C;  5KDM B;  5B1M B;  1KX3 A;  1BH9 A;  1AOI B;  3AZG D;  3O62 C;  4HGA C;  3WA9 C;  5CPK A;  4YS3 C;  3MGP C;  2NZD B;  2NQB C;  3KXB C;  3REK A;  5AV5 C;  1M1A A;  3REI C;  1M19 A;  4R8P A;  3AZH D;  1P3G C;  1KX5 B;  3W97 D;  4LD9 B;  3W96 C;  3KUY B;  2LY8 A;  5B31 B;  4H9S C;  4NE3 A;  5B31 G;  3B6G A;  1EQZ B;  5CPJ D;  3C1C A;  4XUJ B;  1S32 C;  5CP6 B;  3C1B D;  3UTB C;  4CSR A;  3B6F C;  3MGR D;  5AV8 D;  4H9Q A;  3AZK C;  2BYM B;  4Z5T B;  3X1U D;  5B0Y C;  5BNV A;  3W97 B;  5B1L D;  2F8N A;  3MGS A;  4DRA A;  4M6B A;  3AN2 D;  3V9R B;  5B32 G;  4WU9 C;  3TU4 B;  3C1B B;  2PYO C;  4WV4 B;  3MVD C;  1F66 C;  5JA4 A;  1KU5 A;  5G49 A;  5AV8 B;  3LEL D;  1P3B A;  3AZF C;  1P3F B;  4J8W B;  3MNN A;  4H9O A;  5GXQ A;  4J8U D;  1M18 B;  1P3L A;  5B32 C;  4NE6 A;  2FJ7 D;  3WTP B;  1HQ3 A;  5F99 C;  3X1V D;  3A6N A;  3X1T A;  3AN2 B;  4J8X D;  5BT1 C;  3REJ C;  3AZL B;  3C1C B;  3KWQ D;  4J8V C;  4KGC D;  3AZI A;  5B2I C;  3VH5 A;  5E5A C;  3AYW A;  5AVB A;  2HIO A;  3LEL B;  1ZLA A;  5B40 A;  3AFA D;  1KX3 C;  2IO5 B;  3AZM D;  3AZN A;  3AZE D;  5CPI A;  5CPK C;  3B0C T;  3REK C;  5B24 A;  1M1A C;  3REH D;  1M19 C;  4R8P C;  1P3M D;  4J8U B;  3REL B;  4QLC C;  5AV6 D;  5DNN B;  4Z66 D;  1B67 A;  4ZBJ B;  5KDM A;  3B6G C;  1AOI A;  2JSS A;  2NZD A;  3KWQ B;  5AV9 B;  4Z2M G;  2L5A A;  4G92 B;  1KX5 A;  2RVQ D;  4LD9 A;  1U35 B;  1P3A B;  3KUY A;  3AFA B;  4H9P B;  5B33 D;  1EQZ A;  4XUJ A;  3W98 D;  3REH B;  3UTA D;  5CP6 A;  5GT3 B;  4Z66 B;  3MGS C;  3LJA D;  3W99 D;  4X23 D;  2BYM A;  5B0Z B;  4Z5T A;  4WU8 D;  1P3O B;  3O62 D;  3W97 A;  3B0D B;  5GT0 B;  1ID3 B;  3WA9 D;  3KXB D;  5B33 B;  1P3G D;  1P3B C;  3V9R A;  3TU4 A;  3C1B A;  3MNN C;  4E45 A;  5GXQ C;  1P3L C;  1HQ3 C;  1H3O B;  3A6N C;  3X1T C;  5AV8 A;  3W99 B;  3B6F D;  3AZI C;  1P3F A;  4DRB A;  1P3K B;  4WU8 B;  4J8W A;  3B0B A;  3AYW C;  5AVB C;  1M18 A;  2HIO C;  1ZLA C;  5B40 C;  1WWI A;  3WTP A;  3AZN C;  5CPI C;  4JJN D;  3AN2 A;  3AV1 B;  5B24 C;  3AZL A;  5B2J B;  4AWL B;  5AY8 D;  4YM6 D;  5JRG D;  2CV5 B;  2YFW B;  5GSU B;  1KX4 D;  5B1M C;  3LEL A;  3VH6 W;  1AOI C;  1F66 D;  1N1J B;  2NZD C;  3WAA D;  3AZG B;  5AVC D;  4KUD D;  4LD9 C;  1KX5 C;  4J8U A;  3REL A;  3KUY C;  5B31 C;  3AZH B;  5DNN A;  3AZF D;  1P3P D;  3AV2 D;  4JJN B;  1EQZ C;  4XUJ C;  5AY8 B;  5CPJ B;  4YM6 B;  1TAF B;  5CP6 C;  4XZQ D;  3KWQ A;  5AV9 A;  5F99 D;  3WKJ D;  5JRG B;  4EO5 B;  1BFM A;  4ZUX D;  1U35 A;  1P3A A;  1KX4 B;  3MGQ D;  5C3I B;  3AFA A;  3LZ1 D;  3MGR B;  5B2I D;  4H9P A;  5BS7 A;  3WAA B;  4Z5T C;  5E5A D;  5AVC B;  4KUD B;  3REH A;  3W97 C;  3X1U B;  5CPK D;  4NE5 A;  5GT3 A;  4Z66 A;  3REK D;  2CWE A;  1ULY A;  1P3P B;  3AV2 B;  5B1L B;  1M1A D;  1M19 D;  3AZJ D;  4QLC D;  3TU4 C;  2F8N H;  3WKJ B;  3X1S D;  5B0Z A;  4XZQ B;  2YFV B;  3C1B C;  3NQJ B;  4ZUX B;  3LZ0 D;  1P3O A;  1ID3 A;  5GT0 A;  1JFI B;  3MGQ B;  3UT9 D;  3LZ1 B;  5AV8 C;  3R45 B;  2BYK B;  5B33 A;  5FUG B;  1P3F C;  4WNN B;  3UTA A;  4J8W C;  4G91 B;  1P34 D;  1M18 C;  3WTP C;  3AZJ B;  1H3O A;  3LJA A;  3AN2 C;  1P3I D;  4CAY B;  2FJ7 B;  3W99 A;  2F8N D;  3X1V B;  3AZL C;  3X1S B;  4J8X B;  3C1C C;  1P3K A;  4WU8 A;  3LZ0 B;  4WZS B;  3WA9 A;  4KGC B;  4UUZ B;  5BO0 B;  1HTA A;  3UT9 B;  5DNM D;  3LEL C;  1B6W A;  2IO5 C;  1P3G A;  2ARO D;  3AV1 A;  3AZM B;  3AZE B;  5B2J A;  1P34 B;  4J8U C;  3REL C;  1P3B D;  1P3M B;  5DNN C;  1TZY D;  4ZBJ C;  2CV5 A;  2YFW A;  5GSU A;  5AV6 B;  1P3I B;  5GXQ D;  1P3L D;  1N1J A;  3KWQ C;  3AZG A;  1HQ3 D;  5AV9 C;  3X1T D;  4G92 C;  1U35 C;  1P3A C;  3VH6 T;  5DNM B;  3AFA C;  3AZH A;  3AZI D;  4YS3 D;  4NFT A;  3MGP D;  5BS7 C;  4JJN A;  2NQB D;  2ARO B;  5AV5 D;  5AVB D;  3REI D;  5AY8 A;  3REH C;  5CPJ A;  4YM6 A;  1TAF A;  3W98 B;  3AZN D;  3W96 D;  5JRG A;  5GT3 C;  3UTA B;  4Z66 C;  1TZY B;  5B24 D;  1KX4 A;  1S32 D;  3MGR A;  3LJA B;  3UTB D;  3WAA A;  5B0Z C;  5B1M D;  5AVC A;  4X23 B;  4KUD A;  1AOI D;  1P3O C;  2RVQ C;  1ID3 C;  2HUE B;  3B0D C;  5GT0 C;  3X1U A;  2F8N K;  3WA9 B;  3O62 B;  4HGA B;  3AZK D;  3MGP B;  4YS3 B;  1P3P A;  5B33 C;  5B1L A;  3AV2 A;  2NQB B;  3KXB B;  4H9R B;  1A7W A;  5AV5 B;  5B0Y D;  3KUY D;  3REI B;  5B31 D;  1P3G B;  3WKJ A;  4XZQ A;  2YFV A;  3W96 B;  1EQZ D;  3NQJ A;  4ZUX A;  4XUJ D;  1JFI A;  3MGQ A;  3LZ1 A;  1S32 B;  4WU9 D;  3VH5 W;  5B2I A;  3R45 A;  5BNX B;  3W99 C;  3WTP E;  2BYK A;  1P3M A;  3UTB B;  2PYO D;  3B6F B;  5FUG A;  3MVD D;  1P3K C;  4WNN A;  4WU8 C;  4Z5T D;  3AZK B;  3AZJ A;  5B0Y B;  4QLC A;  3AV1 C;  4CAY A;  2FJ7 A;  3X1V A;  3X1S A;  5B2J C;  4J8X A;  4AWL C;  4H9N B;  5B32 D;  3LZ0 A;  4KGC A;  4KHA B;  4UUZ A;  3TU4 D;  2CV5 C;  5BO0 A;  5GSU C;  3UT9 A;  5BT1 D;  4WU9 B;  3REJ D;  2PYO B;  4J8V D;  3AZG C;  3AZM A;  3MVD B;  1F66 B;  3AZE A;  1P34 A;  1KX3 D;  3AZH C;  1P3F D; 
#chains in the Genus database with same CATH topology
 5AV6 A;  4J8W D;  4JJN C;  3AZF B;  3NQU B;  1P3I A;  1M18 D;  4R8P D;  5AY8 C;  5CPJ C;  4YM6 C;  3WTP D;  5B32 B;  5JRG C;  4EO5 C;  5F99 B;  3AZL D;  3B6G D;  1KX4 C;  1BH8 B;  5DNM A;  3C1C D;  5C3I C;  4Z2M H;  3REJ B;  3MGR C;  4J8V B;  3WAA C;  2ARO A;  5B2I B;  5AVC C;  4KUD C;  4E44 A;  5E5A B;  3X1U C;  3W98 A;  2Y2G A;  1KX3 B;  1BH9 B;  1TZY A;  5CPK B;  1P3P C;  3AV2 C;  5B1L C;  3REK B;  3REL D;  1M1A B;  1M19 B;  4R8P B;  5DNN D;  3WKJ C;  4XZQ C;  4QLC B;  4X23 A;  3MGS D;  4ZUX C;  3B6G B;  3MGQ C;  1F1E A;  3O62 A;  5AV9 D;  3LZ1 C;  3MGP A;  4YS3 A;  2NQB A;  3KXB A;  4H9R A;  1U35 D;  5AV5 A;  4CSR B;  1P3A D;  3REI A;  3VH6 A;  2ZM5 A;  4G91 C;  3W96 A;  4H9S A;  4H9Q B;  3AZJ C;  1S32 A;  5BNX A;  5GT3 D;  2FJ7 C;  5BNV B;  3X1V C;  3UTB A;  3X1S C;  3MNN D;  4J8X C;  3B6F A;  2F8N B;  5B1M A;  3MGS B;  3LZ0 C;  2F8N G;  4KGC C;  3A6N D;  5B0Z D;  3VH5 T;  3UT9 C;  3AZK A;  1R4V A;  1P3O D;  1ID3 D;  5GT0 D;  5CHL B;  5B0Y A;  3AZM C;  5B31 A;  4WJ3 C;  3AZE C;  2Y2Q A;  5JA4 B;  3AYW D;  4H9N A;  1P34 C;  5G49 B;  2HIO D;  1ZLA D;  5B40 D;  1P3M C;  4KHA A;  3KSY A;  5CPI D;  5AV6 C;  1P3B B;  3H0M C;  4WU9 A;  1P3I C;  3EG5 B;  2PYO A;  3MNN B;  1Q9C A;  2Y2I A;  4H9O B;  5GXQ B;  1P3L B;  3MVD A;  1F66 A;  1WWS A;  1HQ3 B;  3A6N B;  3X1T B;  5DNM C;  2JCH A;  1P3K D;  3IP4 C;  2NZD D;  3B0C W;  3AZF A;  3AZI B;  3NQU A;  2ARO C;  4LD9 D;  1KX5 D;  3AYW B;  5AVB B;  3W98 C;  2HIO B;  5B32 A;  5B40 B;  1ZLA B;  2Y2K A;  3UTA C;  3AV1 D;  1TZY C;  3AZN B;  5F99 A;  5CPI B;  5B2J D;  1BH8 A;  3REJ A;  5B24 B;  2G5I C;  4J8V A;  5CP6 D;  3LJA C;  2CV5 D;  5GSU D;  4X23 C;  2BG1 A;  5E5A A;  2HUE C;  5KDM B;  5B1M B;  2XD5 A;  1KX3 A;  1BH9 A;  1AOI B;  3AZG D;  3O62 C;  4HGA C;  3WA9 C;  5CPK A;  4YS3 C;  3MGP C;  2NZD B;  2NQB C;  3KXB C;  3REK A;  5AV5 C;  1M1A A;  3REI C;  1M19 A;  4R8P A;  3AZH D;  1P3G C;  1KX5 B;  3W97 D;  4LD9 B;  3W96 C;  3KUY B;  1Z2C B;  2LY8 A;  5B31 B;  4H9S C;  4NE3 A;  2Y2H A;  5B31 G;  3B6G A;  1EQZ B;  5CPJ D;  3C1C A;  4XUJ B;  1S32 C;  5CP6 B;  3C1B D;  3UTB C;  4CSR A;  3B6F C;  3MGR D;  3KFU G;  2J8P A;  5AV8 D;  4H9Q A;  3AZK C;  2BYM B;  4Z5T B;  3X1U D;  5B0Y C;  5BNV A;  3W97 B;  5B1L D;  2F8N A;  3MGS A;  4DRA A;  4M6B A;  3AN2 D;  3V9R B;  5B32 G;  4WU9 C;  3TU4 B;  3C1B B;  2PYO C;  4WV4 B;  3MVD C;  1F66 C;  5JA4 A;  1KU5 A;  5G49 A;  5AV8 B;  3LEL D;  3EPK A;  1P3B A;  3AZF C;  1P3F B;  4J8W B;  3MNN A;  4H9O A;  5GXQ A;  4J8U D;  1M18 B;  1P3L A;  5B32 C;  4NE6 A;  2FJ7 D;  3WTP B;  1HQ3 A;  5F99 C;  3X1V D;  3A6N A;  3X1T A;  3AN2 B;  4J8X D;  5BT1 C;  2VQR A;  3REJ C;  3AZL B;  3C1C B;  3KWQ D;  4J8V C;  4KGC D;  3AZI A;  2Y2N A;  5B2I C;  3VH5 A;  3P5J B;  5E5A C;  3AYW A;  5AVB A;  2HIO A;  3LEL B;  2Y2P A;  5B40 A;  3AFA D;  1KX3 C;  1ZLA A;  2IO5 B;  3AZM D;  3AZN A;  3AZE D;  5CPI A;  5CPK C;  3B0C T;  3REK C;  5B24 A;  1M1A C;  3REH D;  1M19 C;  4R8P C;  4UPK A;  1P3M D;  4J8U B;  3REL B;  4QLC C;  5AV6 D;  2Y2O A;  5DNN B;  4Z66 D;  1B67 A;  4ZBJ B;  5KDM A;  3B6G C;  1AOI A;  2G5H C;  2JSS A;  3EPH A;  3KWQ B;  2NZD A;  5AV9 B;  4Z2M G;  3H0R C;  2L5A A;  4G92 B;  1KX5 A;  2RVQ D;  4LD9 A;  1U35 B;  1P3A B;  3KUY A;  3AFA B;  4H9P B;  5B33 D;  1EQZ A;  4XUJ A;  2ZY4 A;  3W98 D;  1PZR A;  3REH B;  3UTA D;  2Y2M A;  5CP6 A;  2DF4 C;  5GT3 B;  4Z66 B;  3MGS C;  3LJA D;  3W99 D;  4X23 D;  2BYM A;  3A1K A;  5B0Z B;  4Z5T A;  4WU8 D;  1P3O B;  3O62 D;  3W97 A;  3B0D B;  5GT0 B;  1ID3 B;  3WA9 D;  1W2E A;  3KXB D;  3EPJ A;  5B33 B;  1P3G D;  1P3B C;  3V9R A;  3TU4 A;  3C1B A;  3MNN C;  4E45 A;  5GXQ C;  1P3L C;  1HQ3 C;  1H3O B;  3A6N C;  3X1T C;  5AV8 A;  3W99 B;  3B6F D;  3AZI C;  1P3F A;  4DRB A;  1P3K B;  4WU8 B;  4J8W A;  3B0B A;  3AYW C;  5AVB C;  1M18 A;  1T3U A;  2HIO C;  1ZLA C;  5B40 C;  1WWI A;  2UWX A;  3WTP A;  3AZN C;  5CPI C;  4JJN D;  3AN2 A;  3AV1 B;  5B24 C;  3AZL A;  5B2J B;  4AWL B;  5AY8 D;  4YM6 D;  5JRG D;  2CV5 B;  2YFW B;  5GSU B;  1KX4 D;  5B1M C;  3LEL A;  3VH6 W;  1AOI C;  1F66 D;  1N1J B;  2NZD C;  3WAA D;  3AZG B;  5AVC D;  4KUD D;  4LD9 C;  1KX5 C;  4J8U A;  3REL A;  3KUY C;  5B31 C;  3AZH B;  5DNN A;  3AZF D;  3EPL A;  1P3P D;  3AV2 D;  4JJN B;  1EQZ C;  4XUJ C;  2ZY3 A;  5AY8 B;  5CPJ B;  4YM6 B;  1TAF B;  5CP6 C;  4XZQ D;  3KWQ A;  5AV9 A;  5F99 D;  3WKJ D;  5JRG B;  4EO5 B;  1BFM A;  4ZUX D;  1U35 A;  1P3A A;  1KX4 B;  3MGQ D;  5C3I B;  3AFA A;  3LZ1 D;  3MGR B;  5B2I D;  4H9P A;  3A1I A;  5BS7 A;  3WAA B;  4Z5T C;  5E5A D;  3F6T A;  5AVC B;  4KUD B;  3REH A;  3W97 C;  3X1U B;  5CPK D;  4NE5 A;  5GT3 A;  4Z66 A;  3REK D;  2CWE A;  1ULY A;  1P3P B;  3AV2 B;  5B1L B;  1M1A D;  1M19 D;  3AZJ D;  4QLC D;  3TU4 C;  2F8N H;  3WKJ B;  3X1S D;  5B0Z A;  4XZQ B;  2YFV B;  3C1B C;  3NQJ B;  4ZUX B;  3LZ0 D;  1P3O A;  1ID3 A;  2FFF B;  5GT0 A;  1JFI B;  3MGQ B;  2JE5 A;  3LZ1 B;  3UT9 D;  5AV8 C;  3R45 B;  2BYK B;  5B33 A;  5FUG B;  2W8S A;  1P3F C;  4WNN B;  3UTA A;  2XD1 A;  4J8W C;  4G91 B;  1P34 D;  1M18 C;  3WTP C;  3AZJ B;  1H3O A;  3LJA A;  3AN2 C;  1P3I D;  4CAY B;  2FJ7 B;  3W99 A;  2F8N D;  3X1V B;  2RIQ A;  3AZL C;  3X1S B;  4J8X B;  3C1C C;  1P3K A;  4WU8 A;  3LZ0 B;  4WZS B;  3WA9 A;  4KGC B;  4UUZ B;  5BO0 B;  1HTA A;  3UT9 B;  5DNM D;  3LEL C;  1B6W A;  2IO5 C;  1P3G A;  2ARO D;  3AV1 A;  3AZM B;  3AZE B;  5B2J A;  1P34 B;  4J8U C;  3REL C;  1P3B D;  1P3M B;  5DNN C;  1TZY D;  4ZBJ C;  2CV5 A;  2YFW A;  5GSU A;  5AV6 B;  1P3I B;  5GXQ D;  1P3L D;  1N1J A;  3KWQ C;  3AZG A;  1HQ3 D;  5AV9 C;  3X1T D;  4G92 C;  1U35 C;  1P3A C;  3VH6 T;  5DNM B;  3AFA C;  3AZH A;  3AZI D;  4YS3 D;  4NFT A;  3MGP D;  5BS7 C;  4JJN A;  2NQB D;  2ARO B;  5AV5 D;  5AVB D;  3REI D;  5AY8 A;  3REH C;  5CPJ A;  4YM6 A;  1TAF A;  3W98 B;  3AZN D;  3W96 D;  5JRG A;  5GT3 C;  3UTA B;  4Z66 C;  4DQY B;  1TZY B;  2DQN C;  5B24 D;  1KX4 A;  1S32 D;  3MGR A;  3LJA B;  3UTB D;  3WAA A;  5B0Z C;  5B1M D;  5AVC A;  4X23 B;  4KUD A;  1AOI D;  1P3O C;  2RVQ C;  1ID3 C;  2HUE B;  3B0D C;  5GT0 C;  3X1U A;  2F8N K;  3H0L C;  3WA9 B;  3O62 B;  4HGA B;  2Y2J A;  3AZK D;  2ZY2 A;  3MGP B;  4YS3 B;  5B33 C;  5B1L A;  3AV2 A;  1P3P A;  3KXB B;  4H9R B;  2NQB B;  1A7W A;  5AV5 B;  5B0Y D;  3KUY D;  3REI B;  5B31 D;  1P3G B;  3WKJ A;  4XZQ A;  2YFV A;  3W96 B;  1EQZ D;  3NQJ A;  4ZUX A;  4XUJ D;  1JFI A;  3MGQ A;  3LZ1 A;  1S32 B;  4WU9 D;  3VH5 W;  2Y2L A;  5B2I A;  3R45 A;  5BNX B;  3W99 C;  3WTP E;  2BYK A;  1P3M A;  3UTB B;  2PYO D;  3B6F B;  5FUG A;  3MVD D;  3AL0 C;  1P3K C;  4WNN A;  4WU8 C;  2F2A C;  3FDD A;  4Z5T D;  3AZK B;  3AZJ A;  5B0Y B;  4QLC A;  3AV1 C;  4CAY A;  2FJ7 A;  3X1V A;  3X1S A;  5B2J C;  4J8X A;  4AWL C;  4H9N B;  5B32 D;  3LZ0 A;  4KGC A;  4KHA B;  4UUZ A;  3TU4 D;  2CV5 C;  5BO0 A;  5GSU C;  3UT9 A;  5BT1 D;  4WU9 B;  3REJ D;  2ZY5 A;  2PYO B;  4J8V D;  3AZG C;  3AZM A;  3MVD B;  1F66 B;  3AZE A;  1P34 A;  1KX3 D;  3AZH C;  1P3F D; 
#chains in the Genus database with same CATH homology
 5AV6 A;  4J8W D;  4JJN C;  3AZF B;  3NQU B;  1P3I A;  1M18 D;  4R8P D;  5AY8 C;  5CPJ C;  4YM6 C;  3WTP D;  5B32 B;  5JRG C;  4EO5 C;  5F99 B;  3AZL D;  3B6G D;  1KX4 C;  1BH8 B;  5DNM A;  3C1C D;  5C3I C;  4Z2M H;  3REJ B;  3MGR C;  4J8V B;  3WAA C;  2ARO A;  5B2I B;  5AVC C;  4KUD C;  4E44 A;  5E5A B;  3X1U C;  3W98 A;  2Y2G A;  1KX3 B;  1BH9 B;  1TZY A;  5CPK B;  1P3P C;  3AV2 C;  5B1L C;  3REK B;  3REL D;  1M1A B;  1M19 B;  4R8P B;  5DNN D;  3WKJ C;  4XZQ C;  4QLC B;  4X23 A;  3MGS D;  4ZUX C;  3B6G B;  3MGQ C;  1F1E A;  3O62 A;  5AV9 D;  3LZ1 C;  3MGP A;  4YS3 A;  2NQB A;  3KXB A;  4H9R A;  1U35 D;  5AV5 A;  4CSR B;  1P3A D;  3REI A;  3VH6 A;  2ZM5 A;  4G91 C;  3W96 A;  4H9S A;  4H9Q B;  3AZJ C;  1S32 A;  5BNX A;  5GT3 D;  2FJ7 C;  5BNV B;  3X1V C;  3UTB A;  3X1S C;  3MNN D;  4J8X C;  3B6F A;  2F8N B;  5B1M A;  3MGS B;  3LZ0 C;  2F8N G;  4KGC C;  3A6N D;  5B0Z D;  3VH5 T;  3UT9 C;  3AZK A;  1R4V A;  1P3O D;  1ID3 D;  5GT0 D;  5CHL B;  5B0Y A;  3AZM C;  5B31 A;  4WJ3 C;  3AZE C;  2Y2Q A;  5JA4 B;  3AYW D;  4H9N A;  1P34 C;  5G49 B;  2HIO D;  1ZLA D;  5B40 D;  1P3M C;  4KHA A;  3KSY A;  5CPI D;  5AV6 C;  1P3B B;  3H0M C;  4WU9 A;  1P3I C;  3EG5 B;  2PYO A;  3MNN B;  1Q9C A;  2Y2I A;  4H9O B;  5GXQ B;  1P3L B;  3MVD A;  1F66 A;  1WWS A;  1HQ3 B;  3A6N B;  3X1T B;  5DNM C;  2JCH A;  1P3K D;  3IP4 C;  2NZD D;  3B0C W;  3AZF A;  3AZI B;  3NQU A;  2ARO C;  4LD9 D;  1KX5 D;  3AYW B;  5AVB B;  3W98 C;  2HIO B;  5B32 A;  5B40 B;  1ZLA B;  2Y2K A;  3UTA C;  3AV1 D;  1TZY C;  3AZN B;  5F99 A;  5CPI B;  5B2J D;  1BH8 A;  3REJ A;  5B24 B;  2G5I C;  4J8V A;  5CP6 D;  3LJA C;  2CV5 D;  5GSU D;  4X23 C;  2BG1 A;  5E5A A;  2HUE C;  5KDM B;  5B1M B;  2XD5 A;  1KX3 A;  1BH9 A;  1AOI B;  3AZG D;  3O62 C;  4HGA C;  3WA9 C;  5CPK A;  4YS3 C;  3MGP C;  2NZD B;  2NQB C;  3KXB C;  3REK A;  5AV5 C;  1M1A A;  3REI C;  1M19 A;  4R8P A;  3AZH D;  1P3G C;  1KX5 B;  3W97 D;  4LD9 B;  3W96 C;  3KUY B;  1Z2C B;  2LY8 A;  5B31 B;  4H9S C;  4NE3 A;  2Y2H A;  5B31 G;  3B6G A;  1EQZ B;  5CPJ D;  3C1C A;  4XUJ B;  1S32 C;  5CP6 B;  3C1B D;  3UTB C;  4CSR A;  3B6F C;  3MGR D;  3KFU G;  2J8P A;  5AV8 D;  4H9Q A;  3AZK C;  2BYM B;  4Z5T B;  3X1U D;  5B0Y C;  5BNV A;  3W97 B;  5B1L D;  2F8N A;  3MGS A;  4DRA A;  4M6B A;  3AN2 D;  3V9R B;  5B32 G;  4WU9 C;  3TU4 B;  3C1B B;  2PYO C;  4WV4 B;  3MVD C;  1F66 C;  5JA4 A;  1KU5 A;  5G49 A;  5AV8 B;  3LEL D;  3EPK A;  1P3B A;  3AZF C;  1P3F B;  4J8W B;  3MNN A;  4H9O A;  5GXQ A;  4J8U D;  1M18 B;  1P3L A;  5B32 C;  4NE6 A;  2FJ7 D;  3WTP B;  1HQ3 A;  5F99 C;  3X1V D;  3A6N A;  3X1T A;  3AN2 B;  4J8X D;  5BT1 C;  2VQR A;  3REJ C;  3AZL B;  3C1C B;  3KWQ D;  4J8V C;  4KGC D;  3AZI A;  2Y2N A;  5B2I C;  3VH5 A;  3P5J B;  5E5A C;  3AYW A;  5AVB A;  2HIO A;  3LEL B;  2Y2P A;  5B40 A;  3AFA D;  1KX3 C;  1ZLA A;  2IO5 B;  3AZM D;  3AZN A;  3AZE D;  5CPI A;  5CPK C;  3B0C T;  3REK C;  5B24 A;  1M1A C;  3REH D;  1M19 C;  4R8P C;  4UPK A;  1P3M D;  4J8U B;  3REL B;  4QLC C;  5AV6 D;  2Y2O A;  5DNN B;  4Z66 D;  1B67 A;  4ZBJ B;  5KDM A;  3B6G C;  1AOI A;  2G5H C;  2JSS A;  3EPH A;  3KWQ B;  2NZD A;  5AV9 B;  4Z2M G;  3H0R C;  2L5A A;  4G92 B;  1KX5 A;  2RVQ D;  4LD9 A;  1U35 B;  1P3A B;  3KUY A;  3AFA B;  4H9P B;  5B33 D;  1EQZ A;  4XUJ A;  2ZY4 A;  3W98 D;  1PZR A;  3REH B;  3UTA D;  2Y2M A;  5CP6 A;  2DF4 C;  5GT3 B;  4Z66 B;  3MGS C;  3LJA D;  3W99 D;  4X23 D;  2BYM A;  3A1K A;  5B0Z B;  4Z5T A;  4WU8 D;  1P3O B;  3O62 D;  3W97 A;  3B0D B;  5GT0 B;  1ID3 B;  3WA9 D;  1W2E A;  3KXB D;  3EPJ A;  5B33 B;  1P3G D;  1P3B C;  3V9R A;  3TU4 A;  3C1B A;  3MNN C;  4E45 A;  5GXQ C;  1P3L C;  1HQ3 C;  1H3O B;  3A6N C;  3X1T C;  5AV8 A;  3W99 B;  3B6F D;  3AZI C;  1P3F A;  4DRB A;  1P3K B;  4WU8 B;  4J8W A;  3B0B A;  3AYW C;  5AVB C;  1M18 A;  1T3U A;  2HIO C;  1ZLA C;  5B40 C;  1WWI A;  2UWX A;  3WTP A;  3AZN C;  5CPI C;  4JJN D;  3AN2 A;  3AV1 B;  5B24 C;  3AZL A;  5B2J B;  4AWL B;  5AY8 D;  4YM6 D;  5JRG D;  2CV5 B;  2YFW B;  5GSU B;  1KX4 D;  5B1M C;  3LEL A;  3VH6 W;  1AOI C;  1F66 D;  1N1J B;  2NZD C;  3WAA D;  3AZG B;  5AVC D;  4KUD D;  4LD9 C;  1KX5 C;  4J8U A;  3REL A;  3KUY C;  5B31 C;  3AZH B;  5DNN A;  3AZF D;  3EPL A;  1P3P D;  3AV2 D;  4JJN B;  1EQZ C;  4XUJ C;  2ZY3 A;  5AY8 B;  5CPJ B;  4YM6 B;  1TAF B;  5CP6 C;  4XZQ D;  3KWQ A;  5AV9 A;  5F99 D;  3WKJ D;  5JRG B;  4EO5 B;  1BFM A;  4ZUX D;  1U35 A;  1P3A A;  1KX4 B;  3MGQ D;  5C3I B;  3AFA A;  3LZ1 D;  3MGR B;  5B2I D;  4H9P A;  3A1I A;  5BS7 A;  3WAA B;  4Z5T C;  5E5A D;  3F6T A;  5AVC B;  4KUD B;  3REH A;  3W97 C;  3X1U B;  5CPK D;  4NE5 A;  5GT3 A;  4Z66 A;  3REK D;  2CWE A;  1ULY A;  1P3P B;  3AV2 B;  5B1L B;  1M1A D;  1M19 D;  3AZJ D;  4QLC D;  3TU4 C;  2F8N H;  3WKJ B;  3X1S D;  5B0Z A;  4XZQ B;  2YFV B;  3C1B C;  3NQJ B;  4ZUX B;  3LZ0 D;  1P3O A;  1ID3 A;  2FFF B;  5GT0 A;  1JFI B;  3MGQ B;  2JE5 A;  3LZ1 B;  3UT9 D;  5AV8 C;  3R45 B;  2BYK B;  5B33 A;  5FUG B;  2W8S A;  1P3F C;  4WNN B;  3UTA A;  2XD1 A;  4J8W C;  4G91 B;  1P34 D;  1M18 C;  3WTP C;  3AZJ B;  1H3O A;  3LJA A;  3AN2 C;  1P3I D;  4CAY B;  2FJ7 B;  3W99 A;  2F8N D;  3X1V B;  2RIQ A;  3AZL C;  3X1S B;  4J8X B;  3C1C C;  1P3K A;  4WU8 A;  3LZ0 B;  4WZS B;  3WA9 A;  4KGC B;  4UUZ B;  5BO0 B;  1HTA A;  3UT9 B;  5DNM D;  3LEL C;  1B6W A;  2IO5 C;  1P3G A;  2ARO D;  3AV1 A;  3AZM B;  3AZE B;  5B2J A;  1P34 B;  4J8U C;  3REL C;  1P3B D;  1P3M B;  5DNN C;  1TZY D;  4ZBJ C;  2CV5 A;  2YFW A;  5GSU A;  5AV6 B;  1P3I B;  5GXQ D;  1P3L D;  1N1J A;  3KWQ C;  3AZG A;  1HQ3 D;  5AV9 C;  3X1T D;  4G92 C;  1U35 C;  1P3A C;  3VH6 T;  5DNM B;  3AFA C;  3AZH A;  3AZI D;  4YS3 D;  4NFT A;  3MGP D;  5BS7 C;  4JJN A;  2NQB D;  2ARO B;  5AV5 D;  5AVB D;  3REI D;  5AY8 A;  3REH C;  5CPJ A;  4YM6 A;  1TAF A;  3W98 B;  3AZN D;  3W96 D;  5JRG A;  5GT3 C;  3UTA B;  4Z66 C;  4DQY B;  1TZY B;  2DQN C;  5B24 D;  1KX4 A;  1S32 D;  3MGR A;  3LJA B;  3UTB D;  3WAA A;  5B0Z C;  5B1M D;  5AVC A;  4X23 B;  4KUD A;  1AOI D;  1P3O C;  2RVQ C;  1ID3 C;  2HUE B;  3B0D C;  5GT0 C;  3X1U A;  2F8N K;  3H0L C;  3WA9 B;  3O62 B;  4HGA B;  2Y2J A;  3AZK D;  2ZY2 A;  3MGP B;  4YS3 B;  5B33 C;  5B1L A;  3AV2 A;  1P3P A;  3KXB B;  4H9R B;  2NQB B;  1A7W A;  5AV5 B;  5B0Y D;  3KUY D;  3REI B;  5B31 D;  1P3G B;  3WKJ A;  4XZQ A;  2YFV A;  3W96 B;  1EQZ D;  3NQJ A;  4ZUX A;  4XUJ D;  1JFI A;  3MGQ A;  3LZ1 A;  1S32 B;  4WU9 D;  3VH5 W;  2Y2L A;  5B2I A;  3R45 A;  5BNX B;  3W99 C;  3WTP E;  2BYK A;  1P3M A;  3UTB B;  2PYO D;  3B6F B;  5FUG A;  3MVD D;  3AL0 C;  1P3K C;  4WNN A;  4WU8 C;  2F2A C;  3FDD A;  4Z5T D;  3AZK B;  3AZJ A;  5B0Y B;  4QLC A;  3AV1 C;  4CAY A;  2FJ7 A;  3X1V A;  3X1S A;  5B2J C;  4J8X A;  4AWL C;  4H9N B;  5B32 D;  3LZ0 A;  4KGC A;  4KHA B;  4UUZ A;  3TU4 D;  2CV5 C;  5BO0 A;  5GSU C;  3UT9 A;  5BT1 D;  4WU9 B;  3REJ D;  2ZY5 A;  2PYO B;  4J8V D;  3AZG C;  3AZM A;  3MVD B;  1F66 B;  3AZE A;  1P34 A;  1KX3 D;  3AZH C;  1P3F D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...