1P3FD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
91
structure length
91
Chain Sequence
ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
total genus 37
structure length 91
sequence length 91
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3fD00
5B33D 5B0ZD 5B32C 5BS7C 3W96B 1EQZC 3V9RA 3KUYD 2NZDD 3UTAB 1P3AD 4H9NB 4KHAB 5B31B 3NQUB 3MGSA 5B0ZA 4KUDC 1KX5A 3A6NA 4Z5TB 5AV8A 1WWIA 5AV5D 3AYWA 3AV1A 3AZEA 3KWQB 3AZIC 4R8PC 4DRBA 3X1VB 3LJAA 4H9SC 5B1MD 5AVBD 5B1LC 3VH6W 5AV9B 4R8PD 2CV5A 1ZLAB 5GT3B 3MGRA 3WA9D 3AZFA 3UTBB 5JA4B 3AZMC 2NQBB 3W99A 3AZKD 1KX4A 4E45A 1S32D 1P3AC 2BYMA 5C3IB 3LZ0B 4NE5A 5AY8D 5AV5A 1F1EA 3MGRB 5E5AC 3A6ND 3W96A 3X1UC 3AV2A 1M19B 3C1CC 3AN2C 5AVBC 3C1BB 3AV1B 4CAYB 3KUYA 3LELC 4WU9B 3MGPC 1P34B 3B0CT 4KHAA 5B31A 3AZMD 3MVDD 5E5AA 5F99B 4J8WA 5B31G 3MVDC 1HQ3C 1TZYD 3NQJA 1U35A 3X1TD 5BT1C 4XZQB 4CAYA 5B2ID 1P3KD 4WU8D 4WNNB 3UT9A 1AOIC 5B24B 3VH5A 5B2IC 1P3KC 1AOID 5AV9A 1P3LC 3W98C 2BYKB 3WTPB 3X1TC 2AROD 3REJA 5CP6C 3AV2B 1M18A 1BH9A 3WA9A 1U35C 4E44A 3AZGA 3W99B 3WAAA 1AOIA 5B1MA 4J8VA 5GT0A 3AZJC 2F8NA 3REIA 1TZYC 5DNMC 3MNNC 5KDMA 1WWSA 4KGCB 2LY8A 1BH9B 3WA9B 3V9RB 1M18C 3AZNC 5E5AD 1P3OA 1TZYB 5CPID 5B2JA 1P3PC 3O62B 5AV6B 1F66A 4CSRB 4J8UA 1P3MA 4XZQA 2FJ7C 1M18B 1P3OC 5AVCD 4QLCD 5AY8A 4Z66B 5B0YD 3AZKC 3O62A 3AZLD 4J8XD 1H3OA 1ID3A 4YS3D 3LJAB 4KUDB 2BYKA 4LD9D 5GSUA 1P3IA 3AZEB 1KX5C 3A6NC 4LD9C 3W97C 1JFIA 3MGQB 4Z66A 4R8PA 3X1TB 5GT0B 3LZ1A 5B2IB 1P3KB 2FJ7D 3B6FB 3AYWD 1P3IC 4EO5C 5B33C 3WKJD 5B32A 4WU9D 3MGSD 3X1SD 1KX4C 1P3AA 3VH6T 5F99C 3R45A 1N1JB 5B2JB 3LZ1C 3KUYB 3AN2D 2PYOC 4G92B 4KUDD 5B33A 5AV8C 1R4VA 3AV1C 3AZEC 1KX5B 4HGAB 1P3GC 3LJAC 3MGPA 5B32D 3UTBD 5JRGD 3VH5W 1ZLAD 3KXBB 4H9RB 2F8NK 3AYWB 3REID 3KWQA 2CV5B 3B6FD 3REKD 5BNXA 3RELB 3X1VD 5AV5C 5AV9C 1P3LA 3W98A 3C1CB 1P3BC 5FUGA 2F8NG 5B32B 2IO5C 5CP6A 2RVQC 1M1AC 4J8XA 5DNND 2NZDB 3KWQC 3R45B 3LZ0C 3AZIB 3AZLA 1ULYA 4QLCB 1TZYA 5B31C 5DNNB 3AFAB 4J8WD 1EQZB 1ZLAC 4H9QA 4JJNA 5B24D 5B2JD 3WTPC 4H9NA 4X23C 3KXBC 3X1SA 1P3GD 4WU9A 5CPIB 5DNNA 3REJC 3WKJA 4XZQC 3AZHB 5DNMB 1HQ3B 3REJB 1KX3B 3AZJB 1P3IB 1P34D 4AWLB 5GT0D 3AZGC 4DRAA 3X1VA 3B6GB 3REKA 3WAAD 2HIOC 3REHC 5B40C 3X1SC 5CP6B 4H9OB 4WU9C 4J8XB 3WKJC 5FUGB 3MGRD 4LD9B 3B6GC 2AROB 3W97A 3AZNA 5KDMB 5CHLB 4J8VB 5CPKD 1A7WA 1HTAA 1P3BD 2F8NB 1AOIB 5GXQD 2HUEB 3UTAA 5C3IC 3WAAB 5AVCA 5B0ZC 3B0DB 1P3OB 3WKJB 4ZUXB 1M19A 5CPJC 4XZQD 4NE6A 3MGPB 4J8UD 1P3MD 3MGQC 1F66D 3TU4B 1KU5A 5CPIA 3O62C 4ZBJC 5B0YC 5B1LB 2CV5C 4QLCC 4ZUXD 1B67A 2YFVA 3AZFC 5CPJA 4J8WB 5GXQA 3UTAD 3TU4A 4WNNA 5BO0A 1P3PD 1M1AB 4J8VD 1P3BB 3AZID 1TAFB 3W99D 2F8ND 5CPKA 5B0YB 4Z66D 4H9RA 3LZ0D 2YFVB 1P3FB 1M18D 3W96C 3X1UA 5AV8B 3AV2C 3C1CA 4H9PB 3AYWC 4UUZB 3B0BA 4YM6B 4ZUXC 5AVBA 3AZIA 5DNMD 5AV9D 4R8PB 3LZ1B 3KUYC 5AV6D 4YS3A 1BH8B 3AZJD 3TU4D 1P34A 5CPKC 4Z5TC 3MNNB 3AZFB 2IO5B 5JA4A 4HGAC 1P3GB 3MVDB 3AZMA 3W99C 5GXQB 4G91C 4Z5TD 5B31D 4XUJB 5JRGB 3UT9C 4G92C 1P34C 4Z5TA 4XUJC 3AFAD 1M19D 3AN2B 3A6NB 3W96D 5B33B 4H9OA 3B6FC 4J8VC 3AZJA 3AZKB 2CWEA 1S32A 4EO5B 3KXBA 5DNMA 3REKB 5GSUB 3MNNA 4YM6C 3C1CD 2FJ7B 1H3OB 1ID3B 3X1UD 2PYOB 3AZFD 5G49B 2AROA 3W97B 2BYMB 3LZ0A 3AFAC 5AVBB 3C1BC 1KX4B 2HIOA 3UT9D 1P3PA 3KWQD 5B2IA 1P3KA 1F66C 4J8UC 1P3MC 3X1TA 3B0CW 1KX5D 5G49A 1JFIB 3AFAA 3VH5T 3C1BA 5AY8B 2NZDA 4X23A 5B24A 3UTAC 5AV6C 1S32B 4WV4B 5DNNC 5GT3C 1U35B 3MGSB 5CPJB 4XUJD 5BS7A 3RELD 1EQZA 4Z66C 2NZDC 5B24C 5B40A 3REHA 5AV6A 1KX4D 1F66B 3MGSC 5GT3A 3AZND 3W97D 4YM6D 2FJ7A 3B6GA 1KX3A 3LZ1D 3TU4C 4M6BA 3AZHA 2L5AA 5AY8C 4Z2MG 4H9SA 5B40B 3REHB 3LJAD 2HIOB 1P3LB 3W98B 1P3FD 1M1AD 3AZED 1BH8A 5AVCC 4YS3B 1M19C 4LD9A 2YFWB 5JRGA 5B40D 3REHD 4ZUXA 4YS3C 3MGQA 1P3GA 5AVCB 4X23B 4WZSB 4WU8B 4NE3A 2F8NH 4KUDA 1HQ3D 4JJND 2YFWA 4G91B 3AN2A 5JRGC 1P3FC 5GXQC 4KGCD 4AWLC 3NQUA 3C1BD 5E5AB 5F99A 3MGQD 5B1LA 1P3OD 2PYOA 3MGRC 1P3BA 4J8WC 5CPKB 5BO0B 1M1AA 1P3FA 3UTBC 1P3LD 3AZLB 3W98D 3LELB 1TAFA 4ZBJB 3B6FA 3RELC 3WTPD 1S32C 2NQBA 1P3PB 3B6GD 2RVQD 4UUZA 4YM6A 1P3ID 3REJD 5GT3D 4H9PA 1ZLAA 3AZNB 3WTPE 4H9QB 3WA9C 4Z2MH 3O62D 3UTBA 5BNVA 3WAAC 3LELA 4WU8A 5B1LD 4CSRA 4J8UB 5B32G 3MGPD 5F99D 5BNXB 3RELA 3AZMB 1P3MB 2NQBC 4KGCA 4XUJA 2JSSA 5AV5B 3MVDA 1HQ3A 4J8XC 5BNVB 4X23D 3AZLC 3X1VC 4WU8C 3REKC 3NQJB 5B2JC 5BT1D 3LELD 3KSYA 4KGCC 5B0ZB 3VH6A 3AV2D 2HUEC 1Q9CA 4NFTA 5CP6D 4JJNC 2AROC 2HIOD 3WTPA 2NQBD 3AZKA 5B1MC 5GT0C 3AZGD 3REIC 3X1SB 3AZHD 1ID3C 3UT9B 5B1MB 5GSUC 1KX3D 3REIB 3B0DC 3MNND 1BFMA 5GSUD 1KX3C 2CV5D 3KXBD 4JJNB 3AZGB 3X1UB 2PYOD 3AZHC 1B6WA 1ID3D 5CPIC 5B0YA 3AV1D 1N1JA 1U35D 4QLCA 1EQZD 1P3AB 5AV8D 5CPJD
chains in the Genus database with same CATH superfamily
5B33D 5B0ZD 2ZM5A 5B32C 5BS7C 3W96B 1EQZC 3V9RA 3KUYD 2NZDD 3UTAB 1P3AD 4H9NB 4KHAB 5B31B 3NQUB 3MGSA 5B0ZA 4KUDC 1KX5A 3A6NA 4Z5TB 5AV8A 1WWIA 3A1KA 5AV5D 3AYWA 3AV1A 3H0RC 3AZEA 3KWQB 3AZIC 2FFFB 4R8PC 4DRBA 3X1VB 2Y2KA 3LJAA 4H9SC 5B1MD 5AVBD 5B1LC 3VH6W 5AV9B 4R8PD 2CV5A 1ZLAB 2Y2QA 5GT3B 2ZY3A 3MGRA 3WA9D 3AZFA 3UTBB 5JA4B 3AZMC 2NQBB 3W99A 3AZKD 1KX4A 4E45A 1S32D 1P3AC 2BYMA 5C3IB 3LZ0B 4NE5A 5AY8D 5AV5A 1F1EA 3MGRB 5E5AC 3A6ND 3EPLA 2ZY4A 3W96A 3X1UC 3AV2A 1M19B 3C1CC 3AN2C 2ZY5A 5AVBC 3C1BB 3AV1B 4CAYB 3KUYA 3LELC 4WU9B 3A1IA 3MGPC 1P34B 3B0CT 4KHAA 5B31A 3AZMD 3MVDD 5E5AA 5F99B 4J8WA 5B31G 3MVDC 1HQ3C 1TZYD 3NQJA 1U35A 3X1TD 5BT1C 4XZQB 4CAYA 5B2ID 1P3KD 4WU8D 4WNNB 3UT9A 1AOIC 5B24B 3VH5A 5B2IC 1P3KC 1AOID 2Y2LA 5AV9A 1P3LC 2BYKB 3W98C 3WTPB 3X1TC 2AROD 3REJA 5CP6C 3AV2B 1M18A 1BH9A 3WA9A 1U35C 4E44A 3AZGA 3W99B 3WAAA 1AOIA 5B1MA 4J8VA 5GT0A 3AZJC 2F8NA 3REIA 1TZYC 5DNMC 3MNNC 5KDMA 1WWSA 4KGCB 2LY8A 1BH9B 3WA9B 3V9RB 1M18C 3AZNC 5E5AD 1P3OA 1Z2CB 1TZYB 5CPID 5B2JA 1P3PC 3O62B 5AV6B 1F66A 4CSRB 3P5JB 4J8UA 1P3MA 4YS3A 2VQRA 4XZQA 2FJ7C 1M18B 1P3OC 5AVCD 4QLCD 5AY8A 4Z66B 5B0YD 3AZKC 2G5HC 3O62A 3AZLD 2UWXA 4J8XD 1H3OA 1ID3A 4YS3D 3LJAB 4KUDB 2BYKA 4LD9D 5GSUA 1P3IA 3AZEB 1KX5C 3A6NC 4LD9C 3W97C 1JFIA 3MGQB 4Z66A 4R8PA 3X1TB 5GT0B 3LZ1A 5B2IB 1P3KB 2FJ7D 3B6FB 3AYWD 1P3IC 4EO5C 4DQYB 5B33C 3WKJD 5B32A 4WU9D 3MGSD 3X1SD 1KX4C 1P3AA 3VH6T 5F99C 3R45A 1N1JB 5B2JB 2RIQA 3LZ1C 3KUYB 3AN2D 1T3UA 2PYOC 4G92B 4KUDD 5B33A 5AV8C 1R4VA 3AV1C 3AZEC 1KX5B 4HGAB 1P3GC 3LJAC 3MGPA 5B32D 3UTBD 5JRGD 3VH5W 1ZLAD 3KXBB 4H9RB 2F8NK 3AYWB 3EPJA 3REID 3KWQA 2CV5B 2BG1A 2Y2JA 3B6FD 3REKD 5BNXA 3RELB 3X1VD 5AV5C 5AV9C 1P3LA 3W98A 3C1CB 2Y2MA 1P3BC 5FUGA 2F8NG 5B32B 2IO5C 5CP6A 2RVQC 1M1AC 4J8XA 5DNND 2NZDB 3KWQC 3R45B 3LZ0C 3AZIB 3AZLA 3H0MC 1ULYA 4QLCB 1TZYA 5B31C 5DNNB 3AFAB 4J8WD 1EQZB 1ZLAC 4H9QA 4JJNA 5B24D 5B2JD 3WTPC 4H9NA 4X23C 3KXBC 3X1SA 1P3GD 4WU9A 5CPIB 5DNNA 3REJC 3WKJA 4XZQC 3AZHB 5DNMB 2Y2NA 3AL0C 1HQ3B 3IP4C 3REJB 1KX3B 3AZJB 1P3IB 1P34D 4AWLB 5GT0D 3AZGC 4DRAA 3X1VA 3B6GB 3REKA 3WAAD 2HIOC 3REHC 5B40C 3X1SC 5CP6B 4H9OB 4WU9C 4J8XB 3WKJC 5FUGB 3MGRD 4LD9B 3B6GC 2AROB 3W97A 3AZNA 5KDMB 5CHLB 4J8VB 5CPKD 1A7WA 1HTAA 1P3BD 2F8NB 1AOIB 5GXQD 2HUEB 3UTAA 5C3IC 3WAAB 5AVCA 5B0ZC 3B0DB 1P3OB 3WKJB 4ZUXB 1M19A 5CPJC 4XZQD 4NE6A 2DQNC 3MGPB 4J8UD 1P3MD 3MGQC 1F66D 3TU4B 1KU5A 5CPIA 3O62C 4ZBJC 5B0YC 5B1LB 2CV5C 4QLCC 4ZUXD 1B67A 2YFVA 3AZFC 5CPJA 3EPHA 4J8WB 5GXQA 3UTAD 3TU4A 2ZY2A 4WNNA 5BO0A 1P3PD 1M1AB 4J8VD 1P3BB 3AZID 1TAFB 3W99D 2F8ND 5CPKA 5B0YB 4Z66D 4H9RA 3H0LC 3LZ0D 2YFVB 1P3FB 1M18D 3W96C 3X1UA 5AV8B 3AV2C 3C1CA 4H9PB 2JCHA 3AYWC 4UUZB 3B0BA 4YM6B 2Y2IA 4ZUXC 5AVBA 5DNMD 5AV9D 4R8PB 3LZ1B 3KUYC 5AV6D 3AZIA 1BH8B 2JE5A 3AZJD 3TU4D 1P34A 5CPKC 3KFUG 4Z5TC 3MNNB 3AZFB 2IO5B 5JA4A 4HGAC 2W8SA 1P3GB 3MVDB 3AZMA 3W99C 5GXQB 4G91C 4Z5TD 5B31D 4XUJB 5JRGB 3UT9C 4G92C 2XD1A 1P34C 4Z5TA 4XUJC 3AFAD 4WJ3C 1M19D 3AN2B 3A6NB 3W96D 5B33B 4H9OA 3B6FC 4J8VC 3AZJA 3AZKB 2CWEA 1S32A 4EO5B 3KXBA 2DF4C 5DNMA 3REKB 5GSUB 3MNNA 4YM6C 3C1CD 2FJ7B 1H3OB 1ID3B 3X1UD 2PYOB 3AZFD 5G49B 2AROA 3W97B 1W2EA 2BYMB 3LZ0A 3AFAC 5AVBB 3C1BC 1KX4B 2HIOA 3UT9D 1P3PA 3KWQD 5B2IA 1P3KA 1F66C 4J8UC 1P3MC 3X1TA 3B0CW 1KX5D 5G49A 3FDDA 1JFIB 3AFAA 2G5IC 3VH5T 3C1BA 2J8PA 2XD5A 5AY8B 2NZDA 4X23A 5B24A 3UTAC 5AV6C 1S32B 2Y2HA 4WV4B 5DNNC 5GT3C 1U35B 3MGSB 5CPJB 4XUJD 5BS7A 3RELD 1EQZA 4Z66C 3F6TA 2NZDC 5B24C 5B40A 3REHA 5AV6A 1KX4D 1F66B 3MGSC 5GT3A 3AZND 3W97D 4YM6D 2FJ7A 2Y2OA 1KX3A 3B6GA 3LZ1D 3TU4C 4M6BA 3AZHA 2L5AA 5AY8C 4Z2MG 2Y2PA 4H9SA 2F2AC 5B40B 3REHB 3LJAD 2HIOB 1P3LB 3W98B 1P3FD 1M1AD 3AZED 1BH8A 5AVCC 4YS3B 1M19C 4LD9A 2YFWB 5JRGA 5B40D 3REHD 4ZUXA 4YS3C 3MGQA 1P3GA 5AVCB 4X23B 4WZSB 4WU8B 4NE3A 2F8NH 4KUDA 1HQ3D 4JJND 2YFWA 4G91B 3AN2A 5JRGC 1P3FC 5GXQC 4KGCD 4AWLC 3NQUA 3C1BD 5E5AB 5F99A 3MGQD 5B1LA 1P3OD 2PYOA 4UPKA 3MGRC 1P3BA 4J8WC 5CPKB 5BO0B 1M1AA 1P3FA 3UTBC 1P3LD 3AZLB 3W98D 3LELB 1TAFA 4ZBJB 3B6FA 3RELC 3WTPD 1S32C 2NQBA 1P3PB 3B6GD 2RVQD 4UUZA 4YM6A 1P3ID 3REJD 5GT3D 4H9PA 1ZLAA 3AZNB 3WTPE 4H9QB 3WA9C 4Z2MH 3O62D 3UTBA 5BNVA 3WAAC 3LELA 4WU8A 5B1LD 4CSRA 4J8UB 5B32G 3MGPD 5F99D 5BNXB 3RELA 3AZMB 1P3MB 2NQBC 4KGCA 4XUJA 2JSSA 5AV5B 3MVDA 1HQ3A 4J8XC 3EPKA 5BNVB 4X23D 3AZLC 3X1VC 4WU8C 3REKC 3NQJB 5B2JC 5BT1D 3LELD 1PZRA 2Y2GA 3KSYA 4KGCC 5B0ZB 3VH6A 3AV2D 2HUEC 1Q9CA 4NFTA 5CP6D 4JJNC 2AROC 2HIOD 3WTPA 2NQBD 3AZKA 5B1MC 5GT0C 3AZGD 3REIC 3X1SB 3AZHD 1ID3C 3UT9B 5B1MB 5GSUC 1KX3D 3REIB 3B0DC 3MNND 1BFMA 5GSUD 1KX3C 2CV5D 3KXBD 4JJNB 3AZGB 3X1UB 2PYOD 3AZHC 1B6WA 1ID3D 5CPIC 5B0YA 3EG5B 3AV1D 1N1JA 1U35D 4QLCA 1EQZD 1P3AB 5AV8D 5CPJD
chains in the Genus database with same CATH topology
5B33D 5B0ZD 2ZM5A 5B32C 5BS7C 3W96B 1EQZC 3V9RA 3KUYD 2NZDD 3UTAB 1P3AD 4H9NB 4KHAB 5B31B 3NQUB 3MGSA 5B0ZA 4KUDC 1KX5A 3A6NA 4Z5TB 5AV8A 1WWIA 3A1KA 5AV5D 3AYWA 3AV1A 3H0RC 3AZEA 3KWQB 3AZIC 2FFFB 4R8PC 4DRBA 3X1VB 2Y2KA 3LJAA 4H9SC 5B1MD 5AVBD 5B1LC 3VH6W 5AV9B 4R8PD 2CV5A 1ZLAB 2Y2QA 5GT3B 2ZY3A 3MGRA 3WA9D 3AZFA 3UTBB 5JA4B 3AZMC 2NQBB 3W99A 3AZKD 1KX4A 4E45A 1S32D 1P3AC 2BYMA 5C3IB 3LZ0B 4NE5A 5AY8D 5AV5A 1F1EA 3MGRB 5E5AC 3A6ND 3EPLA 2ZY4A 3W96A 3X1UC 3AV2A 1M19B 3C1CC 3AN2C 2ZY5A 5AVBC 3C1BB 3AV1B 4CAYB 3KUYA 3LELC 4WU9B 3A1IA 3MGPC 1P34B 3B0CT 4KHAA 5B31A 3AZMD 3MVDD 5E5AA 5F99B 4J8WA 5B31G 3MVDC 1HQ3C 1TZYD 3NQJA 1U35A 3X1TD 5BT1C 4XZQB 4CAYA 5B2ID 1P3KD 4WU8D 4WNNB 3UT9A 1AOIC 5B24B 3VH5A 5B2IC 1P3KC 1AOID 2Y2LA 5AV9A 1P3LC 2BYKB 3W98C 3WTPB 3X1TC 2AROD 3REJA 5CP6C 3AV2B 1M18A 1BH9A 3WA9A 1U35C 4E44A 3AZGA 3W99B 3WAAA 1AOIA 5B1MA 4J8VA 5GT0A 3AZJC 2F8NA 3REIA 1TZYC 5DNMC 3MNNC 5KDMA 1WWSA 4KGCB 2LY8A 1BH9B 3WA9B 3V9RB 1M18C 3AZNC 5E5AD 1P3OA 1Z2CB 1TZYB 5CPID 5B2JA 1P3PC 3O62B 5AV6B 1F66A 4CSRB 3P5JB 4J8UA 1P3MA 4YS3A 2VQRA 4XZQA 2FJ7C 1M18B 1P3OC 5AVCD 4QLCD 5AY8A 4Z66B 5B0YD 3AZKC 2G5HC 3O62A 3AZLD 2UWXA 4J8XD 1H3OA 1ID3A 4YS3D 3LJAB 4KUDB 2BYKA 4LD9D 5GSUA 1P3IA 3AZEB 1KX5C 3A6NC 4LD9C 3W97C 1JFIA 3MGQB 4Z66A 4R8PA 3X1TB 5GT0B 3LZ1A 5B2IB 1P3KB 2FJ7D 3B6FB 3AYWD 1P3IC 4EO5C 4DQYB 5B33C 3WKJD 5B32A 4WU9D 3MGSD 3X1SD 1KX4C 1P3AA 3VH6T 5F99C 3R45A 1N1JB 5B2JB 2RIQA 3LZ1C 3KUYB 3AN2D 1T3UA 2PYOC 4G92B 4KUDD 5B33A 5AV8C 1R4VA 3AV1C 3AZEC 1KX5B 4HGAB 1P3GC 3LJAC 3MGPA 5B32D 3UTBD 5JRGD 3VH5W 1ZLAD 3KXBB 4H9RB 2F8NK 3AYWB 3EPJA 3REID 3KWQA 2CV5B 2BG1A 2Y2JA 3B6FD 3REKD 5BNXA 3RELB 3X1VD 5AV5C 5AV9C 1P3LA 3W98A 3C1CB 2Y2MA 1P3BC 5FUGA 2F8NG 5B32B 2IO5C 5CP6A 2RVQC 1M1AC 4J8XA 5DNND 2NZDB 3KWQC 3R45B 3LZ0C 3AZIB 3AZLA 3H0MC 1ULYA 4QLCB 1TZYA 5B31C 5DNNB 3AFAB 4J8WD 1EQZB 1ZLAC 4H9QA 4JJNA 5B24D 5B2JD 3WTPC 4H9NA 4X23C 3KXBC 3X1SA 1P3GD 4WU9A 5CPIB 5DNNA 3REJC 3WKJA 4XZQC 3AZHB 5DNMB 2Y2NA 3AL0C 1HQ3B 3IP4C 3REJB 1KX3B 3AZJB 1P3IB 1P34D 4AWLB 5GT0D 3AZGC 4DRAA 3X1VA 3B6GB 3REKA 3WAAD 2HIOC 3REHC 5B40C 3X1SC 5CP6B 4H9OB 4WU9C 4J8XB 3WKJC 5FUGB 3MGRD 4LD9B 3B6GC 2AROB 3W97A 3AZNA 5KDMB 5CHLB 4J8VB 5CPKD 1A7WA 1HTAA 1P3BD 2F8NB 1AOIB 5GXQD 2HUEB 3UTAA 5C3IC 3WAAB 5AVCA 5B0ZC 3B0DB 1P3OB 3WKJB 4ZUXB 1M19A 5CPJC 4XZQD 4NE6A 2DQNC 3MGPB 4J8UD 1P3MD 3MGQC 1F66D 3TU4B 1KU5A 5CPIA 3O62C 4ZBJC 5B0YC 5B1LB 2CV5C 4QLCC 4ZUXD 1B67A 2YFVA 3AZFC 5CPJA 3EPHA 4J8WB 5GXQA 3UTAD 3TU4A 2ZY2A 4WNNA 5BO0A 1P3PD 1M1AB 4J8VD 1P3BB 3AZID 1TAFB 3W99D 2F8ND 5CPKA 5B0YB 4Z66D 4H9RA 3H0LC 3LZ0D 2YFVB 1P3FB 1M18D 3W96C 3X1UA 5AV8B 3AV2C 3C1CA 4H9PB 2JCHA 3AYWC 4UUZB 3B0BA 4YM6B 2Y2IA 4ZUXC 5AVBA 5DNMD 5AV9D 4R8PB 3LZ1B 3KUYC 5AV6D 3AZIA 1BH8B 2JE5A 3AZJD 3TU4D 1P34A 5CPKC 3KFUG 4Z5TC 3MNNB 3AZFB 2IO5B 5JA4A 4HGAC 2W8SA 1P3GB 3MVDB 3AZMA 3W99C 5GXQB 4G91C 4Z5TD 5B31D 4XUJB 5JRGB 3UT9C 4G92C 2XD1A 1P34C 4Z5TA 4XUJC 3AFAD 4WJ3C 1M19D 3AN2B 3A6NB 3W96D 5B33B 4H9OA 3B6FC 4J8VC 3AZJA 3AZKB 2CWEA 1S32A 4EO5B 3KXBA 2DF4C 5DNMA 3REKB 5GSUB 3MNNA 4YM6C 3C1CD 2FJ7B 1H3OB 1ID3B 3X1UD 2PYOB 3AZFD 5G49B 2AROA 3W97B 1W2EA 2BYMB 3LZ0A 3AFAC 5AVBB 3C1BC 1KX4B 2HIOA 3UT9D 1P3PA 3KWQD 5B2IA 1P3KA 1F66C 4J8UC 1P3MC 3X1TA 3B0CW 1KX5D 5G49A 3FDDA 1JFIB 3AFAA 2G5IC 3VH5T 3C1BA 2J8PA 2XD5A 5AY8B 2NZDA 4X23A 5B24A 3UTAC 5AV6C 1S32B 2Y2HA 4WV4B 5DNNC 5GT3C 1U35B 3MGSB 5CPJB 4XUJD 5BS7A 3RELD 1EQZA 4Z66C 3F6TA 2NZDC 5B24C 5B40A 3REHA 5AV6A 1KX4D 1F66B 3MGSC 5GT3A 3AZND 3W97D 4YM6D 2FJ7A 2Y2OA 1KX3A 3B6GA 3LZ1D 3TU4C 4M6BA 3AZHA 2L5AA 5AY8C 4Z2MG 2Y2PA 4H9SA 2F2AC 5B40B 3REHB 3LJAD 2HIOB 1P3LB 3W98B 1P3FD 1M1AD 3AZED 1BH8A 5AVCC 4YS3B 1M19C 4LD9A 2YFWB 5JRGA 5B40D 3REHD 4ZUXA 4YS3C 3MGQA 1P3GA 5AVCB 4X23B 4WZSB 4WU8B 4NE3A 2F8NH 4KUDA 1HQ3D 4JJND 2YFWA 4G91B 3AN2A 5JRGC 1P3FC 5GXQC 4KGCD 4AWLC 3NQUA 3C1BD 5E5AB 5F99A 3MGQD 5B1LA 1P3OD 2PYOA 4UPKA 3MGRC 1P3BA 4J8WC 5CPKB 5BO0B 1M1AA 1P3FA 3UTBC 1P3LD 3AZLB 3W98D 3LELB 1TAFA 4ZBJB 3B6FA 3RELC 3WTPD 1S32C 2NQBA 1P3PB 3B6GD 2RVQD 4UUZA 4YM6A 1P3ID 3REJD 5GT3D 4H9PA 1ZLAA 3AZNB 3WTPE 4H9QB 3WA9C 4Z2MH 3O62D 3UTBA 5BNVA 3WAAC 3LELA 4WU8A 5B1LD 4CSRA 4J8UB 5B32G 3MGPD 5F99D 5BNXB 3RELA 3AZMB 1P3MB 2NQBC 4KGCA 4XUJA 2JSSA 5AV5B 3MVDA 1HQ3A 4J8XC 3EPKA 5BNVB 4X23D 3AZLC 3X1VC 4WU8C 3REKC 3NQJB 5B2JC 5BT1D 3LELD 1PZRA 2Y2GA 3KSYA 4KGCC 5B0ZB 3VH6A 3AV2D 2HUEC 1Q9CA 4NFTA 5CP6D 4JJNC 2AROC 2HIOD 3WTPA 2NQBD 3AZKA 5B1MC 5GT0C 3AZGD 3REIC 3X1SB 3AZHD 1ID3C 3UT9B 5B1MB 5GSUC 1KX3D 3REIB 3B0DC 3MNND 1BFMA 5GSUD 1KX3C 2CV5D 3KXBD 4JJNB 3AZGB 3X1UB 2PYOD 3AZHC 1B6WA 1ID3D 5CPIC 5B0YA 3EG5B 3AV1D 1N1JA 1U35D 4QLCA 1EQZD 1P3AB 5AV8D 5CPJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B33 D;  5B0Z D;  5B32 C;  5BS7 C;  3W96 B;  1EQZ C;  3V9R A;  3KUY D;  2NZD D;  3UTA B;  1P3A D;  4H9N B;  4KHA B;  5B31 B;  3NQU B;  3MGS A;  5B0Z A;  4KUD C;  1KX5 A;  3A6N A;  4Z5T B;  5AV8 A;  1WWI A;  5AV5 D;  3AYW A;  3AV1 A;  3AZE A;  3KWQ B;  3AZI C;  4R8P C;  4DRB A;  3X1V B;  3LJA A;  4H9S C;  5B1M D;  5AVB D;  5B1L C;  3VH6 W;  5AV9 B;  4R8P D;  2CV5 A;  1ZLA B;  5GT3 B;  3MGR A;  3WA9 D;  3AZF A;  3UTB B;  5JA4 B;  3AZM C;  2NQB B;  3W99 A;  3AZK D;  1KX4 A;  4E45 A;  1S32 D;  1P3A C;  2BYM A;  5C3I B;  3LZ0 B;  4NE5 A;  5AY8 D;  5AV5 A;  1F1E A;  3MGR B;  5E5A C;  3A6N D;  3W96 A;  3X1U C;  3AV2 A;  1M19 B;  3C1C C;  3AN2 C;  5AVB C;  3C1B B;  3AV1 B;  4CAY B;  3KUY A;  3LEL C;  4WU9 B;  3MGP C;  1P34 B;  3B0C T;  4KHA A;  5B31 A;  3AZM D;  3MVD D;  5E5A A;  5F99 B;  4J8W A;  5B31 G;  3MVD C;  1HQ3 C;  1TZY D;  3NQJ A;  1U35 A;  3X1T D;  5BT1 C;  4XZQ B;  4CAY A;  5B2I D;  1P3K D;  4WU8 D;  4WNN B;  3UT9 A;  1AOI C;  5B24 B;  3VH5 A;  5B2I C;  1P3K C;  1AOI D;  5AV9 A;  1P3L C;  3W98 C;  2BYK B;  3WTP B;  3X1T C;  2ARO D;  3REJ A;  5CP6 C;  3AV2 B;  1M18 A;  1BH9 A;  3WA9 A;  1U35 C;  4E44 A;  3AZG A;  3W99 B;  3WAA A;  1AOI A;  5B1M A;  4J8V A;  5GT0 A;  3AZJ C;  2F8N A;  3REI A;  1TZY C;  5DNM C;  3MNN C;  5KDM A;  1WWS A;  4KGC B;  2LY8 A;  1BH9 B;  3WA9 B;  3V9R B;  1M18 C;  3AZN C;  5E5A D;  1P3O A;  1TZY B;  5CPI D;  5B2J A;  1P3P C;  3O62 B;  5AV6 B;  1F66 A;  4CSR B;  4J8U A;  1P3M A;  4XZQ A;  2FJ7 C;  1M18 B;  1P3O C;  5AVC D;  4QLC D;  5AY8 A;  4Z66 B;  5B0Y D;  3AZK C;  3O62 A;  3AZL D;  4J8X D;  1H3O A;  1ID3 A;  4YS3 D;  3LJA B;  4KUD B;  2BYK A;  4LD9 D;  5GSU A;  1P3I A;  3AZE B;  1KX5 C;  3A6N C;  4LD9 C;  3W97 C;  1JFI A;  3MGQ B;  4Z66 A;  4R8P A;  3X1T B;  5GT0 B;  3LZ1 A;  5B2I B;  1P3K B;  2FJ7 D;  3B6F B;  3AYW D;  1P3I C;  4EO5 C;  5B33 C;  3WKJ D;  5B32 A;  4WU9 D;  3MGS D;  3X1S D;  1KX4 C;  1P3A A;  3VH6 T;  5F99 C;  3R45 A;  1N1J B;  5B2J B;  3LZ1 C;  3KUY B;  3AN2 D;  2PYO C;  4G92 B;  4KUD D;  5B33 A;  5AV8 C;  1R4V A;  3AV1 C;  3AZE C;  1KX5 B;  4HGA B;  1P3G C;  3LJA C;  3MGP A;  5B32 D;  3UTB D;  5JRG D;  3VH5 W;  1ZLA D;  3KXB B;  4H9R B;  2F8N K;  3AYW B;  3REI D;  3KWQ A;  2CV5 B;  3B6F D;  3REK D;  5BNX A;  3REL B;  3X1V D;  5AV5 C;  5AV9 C;  1P3L A;  3W98 A;  3C1C B;  1P3B C;  5FUG A;  2F8N G;  5B32 B;  2IO5 C;  5CP6 A;  2RVQ C;  1M1A C;  4J8X A;  5DNN D;  2NZD B;  3KWQ C;  3R45 B;  3LZ0 C;  3AZI B;  3AZL A;  1ULY A;  4QLC B;  1TZY A;  5B31 C;  5DNN B;  3AFA B;  4J8W D;  1EQZ B;  1ZLA C;  4H9Q A;  4JJN A;  5B24 D;  5B2J D;  3WTP C;  4H9N A;  4X23 C;  3KXB C;  3X1S A;  1P3G D;  4WU9 A;  5CPI B;  5DNN A;  3REJ C;  3WKJ A;  4XZQ C;  3AZH B;  5DNM B;  1HQ3 B;  3REJ B;  1KX3 B;  3AZJ B;  1P3I B;  1P34 D;  4AWL B;  5GT0 D;  3AZG C;  4DRA A;  3X1V A;  3B6G B;  3REK A;  3WAA D;  2HIO C;  3REH C;  5B40 C;  3X1S C;  5CP6 B;  4H9O B;  4WU9 C;  4J8X B;  3WKJ C;  5FUG B;  3MGR D;  4LD9 B;  3B6G C;  2ARO B;  3W97 A;  3AZN A;  5KDM B;  5CHL B;  4J8V B;  5CPK D;  1A7W A;  1HTA A;  1P3B D;  2F8N B;  1AOI B;  5GXQ D;  2HUE B;  3UTA A;  5C3I C;  3WAA B;  5AVC A;  5B0Z C;  3B0D B;  1P3O B;  3WKJ B;  4ZUX B;  1M19 A;  5CPJ C;  4XZQ D;  4NE6 A;  3MGP B;  4J8U D;  1P3M D;  3MGQ C;  1F66 D;  3TU4 B;  1KU5 A;  5CPI A;  3O62 C;  4ZBJ C;  5B0Y C;  5B1L B;  2CV5 C;  4QLC C;  4ZUX D;  1B67 A;  2YFV A;  3AZF C;  5CPJ A;  4J8W B;  5GXQ A;  3UTA D;  3TU4 A;  4WNN A;  5BO0 A;  1P3P D;  1M1A B;  4J8V D;  1P3B B;  3AZI D;  1TAF B;  3W99 D;  2F8N D;  5CPK A;  5B0Y B;  4Z66 D;  4H9R A;  3LZ0 D;  2YFV B;  1P3F B;  1M18 D;  3W96 C;  3X1U A;  5AV8 B;  3AV2 C;  3C1C A;  4H9P B;  3AYW C;  4UUZ B;  3B0B A;  4YM6 B;  4ZUX C;  5AVB A;  3AZI A;  5DNM D;  5AV9 D;  4R8P B;  3LZ1 B;  3KUY C;  5AV6 D;  4YS3 A;  1BH8 B;  3AZJ D;  3TU4 D;  1P34 A;  5CPK C;  4Z5T C;  3MNN B;  3AZF B;  2IO5 B;  5JA4 A;  4HGA C;  1P3G B;  3MVD B;  3AZM A;  3W99 C;  5GXQ B;  4G91 C;  4Z5T D;  5B31 D;  4XUJ B;  5JRG B;  3UT9 C;  4G92 C;  1P34 C;  4Z5T A;  4XUJ C;  3AFA D;  1M19 D;  3AN2 B;  3A6N B;  3W96 D;  5B33 B;  4H9O A;  3B6F C;  4J8V C;  3AZJ A;  3AZK B;  2CWE A;  1S32 A;  4EO5 B;  3KXB A;  5DNM A;  3REK B;  5GSU B;  3MNN A;  4YM6 C;  3C1C D;  2FJ7 B;  1H3O B;  1ID3 B;  3X1U D;  2PYO B;  3AZF D;  5G49 B;  2ARO A;  3W97 B;  2BYM B;  3LZ0 A;  3AFA C;  5AVB B;  3C1B C;  1KX4 B;  2HIO A;  3UT9 D;  1P3P A;  3KWQ D;  5B2I A;  1P3K A;  1F66 C;  4J8U C;  1P3M C;  3X1T A;  3B0C W;  1KX5 D;  5G49 A;  1JFI B;  3AFA A;  3VH5 T;  3C1B A;  5AY8 B;  2NZD A;  4X23 A;  5B24 A;  3UTA C;  5AV6 C;  1S32 B;  4WV4 B;  5DNN C;  5GT3 C;  1U35 B;  3MGS B;  5CPJ B;  4XUJ D;  5BS7 A;  3REL D;  1EQZ A;  4Z66 C;  2NZD C;  5B24 C;  5B40 A;  3REH A;  5AV6 A;  1KX4 D;  1F66 B;  3MGS C;  5GT3 A;  3AZN D;  3W97 D;  4YM6 D;  2FJ7 A;  3B6G A;  1KX3 A;  3LZ1 D;  3TU4 C;  4M6B A;  3AZH A;  2L5A A;  5AY8 C;  4Z2M G;  4H9S A;  5B40 B;  3REH B;  3LJA D;  2HIO B;  1P3L B;  3W98 B;  1P3F D;  1M1A D;  3AZE D;  1BH8 A;  5AVC C;  4YS3 B;  1M19 C;  4LD9 A;  2YFW B;  5JRG A;  5B40 D;  3REH D;  4ZUX A;  4YS3 C;  3MGQ A;  1P3G A;  5AVC B;  4X23 B;  4WZS B;  4WU8 B;  4NE3 A;  2F8N H;  4KUD A;  1HQ3 D;  4JJN D;  2YFW A;  4G91 B;  3AN2 A;  5JRG C;  1P3F C;  5GXQ C;  4KGC D;  4AWL C;  3NQU A;  3C1B D;  5E5A B;  5F99 A;  3MGQ D;  5B1L A;  1P3O D;  2PYO A;  3MGR C;  1P3B A;  4J8W C;  5CPK B;  5BO0 B;  1M1A A;  1P3F A;  3UTB C;  1P3L D;  3AZL B;  3W98 D;  3LEL B;  1TAF A;  4ZBJ B;  3B6F A;  3REL C;  3WTP D;  1S32 C;  2NQB A;  1P3P B;  3B6G D;  2RVQ D;  4UUZ A;  4YM6 A;  1P3I D;  3REJ D;  5GT3 D;  4H9P A;  1ZLA A;  3AZN B;  3WTP E;  4H9Q B;  3WA9 C;  4Z2M H;  3O62 D;  3UTB A;  5BNV A;  3WAA C;  3LEL A;  4WU8 A;  5B1L D;  4CSR A;  4J8U B;  5B32 G;  3MGP D;  5F99 D;  5BNX B;  3REL A;  3AZM B;  1P3M B;  2NQB C;  4KGC A;  4XUJ A;  2JSS A;  5AV5 B;  3MVD A;  1HQ3 A;  4J8X C;  5BNV B;  4X23 D;  3AZL C;  3X1V C;  4WU8 C;  3REK C;  3NQJ B;  5B2J C;  5BT1 D;  3LEL D;  3KSY A;  4KGC C;  5B0Z B;  3VH6 A;  3AV2 D;  2HUE C;  1Q9C A;  4NFT A;  5CP6 D;  4JJN C;  2ARO C;  2HIO D;  3WTP A;  2NQB D;  3AZK A;  5B1M C;  5GT0 C;  3AZG D;  3REI C;  3X1S B;  3AZH D;  1ID3 C;  3UT9 B;  5B1M B;  5GSU C;  1KX3 D;  3REI B;  3B0D C;  3MNN D;  1BFM A;  5GSU D;  1KX3 C;  2CV5 D;  3KXB D;  4JJN B;  3AZG B;  3X1U B;  2PYO D;  3AZH C;  1B6W A;  1ID3 D;  5CPI C;  5B0Y A;  3AV1 D;  1N1J A;  1U35 D;  4QLC A;  1EQZ D;  1P3A B;  5AV8 D;  5CPJ D; 
#chains in the Genus database with same CATH topology
 5B33 D;  5B0Z D;  2ZM5 A;  5B32 C;  5BS7 C;  3W96 B;  1EQZ C;  3V9R A;  3KUY D;  2NZD D;  3UTA B;  1P3A D;  4H9N B;  4KHA B;  5B31 B;  3NQU B;  3MGS A;  5B0Z A;  4KUD C;  1KX5 A;  3A6N A;  4Z5T B;  5AV8 A;  1WWI A;  3A1K A;  5AV5 D;  3AYW A;  3AV1 A;  3H0R C;  3AZE A;  3KWQ B;  3AZI C;  2FFF B;  4R8P C;  4DRB A;  3X1V B;  2Y2K A;  3LJA A;  4H9S C;  5B1M D;  5AVB D;  5B1L C;  3VH6 W;  5AV9 B;  4R8P D;  2CV5 A;  1ZLA B;  2Y2Q A;  5GT3 B;  2ZY3 A;  3MGR A;  3WA9 D;  3AZF A;  3UTB B;  5JA4 B;  3AZM C;  2NQB B;  3W99 A;  3AZK D;  1KX4 A;  4E45 A;  1S32 D;  1P3A C;  2BYM A;  5C3I B;  3LZ0 B;  4NE5 A;  5AY8 D;  5AV5 A;  1F1E A;  3MGR B;  5E5A C;  3A6N D;  3EPL A;  2ZY4 A;  3W96 A;  3X1U C;  3AV2 A;  1M19 B;  3C1C C;  3AN2 C;  2ZY5 A;  5AVB C;  3C1B B;  3AV1 B;  4CAY B;  3KUY A;  3LEL C;  4WU9 B;  3A1I A;  3MGP C;  1P34 B;  3B0C T;  4KHA A;  5B31 A;  3AZM D;  3MVD D;  5E5A A;  5F99 B;  4J8W A;  5B31 G;  3MVD C;  1HQ3 C;  1TZY D;  3NQJ A;  1U35 A;  3X1T D;  5BT1 C;  4XZQ B;  4CAY A;  5B2I D;  1P3K D;  4WU8 D;  4WNN B;  3UT9 A;  1AOI C;  5B24 B;  3VH5 A;  5B2I C;  1P3K C;  1AOI D;  2Y2L A;  5AV9 A;  1P3L C;  2BYK B;  3W98 C;  3WTP B;  3X1T C;  2ARO D;  3REJ A;  5CP6 C;  3AV2 B;  1M18 A;  1BH9 A;  3WA9 A;  1U35 C;  4E44 A;  3AZG A;  3W99 B;  3WAA A;  1AOI A;  5B1M A;  4J8V A;  5GT0 A;  3AZJ C;  2F8N A;  3REI A;  1TZY C;  5DNM C;  3MNN C;  5KDM A;  1WWS A;  4KGC B;  2LY8 A;  1BH9 B;  3WA9 B;  3V9R B;  1M18 C;  3AZN C;  5E5A D;  1P3O A;  1Z2C B;  1TZY B;  5CPI D;  5B2J A;  1P3P C;  3O62 B;  5AV6 B;  1F66 A;  4CSR B;  3P5J B;  4J8U A;  1P3M A;  4YS3 A;  2VQR A;  4XZQ A;  2FJ7 C;  1M18 B;  1P3O C;  5AVC D;  4QLC D;  5AY8 A;  4Z66 B;  5B0Y D;  3AZK C;  2G5H C;  3O62 A;  3AZL D;  2UWX A;  4J8X D;  1H3O A;  1ID3 A;  4YS3 D;  3LJA B;  4KUD B;  2BYK A;  4LD9 D;  5GSU A;  1P3I A;  3AZE B;  1KX5 C;  3A6N C;  4LD9 C;  3W97 C;  1JFI A;  3MGQ B;  4Z66 A;  4R8P A;  3X1T B;  5GT0 B;  3LZ1 A;  5B2I B;  1P3K B;  2FJ7 D;  3B6F B;  3AYW D;  1P3I C;  4EO5 C;  4DQY B;  5B33 C;  3WKJ D;  5B32 A;  4WU9 D;  3MGS D;  3X1S D;  1KX4 C;  1P3A A;  3VH6 T;  5F99 C;  3R45 A;  1N1J B;  5B2J B;  2RIQ A;  3LZ1 C;  3KUY B;  3AN2 D;  1T3U A;  2PYO C;  4G92 B;  4KUD D;  5B33 A;  5AV8 C;  1R4V A;  3AV1 C;  3AZE C;  1KX5 B;  4HGA B;  1P3G C;  3LJA C;  3MGP A;  5B32 D;  3UTB D;  5JRG D;  3VH5 W;  1ZLA D;  3KXB B;  4H9R B;  2F8N K;  3AYW B;  3EPJ A;  3REI D;  3KWQ A;  2CV5 B;  2BG1 A;  2Y2J A;  3B6F D;  3REK D;  5BNX A;  3REL B;  3X1V D;  5AV5 C;  5AV9 C;  1P3L A;  3W98 A;  3C1C B;  2Y2M A;  1P3B C;  5FUG A;  2F8N G;  5B32 B;  2IO5 C;  5CP6 A;  2RVQ C;  1M1A C;  4J8X A;  5DNN D;  2NZD B;  3KWQ C;  3R45 B;  3LZ0 C;  3AZI B;  3AZL A;  3H0M C;  1ULY A;  4QLC B;  1TZY A;  5B31 C;  5DNN B;  3AFA B;  4J8W D;  1EQZ B;  1ZLA C;  4H9Q A;  4JJN A;  5B24 D;  5B2J D;  3WTP C;  4H9N A;  4X23 C;  3KXB C;  3X1S A;  1P3G D;  4WU9 A;  5CPI B;  5DNN A;  3REJ C;  3WKJ A;  4XZQ C;  3AZH B;  5DNM B;  2Y2N A;  3AL0 C;  1HQ3 B;  3IP4 C;  3REJ B;  1KX3 B;  3AZJ B;  1P3I B;  1P34 D;  4AWL B;  5GT0 D;  3AZG C;  4DRA A;  3X1V A;  3B6G B;  3REK A;  3WAA D;  2HIO C;  3REH C;  5B40 C;  3X1S C;  5CP6 B;  4H9O B;  4WU9 C;  4J8X B;  3WKJ C;  5FUG B;  3MGR D;  4LD9 B;  3B6G C;  2ARO B;  3W97 A;  3AZN A;  5KDM B;  5CHL B;  4J8V B;  5CPK D;  1A7W A;  1HTA A;  1P3B D;  2F8N B;  1AOI B;  5GXQ D;  2HUE B;  3UTA A;  5C3I C;  3WAA B;  5AVC A;  5B0Z C;  3B0D B;  1P3O B;  3WKJ B;  4ZUX B;  1M19 A;  5CPJ C;  4XZQ D;  4NE6 A;  2DQN C;  3MGP B;  4J8U D;  1P3M D;  3MGQ C;  1F66 D;  3TU4 B;  1KU5 A;  5CPI A;  3O62 C;  4ZBJ C;  5B0Y C;  5B1L B;  2CV5 C;  4QLC C;  4ZUX D;  1B67 A;  2YFV A;  3AZF C;  5CPJ A;  3EPH A;  4J8W B;  5GXQ A;  3UTA D;  3TU4 A;  2ZY2 A;  4WNN A;  5BO0 A;  1P3P D;  1M1A B;  4J8V D;  1P3B B;  3AZI D;  1TAF B;  3W99 D;  2F8N D;  5CPK A;  5B0Y B;  4Z66 D;  4H9R A;  3H0L C;  3LZ0 D;  2YFV B;  1P3F B;  1M18 D;  3W96 C;  3X1U A;  5AV8 B;  3AV2 C;  3C1C A;  4H9P B;  2JCH A;  3AYW C;  4UUZ B;  3B0B A;  4YM6 B;  2Y2I A;  4ZUX C;  5AVB A;  5DNM D;  5AV9 D;  4R8P B;  3LZ1 B;  3KUY C;  5AV6 D;  3AZI A;  1BH8 B;  2JE5 A;  3AZJ D;  3TU4 D;  1P34 A;  5CPK C;  3KFU G;  4Z5T C;  3MNN B;  3AZF B;  2IO5 B;  5JA4 A;  4HGA C;  2W8S A;  1P3G B;  3MVD B;  3AZM A;  3W99 C;  5GXQ B;  4G91 C;  4Z5T D;  5B31 D;  4XUJ B;  5JRG B;  3UT9 C;  4G92 C;  2XD1 A;  1P34 C;  4Z5T A;  4XUJ C;  3AFA D;  4WJ3 C;  1M19 D;  3AN2 B;  3A6N B;  3W96 D;  5B33 B;  4H9O A;  3B6F C;  4J8V C;  3AZJ A;  3AZK B;  2CWE A;  1S32 A;  4EO5 B;  3KXB A;  2DF4 C;  5DNM A;  3REK B;  5GSU B;  3MNN A;  4YM6 C;  3C1C D;  2FJ7 B;  1H3O B;  1ID3 B;  3X1U D;  2PYO B;  3AZF D;  5G49 B;  2ARO A;  3W97 B;  1W2E A;  2BYM B;  3LZ0 A;  3AFA C;  5AVB B;  3C1B C;  1KX4 B;  2HIO A;  3UT9 D;  1P3P A;  3KWQ D;  5B2I A;  1P3K A;  1F66 C;  4J8U C;  1P3M C;  3X1T A;  3B0C W;  1KX5 D;  5G49 A;  3FDD A;  1JFI B;  3AFA A;  2G5I C;  3VH5 T;  3C1B A;  2J8P A;  2XD5 A;  5AY8 B;  2NZD A;  4X23 A;  5B24 A;  3UTA C;  5AV6 C;  1S32 B;  2Y2H A;  4WV4 B;  5DNN C;  5GT3 C;  1U35 B;  3MGS B;  5CPJ B;  4XUJ D;  5BS7 A;  3REL D;  1EQZ A;  4Z66 C;  3F6T A;  2NZD C;  5B24 C;  5B40 A;  3REH A;  5AV6 A;  1KX4 D;  1F66 B;  3MGS C;  5GT3 A;  3AZN D;  3W97 D;  4YM6 D;  2FJ7 A;  2Y2O A;  1KX3 A;  3B6G A;  3LZ1 D;  3TU4 C;  4M6B A;  3AZH A;  2L5A A;  5AY8 C;  4Z2M G;  2Y2P A;  4H9S A;  2F2A C;  5B40 B;  3REH B;  3LJA D;  2HIO B;  1P3L B;  3W98 B;  1P3F D;  1M1A D;  3AZE D;  1BH8 A;  5AVC C;  4YS3 B;  1M19 C;  4LD9 A;  2YFW B;  5JRG A;  5B40 D;  3REH D;  4ZUX A;  4YS3 C;  3MGQ A;  1P3G A;  5AVC B;  4X23 B;  4WZS B;  4WU8 B;  4NE3 A;  2F8N H;  4KUD A;  1HQ3 D;  4JJN D;  2YFW A;  4G91 B;  3AN2 A;  5JRG C;  1P3F C;  5GXQ C;  4KGC D;  4AWL C;  3NQU A;  3C1B D;  5E5A B;  5F99 A;  3MGQ D;  5B1L A;  1P3O D;  2PYO A;  4UPK A;  3MGR C;  1P3B A;  4J8W C;  5CPK B;  5BO0 B;  1M1A A;  1P3F A;  3UTB C;  1P3L D;  3AZL B;  3W98 D;  3LEL B;  1TAF A;  4ZBJ B;  3B6F A;  3REL C;  3WTP D;  1S32 C;  2NQB A;  1P3P B;  3B6G D;  2RVQ D;  4UUZ A;  4YM6 A;  1P3I D;  3REJ D;  5GT3 D;  4H9P A;  1ZLA A;  3AZN B;  3WTP E;  4H9Q B;  3WA9 C;  4Z2M H;  3O62 D;  3UTB A;  5BNV A;  3WAA C;  3LEL A;  4WU8 A;  5B1L D;  4CSR A;  4J8U B;  5B32 G;  3MGP D;  5F99 D;  5BNX B;  3REL A;  3AZM B;  1P3M B;  2NQB C;  4KGC A;  4XUJ A;  2JSS A;  5AV5 B;  3MVD A;  1HQ3 A;  4J8X C;  3EPK A;  5BNV B;  4X23 D;  3AZL C;  3X1V C;  4WU8 C;  3REK C;  3NQJ B;  5B2J C;  5BT1 D;  3LEL D;  1PZR A;  2Y2G A;  3KSY A;  4KGC C;  5B0Z B;  3VH6 A;  3AV2 D;  2HUE C;  1Q9C A;  4NFT A;  5CP6 D;  4JJN C;  2ARO C;  2HIO D;  3WTP A;  2NQB D;  3AZK A;  5B1M C;  5GT0 C;  3AZG D;  3REI C;  3X1S B;  3AZH D;  1ID3 C;  3UT9 B;  5B1M B;  5GSU C;  1KX3 D;  3REI B;  3B0D C;  3MNN D;  1BFM A;  5GSU D;  1KX3 C;  2CV5 D;  3KXB D;  4JJN B;  3AZG B;  3X1U B;  2PYO D;  3AZH C;  1B6W A;  1ID3 D;  5CPI C;  5B0Y A;  3EG5 B;  3AV1 D;  1N1J A;  1U35 D;  4QLC A;  1EQZ D;  1P3A B;  5AV8 D;  5CPJ D; 
#chains in the Genus database with same CATH homology
 5B33 D;  5B0Z D;  2ZM5 A;  5B32 C;  5BS7 C;  3W96 B;  1EQZ C;  3V9R A;  3KUY D;  2NZD D;  3UTA B;  1P3A D;  4H9N B;  4KHA B;  5B31 B;  3NQU B;  3MGS A;  5B0Z A;  4KUD C;  1KX5 A;  3A6N A;  4Z5T B;  5AV8 A;  1WWI A;  3A1K A;  5AV5 D;  3AYW A;  3AV1 A;  3H0R C;  3AZE A;  3KWQ B;  3AZI C;  2FFF B;  4R8P C;  4DRB A;  3X1V B;  2Y2K A;  3LJA A;  4H9S C;  5B1M D;  5AVB D;  5B1L C;  3VH6 W;  5AV9 B;  4R8P D;  2CV5 A;  1ZLA B;  2Y2Q A;  5GT3 B;  2ZY3 A;  3MGR A;  3WA9 D;  3AZF A;  3UTB B;  5JA4 B;  3AZM C;  2NQB B;  3W99 A;  3AZK D;  1KX4 A;  4E45 A;  1S32 D;  1P3A C;  2BYM A;  5C3I B;  3LZ0 B;  4NE5 A;  5AY8 D;  5AV5 A;  1F1E A;  3MGR B;  5E5A C;  3A6N D;  3EPL A;  2ZY4 A;  3W96 A;  3X1U C;  3AV2 A;  1M19 B;  3C1C C;  3AN2 C;  2ZY5 A;  5AVB C;  3C1B B;  3AV1 B;  4CAY B;  3KUY A;  3LEL C;  4WU9 B;  3A1I A;  3MGP C;  1P34 B;  3B0C T;  4KHA A;  5B31 A;  3AZM D;  3MVD D;  5E5A A;  5F99 B;  4J8W A;  5B31 G;  3MVD C;  1HQ3 C;  1TZY D;  3NQJ A;  1U35 A;  3X1T D;  5BT1 C;  4XZQ B;  4CAY A;  5B2I D;  1P3K D;  4WU8 D;  4WNN B;  3UT9 A;  1AOI C;  5B24 B;  3VH5 A;  5B2I C;  1P3K C;  1AOI D;  2Y2L A;  5AV9 A;  1P3L C;  2BYK B;  3W98 C;  3WTP B;  3X1T C;  2ARO D;  3REJ A;  5CP6 C;  3AV2 B;  1M18 A;  1BH9 A;  3WA9 A;  1U35 C;  4E44 A;  3AZG A;  3W99 B;  3WAA A;  1AOI A;  5B1M A;  4J8V A;  5GT0 A;  3AZJ C;  2F8N A;  3REI A;  1TZY C;  5DNM C;  3MNN C;  5KDM A;  1WWS A;  4KGC B;  2LY8 A;  1BH9 B;  3WA9 B;  3V9R B;  1M18 C;  3AZN C;  5E5A D;  1P3O A;  1Z2C B;  1TZY B;  5CPI D;  5B2J A;  1P3P C;  3O62 B;  5AV6 B;  1F66 A;  4CSR B;  3P5J B;  4J8U A;  1P3M A;  4YS3 A;  2VQR A;  4XZQ A;  2FJ7 C;  1M18 B;  1P3O C;  5AVC D;  4QLC D;  5AY8 A;  4Z66 B;  5B0Y D;  3AZK C;  2G5H C;  3O62 A;  3AZL D;  2UWX A;  4J8X D;  1H3O A;  1ID3 A;  4YS3 D;  3LJA B;  4KUD B;  2BYK A;  4LD9 D;  5GSU A;  1P3I A;  3AZE B;  1KX5 C;  3A6N C;  4LD9 C;  3W97 C;  1JFI A;  3MGQ B;  4Z66 A;  4R8P A;  3X1T B;  5GT0 B;  3LZ1 A;  5B2I B;  1P3K B;  2FJ7 D;  3B6F B;  3AYW D;  1P3I C;  4EO5 C;  4DQY B;  5B33 C;  3WKJ D;  5B32 A;  4WU9 D;  3MGS D;  3X1S D;  1KX4 C;  1P3A A;  3VH6 T;  5F99 C;  3R45 A;  1N1J B;  5B2J B;  2RIQ A;  3LZ1 C;  3KUY B;  3AN2 D;  1T3U A;  2PYO C;  4G92 B;  4KUD D;  5B33 A;  5AV8 C;  1R4V A;  3AV1 C;  3AZE C;  1KX5 B;  4HGA B;  1P3G C;  3LJA C;  3MGP A;  5B32 D;  3UTB D;  5JRG D;  3VH5 W;  1ZLA D;  3KXB B;  4H9R B;  2F8N K;  3AYW B;  3EPJ A;  3REI D;  3KWQ A;  2CV5 B;  2BG1 A;  2Y2J A;  3B6F D;  3REK D;  5BNX A;  3REL B;  3X1V D;  5AV5 C;  5AV9 C;  1P3L A;  3W98 A;  3C1C B;  2Y2M A;  1P3B C;  5FUG A;  2F8N G;  5B32 B;  2IO5 C;  5CP6 A;  2RVQ C;  1M1A C;  4J8X A;  5DNN D;  2NZD B;  3KWQ C;  3R45 B;  3LZ0 C;  3AZI B;  3AZL A;  3H0M C;  1ULY A;  4QLC B;  1TZY A;  5B31 C;  5DNN B;  3AFA B;  4J8W D;  1EQZ B;  1ZLA C;  4H9Q A;  4JJN A;  5B24 D;  5B2J D;  3WTP C;  4H9N A;  4X23 C;  3KXB C;  3X1S A;  1P3G D;  4WU9 A;  5CPI B;  5DNN A;  3REJ C;  3WKJ A;  4XZQ C;  3AZH B;  5DNM B;  2Y2N A;  3AL0 C;  1HQ3 B;  3IP4 C;  3REJ B;  1KX3 B;  3AZJ B;  1P3I B;  1P34 D;  4AWL B;  5GT0 D;  3AZG C;  4DRA A;  3X1V A;  3B6G B;  3REK A;  3WAA D;  2HIO C;  3REH C;  5B40 C;  3X1S C;  5CP6 B;  4H9O B;  4WU9 C;  4J8X B;  3WKJ C;  5FUG B;  3MGR D;  4LD9 B;  3B6G C;  2ARO B;  3W97 A;  3AZN A;  5KDM B;  5CHL B;  4J8V B;  5CPK D;  1A7W A;  1HTA A;  1P3B D;  2F8N B;  1AOI B;  5GXQ D;  2HUE B;  3UTA A;  5C3I C;  3WAA B;  5AVC A;  5B0Z C;  3B0D B;  1P3O B;  3WKJ B;  4ZUX B;  1M19 A;  5CPJ C;  4XZQ D;  4NE6 A;  2DQN C;  3MGP B;  4J8U D;  1P3M D;  3MGQ C;  1F66 D;  3TU4 B;  1KU5 A;  5CPI A;  3O62 C;  4ZBJ C;  5B0Y C;  5B1L B;  2CV5 C;  4QLC C;  4ZUX D;  1B67 A;  2YFV A;  3AZF C;  5CPJ A;  3EPH A;  4J8W B;  5GXQ A;  3UTA D;  3TU4 A;  2ZY2 A;  4WNN A;  5BO0 A;  1P3P D;  1M1A B;  4J8V D;  1P3B B;  3AZI D;  1TAF B;  3W99 D;  2F8N D;  5CPK A;  5B0Y B;  4Z66 D;  4H9R A;  3H0L C;  3LZ0 D;  2YFV B;  1P3F B;  1M18 D;  3W96 C;  3X1U A;  5AV8 B;  3AV2 C;  3C1C A;  4H9P B;  2JCH A;  3AYW C;  4UUZ B;  3B0B A;  4YM6 B;  2Y2I A;  4ZUX C;  5AVB A;  5DNM D;  5AV9 D;  4R8P B;  3LZ1 B;  3KUY C;  5AV6 D;  3AZI A;  1BH8 B;  2JE5 A;  3AZJ D;  3TU4 D;  1P34 A;  5CPK C;  3KFU G;  4Z5T C;  3MNN B;  3AZF B;  2IO5 B;  5JA4 A;  4HGA C;  2W8S A;  1P3G B;  3MVD B;  3AZM A;  3W99 C;  5GXQ B;  4G91 C;  4Z5T D;  5B31 D;  4XUJ B;  5JRG B;  3UT9 C;  4G92 C;  2XD1 A;  1P34 C;  4Z5T A;  4XUJ C;  3AFA D;  4WJ3 C;  1M19 D;  3AN2 B;  3A6N B;  3W96 D;  5B33 B;  4H9O A;  3B6F C;  4J8V C;  3AZJ A;  3AZK B;  2CWE A;  1S32 A;  4EO5 B;  3KXB A;  2DF4 C;  5DNM A;  3REK B;  5GSU B;  3MNN A;  4YM6 C;  3C1C D;  2FJ7 B;  1H3O B;  1ID3 B;  3X1U D;  2PYO B;  3AZF D;  5G49 B;  2ARO A;  3W97 B;  1W2E A;  2BYM B;  3LZ0 A;  3AFA C;  5AVB B;  3C1B C;  1KX4 B;  2HIO A;  3UT9 D;  1P3P A;  3KWQ D;  5B2I A;  1P3K A;  1F66 C;  4J8U C;  1P3M C;  3X1T A;  3B0C W;  1KX5 D;  5G49 A;  3FDD A;  1JFI B;  3AFA A;  2G5I C;  3VH5 T;  3C1B A;  2J8P A;  2XD5 A;  5AY8 B;  2NZD A;  4X23 A;  5B24 A;  3UTA C;  5AV6 C;  1S32 B;  2Y2H A;  4WV4 B;  5DNN C;  5GT3 C;  1U35 B;  3MGS B;  5CPJ B;  4XUJ D;  5BS7 A;  3REL D;  1EQZ A;  4Z66 C;  3F6T A;  2NZD C;  5B24 C;  5B40 A;  3REH A;  5AV6 A;  1KX4 D;  1F66 B;  3MGS C;  5GT3 A;  3AZN D;  3W97 D;  4YM6 D;  2FJ7 A;  2Y2O A;  1KX3 A;  3B6G A;  3LZ1 D;  3TU4 C;  4M6B A;  3AZH A;  2L5A A;  5AY8 C;  4Z2M G;  2Y2P A;  4H9S A;  2F2A C;  5B40 B;  3REH B;  3LJA D;  2HIO B;  1P3L B;  3W98 B;  1P3F D;  1M1A D;  3AZE D;  1BH8 A;  5AVC C;  4YS3 B;  1M19 C;  4LD9 A;  2YFW B;  5JRG A;  5B40 D;  3REH D;  4ZUX A;  4YS3 C;  3MGQ A;  1P3G A;  5AVC B;  4X23 B;  4WZS B;  4WU8 B;  4NE3 A;  2F8N H;  4KUD A;  1HQ3 D;  4JJN D;  2YFW A;  4G91 B;  3AN2 A;  5JRG C;  1P3F C;  5GXQ C;  4KGC D;  4AWL C;  3NQU A;  3C1B D;  5E5A B;  5F99 A;  3MGQ D;  5B1L A;  1P3O D;  2PYO A;  4UPK A;  3MGR C;  1P3B A;  4J8W C;  5CPK B;  5BO0 B;  1M1A A;  1P3F A;  3UTB C;  1P3L D;  3AZL B;  3W98 D;  3LEL B;  1TAF A;  4ZBJ B;  3B6F A;  3REL C;  3WTP D;  1S32 C;  2NQB A;  1P3P B;  3B6G D;  2RVQ D;  4UUZ A;  4YM6 A;  1P3I D;  3REJ D;  5GT3 D;  4H9P A;  1ZLA A;  3AZN B;  3WTP E;  4H9Q B;  3WA9 C;  4Z2M H;  3O62 D;  3UTB A;  5BNV A;  3WAA C;  3LEL A;  4WU8 A;  5B1L D;  4CSR A;  4J8U B;  5B32 G;  3MGP D;  5F99 D;  5BNX B;  3REL A;  3AZM B;  1P3M B;  2NQB C;  4KGC A;  4XUJ A;  2JSS A;  5AV5 B;  3MVD A;  1HQ3 A;  4J8X C;  3EPK A;  5BNV B;  4X23 D;  3AZL C;  3X1V C;  4WU8 C;  3REK C;  3NQJ B;  5B2J C;  5BT1 D;  3LEL D;  1PZR A;  2Y2G A;  3KSY A;  4KGC C;  5B0Z B;  3VH6 A;  3AV2 D;  2HUE C;  1Q9C A;  4NFT A;  5CP6 D;  4JJN C;  2ARO C;  2HIO D;  3WTP A;  2NQB D;  3AZK A;  5B1M C;  5GT0 C;  3AZG D;  3REI C;  3X1S B;  3AZH D;  1ID3 C;  3UT9 B;  5B1M B;  5GSU C;  1KX3 D;  3REI B;  3B0D C;  3MNN D;  1BFM A;  5GSU D;  1KX3 C;  2CV5 D;  3KXB D;  4JJN B;  3AZG B;  3X1U B;  2PYO D;  3AZH C;  1B6W A;  1ID3 D;  5CPI C;  5B0Y A;  3EG5 B;  3AV1 D;  1N1J A;  1U35 D;  4QLC A;  1EQZ D;  1P3A B;  5AV8 D;  5CPJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...