1P3FD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
91
structure length
91
Chain Sequence
b'ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 37
structure length 91
sequence length 91
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3fD00
1TZYA 3KUYA 5F99D 3WTPC 4XZQD 3REIB 4LD9A 5GT0A 3MVDC 3KWQC 1P3PA 3REJC 4KHAA 1M1AB 4H9PA 5E5AA 3AZMA 4J8VB 3AN2B 1KX5D 2YFVA 4R8PD 4Z2MH 3AZHD 4KGCC 4H9SC 1P3IA 3AZEC 3W96D 2HIOD 1BFMA 3AYWA 2IO5C 5AY8B 3WTPA 2CV5C 3WA9D 3KXBB 3RELB 3UT9C 4JJND 5CPJC 5B31G 2F8NH 5AV5D 5AVBB 3REHD 4Z5TD 3REKC 4UUZA 4WU9B 5JRGD 3B6FD 3W98D 3MGSC 3C1CB 4KUDB 3AZEA 1M18B 4XUJC 3AV2D 2BYKA 1S32C 5B1MD 1U35B 4HGAC 5CPKD 3UTAC 5B2IA 4H9RB 1AOIC 3LJAA 1N1JA 5GT3A 5B32D 5AV9C 4J8WA 3REKA 1F66B 1BH8A 1ID3D 3X1VB 4QLCC 1H3OB 5CPKB 3AV1A 3KUYD 4H9QB 3NQUA 1S32A 5AV6A 4DRAA 4ZUXB 3UTAA 4ZBJB 3A6NA 1M19C 5GXQA 3AZJA 3WAAD 1EQZB 5DNND 5CP6C 3MGQC 3X1SD 4YM6D 1TZYB 3AZFD 3KUYB 5CPID 4LD9B 5B1LC 5GT0B 1ZLAD 1P3PB 1P34D 4KHAB 4XZQC 1KX4C 5B24C 5E5AB 3C1BD 3AZMB 5GSUC 3MVDD 3KWQD 3REJD 1P3OC 1P3AC 3LELC 1P3BC 4R8PC 3W99D 1P3IB 4CAYA 3MGQA 4KGCD 3WTPB 1KU5A 5B1LA 2HIOC 4WV4B 3KWQB 3REJB 5F99A 4XZQA 2CV5D 3UT9D 4UUZB 4JJNC 3AFAC 5CPJD 5AV5C 4Z5TC 3WKJC 1KX5A 4R8PA 3AZEB 3AZHA 3W98C 3MGSD 2LY8A 2BYKB 5CHLB 5B2IB 3W96A 2HIOA 4XUJD 3AV2C 3UT9B 3LJAB 3AZND 1N1JB 5B1MC 3WA9A 5GT3B 4J8WB 3REKB 1AOID 5C3IC 4JJNA 2CWEA 5AV5A 3REHA 1BH8B 5B32C 4Z5TA 5KDMA 3MGPC 5AV9D 3B6FA 5JRGA 3W98A 3AV1B 3MGRD 3NQUB 1S32B 4QLCD 1P3FC 5AV6B 4HGAB 3UTAB 3A6NB 3AV2A 4YS3D 5B1MA 3AZJB 5CPKA 4G92B 5AV9B 1M19D 3AZLC 1BH9A 2AROC 5B32A 5CP6D 3VH6W 3MGQD 3X1SC 1HTAA 4AWLC 3B0DB 1ID3A 1ZLAC 1KX3C 1P34C 3TU4D 3AZIC 1KX4D 3C1BC 2NZDC 5B24D 5GSUD 1P3OD 3X1TC 4CAYB 4E44A 5CP6B 3LZ1D 3MGQB 1P3AD 3LELD 3WAAA 3LZ0C 1P3BD 3W99C 5DNNA 5B1LB 3X1SA 5BO0A 4YM6A 3AZFA 5F99B 4XZQB 5CPIA 1KX4B 2FJ7D 1ZLAA 1P3GC 5GSUB 1P34A 3AZIA 3C1BA 3O62C 1B67A 1ULYA 3MVDA 3KWQA 3REJA 1P3LD 4R8PB 1KX5B 4WU8C 3AZHB 3X1UD 3AFAD 3AZGD 3WKJD 3W99A 5B2JC 3UTBC 5DNMC 3W96B 2HIOB 4KGCA 4H9SA 3WA9B 3W97D 4J8UC 2F8ND 3AZNC 5B0ZD 4JJNB 2CV5A 5AV5B 3REHB 4Z5TB 5KDMB 3UT9A 3B6FB 5JRGB 5CPJA 3W98B 2L5AA 3MGPD 3KSYA 4DRBA 3AV2B 3MGSA 3MGRC 1P3FD 5B1MB 5B0YC 4H9OA 4XUJA 4YS3C 3AZNA 5C3IB 5B40C 1WWIA 1BH9B 5B32B 4X23C 1AOIA 5AVCC 1Q9CA 3AZLD 1ID3B 1JFIA 2AROD 1P3FB 1P3MD 5AV9A 3MGRA 4QLCA 5BT1D 5B33D 1KX3D 3TU4C 3AZID 4YS3A 2NZDD 3B6GD 3WAAB 3VH5W 5DNNB 2NQBC 3X1TD 3LZ1C 1M19A 3X1SB 4WNNA 2HUEB 5BO0B 4YM6B 3LZ0D 4J8XC 3AZFB 5CPIB 5CP6A 1ZLAB 4E45A 1P34B 1A7WA 3AZIB 3C1BB 2FJ7C 1P3GD 3MVDB 3TU4A 3AN2C 1KX4A 5B24A 5GSUA 3O62D 1P3LC 3W99B 1P3OA 2NQBA 3AZKC 3LZ1A 3X1UC 4WU8D 1P3AA 4KGCB 3LELA 3AZGC 1P3BA 5B2JD 3UTBD 5DNMD 3NQJA 3KXBC 2IO5B 2CV5B 2FJ7A 3W97C 4J8UD 3O62B 5AVBC 5B0ZC 5CPJB 4WU9C 5B31D 4Z66D 1P3LA 4NE5A 3C1CC 3UTBB 5AV8D 3X1UA 3AFAA 3MGSB 1M18C 3AZGA 3WKJA 4H9OB 2PYOD 1U35C 4XUJB 1P3KD 3AZNB 4NE6A 5B0YD 3W97A 2F8NA 4NFTA 5B32G 1AOIB 5B0ZA 5B40D 1JFIB 1F66C 4X23D 5AVCD 3X1VC 3MGRB 1P3MC 4QLCB 3MGPA 4YS3B 5BT1C 5B33C 1P3FA 2YFWA 1M19B 1EQZC 3B0CW 4WNNB 3B6GC 1TZYC 2NQBD 5GT0C 3AZLA 3VH6T 4J8XD 2AROA 1P3MA 5E5AC 3TU4B 5B24B 5B33A 1KX3A 1P3OB 2NQBB 4J8VD 3AN2D 3LZ1B 1P3AB 1P3IC 3LELB 3B6GA 2NZDA 4J8XB 1P3BB 3AYWC 3X1TA 3AZKD 3NQJB 3LZ0A 2FJ7B 5AY8D 2BYMA 3KXBD 3RELD 1HQ3C 1P3GA 1P3LB 5AVBD 5BNXA 3AZKB 3X1UB 3AFAB 4WU9D 5B31C 4Z66C 3O62A 3AZGB 3WKJB 4G91C 3C1CD 5AV8C 4WU8A 4KUDD 5B2IC 1M18D 2RVQC 3LJAC 2PYOC 5B2JA 3UTBA 5DNMA 1P3KC 2F8NB 1U35D 3W97B 5B0ZB 5GT3C 4J8WC 1HQ3A 3MNNC 4J8UA 5BNVA 5G49B 5B31A 4Z66A 3V9RA 3MGPB 3AV1C 1F66D 3X1VD 5AV8A 5AV6C 1WWSA 3A6NC 5GXQC 2PYOA 3AZJC 1P3KA 2YFWB 4ZUXD 4G92C 5B0YA 4NE3A 3MNNA 3VH6A 1EQZD 5B40A 3AZLB 4EO5C 2AROB 1P3MB 1TZYD 4X23A 3B0DC 5AVCA 4LD9D 5GT0D 5JA4A 3R45A 5FUGA 4AWLB 1P3PD 5B33B 3REIC 1KX3B 5E5AD 3AZMD 1TAFA 2NZDB 3B6GB 1M1AC 4J8VC 3X1TB 3B0BA 3VH5T 1P3ID 4H9NA 4CSRA 3LZ0B 3AYWD 5F99C 3WTPD 2BYMB 4H9PB 4J8XA 2YFVB 5AY8C 1P3GB 4Z2MG 3REIA 5BNXB 3RELC 1KX5C 1HQ3D 3AZHC 1M1AA 3AYWB 1F1EA 4J8VA 3AN2A 4WU8B 3W96C 3AZED 4WZSB 5B2JB 3AZKA 5DNMB 3WA9C 2F8NG 4KUDC 5B2ID 5BS7C 2RVQD 1HQ3B 3LJAD 5AY8A 4J8UB 3REHC 5BNVB 3KXBA 3RELA 5GT3D 4J8WD 3REKD 3B6FC 5JRGC 3MNND 4Z66B 5B31B 3V9RB 5AVBA 4G91B 1B6WA 2F8NK 5AV8B 4M6BA 4WU9A 3AV1D 5G49A 2PYOB 3C1CA 1S32D 1P3KB 5CPKC 5AV6D 4KUDA 3UTAD 1M18A 3A6ND 5B0YB 5BS7A 5GXQD 3MNNB 1U35A 3AZJD 4ZUXC 4ZBJC 4H9RA 5B40B 4X23B 5AVCB 1ID3C 5JA4B 3R45B 2JSSA 5FUGB 1F66A 3KUYC 5GXQB 3X1VA 4LD9C 3WTPE 1H3OA 1TAFB 1P3PC 3REID 4H9QA 3VH5A 3AZMC 3WAAC 4ZUXA 5DNNC 4H9NB 4CSRB 1R4VA 3B0CT 1M1AD 4YM6C 2HUEC 4EO5B 3AZFC 1EQZA 5CPIC 5B1LD
chains in the Genus database with same CATH superfamily
1TZYA 3KUYA 5F99D 3WTPC 4DQYB 4XZQD 3REIB 1PZRA 5GT0A 4LD9A 3MVDC 3KWQC 1P3PA 3REJC 4KHAA 1M1AB 4H9PA 5E5AA 3AZMA 4J8VB 3AN2B 1KX5D 2YFVA 4R8PD 4Z2MH 3AZHD 4KGCC 4H9SC 1P3IA 3AZEC 3W96D 2HIOD 1BFMA 3AYWA 2IO5C 5AY8B 3WTPA 2CV5C 3WA9D 3KXBB 3RELB 3UT9C 4JJND 5CPJC 5B31G 2F8NH 5AV5D 5AVBB 2UWXA 3REHD 4Z5TD 3REKC 4UUZA 4WU9B 5JRGD 3B6FD 3W98D 3MGSC 3C1CB 4KUDB 3EPHA 3AZEA 1T3UA 1M18B 4XUJC 3AV2D 2BYKA 2ZY5A 1S32C 5B1MD 1U35B 4HGAC 5CPKD 3UTAC 5B2IA 4H9RB 1AOIC 3LJAA 1N1JA 5GT3A 5B32D 5AV9C 4J8WA 3REKA 1F66B 1BH8A 1ID3D 3X1VB 4QLCC 1H3OB 5CPKB 3AV1A 3KUYD 3NQUA 4H9QB 1S32A 5AV6A 4DRAA 4ZUXB 3UTAA 4ZBJB 3A6NA 1M19C 5GXQA 3AZJA 3WAAD 1EQZB 5DNND 5CP6C 3MGQC 3X1SD 4YM6D 1TZYB 3AZFD 3KUYB 5CPID 4LD9B 5B1LC 5GT0B 1ZLAD 1P3PB 2J8PA 1P34D 4KHAB 4XZQC 1KX4C 3EPJA 5B24C 5E5AB 3C1BD 3AZMB 3KFUG 5GSUC 3MVDD 3KWQD 3REJD 1P3OC 4WJ3C 1P3AC 3LELC 1P3BC 4R8PC 3W99D 1P3IB 4CAYA 3MGQA 4KGCD 3WTPB 1KU5A 5B1LA 2HIOC 4WV4B 3KWQB 3REJB 5F99A 4XZQA 2CV5D 3UT9D 4UUZB 4JJNC 3AFAC 5CPJD 2Y2MA 5AV5C 4Z5TC 3WKJC 1KX5A 4R8PA 3AZEB 3AZHA 3W98C 3MGSD 2LY8A 2BYKB 5CHLB 5B2IB 3W96A 2HIOA 4XUJD 3AV2C 3UT9B 3LJAB 3AZND 1N1JB 5B1MC 3WA9A 3H0RC 5GT3B 4J8WB 3REKB 1AOID 3FDDA 5C3IC 4JJNA 2CWEA 5AV5A 3REHA 2XD5A 1BH8B 5B32C 4Z5TA 5KDMA 3MGPC 5AV9D 2Y2IA 3B6FA 5JRGA 3W98A 3AV1B 3MGRD 3NQUB 1S32B 4QLCD 1P3FC 5AV6B 4HGAB 3UTAB 3A6NB 3AV2A 4YS3D 5B1MA 3AZJB 5CPKA 4G92B 5AV9B 1M19D 3AZLC 1BH9A 2AROC 5B32A 5CP6D 3VH6W 3MGQD 3X1SC 1HTAA 4AWLC 3B0DB 1ID3A 1ZLAC 1KX3C 1P34C 3TU4D 3A1KA 3AZIC 1KX4D 3C1BC 2NZDC 5B24D 5GSUD 1P3OD 3X1TC 4CAYB 4E44A 5CP6B 3LZ1D 3MGQB 1P3AD 3LELD 3WAAA 3LZ0C 1P3BD 3W99C 5DNNA 5B1LB 3X1SA 5BO0A 4YM6A 3AZFA 5F99B 4XZQB 5CPIA 1KX4B 2FJ7D 1ZLAA 2RIQA 1P3GC 5GSUB 1P34A 3AZIA 3C1BA 3O62C 1B67A 1ULYA 3MVDA 3KWQA 3REJA 1P3LD 4R8PB 1KX5B 4WU8C 3AZHB 3X1UD 3AFAD 3H0LC 3AZGD 3WKJD 3W99A 5B2JC 3UTBC 5DNMC 3W96B 2HIOB 2Y2PA 4KGCA 4H9SA 3WA9B 3W97D 4J8UC 2F8ND 3AZNC 5B0ZD 4JJNB 2CV5A 5AV5B 2Y2OA 3REHB 4Z5TB 5KDMB 3UT9A 3B6FB 5JRGB 5CPJA 3W98B 2DQNC 2L5AA 3MGPD 3KSYA 4DRBA 3AV2B 2ZM5A 3MGSA 3MGRC 1P3FD 5B1MB 5B0YC 4H9OA 4XUJA 4YS3C 3AZNA 5C3IB 3IP4C 5B40C 1WWIA 1BH9B 5B32B 4X23C 1AOIA 5AVCC 1Q9CA 3AZLD 1ID3B 1JFIA 2AROD 1P3FB 1P3MD 5AV9A 3MGRA 4QLCA 5BT1D 5B33D 1KX3D 3TU4C 3AZID 4YS3A 2NZDD 3B6GD 3WAAB 2ZY2A 3VH5W 5DNNB 2NQBC 3X1TD 3LZ1C 1M19A 3X1SB 4WNNA 2HUEB 5BO0B 4YM6B 2Y2HA 3LZ0D 4J8XC 3AZFB 5CPIB 5CP6A 1ZLAB 4E45A 1P34B 1A7WA 3AZIB 3C1BB 2FJ7C 1P3GD 3MVDB 3TU4A 2JE5A 3AN2C 1KX4A 5B24A 5GSUA 3O62D 2FFFB 1P3LC 3W99B 1P3OA 2NQBA 3AZKC 3LZ1A 3X1UC 4WU8D 1P3AA 4KGCB 3LELA 3AZGC 1P3BA 5B2JD 3UTBD 5DNMD 3NQJA 3KXBC 2IO5B 2CV5B 2G5HC 2BG1A 2FJ7A 3W97C 4J8UD 3O62B 5AVBC 5B0ZC 5CPJB 4WU9C 5B31D 4Z66D 1P3LA 4NE5A 3C1CC 3UTBB 2Y2QA 5AV8D 3X1UA 3AFAA 3MGSB 1M18C 3AZGA 3WKJA 4H9OB 2PYOD 1U35C 4XUJB 1P3KD 3AZNB 2VQRA 4NE6A 5B0YD 3W97A 2F8NA 4NFTA 5B32G 1AOIB 5B0ZA 5B40D 1JFIB 1F66C 4X23D 5AVCD 3X1VC 3MGRB 1P3MC 4QLCB 3MGPA 4YS3B 3H0MC 5BT1C 5B33C 1P3FA 2YFWA 1M19B 1EQZC 3B0CW 4WNNB 3B6GC 2F2AC 1TZYC 2NQBD 5GT0C 3AZLA 3VH6T 4J8XD 2AROA 1P3MA 5E5AC 3TU4B 5B24B 5B33A 2ZY3A 1KX3A 1P3OB 2NQBB 4J8VD 3AN2D 3LZ1B 1P3AB 1P3IC 3LELB 3B6GA 2NZDA 4J8XB 1P3BB 3AYWC 2Y2LA 3X1TA 3AZKD 2W8SA 3NQJB 3LZ0A 2FJ7B 5AY8D 2BYMA 2G5IC 3KXBD 3RELD 1HQ3C 1P3GA 1P3LB 5AVBD 5BNXA 3EPLA 3AZKB 3X1UB 3AFAB 4WU9D 5B31C 4Z66C 3O62A 3AZGB 3WKJB 2ZY4A 4G91C 3C1CD 5AV8C 4WU8A 4KUDD 3P5JB 5B2IC 1M18D 2RVQC 3LJAC 2PYOC 5B2JA 3UTBA 5DNMA 1P3KC 2F8NB 1U35D 3W97B 5B0ZB 5GT3C 4J8WC 1HQ3A 3MNNC 4J8UA 3EPKA 3AL0C 5BNVA 5G49B 5B31A 4Z66A 3A1IA 3V9RA 3MGPB 3AV1C 1F66D 3X1VD 5AV8A 5AV6C 1WWSA 3A6NC 5GXQC 2PYOA 3AZJC 1P3KA 2YFWB 4ZUXD 4G92C 5B0YA 4NE3A 3EG5B 3MNNA 3VH6A 1EQZD 5B40A 3AZLB 4EO5C 3F6TA 2AROB 1P3MB 1TZYD 4X23A 3B0DC 5AVCA 4LD9D 5GT0D 5JA4A 3R45A 5FUGA 4AWLB 1P3PD 5B33B 3REIC 1KX3B 5E5AD 3AZMD 1TAFA 2NZDB 3B6GB 1M1AC 4J8VC 3X1TB 3B0BA 3VH5T 1P3ID 4H9NA 4CSRA 3LZ0B 3AYWD 5F99C 3WTPD 2BYMB 4H9PB 4J8XA 2YFVB 5AY8C 1P3GB 4Z2MG 3REIA 5BNXB 3RELC 1KX5C 2DF4C 1HQ3D 2Y2KA 3AZHC 1M1AA 2JCHA 2Y2NA 3AYWB 1F1EA 2Y2GA 4J8VA 4WU8B 3AN2A 3W96C 3AZED 4WZSB 5B2JB 3AZKA 5DNMB 3WA9C 2F8NG 4KUDC 5B2ID 4UPKA 5BS7C 2RVQD 1HQ3B 3LJAD 5AY8A 4J8UB 3REHC 5BNVB 1Z2CB 3KXBA 3RELA 5GT3D 4J8WD 3REKD 3B6FC 5JRGC 3MNND 4Z66B 5B31B 3V9RB 5AVBA 4G91B 1B6WA 2F8NK 5AV8B 4M6BA 4WU9A 3AV1D 5G49A 2PYOB 3C1CA 1S32D 1P3KB 5CPKC 5AV6D 4KUDA 3UTAD 1M18A 3A6ND 5B0YB 5BS7A 5GXQD 3MNNB 1U35A 3AZJD 4ZUXC 4ZBJC 2Y2JA 4H9RA 5B40B 4X23B 5AVCB 1ID3C 5JA4B 3R45B 2JSSA 5FUGB 1F66A 3KUYC 5GXQB 3X1VA 2XD1A 1W2EA 4LD9C 3WTPE 1H3OA 1TAFB 1P3PC 3REID 4H9QA 3VH5A 3AZMC 3WAAC 4ZUXA 5DNNC 4H9NB 4CSRB 1R4VA 3B0CT 1M1AD 2HUEC 4EO5B 4YM6C 3AZFC 1EQZA 5CPIC 5B1LD
chains in the Genus database with same CATH topology
1TZYA 3KUYA 5F99D 3WTPC 4DQYB 4XZQD 3REIB 1PZRA 5GT0A 4LD9A 3MVDC 3KWQC 1P3PA 3REJC 4KHAA 1M1AB 4H9PA 5E5AA 3AZMA 4J8VB 3AN2B 1KX5D 2YFVA 4R8PD 4Z2MH 3AZHD 4KGCC 4H9SC 1P3IA 3AZEC 3W96D 2HIOD 1BFMA 3AYWA 2IO5C 5AY8B 3WTPA 2CV5C 3WA9D 3KXBB 3RELB 3UT9C 4JJND 5CPJC 5B31G 2F8NH 5AV5D 5AVBB 2UWXA 3REHD 4Z5TD 3REKC 4UUZA 4WU9B 5JRGD 3B6FD 3W98D 3MGSC 3C1CB 4KUDB 3EPHA 3AZEA 1T3UA 1M18B 4XUJC 3AV2D 2BYKA 2ZY5A 1S32C 5B1MD 1U35B 4HGAC 5CPKD 3UTAC 5B2IA 4H9RB 1AOIC 3LJAA 1N1JA 5GT3A 5B32D 5AV9C 4J8WA 3REKA 1F66B 1BH8A 1ID3D 3X1VB 4QLCC 1H3OB 5CPKB 3AV1A 3KUYD 3NQUA 4H9QB 1S32A 5AV6A 4DRAA 4ZUXB 3UTAA 4ZBJB 3A6NA 1M19C 5GXQA 3AZJA 3WAAD 1EQZB 5DNND 5CP6C 3MGQC 3X1SD 4YM6D 1TZYB 3AZFD 3KUYB 5CPID 4LD9B 5B1LC 5GT0B 1ZLAD 1P3PB 2J8PA 1P34D 4KHAB 4XZQC 1KX4C 3EPJA 5B24C 5E5AB 3C1BD 3AZMB 3KFUG 5GSUC 3MVDD 3KWQD 3REJD 1P3OC 4WJ3C 1P3AC 3LELC 1P3BC 4R8PC 3W99D 1P3IB 4CAYA 3MGQA 4KGCD 3WTPB 1KU5A 5B1LA 2HIOC 4WV4B 3KWQB 3REJB 5F99A 4XZQA 2CV5D 3UT9D 4UUZB 4JJNC 3AFAC 5CPJD 2Y2MA 5AV5C 4Z5TC 3WKJC 1KX5A 4R8PA 3AZEB 3AZHA 3W98C 3MGSD 2LY8A 2BYKB 5CHLB 5B2IB 3W96A 2HIOA 4XUJD 3AV2C 3UT9B 3LJAB 3AZND 1N1JB 5B1MC 3WA9A 3H0RC 5GT3B 4J8WB 3REKB 1AOID 3FDDA 5C3IC 4JJNA 2CWEA 5AV5A 3REHA 2XD5A 1BH8B 5B32C 4Z5TA 5KDMA 3MGPC 5AV9D 2Y2IA 3B6FA 5JRGA 3W98A 3AV1B 3MGRD 3NQUB 1S32B 4QLCD 1P3FC 5AV6B 4HGAB 3UTAB 3A6NB 3AV2A 4YS3D 5B1MA 3AZJB 5CPKA 4G92B 5AV9B 1M19D 3AZLC 1BH9A 2AROC 5B32A 5CP6D 3VH6W 3MGQD 3X1SC 1HTAA 4AWLC 3B0DB 1ID3A 1ZLAC 1KX3C 1P34C 3TU4D 3A1KA 3AZIC 1KX4D 3C1BC 2NZDC 5B24D 5GSUD 1P3OD 3X1TC 4CAYB 4E44A 5CP6B 3LZ1D 3MGQB 1P3AD 3LELD 3WAAA 3LZ0C 1P3BD 3W99C 5DNNA 5B1LB 3X1SA 5BO0A 4YM6A 3AZFA 5F99B 4XZQB 5CPIA 1KX4B 2FJ7D 1ZLAA 2RIQA 1P3GC 5GSUB 1P34A 3AZIA 3C1BA 3O62C 1B67A 1ULYA 3MVDA 3KWQA 3REJA 1P3LD 4R8PB 1KX5B 4WU8C 3AZHB 3X1UD 3AFAD 3H0LC 3AZGD 3WKJD 3W99A 5B2JC 3UTBC 5DNMC 3W96B 2HIOB 2Y2PA 4KGCA 4H9SA 3WA9B 3W97D 4J8UC 2F8ND 3AZNC 5B0ZD 4JJNB 2CV5A 5AV5B 2Y2OA 3REHB 4Z5TB 5KDMB 3UT9A 3B6FB 5JRGB 5CPJA 3W98B 2DQNC 2L5AA 3MGPD 3KSYA 4DRBA 3AV2B 2ZM5A 3MGSA 3MGRC 1P3FD 5B1MB 5B0YC 4H9OA 4XUJA 4YS3C 3AZNA 5C3IB 3IP4C 5B40C 1WWIA 1BH9B 5B32B 4X23C 1AOIA 5AVCC 1Q9CA 3AZLD 1ID3B 1JFIA 2AROD 1P3FB 1P3MD 5AV9A 3MGRA 4QLCA 5BT1D 5B33D 1KX3D 3TU4C 3AZID 4YS3A 2NZDD 3B6GD 3WAAB 2ZY2A 3VH5W 5DNNB 2NQBC 3X1TD 3LZ1C 1M19A 3X1SB 4WNNA 2HUEB 5BO0B 4YM6B 2Y2HA 3LZ0D 4J8XC 3AZFB 5CPIB 5CP6A 1ZLAB 4E45A 1P34B 1A7WA 3AZIB 3C1BB 2FJ7C 1P3GD 3MVDB 3TU4A 2JE5A 3AN2C 1KX4A 5B24A 5GSUA 3O62D 2FFFB 1P3LC 3W99B 1P3OA 2NQBA 3AZKC 3LZ1A 3X1UC 4WU8D 1P3AA 4KGCB 3LELA 3AZGC 1P3BA 5B2JD 3UTBD 5DNMD 3NQJA 3KXBC 2IO5B 2CV5B 2G5HC 2BG1A 2FJ7A 3W97C 4J8UD 3O62B 5AVBC 5B0ZC 5CPJB 4WU9C 5B31D 4Z66D 1P3LA 4NE5A 3C1CC 3UTBB 2Y2QA 5AV8D 3X1UA 3AFAA 3MGSB 1M18C 3AZGA 3WKJA 4H9OB 2PYOD 1U35C 4XUJB 1P3KD 3AZNB 2VQRA 4NE6A 5B0YD 3W97A 2F8NA 4NFTA 5B32G 1AOIB 5B0ZA 5B40D 1JFIB 1F66C 4X23D 5AVCD 3X1VC 3MGRB 1P3MC 4QLCB 3MGPA 4YS3B 3H0MC 5BT1C 5B33C 1P3FA 2YFWA 1M19B 1EQZC 3B0CW 4WNNB 3B6GC 2F2AC 1TZYC 2NQBD 5GT0C 3AZLA 3VH6T 4J8XD 2AROA 1P3MA 5E5AC 3TU4B 5B24B 5B33A 2ZY3A 1KX3A 1P3OB 2NQBB 4J8VD 3AN2D 3LZ1B 1P3AB 1P3IC 3LELB 3B6GA 2NZDA 4J8XB 1P3BB 3AYWC 2Y2LA 3X1TA 3AZKD 2W8SA 3NQJB 3LZ0A 2FJ7B 5AY8D 2BYMA 2G5IC 3KXBD 3RELD 1HQ3C 1P3GA 1P3LB 5AVBD 5BNXA 3EPLA 3AZKB 3X1UB 3AFAB 4WU9D 5B31C 4Z66C 3O62A 3AZGB 3WKJB 2ZY4A 4G91C 3C1CD 5AV8C 4WU8A 4KUDD 3P5JB 5B2IC 1M18D 2RVQC 3LJAC 2PYOC 5B2JA 3UTBA 5DNMA 1P3KC 2F8NB 1U35D 3W97B 5B0ZB 5GT3C 4J8WC 1HQ3A 3MNNC 4J8UA 3EPKA 3AL0C 5BNVA 5G49B 5B31A 4Z66A 3A1IA 3V9RA 3MGPB 3AV1C 1F66D 3X1VD 5AV8A 5AV6C 1WWSA 3A6NC 5GXQC 2PYOA 3AZJC 1P3KA 2YFWB 4ZUXD 4G92C 5B0YA 4NE3A 3EG5B 3MNNA 3VH6A 1EQZD 5B40A 3AZLB 4EO5C 3F6TA 2AROB 1P3MB 1TZYD 4X23A 3B0DC 5AVCA 4LD9D 5GT0D 5JA4A 3R45A 5FUGA 4AWLB 1P3PD 5B33B 3REIC 1KX3B 5E5AD 3AZMD 1TAFA 2NZDB 3B6GB 1M1AC 4J8VC 3X1TB 3B0BA 3VH5T 1P3ID 4H9NA 4CSRA 3LZ0B 3AYWD 5F99C 3WTPD 2BYMB 4H9PB 4J8XA 2YFVB 5AY8C 1P3GB 4Z2MG 3REIA 5BNXB 3RELC 1KX5C 2DF4C 1HQ3D 2Y2KA 3AZHC 1M1AA 2JCHA 2Y2NA 3AYWB 1F1EA 2Y2GA 4J8VA 4WU8B 3AN2A 3W96C 3AZED 4WZSB 5B2JB 3AZKA 5DNMB 3WA9C 2F8NG 4KUDC 5B2ID 4UPKA 5BS7C 2RVQD 1HQ3B 3LJAD 5AY8A 4J8UB 3REHC 5BNVB 1Z2CB 3KXBA 3RELA 5GT3D 4J8WD 3REKD 3B6FC 5JRGC 3MNND 4Z66B 5B31B 3V9RB 5AVBA 4G91B 1B6WA 2F8NK 5AV8B 4M6BA 4WU9A 3AV1D 5G49A 2PYOB 3C1CA 1S32D 1P3KB 5CPKC 5AV6D 4KUDA 3UTAD 1M18A 3A6ND 5B0YB 5BS7A 5GXQD 3MNNB 1U35A 3AZJD 4ZUXC 4ZBJC 2Y2JA 4H9RA 5B40B 4X23B 5AVCB 1ID3C 5JA4B 3R45B 2JSSA 5FUGB 1F66A 3KUYC 5GXQB 3X1VA 2XD1A 1W2EA 4LD9C 3WTPE 1H3OA 1TAFB 1P3PC 3REID 4H9QA 3VH5A 3AZMC 3WAAC 4ZUXA 5DNNC 4H9NB 4CSRB 1R4VA 3B0CT 1M1AD 2HUEC 4EO5B 4YM6C 3AZFC 1EQZA 5CPIC 5B1LD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TZY A;  3KUY A;  5F99 D;  3WTP C;  4XZQ D;  3REI B;  4LD9 A;  5GT0 A;  3MVD C;  3KWQ C;  1P3P A;  3REJ C;  4KHA A;  1M1A B;  4H9P A;  5E5A A;  3AZM A;  4J8V B;  3AN2 B;  1KX5 D;  2YFV A;  4R8P D;  4Z2M H;  3AZH D;  4KGC C;  4H9S C;  1P3I A;  3AZE C;  3W96 D;  2HIO D;  1BFM A;  3AYW A;  2IO5 C;  5AY8 B;  3WTP A;  2CV5 C;  3WA9 D;  3KXB B;  3REL B;  3UT9 C;  4JJN D;  5CPJ C;  5B31 G;  2F8N H;  5AV5 D;  5AVB B;  3REH D;  4Z5T D;  3REK C;  4UUZ A;  4WU9 B;  5JRG D;  3B6F D;  3W98 D;  3MGS C;  3C1C B;  4KUD B;  3AZE A;  1M18 B;  4XUJ C;  3AV2 D;  2BYK A;  1S32 C;  5B1M D;  1U35 B;  4HGA C;  5CPK D;  3UTA C;  5B2I A;  4H9R B;  1AOI C;  3LJA A;  1N1J A;  5GT3 A;  5B32 D;  5AV9 C;  4J8W A;  3REK A;  1F66 B;  1BH8 A;  1ID3 D;  3X1V B;  4QLC C;  1H3O B;  5CPK B;  3AV1 A;  3KUY D;  4H9Q B;  3NQU A;  1S32 A;  5AV6 A;  4DRA A;  4ZUX B;  3UTA A;  4ZBJ B;  3A6N A;  1M19 C;  5GXQ A;  3AZJ A;  3WAA D;  1EQZ B;  5DNN D;  5CP6 C;  3MGQ C;  3X1S D;  4YM6 D;  1TZY B;  3AZF D;  3KUY B;  5CPI D;  4LD9 B;  5B1L C;  5GT0 B;  1ZLA D;  1P3P B;  1P34 D;  4KHA B;  4XZQ C;  1KX4 C;  5B24 C;  5E5A B;  3C1B D;  3AZM B;  5GSU C;  3MVD D;  3KWQ D;  3REJ D;  1P3O C;  1P3A C;  3LEL C;  1P3B C;  4R8P C;  3W99 D;  1P3I B;  4CAY A;  3MGQ A;  4KGC D;  3WTP B;  1KU5 A;  5B1L A;  2HIO C;  4WV4 B;  3KWQ B;  3REJ B;  5F99 A;  4XZQ A;  2CV5 D;  3UT9 D;  4UUZ B;  4JJN C;  3AFA C;  5CPJ D;  5AV5 C;  4Z5T C;  3WKJ C;  1KX5 A;  4R8P A;  3AZE B;  3AZH A;  3W98 C;  3MGS D;  2LY8 A;  2BYK B;  5CHL B;  5B2I B;  3W96 A;  2HIO A;  4XUJ D;  3AV2 C;  3UT9 B;  3LJA B;  3AZN D;  1N1J B;  5B1M C;  3WA9 A;  5GT3 B;  4J8W B;  3REK B;  1AOI D;  5C3I C;  4JJN A;  2CWE A;  5AV5 A;  3REH A;  1BH8 B;  5B32 C;  4Z5T A;  5KDM A;  3MGP C;  5AV9 D;  3B6F A;  5JRG A;  3W98 A;  3AV1 B;  3MGR D;  3NQU B;  1S32 B;  4QLC D;  1P3F C;  5AV6 B;  4HGA B;  3UTA B;  3A6N B;  3AV2 A;  4YS3 D;  5B1M A;  3AZJ B;  5CPK A;  4G92 B;  5AV9 B;  1M19 D;  3AZL C;  1BH9 A;  2ARO C;  5B32 A;  5CP6 D;  3VH6 W;  3MGQ D;  3X1S C;  1HTA A;  4AWL C;  3B0D B;  1ID3 A;  1ZLA C;  1KX3 C;  1P34 C;  3TU4 D;  3AZI C;  1KX4 D;  3C1B C;  2NZD C;  5B24 D;  5GSU D;  1P3O D;  3X1T C;  4CAY B;  4E44 A;  5CP6 B;  3LZ1 D;  3MGQ B;  1P3A D;  3LEL D;  3WAA A;  3LZ0 C;  1P3B D;  3W99 C;  5DNN A;  5B1L B;  3X1S A;  5BO0 A;  4YM6 A;  3AZF A;  5F99 B;  4XZQ B;  5CPI A;  1KX4 B;  2FJ7 D;  1ZLA A;  1P3G C;  5GSU B;  1P34 A;  3AZI A;  3C1B A;  3O62 C;  1B67 A;  1ULY A;  3MVD A;  3KWQ A;  3REJ A;  1P3L D;  4R8P B;  1KX5 B;  4WU8 C;  3AZH B;  3X1U D;  3AFA D;  3AZG D;  3WKJ D;  3W99 A;  5B2J C;  3UTB C;  5DNM C;  3W96 B;  2HIO B;  4KGC A;  4H9S A;  3WA9 B;  3W97 D;  4J8U C;  2F8N D;  3AZN C;  5B0Z D;  4JJN B;  2CV5 A;  5AV5 B;  3REH B;  4Z5T B;  5KDM B;  3UT9 A;  3B6F B;  5JRG B;  5CPJ A;  3W98 B;  2L5A A;  3MGP D;  3KSY A;  4DRB A;  3AV2 B;  3MGS A;  3MGR C;  1P3F D;  5B1M B;  5B0Y C;  4H9O A;  4XUJ A;  4YS3 C;  3AZN A;  5C3I B;  5B40 C;  1WWI A;  1BH9 B;  5B32 B;  4X23 C;  1AOI A;  5AVC C;  1Q9C A;  3AZL D;  1ID3 B;  1JFI A;  2ARO D;  1P3F B;  1P3M D;  5AV9 A;  3MGR A;  4QLC A;  5BT1 D;  5B33 D;  1KX3 D;  3TU4 C;  3AZI D;  4YS3 A;  2NZD D;  3B6G D;  3WAA B;  3VH5 W;  5DNN B;  2NQB C;  3X1T D;  3LZ1 C;  1M19 A;  3X1S B;  4WNN A;  2HUE B;  5BO0 B;  4YM6 B;  3LZ0 D;  4J8X C;  3AZF B;  5CPI B;  5CP6 A;  1ZLA B;  4E45 A;  1P34 B;  1A7W A;  3AZI B;  3C1B B;  2FJ7 C;  1P3G D;  3MVD B;  3TU4 A;  3AN2 C;  1KX4 A;  5B24 A;  5GSU A;  3O62 D;  1P3L C;  3W99 B;  1P3O A;  2NQB A;  3AZK C;  3LZ1 A;  3X1U C;  4WU8 D;  1P3A A;  4KGC B;  3LEL A;  3AZG C;  1P3B A;  5B2J D;  3UTB D;  5DNM D;  3NQJ A;  3KXB C;  2IO5 B;  2CV5 B;  2FJ7 A;  3W97 C;  4J8U D;  3O62 B;  5AVB C;  5B0Z C;  5CPJ B;  4WU9 C;  5B31 D;  4Z66 D;  1P3L A;  4NE5 A;  3C1C C;  3UTB B;  5AV8 D;  3X1U A;  3AFA A;  3MGS B;  1M18 C;  3AZG A;  3WKJ A;  4H9O B;  2PYO D;  1U35 C;  4XUJ B;  1P3K D;  3AZN B;  4NE6 A;  5B0Y D;  3W97 A;  2F8N A;  4NFT A;  5B32 G;  1AOI B;  5B0Z A;  5B40 D;  1JFI B;  1F66 C;  4X23 D;  5AVC D;  3X1V C;  3MGR B;  1P3M C;  4QLC B;  3MGP A;  4YS3 B;  5BT1 C;  5B33 C;  1P3F A;  2YFW A;  1M19 B;  1EQZ C;  3B0C W;  4WNN B;  3B6G C;  1TZY C;  2NQB D;  5GT0 C;  3AZL A;  3VH6 T;  4J8X D;  2ARO A;  1P3M A;  5E5A C;  3TU4 B;  5B24 B;  5B33 A;  1KX3 A;  1P3O B;  2NQB B;  4J8V D;  3AN2 D;  3LZ1 B;  1P3A B;  1P3I C;  3LEL B;  3B6G A;  2NZD A;  4J8X B;  1P3B B;  3AYW C;  3X1T A;  3AZK D;  3NQJ B;  3LZ0 A;  2FJ7 B;  5AY8 D;  2BYM A;  3KXB D;  3REL D;  1HQ3 C;  1P3G A;  1P3L B;  5AVB D;  5BNX A;  3AZK B;  3X1U B;  3AFA B;  4WU9 D;  5B31 C;  4Z66 C;  3O62 A;  3AZG B;  3WKJ B;  4G91 C;  3C1C D;  5AV8 C;  4WU8 A;  4KUD D;  5B2I C;  1M18 D;  2RVQ C;  3LJA C;  2PYO C;  5B2J A;  3UTB A;  5DNM A;  1P3K C;  2F8N B;  1U35 D;  3W97 B;  5B0Z B;  5GT3 C;  4J8W C;  1HQ3 A;  3MNN C;  4J8U A;  5BNV A;  5G49 B;  5B31 A;  4Z66 A;  3V9R A;  3MGP B;  3AV1 C;  1F66 D;  3X1V D;  5AV8 A;  5AV6 C;  1WWS A;  3A6N C;  5GXQ C;  2PYO A;  3AZJ C;  1P3K A;  2YFW B;  4ZUX D;  4G92 C;  5B0Y A;  4NE3 A;  3MNN A;  3VH6 A;  1EQZ D;  5B40 A;  3AZL B;  4EO5 C;  2ARO B;  1P3M B;  1TZY D;  4X23 A;  3B0D C;  5AVC A;  4LD9 D;  5GT0 D;  5JA4 A;  3R45 A;  5FUG A;  4AWL B;  1P3P D;  5B33 B;  3REI C;  1KX3 B;  5E5A D;  3AZM D;  1TAF A;  2NZD B;  3B6G B;  1M1A C;  4J8V C;  3X1T B;  3B0B A;  3VH5 T;  1P3I D;  4H9N A;  4CSR A;  3LZ0 B;  3AYW D;  5F99 C;  3WTP D;  2BYM B;  4H9P B;  4J8X A;  2YFV B;  5AY8 C;  1P3G B;  4Z2M G;  3REI A;  5BNX B;  3REL C;  1KX5 C;  1HQ3 D;  3AZH C;  1M1A A;  3AYW B;  1F1E A;  4J8V A;  3AN2 A;  4WU8 B;  3W96 C;  3AZE D;  4WZS B;  5B2J B;  3AZK A;  5DNM B;  3WA9 C;  2F8N G;  4KUD C;  5B2I D;  5BS7 C;  2RVQ D;  1HQ3 B;  3LJA D;  5AY8 A;  4J8U B;  3REH C;  5BNV B;  3KXB A;  3REL A;  5GT3 D;  4J8W D;  3REK D;  3B6F C;  5JRG C;  3MNN D;  4Z66 B;  5B31 B;  3V9R B;  5AVB A;  4G91 B;  1B6W A;  2F8N K;  5AV8 B;  4M6B A;  4WU9 A;  3AV1 D;  5G49 A;  2PYO B;  3C1C A;  1S32 D;  1P3K B;  5CPK C;  5AV6 D;  4KUD A;  3UTA D;  1M18 A;  3A6N D;  5B0Y B;  5BS7 A;  5GXQ D;  3MNN B;  1U35 A;  3AZJ D;  4ZUX C;  4ZBJ C;  4H9R A;  5B40 B;  4X23 B;  5AVC B;  1ID3 C;  5JA4 B;  3R45 B;  2JSS A;  5FUG B;  1F66 A;  3KUY C;  5GXQ B;  3X1V A;  4LD9 C;  3WTP E;  1H3O A;  1TAF B;  1P3P C;  3REI D;  4H9Q A;  3VH5 A;  3AZM C;  3WAA C;  4ZUX A;  5DNN C;  4H9N B;  4CSR B;  1R4V A;  3B0C T;  1M1A D;  4YM6 C;  2HUE C;  4EO5 B;  3AZF C;  1EQZ A;  5CPI C;  5B1L D; 
#chains in the Genus database with same CATH topology
 1TZY A;  3KUY A;  5F99 D;  3WTP C;  4DQY B;  4XZQ D;  3REI B;  1PZR A;  5GT0 A;  4LD9 A;  3MVD C;  3KWQ C;  1P3P A;  3REJ C;  4KHA A;  1M1A B;  4H9P A;  5E5A A;  3AZM A;  4J8V B;  3AN2 B;  1KX5 D;  2YFV A;  4R8P D;  4Z2M H;  3AZH D;  4KGC C;  4H9S C;  1P3I A;  3AZE C;  3W96 D;  2HIO D;  1BFM A;  3AYW A;  2IO5 C;  5AY8 B;  3WTP A;  2CV5 C;  3WA9 D;  3KXB B;  3REL B;  3UT9 C;  4JJN D;  5CPJ C;  5B31 G;  2F8N H;  5AV5 D;  5AVB B;  2UWX A;  3REH D;  4Z5T D;  3REK C;  4UUZ A;  4WU9 B;  5JRG D;  3B6F D;  3W98 D;  3MGS C;  3C1C B;  4KUD B;  3EPH A;  3AZE A;  1T3U A;  1M18 B;  4XUJ C;  3AV2 D;  2BYK A;  2ZY5 A;  1S32 C;  5B1M D;  1U35 B;  4HGA C;  5CPK D;  3UTA C;  5B2I A;  4H9R B;  1AOI C;  3LJA A;  1N1J A;  5GT3 A;  5B32 D;  5AV9 C;  4J8W A;  3REK A;  1F66 B;  1BH8 A;  1ID3 D;  3X1V B;  4QLC C;  1H3O B;  5CPK B;  3AV1 A;  3KUY D;  3NQU A;  4H9Q B;  1S32 A;  5AV6 A;  4DRA A;  4ZUX B;  3UTA A;  4ZBJ B;  3A6N A;  1M19 C;  5GXQ A;  3AZJ A;  3WAA D;  1EQZ B;  5DNN D;  5CP6 C;  3MGQ C;  3X1S D;  4YM6 D;  1TZY B;  3AZF D;  3KUY B;  5CPI D;  4LD9 B;  5B1L C;  5GT0 B;  1ZLA D;  1P3P B;  2J8P A;  1P34 D;  4KHA B;  4XZQ C;  1KX4 C;  3EPJ A;  5B24 C;  5E5A B;  3C1B D;  3AZM B;  3KFU G;  5GSU C;  3MVD D;  3KWQ D;  3REJ D;  1P3O C;  4WJ3 C;  1P3A C;  3LEL C;  1P3B C;  4R8P C;  3W99 D;  1P3I B;  4CAY A;  3MGQ A;  4KGC D;  3WTP B;  1KU5 A;  5B1L A;  2HIO C;  4WV4 B;  3KWQ B;  3REJ B;  5F99 A;  4XZQ A;  2CV5 D;  3UT9 D;  4UUZ B;  4JJN C;  3AFA C;  5CPJ D;  2Y2M A;  5AV5 C;  4Z5T C;  3WKJ C;  1KX5 A;  4R8P A;  3AZE B;  3AZH A;  3W98 C;  3MGS D;  2LY8 A;  2BYK B;  5CHL B;  5B2I B;  3W96 A;  2HIO A;  4XUJ D;  3AV2 C;  3UT9 B;  3LJA B;  3AZN D;  1N1J B;  5B1M C;  3WA9 A;  3H0R C;  5GT3 B;  4J8W B;  3REK B;  1AOI D;  3FDD A;  5C3I C;  4JJN A;  2CWE A;  5AV5 A;  3REH A;  2XD5 A;  1BH8 B;  5B32 C;  4Z5T A;  5KDM A;  3MGP C;  5AV9 D;  2Y2I A;  3B6F A;  5JRG A;  3W98 A;  3AV1 B;  3MGR D;  3NQU B;  1S32 B;  4QLC D;  1P3F C;  5AV6 B;  4HGA B;  3UTA B;  3A6N B;  3AV2 A;  4YS3 D;  5B1M A;  3AZJ B;  5CPK A;  4G92 B;  5AV9 B;  1M19 D;  3AZL C;  1BH9 A;  2ARO C;  5B32 A;  5CP6 D;  3VH6 W;  3MGQ D;  3X1S C;  1HTA A;  4AWL C;  3B0D B;  1ID3 A;  1ZLA C;  1KX3 C;  1P34 C;  3TU4 D;  3A1K A;  3AZI C;  1KX4 D;  3C1B C;  2NZD C;  5B24 D;  5GSU D;  1P3O D;  3X1T C;  4CAY B;  4E44 A;  5CP6 B;  3LZ1 D;  3MGQ B;  1P3A D;  3LEL D;  3WAA A;  3LZ0 C;  1P3B D;  3W99 C;  5DNN A;  5B1L B;  3X1S A;  5BO0 A;  4YM6 A;  3AZF A;  5F99 B;  4XZQ B;  5CPI A;  1KX4 B;  2FJ7 D;  1ZLA A;  2RIQ A;  1P3G C;  5GSU B;  1P34 A;  3AZI A;  3C1B A;  3O62 C;  1B67 A;  1ULY A;  3MVD A;  3KWQ A;  3REJ A;  1P3L D;  4R8P B;  1KX5 B;  4WU8 C;  3AZH B;  3X1U D;  3AFA D;  3H0L C;  3AZG D;  3WKJ D;  3W99 A;  5B2J C;  3UTB C;  5DNM C;  3W96 B;  2HIO B;  2Y2P A;  4KGC A;  4H9S A;  3WA9 B;  3W97 D;  4J8U C;  2F8N D;  3AZN C;  5B0Z D;  4JJN B;  2CV5 A;  5AV5 B;  2Y2O A;  3REH B;  4Z5T B;  5KDM B;  3UT9 A;  3B6F B;  5JRG B;  5CPJ A;  3W98 B;  2DQN C;  2L5A A;  3MGP D;  3KSY A;  4DRB A;  3AV2 B;  2ZM5 A;  3MGS A;  3MGR C;  1P3F D;  5B1M B;  5B0Y C;  4H9O A;  4XUJ A;  4YS3 C;  3AZN A;  5C3I B;  3IP4 C;  5B40 C;  1WWI A;  1BH9 B;  5B32 B;  4X23 C;  1AOI A;  5AVC C;  1Q9C A;  3AZL D;  1ID3 B;  1JFI A;  2ARO D;  1P3F B;  1P3M D;  5AV9 A;  3MGR A;  4QLC A;  5BT1 D;  5B33 D;  1KX3 D;  3TU4 C;  3AZI D;  4YS3 A;  2NZD D;  3B6G D;  3WAA B;  2ZY2 A;  3VH5 W;  5DNN B;  2NQB C;  3X1T D;  3LZ1 C;  1M19 A;  3X1S B;  4WNN A;  2HUE B;  5BO0 B;  4YM6 B;  2Y2H A;  3LZ0 D;  4J8X C;  3AZF B;  5CPI B;  5CP6 A;  1ZLA B;  4E45 A;  1P34 B;  1A7W A;  3AZI B;  3C1B B;  2FJ7 C;  1P3G D;  3MVD B;  3TU4 A;  2JE5 A;  3AN2 C;  1KX4 A;  5B24 A;  5GSU A;  3O62 D;  2FFF B;  1P3L C;  3W99 B;  1P3O A;  2NQB A;  3AZK C;  3LZ1 A;  3X1U C;  4WU8 D;  1P3A A;  4KGC B;  3LEL A;  3AZG C;  1P3B A;  5B2J D;  3UTB D;  5DNM D;  3NQJ A;  3KXB C;  2IO5 B;  2CV5 B;  2G5H C;  2BG1 A;  2FJ7 A;  3W97 C;  4J8U D;  3O62 B;  5AVB C;  5B0Z C;  5CPJ B;  4WU9 C;  5B31 D;  4Z66 D;  1P3L A;  4NE5 A;  3C1C C;  3UTB B;  2Y2Q A;  5AV8 D;  3X1U A;  3AFA A;  3MGS B;  1M18 C;  3AZG A;  3WKJ A;  4H9O B;  2PYO D;  1U35 C;  4XUJ B;  1P3K D;  3AZN B;  2VQR A;  4NE6 A;  5B0Y D;  3W97 A;  2F8N A;  4NFT A;  5B32 G;  1AOI B;  5B0Z A;  5B40 D;  1JFI B;  1F66 C;  4X23 D;  5AVC D;  3X1V C;  3MGR B;  1P3M C;  4QLC B;  3MGP A;  4YS3 B;  3H0M C;  5BT1 C;  5B33 C;  1P3F A;  2YFW A;  1M19 B;  1EQZ C;  3B0C W;  4WNN B;  3B6G C;  2F2A C;  1TZY C;  2NQB D;  5GT0 C;  3AZL A;  3VH6 T;  4J8X D;  2ARO A;  1P3M A;  5E5A C;  3TU4 B;  5B24 B;  5B33 A;  2ZY3 A;  1KX3 A;  1P3O B;  2NQB B;  4J8V D;  3AN2 D;  3LZ1 B;  1P3A B;  1P3I C;  3LEL B;  3B6G A;  2NZD A;  4J8X B;  1P3B B;  3AYW C;  2Y2L A;  3X1T A;  3AZK D;  2W8S A;  3NQJ B;  3LZ0 A;  2FJ7 B;  5AY8 D;  2BYM A;  2G5I C;  3KXB D;  3REL D;  1HQ3 C;  1P3G A;  1P3L B;  5AVB D;  5BNX A;  3EPL A;  3AZK B;  3X1U B;  3AFA B;  4WU9 D;  5B31 C;  4Z66 C;  3O62 A;  3AZG B;  3WKJ B;  2ZY4 A;  4G91 C;  3C1C D;  5AV8 C;  4WU8 A;  4KUD D;  3P5J B;  5B2I C;  1M18 D;  2RVQ C;  3LJA C;  2PYO C;  5B2J A;  3UTB A;  5DNM A;  1P3K C;  2F8N B;  1U35 D;  3W97 B;  5B0Z B;  5GT3 C;  4J8W C;  1HQ3 A;  3MNN C;  4J8U A;  3EPK A;  3AL0 C;  5BNV A;  5G49 B;  5B31 A;  4Z66 A;  3A1I A;  3V9R A;  3MGP B;  3AV1 C;  1F66 D;  3X1V D;  5AV8 A;  5AV6 C;  1WWS A;  3A6N C;  5GXQ C;  2PYO A;  3AZJ C;  1P3K A;  2YFW B;  4ZUX D;  4G92 C;  5B0Y A;  4NE3 A;  3EG5 B;  3MNN A;  3VH6 A;  1EQZ D;  5B40 A;  3AZL B;  4EO5 C;  3F6T A;  2ARO B;  1P3M B;  1TZY D;  4X23 A;  3B0D C;  5AVC A;  4LD9 D;  5GT0 D;  5JA4 A;  3R45 A;  5FUG A;  4AWL B;  1P3P D;  5B33 B;  3REI C;  1KX3 B;  5E5A D;  3AZM D;  1TAF A;  2NZD B;  3B6G B;  1M1A C;  4J8V C;  3X1T B;  3B0B A;  3VH5 T;  1P3I D;  4H9N A;  4CSR A;  3LZ0 B;  3AYW D;  5F99 C;  3WTP D;  2BYM B;  4H9P B;  4J8X A;  2YFV B;  5AY8 C;  1P3G B;  4Z2M G;  3REI A;  5BNX B;  3REL C;  1KX5 C;  2DF4 C;  1HQ3 D;  2Y2K A;  3AZH C;  1M1A A;  2JCH A;  2Y2N A;  3AYW B;  1F1E A;  2Y2G A;  4J8V A;  4WU8 B;  3AN2 A;  3W96 C;  3AZE D;  4WZS B;  5B2J B;  3AZK A;  5DNM B;  3WA9 C;  2F8N G;  4KUD C;  5B2I D;  4UPK A;  5BS7 C;  2RVQ D;  1HQ3 B;  3LJA D;  5AY8 A;  4J8U B;  3REH C;  5BNV B;  1Z2C B;  3KXB A;  3REL A;  5GT3 D;  4J8W D;  3REK D;  3B6F C;  5JRG C;  3MNN D;  4Z66 B;  5B31 B;  3V9R B;  5AVB A;  4G91 B;  1B6W A;  2F8N K;  5AV8 B;  4M6B A;  4WU9 A;  3AV1 D;  5G49 A;  2PYO B;  3C1C A;  1S32 D;  1P3K B;  5CPK C;  5AV6 D;  4KUD A;  3UTA D;  1M18 A;  3A6N D;  5B0Y B;  5BS7 A;  5GXQ D;  3MNN B;  1U35 A;  3AZJ D;  4ZUX C;  4ZBJ C;  2Y2J A;  4H9R A;  5B40 B;  4X23 B;  5AVC B;  1ID3 C;  5JA4 B;  3R45 B;  2JSS A;  5FUG B;  1F66 A;  3KUY C;  5GXQ B;  3X1V A;  2XD1 A;  1W2E A;  4LD9 C;  3WTP E;  1H3O A;  1TAF B;  1P3P C;  3REI D;  4H9Q A;  3VH5 A;  3AZM C;  3WAA C;  4ZUX A;  5DNN C;  4H9N B;  4CSR B;  1R4V A;  3B0C T;  1M1A D;  2HUE C;  4EO5 B;  4YM6 C;  3AZF C;  1EQZ A;  5CPI C;  5B1L D; 
#chains in the Genus database with same CATH homology
 1TZY A;  3KUY A;  5F99 D;  3WTP C;  4DQY B;  4XZQ D;  3REI B;  1PZR A;  5GT0 A;  4LD9 A;  3MVD C;  3KWQ C;  1P3P A;  3REJ C;  4KHA A;  1M1A B;  4H9P A;  5E5A A;  3AZM A;  4J8V B;  3AN2 B;  1KX5 D;  2YFV A;  4R8P D;  4Z2M H;  3AZH D;  4KGC C;  4H9S C;  1P3I A;  3AZE C;  3W96 D;  2HIO D;  1BFM A;  3AYW A;  2IO5 C;  5AY8 B;  3WTP A;  2CV5 C;  3WA9 D;  3KXB B;  3REL B;  3UT9 C;  4JJN D;  5CPJ C;  5B31 G;  2F8N H;  5AV5 D;  5AVB B;  2UWX A;  3REH D;  4Z5T D;  3REK C;  4UUZ A;  4WU9 B;  5JRG D;  3B6F D;  3W98 D;  3MGS C;  3C1C B;  4KUD B;  3EPH A;  3AZE A;  1T3U A;  1M18 B;  4XUJ C;  3AV2 D;  2BYK A;  2ZY5 A;  1S32 C;  5B1M D;  1U35 B;  4HGA C;  5CPK D;  3UTA C;  5B2I A;  4H9R B;  1AOI C;  3LJA A;  1N1J A;  5GT3 A;  5B32 D;  5AV9 C;  4J8W A;  3REK A;  1F66 B;  1BH8 A;  1ID3 D;  3X1V B;  4QLC C;  1H3O B;  5CPK B;  3AV1 A;  3KUY D;  3NQU A;  4H9Q B;  1S32 A;  5AV6 A;  4DRA A;  4ZUX B;  3UTA A;  4ZBJ B;  3A6N A;  1M19 C;  5GXQ A;  3AZJ A;  3WAA D;  1EQZ B;  5DNN D;  5CP6 C;  3MGQ C;  3X1S D;  4YM6 D;  1TZY B;  3AZF D;  3KUY B;  5CPI D;  4LD9 B;  5B1L C;  5GT0 B;  1ZLA D;  1P3P B;  2J8P A;  1P34 D;  4KHA B;  4XZQ C;  1KX4 C;  3EPJ A;  5B24 C;  5E5A B;  3C1B D;  3AZM B;  3KFU G;  5GSU C;  3MVD D;  3KWQ D;  3REJ D;  1P3O C;  4WJ3 C;  1P3A C;  3LEL C;  1P3B C;  4R8P C;  3W99 D;  1P3I B;  4CAY A;  3MGQ A;  4KGC D;  3WTP B;  1KU5 A;  5B1L A;  2HIO C;  4WV4 B;  3KWQ B;  3REJ B;  5F99 A;  4XZQ A;  2CV5 D;  3UT9 D;  4UUZ B;  4JJN C;  3AFA C;  5CPJ D;  2Y2M A;  5AV5 C;  4Z5T C;  3WKJ C;  1KX5 A;  4R8P A;  3AZE B;  3AZH A;  3W98 C;  3MGS D;  2LY8 A;  2BYK B;  5CHL B;  5B2I B;  3W96 A;  2HIO A;  4XUJ D;  3AV2 C;  3UT9 B;  3LJA B;  3AZN D;  1N1J B;  5B1M C;  3WA9 A;  3H0R C;  5GT3 B;  4J8W B;  3REK B;  1AOI D;  3FDD A;  5C3I C;  4JJN A;  2CWE A;  5AV5 A;  3REH A;  2XD5 A;  1BH8 B;  5B32 C;  4Z5T A;  5KDM A;  3MGP C;  5AV9 D;  2Y2I A;  3B6F A;  5JRG A;  3W98 A;  3AV1 B;  3MGR D;  3NQU B;  1S32 B;  4QLC D;  1P3F C;  5AV6 B;  4HGA B;  3UTA B;  3A6N B;  3AV2 A;  4YS3 D;  5B1M A;  3AZJ B;  5CPK A;  4G92 B;  5AV9 B;  1M19 D;  3AZL C;  1BH9 A;  2ARO C;  5B32 A;  5CP6 D;  3VH6 W;  3MGQ D;  3X1S C;  1HTA A;  4AWL C;  3B0D B;  1ID3 A;  1ZLA C;  1KX3 C;  1P34 C;  3TU4 D;  3A1K A;  3AZI C;  1KX4 D;  3C1B C;  2NZD C;  5B24 D;  5GSU D;  1P3O D;  3X1T C;  4CAY B;  4E44 A;  5CP6 B;  3LZ1 D;  3MGQ B;  1P3A D;  3LEL D;  3WAA A;  3LZ0 C;  1P3B D;  3W99 C;  5DNN A;  5B1L B;  3X1S A;  5BO0 A;  4YM6 A;  3AZF A;  5F99 B;  4XZQ B;  5CPI A;  1KX4 B;  2FJ7 D;  1ZLA A;  2RIQ A;  1P3G C;  5GSU B;  1P34 A;  3AZI A;  3C1B A;  3O62 C;  1B67 A;  1ULY A;  3MVD A;  3KWQ A;  3REJ A;  1P3L D;  4R8P B;  1KX5 B;  4WU8 C;  3AZH B;  3X1U D;  3AFA D;  3H0L C;  3AZG D;  3WKJ D;  3W99 A;  5B2J C;  3UTB C;  5DNM C;  3W96 B;  2HIO B;  2Y2P A;  4KGC A;  4H9S A;  3WA9 B;  3W97 D;  4J8U C;  2F8N D;  3AZN C;  5B0Z D;  4JJN B;  2CV5 A;  5AV5 B;  2Y2O A;  3REH B;  4Z5T B;  5KDM B;  3UT9 A;  3B6F B;  5JRG B;  5CPJ A;  3W98 B;  2DQN C;  2L5A A;  3MGP D;  3KSY A;  4DRB A;  3AV2 B;  2ZM5 A;  3MGS A;  3MGR C;  1P3F D;  5B1M B;  5B0Y C;  4H9O A;  4XUJ A;  4YS3 C;  3AZN A;  5C3I B;  3IP4 C;  5B40 C;  1WWI A;  1BH9 B;  5B32 B;  4X23 C;  1AOI A;  5AVC C;  1Q9C A;  3AZL D;  1ID3 B;  1JFI A;  2ARO D;  1P3F B;  1P3M D;  5AV9 A;  3MGR A;  4QLC A;  5BT1 D;  5B33 D;  1KX3 D;  3TU4 C;  3AZI D;  4YS3 A;  2NZD D;  3B6G D;  3WAA B;  2ZY2 A;  3VH5 W;  5DNN B;  2NQB C;  3X1T D;  3LZ1 C;  1M19 A;  3X1S B;  4WNN A;  2HUE B;  5BO0 B;  4YM6 B;  2Y2H A;  3LZ0 D;  4J8X C;  3AZF B;  5CPI B;  5CP6 A;  1ZLA B;  4E45 A;  1P34 B;  1A7W A;  3AZI B;  3C1B B;  2FJ7 C;  1P3G D;  3MVD B;  3TU4 A;  2JE5 A;  3AN2 C;  1KX4 A;  5B24 A;  5GSU A;  3O62 D;  2FFF B;  1P3L C;  3W99 B;  1P3O A;  2NQB A;  3AZK C;  3LZ1 A;  3X1U C;  4WU8 D;  1P3A A;  4KGC B;  3LEL A;  3AZG C;  1P3B A;  5B2J D;  3UTB D;  5DNM D;  3NQJ A;  3KXB C;  2IO5 B;  2CV5 B;  2G5H C;  2BG1 A;  2FJ7 A;  3W97 C;  4J8U D;  3O62 B;  5AVB C;  5B0Z C;  5CPJ B;  4WU9 C;  5B31 D;  4Z66 D;  1P3L A;  4NE5 A;  3C1C C;  3UTB B;  2Y2Q A;  5AV8 D;  3X1U A;  3AFA A;  3MGS B;  1M18 C;  3AZG A;  3WKJ A;  4H9O B;  2PYO D;  1U35 C;  4XUJ B;  1P3K D;  3AZN B;  2VQR A;  4NE6 A;  5B0Y D;  3W97 A;  2F8N A;  4NFT A;  5B32 G;  1AOI B;  5B0Z A;  5B40 D;  1JFI B;  1F66 C;  4X23 D;  5AVC D;  3X1V C;  3MGR B;  1P3M C;  4QLC B;  3MGP A;  4YS3 B;  3H0M C;  5BT1 C;  5B33 C;  1P3F A;  2YFW A;  1M19 B;  1EQZ C;  3B0C W;  4WNN B;  3B6G C;  2F2A C;  1TZY C;  2NQB D;  5GT0 C;  3AZL A;  3VH6 T;  4J8X D;  2ARO A;  1P3M A;  5E5A C;  3TU4 B;  5B24 B;  5B33 A;  2ZY3 A;  1KX3 A;  1P3O B;  2NQB B;  4J8V D;  3AN2 D;  3LZ1 B;  1P3A B;  1P3I C;  3LEL B;  3B6G A;  2NZD A;  4J8X B;  1P3B B;  3AYW C;  2Y2L A;  3X1T A;  3AZK D;  2W8S A;  3NQJ B;  3LZ0 A;  2FJ7 B;  5AY8 D;  2BYM A;  2G5I C;  3KXB D;  3REL D;  1HQ3 C;  1P3G A;  1P3L B;  5AVB D;  5BNX A;  3EPL A;  3AZK B;  3X1U B;  3AFA B;  4WU9 D;  5B31 C;  4Z66 C;  3O62 A;  3AZG B;  3WKJ B;  2ZY4 A;  4G91 C;  3C1C D;  5AV8 C;  4WU8 A;  4KUD D;  3P5J B;  5B2I C;  1M18 D;  2RVQ C;  3LJA C;  2PYO C;  5B2J A;  3UTB A;  5DNM A;  1P3K C;  2F8N B;  1U35 D;  3W97 B;  5B0Z B;  5GT3 C;  4J8W C;  1HQ3 A;  3MNN C;  4J8U A;  3EPK A;  3AL0 C;  5BNV A;  5G49 B;  5B31 A;  4Z66 A;  3A1I A;  3V9R A;  3MGP B;  3AV1 C;  1F66 D;  3X1V D;  5AV8 A;  5AV6 C;  1WWS A;  3A6N C;  5GXQ C;  2PYO A;  3AZJ C;  1P3K A;  2YFW B;  4ZUX D;  4G92 C;  5B0Y A;  4NE3 A;  3EG5 B;  3MNN A;  3VH6 A;  1EQZ D;  5B40 A;  3AZL B;  4EO5 C;  3F6T A;  2ARO B;  1P3M B;  1TZY D;  4X23 A;  3B0D C;  5AVC A;  4LD9 D;  5GT0 D;  5JA4 A;  3R45 A;  5FUG A;  4AWL B;  1P3P D;  5B33 B;  3REI C;  1KX3 B;  5E5A D;  3AZM D;  1TAF A;  2NZD B;  3B6G B;  1M1A C;  4J8V C;  3X1T B;  3B0B A;  3VH5 T;  1P3I D;  4H9N A;  4CSR A;  3LZ0 B;  3AYW D;  5F99 C;  3WTP D;  2BYM B;  4H9P B;  4J8X A;  2YFV B;  5AY8 C;  1P3G B;  4Z2M G;  3REI A;  5BNX B;  3REL C;  1KX5 C;  2DF4 C;  1HQ3 D;  2Y2K A;  3AZH C;  1M1A A;  2JCH A;  2Y2N A;  3AYW B;  1F1E A;  2Y2G A;  4J8V A;  4WU8 B;  3AN2 A;  3W96 C;  3AZE D;  4WZS B;  5B2J B;  3AZK A;  5DNM B;  3WA9 C;  2F8N G;  4KUD C;  5B2I D;  4UPK A;  5BS7 C;  2RVQ D;  1HQ3 B;  3LJA D;  5AY8 A;  4J8U B;  3REH C;  5BNV B;  1Z2C B;  3KXB A;  3REL A;  5GT3 D;  4J8W D;  3REK D;  3B6F C;  5JRG C;  3MNN D;  4Z66 B;  5B31 B;  3V9R B;  5AVB A;  4G91 B;  1B6W A;  2F8N K;  5AV8 B;  4M6B A;  4WU9 A;  3AV1 D;  5G49 A;  2PYO B;  3C1C A;  1S32 D;  1P3K B;  5CPK C;  5AV6 D;  4KUD A;  3UTA D;  1M18 A;  3A6N D;  5B0Y B;  5BS7 A;  5GXQ D;  3MNN B;  1U35 A;  3AZJ D;  4ZUX C;  4ZBJ C;  2Y2J A;  4H9R A;  5B40 B;  4X23 B;  5AVC B;  1ID3 C;  5JA4 B;  3R45 B;  2JSS A;  5FUG B;  1F66 A;  3KUY C;  5GXQ B;  3X1V A;  2XD1 A;  1W2E A;  4LD9 C;  3WTP E;  1H3O A;  1TAF B;  1P3P C;  3REI D;  4H9Q A;  3VH5 A;  3AZM C;  3WAA C;  4ZUX A;  5DNN C;  4H9N B;  4CSR B;  1R4V A;  3B0C T;  1M1A D;  2HUE C;  4EO5 B;  4YM6 C;  3AZF C;  1EQZ A;  5CPI C;  5B1L D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...