1P3FD

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
91
structure length
91
Chain Sequence
ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 37
structure length 91
sequence length 91
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3fD00
1ZLAD 3W97D 1KX3B 2RVQD 3C1BC 5AV5D 1P34D 4CSRB 3AZHB 3REHA 3AZMD 1HQ3B 1P3LC 3REJA 1B67A 1ZLAA 3AV1B 3B0CT 4H9RB 4J8VB 5CPKB 4LD9D 3C1CD 5CPIC 1P3MD 1N1JB 5AY8B 5GXQD 3X1UB 4NE3A 3AZIC 5B32A 5BO0B 3KUYA 4YM6B 5B24C 3B6FA 4LD9A 4JJNB 2F8NA 3C1CA 1P3MA 3A6NA 3NQJA 4WU8D 1P3PB 1P3GC 1P3BC 5B2ID 1M19A 3B6GC 4QLCC 3AV2C 3AZJB 4AWLC 3KXBD 1S32A 4NE5A 1KX3A 3O62B 3WTPC 3MGQC 4Z2MH 3AZHA 4XUJB 5B2IA 5JRGB 5AVCD 3AN2D 3AV1A 4H9RA 3LELC 3W99D 5AY8A 1EQZB 4X23D 4YM6A 4WU8C 4Z66D 4JJNA 2LY8A 4G91C 4WU9C 2NQBC 5B31C 4KUDD 5B0YD 5B2JD 4J8UC 3UTBD 3AZJA 4ZBJC 1B6WA 5B1LD 1AOID 5CPJD 4J8XD 4KUDA 3UT9B 5B2JA 5B0ZC 5B33B 3O62A 5GT0C 3AN2C 1M18C 4XUJA 4HGAC 5JRGA 3KWQC 1ID3B 3REKC 4J8WD 4XZQD 1P3FB 4R8PC 5B1MD 3WTPE 4KGCB 3MNNC 3REID 2CV5D 1KX5D 2YFVB 3LZ1B 2PYOD 3MGSB 5BNVA 4J8WA 2AROD 5DNMD 3TU4C 1U35B 5AV9B 1A7WA 2CV5A 3AZND 1KX5A 5DNNB 1P3OD 3AZEB 3X1VC 3VH5A 3RELB 3MGRC 3UT9A 5B33A 3AYWD 3AFAC 1TAFB 5GSUB 4H9NA 1M1AC 3W98B 1TZYD 1ID3A 3WA9B 2NZDD 1P3FA 4Z5TB 5KDMB 4YS3C 4KGCA 3KSYA 3C1BD 4H9QB 1KX4C 3REJB 3LZ1A 1ZLAB 3MGSA 3REKA 1P3LD 5AV8C 3W97B 3AZGC 4NE6A 5AV5B 1P34B 5CPID 1P3OC 4H9SC 3AZMB 1U35A 5AV9A 3NQUB 3UTAC 3AZID 5DNNA 5CP6C 5GT3C 3X1TC 4LD9B 3AZEA 3C1CB 1P3MB 3AYWC 3RELA 5B24D 5GXQB 2IO5B 5GSUA 1P3BD 1P3GD 1P3IC 3W98A 3B6GD 4QLCD 1S32B 3WA9A 2FJ7C 3AV2D 3W96D 4Z5TA 5KDMA 5B24A 1WWSA 5B2IB 4H9QA 4CAYB 3WTPD 3MGQD 1P3BA 1P3GA 4EO5C 3KXBB 4QLCA 3W97A 3AV2A 1P3AC 5F99C 3LELD 5AV5A 1P34A 3AZFC 2HIOC 5B40C 1WWIA 5AVCB 3WTPA 2HUEC 3AZMA 3AN2B 5AVBC 1H3OA 3NQUA 3AZKC 5B32G 3WKJC 3W99B 3LELA 5AV6C 4KHAB 5GXQA 4WU9D 2NQBD 5B31D 2F8NG 1F66C 4X23B 4J8UD 3W96C 5BS7A 3MGPC 4Z66B 3LZ0C 3X1SC 5B0YB 4KUDB 5B2JB 4WU8A 3B0DB 5JA4B 4WU9A 2NQBA 5B31A 4DRBA 3MVDC 3UTBB 5B0ZD 4CAYA 5GT0D 1M18D 3LJAC 3KXBA 3KWQD 5B1LB 1AOIB 4J8XB 5CPJB 4R8PD 3WAAC 3AZLC 3REHC 1P3KC 5E5AC 5AVCA 3AN2A 1M18A 3MNND 5BNVB 4XZQB 4J8WB 3KWQA 5B1MB 4WV4B 2BYMB 3W99A 4R8PA 4KHAA 3VH5W 5B32C 3REIB 2CV5B 4ZUXC 3KUYC 1KX5B 4X23A 2PYOB 3MNNA 3TU4D 3B6FC 4DRAA 4WNNB 2AROB 4Z66A 5DNMB 3A6NC 5B0YA 5CHLB 3X1VD 5JA4A 1M19C 3MGRD 3AZNB 4H9NB 3UTBA 1P3OB 3VH6A 3AFAD 1M1AD 1KX3C 5B1LA 1AOIA 4J8XA 5CPJA 2YFWA 3AZHC 3AYWB 3MGRA 4YS3D 1HQ3C 1TZYB 3AV1C 1KX4D 3REKB 3AFAA 2NZDB 4XZQA 4J8VC 5CPKC 2JSSA 5BT1C 4M6BA 5B1MA 5AV8D 2BYMA 5AY8C 3AZGD 3X1UC 3C1BB 4YS3A 3REIA 2PYOA 1KX4A 1P3LB 4YM6C 4EO5B 3UTAD 4JJNC 4WNNA 2AROA 5CP6D 5AV8A 5DNMA 5GT3D 3X1TD 1P3PC 5CPIB 3AZNA 3AZIB 1P3OA 3AZJC 1P3ID 5B24B 2FJ7D 4XUJC 3AYWA 5JRGC 1P3GB 1P3BB 4H9PB 1TZYA 3B6GB 4QLCB 2NZDA 3AV2B 3W96B 4AWLB 4E44A 2FJ7A 1P3AD 5F99D 3C1BA 3WTPB 5C3IC 3MGQB 3AZFD 1EQZC 1H3OB 2HIOD 5B40D 1P3LA 5AVBD 1R4VA 5FUGB 3AZKD 3LELB 3WKJD 4E45A 5CPIA 5AV6D 3VH5T 4G92C 3AZIA 1F66D 4WU8B 3MGPD 3UT9C 5B33C 4G91B 3LZ0D 4WU9B 2NQBB 5B31B 3X1SD 4J8UB 4WZSB 1ID3C 3MVDD 4H9PA 1F66A 3B6GA 1P3FC 3W96A 3LJAD 4ZBJB 3MGPA 4KGCC 5B0ZB 3MGQA 5GT0B 1M18B 3WAAD 3AZLD 5BNXA 3MGSC 3REHD 5E5AD 4HGAB 1P3KD 3KWQB 3LJAA 5FUGA 1Q9CA 4R8PB 1ULYA 1U35C 5AV9C 3WAAA 3AZLA 5B32D 3MNNB 5E5AA 5DNNC 1P3KA 4ZUXD 3KUYD 3AZEC 3VH6W 3RELC 3B6FD 2F8ND 3A6ND 5GSUC 3W98C 4J8UA 3TU4B 1M19D 4ZUXA 4Z2MG 3WA9C 4H9OB 5B31G 4Z5TC 1S32D 2YFWB 2F8NH 1KX3D 3X1VB 2BYKA 3MGRB 3REJC 5B0ZA 3AZHD 1ZLAC 5GT0A 3AFAB 1M1AB 1HQ3D 3W97C 2L5AA 2RVQC 3AV1D 4J8VD 5AV5C 1P34C 5CPKD 4UUZB 5BT1D 3AZMC 4YS3B 5AY8D 4CSRA 3X1UD 1KX4B 1HQ3A 3R45B 5G49B 4LD9C 3C1CC 5AV8B 1P3MC 4J8VA 4YM6D 3AZGB 5GXQC 5CPKA 4JJND 1N1JA 2IO5C 2F8NK 1P3PD 3X1UA 5BS7C 5C3IB 5BO0A 3TU4A 1S32C 3V9RB 4H9OA 3UTAB 5CP6B 3AZJD 5GT3B 2CWEA 3X1TB 3X1VA 5B2IC 3O62D 1P3PA 1KU5A 4XUJD 5JRGD 3KXBC 1M1AA 1P3IB 4G92B 1BH8B 2FJ7B 4UUZA 5AVCC 3B0CW 1EQZD 3R45A 5G49A 3W99C 1P3AB 3AZGA 5F99B 1JFIB 3AZFB 4X23C 2HIOB 5B40B 4H9SA 2HUEB 1EQZA 5AVBB 3V9RA 3UTAA 4Z66C 5CP6A 3AZKB 4NFTA 3WKJB 5B0YC 4KUDC 3VH6T 5GT3A 3B0DC 5B2JC 3O62C 3X1TA 1BFMA 5AV6B 3UTBC 3UT9D 5B33D 1F66B 5B1LC 1P3IA 1ID3D 1AOIC 4J8XC 5CPJC 3MGPB 1P3FD 1BH8A 3LZ0B 3X1SB 1BH9B 4KGCD 5BNXB 3MVDB 2NZDC 4J8WC 4XZQC 3LZ1D 3MGSD 5B1MC 3LJAB 3REKD 1HTAA 1P3AA 5F99A 3REIC 2CV5C 1KX5C 1JFIA 3AZFA 3AZLB 3REHB 1P3KB 2HIOA 5E5AB 5B40A 2PYOC 1U35D 3WAAB 5AV9D 2YFVA 5AVBA 2AROC 5DNND 5DNMC 3AZKA 3AZED 3WKJA 3RELD 5AV6A 3AZNC 5B32B 1F1EA 4ZUXB 3KUYB 5GSUD 3W98D 3B6FB 3WA9D 2F8NB 4Z5TD 3MVDA 2BYKB 3LZ0A 3NQJB 3A6NB 3X1SA 1BH9A 3LZ1C 1TZYC 1M19B 3B0BA 1TAFA 3REJD
chains in the Genus database with same CATH superfamily
1ZLAD 2Y2PA 3W97D 1KX3B 2RVQD 3C1BC 5AV5D 1P34D 4CSRB 3AZHB 3REHA 2W8SA 1HQ3B 3AZMD 3REJA 1P3LC 1B67A 1ZLAA 3AV1B 3B0CT 4H9RB 4J8VB 5CPKB 4LD9D 3C1CD 5CPIC 1P3MD 1N1JB 5AY8B 5GXQD 3X1UB 4NE3A 3AZIC 5B32A 5BO0B 3KUYA 2G5IC 2ZM5A 4YM6B 5B24C 3B6FA 4LD9A 4JJNB 2F8NA 3C1CA 1P3MA 3A6NA 2ZY4A 3NQJA 4WU8D 1P3PB 1P3GC 1P3BC 2Y2JA 5B2ID 1M19A 3B6GC 4QLCC 3AV2C 3AZJB 4AWLC 3KXBD 1S32A 4NE5A 1KX3A 3O62B 3WTPC 3MGQC 4Z2MH 3AZHA 4XUJB 5B2IA 5JRGB 5AVCD 3AN2D 3AV1A 4H9RA 3LELC 3W99D 5AY8A 1EQZB 4X23D 4YM6A 4WU8C 4Z66D 4JJNA 2LY8A 4G91C 4WU9C 2NQBC 5B31C 4KUDD 5B0YD 5B2JD 2ZY3A 4J8UC 3UTBD 3AZJA 4ZBJC 1B6WA 5B1LD 1AOID 5CPJD 4J8XD 4KUDA 3UT9B 5B2JA 5B0ZC 5B33B 3O62A 5GT0C 3AN2C 1M18C 4XUJA 4HGAC 5JRGA 3KWQC 1ID3B 3EPLA 3REKC 4J8WD 4XZQD 1P3FB 4R8PC 2XD5A 5B1MD 3WTPE 4KGCB 3MNNC 3REID 2CV5D 1KX5D 2YFVB 3LZ1B 2PYOD 3MGSB 5BNVA 4J8WA 2AROD 4UPKA 5DNMD 3TU4C 1U35B 5AV9B 1A7WA 2CV5A 3AZND 1KX5A 5DNNB 1P3OD 2J8PA 3AZEB 3X1VC 3VH5A 3RELB 3MGRC 3UT9A 5B33A 3AYWD 3AFAC 1TAFB 5GSUB 4H9NA 2JCHA 1M1AC 3W98B 1TZYD 1ID3A 3WA9B 2F2AC 2NZDD 4WJ3C 1P3FA 2DQNC 1W2EA 4Z5TB 5KDMB 4YS3C 4KGCA 3KSYA 3C1BD 4H9QB 1KX4C 3REJB 3LZ1A 1ZLAB 3MGSA 3REKA 1P3LD 5AV8C 3W97B 3AZGC 4NE6A 1Z2CB 5AV5B 1P34B 2Y2QA 5CPID 1P3OC 4H9SC 3AZMB 1U35A 5AV9A 3NQUB 3UTAC 3AZID 5DNNA 5CP6C 5GT3C 3X1TC 4LD9B 3AZEA 3C1CB 1P3MB 3AYWC 3RELA 5B24D 5GXQB 2IO5B 5GSUA 1P3BD 1P3GD 1P3IC 3W98A 3B6GD 4QLCD 1S32B 3EPKA 2FJ7C 3WA9A 3AV2D 3W96D 4Z5TA 5KDMA 5B24A 2G5HC 1WWSA 5B2IB 4H9QA 4CAYB 3WTPD 3MGQD 2Y2NA 1P3BA 1P3GA 4EO5C 3KXBB 4QLCA 3W97A 3AV2A 1P3AC 5F99C 3LELD 5AV5A 1P34A 3AZFC 2HIOC 5B40C 1WWIA 5AVCB 3WTPA 2HUEC 3AZMA 3AN2B 5AVBC 1H3OA 3NQUA 3A1IA 3AZKC 5B32G 3WKJC 3W99B 3LELA 5AV6C 4KHAB 5GXQA 4WU9D 2NQBD 5B31D 2F8NG 1F66C 4X23B 4J8UD 2UWXA 3W96C 5BS7A 3MGPC 4Z66B 3LZ0C 3X1SC 5B0YB 4KUDB 5B2JB 4WU8A 3B0DB 5JA4B 4WU9A 2NQBA 5B31A 4DRBA 3MVDC 3UTBB 5B0ZD 4CAYA 5GT0D 1M18D 2Y2IA 3LJAC 3KXBA 3KWQD 5B1LB 1AOIB 2Y2HA 4J8XB 5CPJB 3H0LC 4R8PD 3WAAC 3AZLC 3REHC 1P3KC 3EPHA 5E5AC 5AVCA 3AN2A 1M18A 3MNND 5BNVB 4XZQB 4J8WB 3KWQA 5B1MB 4WV4B 2BYMB 3W99A 4R8PA 4KHAA 5B32C 3VH5W 3REIB 2CV5B 4ZUXC 3KUYC 1KX5B 4X23A 2PYOB 3MNNA 3TU4D 3B6FC 4DRAA 4WNNB 2AROB 4Z66A 5DNMB 3A6NC 5B0YA 5CHLB 3X1VD 5JA4A 1M19C 3MGRD 3AZNB 4H9NB 3UTBA 1P3OB 3VH6A 3AFAD 1M1AD 1KX3C 5B1LA 2Y2MA 1AOIA 1T3UA 4J8XA 5CPJA 2YFWA 3AZHC 3AYWB 3MGRA 4YS3D 1HQ3C 1TZYB 3AV1C 1KX4D 3REKB 3AFAA 2NZDB 4XZQA 4J8VC 5CPKC 2FFFB 2JSSA 5BT1C 4M6BA 5B1MA 5AV8D 2BYMA 5AY8C 3AZGD 3X1UC 3C1BB 4YS3A 3REIA 2PYOA 1KX4A 1P3LB 2XD1A 4YM6C 4EO5B 2ZY5A 4JJNC 4WNNA 2AROA 5CP6D 3UTAD 5AV8A 5DNMA 5GT3D 3X1TD 1P3PC 5CPIB 3AZNA 3AZIB 1P3OA 3AZJC 1P3ID 5B24B 2FJ7D 3F6TA 4XUJC 3AYWA 5JRGC 1P3GB 1P3BB 4H9PB 1TZYA 3B6GB 4QLCB 2NZDA 3AV2B 3W96B 4AWLB 4E44A 2FJ7A 1P3AD 5F99D 3C1BA 3WTPB 5C3IC 3MGQB 3AZFD 1EQZC 1H3OB 2HIOD 5B40D 3AL0C 1P3LA 5AVBD 1R4VA 5FUGB 3AZKD 3LELB 3WKJD 3H0RC 4E45A 5CPIA 5AV6D 3VH5T 4G92C 3AZIA 1F66D 4WU8B 3MGPD 3UT9C 5B33C 4G91B 3LZ0D 4WU9B 2NQBB 5B31B 3X1SD 4J8UB 4WZSB 1ID3C 3MVDD 4H9PA 1F66A 3B6GA 1P3FC 3W96A 3LJAD 4ZBJB 3MGPA 4KGCC 5B0ZB 3MGQA 5GT0B 1M18B 3WAAD 3AZLD 5BNXA 3MGSC 3REHD 5E5AD 4HGAB 1P3KD 3KWQB 3LJAA 5FUGA 1Q9CA 4R8PB 1ULYA 1U35C 5AV9C 3WAAA 3AZLA 5B32D 2BG1A 5E5AA 5DNNC 3MNNB 1P3KA 4ZUXD 3KUYD 3AZEC 2Y2OA 3VH6W 3RELC 3B6FD 2Y2LA 2F8ND 3FDDA 2RIQA 3A6ND 5GSUC 3W98C 4J8UA 3TU4B 1M19D 4ZUXA 4Z2MG 3WA9C 4H9OB 5B31G 4Z5TC 1S32D 2YFWB 2F8NH 1KX3D 3X1VB 2BYKA 3MGRB 3REJC 5B0ZA 3AZHD 1ZLAC 5GT0A 1PZRA 3AFAB 1M1AB 1HQ3D 3W97C 2Y2KA 2L5AA 2RVQC 3AV1D 4J8VD 5AV5C 1P34C 5CPKD 3P5JB 4UUZB 5BT1D 3AZMC 4YS3B 5AY8D 4CSRA 3X1UD 1KX4B 1HQ3A 3R45B 5G49B 4LD9C 3C1CC 2DF4C 5AV8B 4J8VA 1P3MC 4YM6D 3AZGB 5GXQC 5CPKA 4JJND 1N1JA 2IO5C 2F8NK 1P3PD 3X1UA 5BS7C 5C3IB 5BO0A 3TU4A 1S32C 3V9RB 2VQRA 4H9OA 3UTAB 5CP6B 3AZJD 5GT3B 2CWEA 3X1TB 3X1VA 5B2IC 3O62D 1P3PA 3EG5B 1KU5A 4XUJD 5JRGD 3KXBC 1M1AA 1P3IB 4G92B 1BH8B 2FJ7B 4UUZA 5AVCC 3B0CW 1EQZD 3IP4C 3R45A 5G49A 3W99C 1P3AB 3AZGA 5F99B 3KFUG 1JFIB 3AZFB 4X23C 2HIOB 5B40B 4H9SA 2HUEB 1EQZA 5AVBB 3V9RA 3UTAA 4Z66C 5CP6A 3AZKB 4NFTA 3WKJB 5B0YC 4KUDC 3VH6T 5GT3A 3B0DC 5B2JC 3O62C 3X1TA 1BFMA 5AV6B 3UTBC 3UT9D 5B33D 1F66B 5B1LC 1P3IA 1ID3D 1AOIC 4J8XC 5CPJC 3MGPB 1P3FD 1BH8A 3LZ0B 3X1SB 1BH9B 4KGCD 5BNXB 3MVDB 2NZDC 4J8WC 4XZQC 3LZ1D 3MGSD 4DQYB 5B1MC 3LJAB 3REKD 3A1KA 3EPJA 1HTAA 1P3AA 5F99A 3REIC 2CV5C 1KX5C 1JFIA 3AZFA 3AZLB 3REHB 1P3KB 2HIOA 5E5AB 5B40A 2PYOC 1U35D 3WAAB 5AV9D 2YFVA 5AVBA 2AROC 5DNND 3H0MC 5DNMC 3AZKA 3AZED 3WKJA 3RELD 5AV6A 3AZNC 5B32B 2JE5A 1F1EA 4ZUXB 3KUYB 5GSUD 3W98D 3B6FB 3WA9D 2F8NB 4Z5TD 3MVDA 2BYKB 2ZY2A 3NQJB 3LZ0A 3A6NB 3X1SA 1BH9A 3LZ1C 1TZYC 1M19B 3B0BA 1TAFA 3REJD 2Y2GA
chains in the Genus database with same CATH topology
1ZLAD 2Y2PA 3W97D 1KX3B 2RVQD 3C1BC 5AV5D 1P34D 4CSRB 3AZHB 3REHA 2W8SA 1HQ3B 3AZMD 3REJA 1P3LC 1B67A 1ZLAA 3AV1B 3B0CT 4H9RB 4J8VB 5CPKB 4LD9D 3C1CD 5CPIC 1P3MD 1N1JB 5AY8B 5GXQD 3X1UB 4NE3A 3AZIC 5B32A 5BO0B 3KUYA 2G5IC 2ZM5A 4YM6B 5B24C 3B6FA 4LD9A 4JJNB 2F8NA 3C1CA 1P3MA 3A6NA 2ZY4A 3NQJA 4WU8D 1P3PB 1P3GC 1P3BC 2Y2JA 5B2ID 1M19A 3B6GC 4QLCC 3AV2C 3AZJB 4AWLC 3KXBD 1S32A 4NE5A 1KX3A 3O62B 3WTPC 3MGQC 4Z2MH 3AZHA 4XUJB 5B2IA 5JRGB 5AVCD 3AN2D 3AV1A 4H9RA 3LELC 3W99D 5AY8A 1EQZB 4X23D 4YM6A 4WU8C 4Z66D 4JJNA 2LY8A 4G91C 4WU9C 2NQBC 5B31C 4KUDD 5B0YD 5B2JD 2ZY3A 4J8UC 3UTBD 3AZJA 4ZBJC 1B6WA 5B1LD 1AOID 5CPJD 4J8XD 4KUDA 3UT9B 5B2JA 5B0ZC 5B33B 3O62A 5GT0C 3AN2C 1M18C 4XUJA 4HGAC 5JRGA 3KWQC 1ID3B 3EPLA 3REKC 4J8WD 4XZQD 1P3FB 4R8PC 2XD5A 5B1MD 3WTPE 4KGCB 3MNNC 3REID 2CV5D 1KX5D 2YFVB 3LZ1B 2PYOD 3MGSB 5BNVA 4J8WA 2AROD 4UPKA 5DNMD 3TU4C 1U35B 5AV9B 1A7WA 2CV5A 3AZND 1KX5A 5DNNB 1P3OD 2J8PA 3AZEB 3X1VC 3VH5A 3RELB 3MGRC 3UT9A 5B33A 3AYWD 3AFAC 1TAFB 5GSUB 4H9NA 2JCHA 1M1AC 3W98B 1TZYD 1ID3A 3WA9B 2F2AC 2NZDD 4WJ3C 1P3FA 2DQNC 1W2EA 4Z5TB 5KDMB 4YS3C 4KGCA 3KSYA 3C1BD 4H9QB 1KX4C 3REJB 3LZ1A 1ZLAB 3MGSA 3REKA 1P3LD 5AV8C 3W97B 3AZGC 4NE6A 1Z2CB 5AV5B 1P34B 2Y2QA 5CPID 1P3OC 4H9SC 3AZMB 1U35A 5AV9A 3NQUB 3UTAC 3AZID 5DNNA 5CP6C 5GT3C 3X1TC 4LD9B 3AZEA 3C1CB 1P3MB 3AYWC 3RELA 5B24D 5GXQB 2IO5B 5GSUA 1P3BD 1P3GD 1P3IC 3W98A 3B6GD 4QLCD 1S32B 3EPKA 2FJ7C 3WA9A 3AV2D 3W96D 4Z5TA 5KDMA 5B24A 2G5HC 1WWSA 5B2IB 4H9QA 4CAYB 3WTPD 3MGQD 2Y2NA 1P3BA 1P3GA 4EO5C 3KXBB 4QLCA 3W97A 3AV2A 1P3AC 5F99C 3LELD 5AV5A 1P34A 3AZFC 2HIOC 5B40C 1WWIA 5AVCB 3WTPA 2HUEC 3AZMA 3AN2B 5AVBC 1H3OA 3NQUA 3A1IA 3AZKC 5B32G 3WKJC 3W99B 3LELA 5AV6C 4KHAB 5GXQA 4WU9D 2NQBD 5B31D 2F8NG 1F66C 4X23B 4J8UD 2UWXA 3W96C 5BS7A 3MGPC 4Z66B 3LZ0C 3X1SC 5B0YB 4KUDB 5B2JB 4WU8A 3B0DB 5JA4B 4WU9A 2NQBA 5B31A 4DRBA 3MVDC 3UTBB 5B0ZD 4CAYA 5GT0D 1M18D 2Y2IA 3LJAC 3KXBA 3KWQD 5B1LB 1AOIB 2Y2HA 4J8XB 5CPJB 3H0LC 4R8PD 3WAAC 3AZLC 3REHC 1P3KC 3EPHA 5E5AC 5AVCA 3AN2A 1M18A 3MNND 5BNVB 4XZQB 4J8WB 3KWQA 5B1MB 4WV4B 2BYMB 3W99A 4R8PA 4KHAA 5B32C 3VH5W 3REIB 2CV5B 4ZUXC 3KUYC 1KX5B 4X23A 2PYOB 3MNNA 3TU4D 3B6FC 4DRAA 4WNNB 2AROB 4Z66A 5DNMB 3A6NC 5B0YA 5CHLB 3X1VD 5JA4A 1M19C 3MGRD 3AZNB 4H9NB 3UTBA 1P3OB 3VH6A 3AFAD 1M1AD 1KX3C 5B1LA 2Y2MA 1AOIA 1T3UA 4J8XA 5CPJA 2YFWA 3AZHC 3AYWB 3MGRA 4YS3D 1HQ3C 1TZYB 3AV1C 1KX4D 3REKB 3AFAA 2NZDB 4XZQA 4J8VC 5CPKC 2FFFB 2JSSA 5BT1C 4M6BA 5B1MA 5AV8D 2BYMA 5AY8C 3AZGD 3X1UC 3C1BB 4YS3A 3REIA 2PYOA 1KX4A 1P3LB 2XD1A 4YM6C 4EO5B 2ZY5A 4JJNC 4WNNA 2AROA 5CP6D 3UTAD 5AV8A 5DNMA 5GT3D 3X1TD 1P3PC 5CPIB 3AZNA 3AZIB 1P3OA 3AZJC 1P3ID 5B24B 2FJ7D 3F6TA 4XUJC 3AYWA 5JRGC 1P3GB 1P3BB 4H9PB 1TZYA 3B6GB 4QLCB 2NZDA 3AV2B 3W96B 4AWLB 4E44A 2FJ7A 1P3AD 5F99D 3C1BA 3WTPB 5C3IC 3MGQB 3AZFD 1EQZC 1H3OB 2HIOD 5B40D 3AL0C 1P3LA 5AVBD 1R4VA 5FUGB 3AZKD 3LELB 3WKJD 3H0RC 4E45A 5CPIA 5AV6D 3VH5T 4G92C 3AZIA 1F66D 4WU8B 3MGPD 3UT9C 5B33C 4G91B 3LZ0D 4WU9B 2NQBB 5B31B 3X1SD 4J8UB 4WZSB 1ID3C 3MVDD 4H9PA 1F66A 3B6GA 1P3FC 3W96A 3LJAD 4ZBJB 3MGPA 4KGCC 5B0ZB 3MGQA 5GT0B 1M18B 3WAAD 3AZLD 5BNXA 3MGSC 3REHD 5E5AD 4HGAB 1P3KD 3KWQB 3LJAA 5FUGA 1Q9CA 4R8PB 1ULYA 1U35C 5AV9C 3WAAA 3AZLA 5B32D 2BG1A 5E5AA 5DNNC 3MNNB 1P3KA 4ZUXD 3KUYD 3AZEC 2Y2OA 3VH6W 3RELC 3B6FD 2Y2LA 2F8ND 3FDDA 2RIQA 3A6ND 5GSUC 3W98C 4J8UA 3TU4B 1M19D 4ZUXA 4Z2MG 3WA9C 4H9OB 5B31G 4Z5TC 1S32D 2YFWB 2F8NH 1KX3D 3X1VB 2BYKA 3MGRB 3REJC 5B0ZA 3AZHD 1ZLAC 5GT0A 1PZRA 3AFAB 1M1AB 1HQ3D 3W97C 2Y2KA 2L5AA 2RVQC 3AV1D 4J8VD 5AV5C 1P34C 5CPKD 3P5JB 4UUZB 5BT1D 3AZMC 4YS3B 5AY8D 4CSRA 3X1UD 1KX4B 1HQ3A 3R45B 5G49B 4LD9C 3C1CC 2DF4C 5AV8B 4J8VA 1P3MC 4YM6D 3AZGB 5GXQC 5CPKA 4JJND 1N1JA 2IO5C 2F8NK 1P3PD 3X1UA 5BS7C 5C3IB 5BO0A 3TU4A 1S32C 3V9RB 2VQRA 4H9OA 3UTAB 5CP6B 3AZJD 5GT3B 2CWEA 3X1TB 3X1VA 5B2IC 3O62D 1P3PA 3EG5B 1KU5A 4XUJD 5JRGD 3KXBC 1M1AA 1P3IB 4G92B 1BH8B 2FJ7B 4UUZA 5AVCC 3B0CW 1EQZD 3IP4C 3R45A 5G49A 3W99C 1P3AB 3AZGA 5F99B 3KFUG 1JFIB 3AZFB 4X23C 2HIOB 5B40B 4H9SA 2HUEB 1EQZA 5AVBB 3V9RA 3UTAA 4Z66C 5CP6A 3AZKB 4NFTA 3WKJB 5B0YC 4KUDC 3VH6T 5GT3A 3B0DC 5B2JC 3O62C 3X1TA 1BFMA 5AV6B 3UTBC 3UT9D 5B33D 1F66B 5B1LC 1P3IA 1ID3D 1AOIC 4J8XC 5CPJC 3MGPB 1P3FD 1BH8A 3LZ0B 3X1SB 1BH9B 4KGCD 5BNXB 3MVDB 2NZDC 4J8WC 4XZQC 3LZ1D 3MGSD 4DQYB 5B1MC 3LJAB 3REKD 3A1KA 3EPJA 1HTAA 1P3AA 5F99A 3REIC 2CV5C 1KX5C 1JFIA 3AZFA 3AZLB 3REHB 1P3KB 2HIOA 5E5AB 5B40A 2PYOC 1U35D 3WAAB 5AV9D 2YFVA 5AVBA 2AROC 5DNND 3H0MC 5DNMC 3AZKA 3AZED 3WKJA 3RELD 5AV6A 3AZNC 5B32B 2JE5A 1F1EA 4ZUXB 3KUYB 5GSUD 3W98D 3B6FB 3WA9D 2F8NB 4Z5TD 3MVDA 2BYKB 2ZY2A 3NQJB 3LZ0A 3A6NB 3X1SA 1BH9A 3LZ1C 1TZYC 1M19B 3B0BA 1TAFA 3REJD 2Y2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZLA D;  3W97 D;  1KX3 B;  2RVQ D;  3C1B C;  5AV5 D;  1P34 D;  4CSR B;  3AZH B;  3REH A;  3AZM D;  1HQ3 B;  1P3L C;  3REJ A;  1B67 A;  1ZLA A;  3AV1 B;  3B0C T;  4H9R B;  4J8V B;  5CPK B;  4LD9 D;  3C1C D;  5CPI C;  1P3M D;  1N1J B;  5AY8 B;  5GXQ D;  3X1U B;  4NE3 A;  3AZI C;  5B32 A;  5BO0 B;  3KUY A;  4YM6 B;  5B24 C;  3B6F A;  4LD9 A;  4JJN B;  2F8N A;  3C1C A;  1P3M A;  3A6N A;  3NQJ A;  4WU8 D;  1P3P B;  1P3G C;  1P3B C;  5B2I D;  1M19 A;  3B6G C;  4QLC C;  3AV2 C;  3AZJ B;  4AWL C;  3KXB D;  1S32 A;  4NE5 A;  1KX3 A;  3O62 B;  3WTP C;  3MGQ C;  4Z2M H;  3AZH A;  4XUJ B;  5B2I A;  5JRG B;  5AVC D;  3AN2 D;  3AV1 A;  4H9R A;  3LEL C;  3W99 D;  5AY8 A;  1EQZ B;  4X23 D;  4YM6 A;  4WU8 C;  4Z66 D;  4JJN A;  2LY8 A;  4G91 C;  4WU9 C;  2NQB C;  5B31 C;  4KUD D;  5B0Y D;  5B2J D;  4J8U C;  3UTB D;  3AZJ A;  4ZBJ C;  1B6W A;  5B1L D;  1AOI D;  5CPJ D;  4J8X D;  4KUD A;  3UT9 B;  5B2J A;  5B0Z C;  5B33 B;  3O62 A;  5GT0 C;  3AN2 C;  1M18 C;  4XUJ A;  4HGA C;  5JRG A;  3KWQ C;  1ID3 B;  3REK C;  4J8W D;  4XZQ D;  1P3F B;  4R8P C;  5B1M D;  3WTP E;  4KGC B;  3MNN C;  3REI D;  2CV5 D;  1KX5 D;  2YFV B;  3LZ1 B;  2PYO D;  3MGS B;  5BNV A;  4J8W A;  2ARO D;  5DNM D;  3TU4 C;  1U35 B;  5AV9 B;  1A7W A;  2CV5 A;  3AZN D;  1KX5 A;  5DNN B;  1P3O D;  3AZE B;  3X1V C;  3VH5 A;  3REL B;  3MGR C;  3UT9 A;  5B33 A;  3AYW D;  3AFA C;  1TAF B;  5GSU B;  4H9N A;  1M1A C;  3W98 B;  1TZY D;  1ID3 A;  3WA9 B;  2NZD D;  1P3F A;  4Z5T B;  5KDM B;  4YS3 C;  4KGC A;  3KSY A;  3C1B D;  4H9Q B;  1KX4 C;  3REJ B;  3LZ1 A;  1ZLA B;  3MGS A;  3REK A;  1P3L D;  5AV8 C;  3W97 B;  3AZG C;  4NE6 A;  5AV5 B;  1P34 B;  5CPI D;  1P3O C;  4H9S C;  3AZM B;  1U35 A;  5AV9 A;  3NQU B;  3UTA C;  3AZI D;  5DNN A;  5CP6 C;  5GT3 C;  3X1T C;  4LD9 B;  3AZE A;  3C1C B;  1P3M B;  3AYW C;  3REL A;  5B24 D;  5GXQ B;  2IO5 B;  5GSU A;  1P3B D;  1P3G D;  1P3I C;  3W98 A;  3B6G D;  4QLC D;  1S32 B;  3WA9 A;  2FJ7 C;  3AV2 D;  3W96 D;  4Z5T A;  5KDM A;  5B24 A;  1WWS A;  5B2I B;  4H9Q A;  4CAY B;  3WTP D;  3MGQ D;  1P3B A;  1P3G A;  4EO5 C;  3KXB B;  4QLC A;  3W97 A;  3AV2 A;  1P3A C;  5F99 C;  3LEL D;  5AV5 A;  1P34 A;  3AZF C;  2HIO C;  5B40 C;  1WWI A;  5AVC B;  3WTP A;  2HUE C;  3AZM A;  3AN2 B;  5AVB C;  1H3O A;  3NQU A;  3AZK C;  5B32 G;  3WKJ C;  3W99 B;  3LEL A;  5AV6 C;  4KHA B;  5GXQ A;  4WU9 D;  2NQB D;  5B31 D;  2F8N G;  1F66 C;  4X23 B;  4J8U D;  3W96 C;  5BS7 A;  3MGP C;  4Z66 B;  3LZ0 C;  3X1S C;  5B0Y B;  4KUD B;  5B2J B;  4WU8 A;  3B0D B;  5JA4 B;  4WU9 A;  2NQB A;  5B31 A;  4DRB A;  3MVD C;  3UTB B;  5B0Z D;  4CAY A;  5GT0 D;  1M18 D;  3LJA C;  3KXB A;  3KWQ D;  5B1L B;  1AOI B;  4J8X B;  5CPJ B;  4R8P D;  3WAA C;  3AZL C;  3REH C;  1P3K C;  5E5A C;  5AVC A;  3AN2 A;  1M18 A;  3MNN D;  5BNV B;  4XZQ B;  4J8W B;  3KWQ A;  5B1M B;  4WV4 B;  2BYM B;  3W99 A;  4R8P A;  4KHA A;  3VH5 W;  5B32 C;  3REI B;  2CV5 B;  4ZUX C;  3KUY C;  1KX5 B;  4X23 A;  2PYO B;  3MNN A;  3TU4 D;  3B6F C;  4DRA A;  4WNN B;  2ARO B;  4Z66 A;  5DNM B;  3A6N C;  5B0Y A;  5CHL B;  3X1V D;  5JA4 A;  1M19 C;  3MGR D;  3AZN B;  4H9N B;  3UTB A;  1P3O B;  3VH6 A;  3AFA D;  1M1A D;  1KX3 C;  5B1L A;  1AOI A;  4J8X A;  5CPJ A;  2YFW A;  3AZH C;  3AYW B;  3MGR A;  4YS3 D;  1HQ3 C;  1TZY B;  3AV1 C;  1KX4 D;  3REK B;  3AFA A;  2NZD B;  4XZQ A;  4J8V C;  5CPK C;  2JSS A;  5BT1 C;  4M6B A;  5B1M A;  5AV8 D;  2BYM A;  5AY8 C;  3AZG D;  3X1U C;  3C1B B;  4YS3 A;  3REI A;  2PYO A;  1KX4 A;  1P3L B;  4YM6 C;  4EO5 B;  3UTA D;  4JJN C;  4WNN A;  2ARO A;  5CP6 D;  5AV8 A;  5DNM A;  5GT3 D;  3X1T D;  1P3P C;  5CPI B;  3AZN A;  3AZI B;  1P3O A;  3AZJ C;  1P3I D;  5B24 B;  2FJ7 D;  4XUJ C;  3AYW A;  5JRG C;  1P3G B;  1P3B B;  4H9P B;  1TZY A;  3B6G B;  4QLC B;  2NZD A;  3AV2 B;  3W96 B;  4AWL B;  4E44 A;  2FJ7 A;  1P3A D;  5F99 D;  3C1B A;  3WTP B;  5C3I C;  3MGQ B;  3AZF D;  1EQZ C;  1H3O B;  2HIO D;  5B40 D;  1P3L A;  5AVB D;  1R4V A;  5FUG B;  3AZK D;  3LEL B;  3WKJ D;  4E45 A;  5CPI A;  5AV6 D;  3VH5 T;  4G92 C;  3AZI A;  1F66 D;  4WU8 B;  3MGP D;  3UT9 C;  5B33 C;  4G91 B;  3LZ0 D;  4WU9 B;  2NQB B;  5B31 B;  3X1S D;  4J8U B;  4WZS B;  1ID3 C;  3MVD D;  4H9P A;  1F66 A;  3B6G A;  1P3F C;  3W96 A;  3LJA D;  4ZBJ B;  3MGP A;  4KGC C;  5B0Z B;  3MGQ A;  5GT0 B;  1M18 B;  3WAA D;  3AZL D;  5BNX A;  3MGS C;  3REH D;  5E5A D;  4HGA B;  1P3K D;  3KWQ B;  3LJA A;  5FUG A;  1Q9C A;  4R8P B;  1ULY A;  1U35 C;  5AV9 C;  3WAA A;  3AZL A;  5B32 D;  3MNN B;  5E5A A;  5DNN C;  1P3K A;  4ZUX D;  3KUY D;  3AZE C;  3VH6 W;  3REL C;  3B6F D;  2F8N D;  3A6N D;  5GSU C;  3W98 C;  4J8U A;  3TU4 B;  1M19 D;  4ZUX A;  4Z2M G;  3WA9 C;  4H9O B;  5B31 G;  4Z5T C;  1S32 D;  2YFW B;  2F8N H;  1KX3 D;  3X1V B;  2BYK A;  3MGR B;  3REJ C;  5B0Z A;  3AZH D;  1ZLA C;  5GT0 A;  3AFA B;  1M1A B;  1HQ3 D;  3W97 C;  2L5A A;  2RVQ C;  3AV1 D;  4J8V D;  5AV5 C;  1P34 C;  5CPK D;  4UUZ B;  5BT1 D;  3AZM C;  4YS3 B;  5AY8 D;  4CSR A;  3X1U D;  1KX4 B;  1HQ3 A;  3R45 B;  5G49 B;  4LD9 C;  3C1C C;  5AV8 B;  1P3M C;  4J8V A;  4YM6 D;  3AZG B;  5GXQ C;  5CPK A;  4JJN D;  1N1J A;  2IO5 C;  2F8N K;  1P3P D;  3X1U A;  5BS7 C;  5C3I B;  5BO0 A;  3TU4 A;  1S32 C;  3V9R B;  4H9O A;  3UTA B;  5CP6 B;  3AZJ D;  5GT3 B;  2CWE A;  3X1T B;  3X1V A;  5B2I C;  3O62 D;  1P3P A;  1KU5 A;  4XUJ D;  5JRG D;  3KXB C;  1M1A A;  1P3I B;  4G92 B;  1BH8 B;  2FJ7 B;  4UUZ A;  5AVC C;  3B0C W;  1EQZ D;  3R45 A;  5G49 A;  3W99 C;  1P3A B;  3AZG A;  5F99 B;  1JFI B;  3AZF B;  4X23 C;  2HIO B;  5B40 B;  4H9S A;  2HUE B;  1EQZ A;  5AVB B;  3V9R A;  3UTA A;  4Z66 C;  5CP6 A;  3AZK B;  4NFT A;  3WKJ B;  5B0Y C;  4KUD C;  3VH6 T;  5GT3 A;  3B0D C;  5B2J C;  3O62 C;  3X1T A;  1BFM A;  5AV6 B;  3UTB C;  3UT9 D;  5B33 D;  1F66 B;  5B1L C;  1P3I A;  1ID3 D;  1AOI C;  4J8X C;  5CPJ C;  3MGP B;  1P3F D;  1BH8 A;  3LZ0 B;  3X1S B;  1BH9 B;  4KGC D;  5BNX B;  3MVD B;  2NZD C;  4J8W C;  4XZQ C;  3LZ1 D;  3MGS D;  5B1M C;  3LJA B;  3REK D;  1HTA A;  1P3A A;  5F99 A;  3REI C;  2CV5 C;  1KX5 C;  1JFI A;  3AZF A;  3AZL B;  3REH B;  1P3K B;  2HIO A;  5E5A B;  5B40 A;  2PYO C;  1U35 D;  3WAA B;  5AV9 D;  2YFV A;  5AVB A;  2ARO C;  5DNN D;  5DNM C;  3AZK A;  3AZE D;  3WKJ A;  3REL D;  5AV6 A;  3AZN C;  5B32 B;  1F1E A;  4ZUX B;  3KUY B;  5GSU D;  3W98 D;  3B6F B;  3WA9 D;  2F8N B;  4Z5T D;  3MVD A;  2BYK B;  3LZ0 A;  3NQJ B;  3A6N B;  3X1S A;  1BH9 A;  3LZ1 C;  1TZY C;  1M19 B;  3B0B A;  1TAF A;  3REJ D; 
#chains in the Genus database with same CATH topology
 1ZLA D;  2Y2P A;  3W97 D;  1KX3 B;  2RVQ D;  3C1B C;  5AV5 D;  1P34 D;  4CSR B;  3AZH B;  3REH A;  2W8S A;  1HQ3 B;  3AZM D;  3REJ A;  1P3L C;  1B67 A;  1ZLA A;  3AV1 B;  3B0C T;  4H9R B;  4J8V B;  5CPK B;  4LD9 D;  3C1C D;  5CPI C;  1P3M D;  1N1J B;  5AY8 B;  5GXQ D;  3X1U B;  4NE3 A;  3AZI C;  5B32 A;  5BO0 B;  3KUY A;  2G5I C;  2ZM5 A;  4YM6 B;  5B24 C;  3B6F A;  4LD9 A;  4JJN B;  2F8N A;  3C1C A;  1P3M A;  3A6N A;  2ZY4 A;  3NQJ A;  4WU8 D;  1P3P B;  1P3G C;  1P3B C;  2Y2J A;  5B2I D;  1M19 A;  3B6G C;  4QLC C;  3AV2 C;  3AZJ B;  4AWL C;  3KXB D;  1S32 A;  4NE5 A;  1KX3 A;  3O62 B;  3WTP C;  3MGQ C;  4Z2M H;  3AZH A;  4XUJ B;  5B2I A;  5JRG B;  5AVC D;  3AN2 D;  3AV1 A;  4H9R A;  3LEL C;  3W99 D;  5AY8 A;  1EQZ B;  4X23 D;  4YM6 A;  4WU8 C;  4Z66 D;  4JJN A;  2LY8 A;  4G91 C;  4WU9 C;  2NQB C;  5B31 C;  4KUD D;  5B0Y D;  5B2J D;  2ZY3 A;  4J8U C;  3UTB D;  3AZJ A;  4ZBJ C;  1B6W A;  5B1L D;  1AOI D;  5CPJ D;  4J8X D;  4KUD A;  3UT9 B;  5B2J A;  5B0Z C;  5B33 B;  3O62 A;  5GT0 C;  3AN2 C;  1M18 C;  4XUJ A;  4HGA C;  5JRG A;  3KWQ C;  1ID3 B;  3EPL A;  3REK C;  4J8W D;  4XZQ D;  1P3F B;  4R8P C;  2XD5 A;  5B1M D;  3WTP E;  4KGC B;  3MNN C;  3REI D;  2CV5 D;  1KX5 D;  2YFV B;  3LZ1 B;  2PYO D;  3MGS B;  5BNV A;  4J8W A;  2ARO D;  4UPK A;  5DNM D;  3TU4 C;  1U35 B;  5AV9 B;  1A7W A;  2CV5 A;  3AZN D;  1KX5 A;  5DNN B;  1P3O D;  2J8P A;  3AZE B;  3X1V C;  3VH5 A;  3REL B;  3MGR C;  3UT9 A;  5B33 A;  3AYW D;  3AFA C;  1TAF B;  5GSU B;  4H9N A;  2JCH A;  1M1A C;  3W98 B;  1TZY D;  1ID3 A;  3WA9 B;  2F2A C;  2NZD D;  4WJ3 C;  1P3F A;  2DQN C;  1W2E A;  4Z5T B;  5KDM B;  4YS3 C;  4KGC A;  3KSY A;  3C1B D;  4H9Q B;  1KX4 C;  3REJ B;  3LZ1 A;  1ZLA B;  3MGS A;  3REK A;  1P3L D;  5AV8 C;  3W97 B;  3AZG C;  4NE6 A;  1Z2C B;  5AV5 B;  1P34 B;  2Y2Q A;  5CPI D;  1P3O C;  4H9S C;  3AZM B;  1U35 A;  5AV9 A;  3NQU B;  3UTA C;  3AZI D;  5DNN A;  5CP6 C;  5GT3 C;  3X1T C;  4LD9 B;  3AZE A;  3C1C B;  1P3M B;  3AYW C;  3REL A;  5B24 D;  5GXQ B;  2IO5 B;  5GSU A;  1P3B D;  1P3G D;  1P3I C;  3W98 A;  3B6G D;  4QLC D;  1S32 B;  3EPK A;  2FJ7 C;  3WA9 A;  3AV2 D;  3W96 D;  4Z5T A;  5KDM A;  5B24 A;  2G5H C;  1WWS A;  5B2I B;  4H9Q A;  4CAY B;  3WTP D;  3MGQ D;  2Y2N A;  1P3B A;  1P3G A;  4EO5 C;  3KXB B;  4QLC A;  3W97 A;  3AV2 A;  1P3A C;  5F99 C;  3LEL D;  5AV5 A;  1P34 A;  3AZF C;  2HIO C;  5B40 C;  1WWI A;  5AVC B;  3WTP A;  2HUE C;  3AZM A;  3AN2 B;  5AVB C;  1H3O A;  3NQU A;  3A1I A;  3AZK C;  5B32 G;  3WKJ C;  3W99 B;  3LEL A;  5AV6 C;  4KHA B;  5GXQ A;  4WU9 D;  2NQB D;  5B31 D;  2F8N G;  1F66 C;  4X23 B;  4J8U D;  2UWX A;  3W96 C;  5BS7 A;  3MGP C;  4Z66 B;  3LZ0 C;  3X1S C;  5B0Y B;  4KUD B;  5B2J B;  4WU8 A;  3B0D B;  5JA4 B;  4WU9 A;  2NQB A;  5B31 A;  4DRB A;  3MVD C;  3UTB B;  5B0Z D;  4CAY A;  5GT0 D;  1M18 D;  2Y2I A;  3LJA C;  3KXB A;  3KWQ D;  5B1L B;  1AOI B;  2Y2H A;  4J8X B;  5CPJ B;  3H0L C;  4R8P D;  3WAA C;  3AZL C;  3REH C;  1P3K C;  3EPH A;  5E5A C;  5AVC A;  3AN2 A;  1M18 A;  3MNN D;  5BNV B;  4XZQ B;  4J8W B;  3KWQ A;  5B1M B;  4WV4 B;  2BYM B;  3W99 A;  4R8P A;  4KHA A;  5B32 C;  3VH5 W;  3REI B;  2CV5 B;  4ZUX C;  3KUY C;  1KX5 B;  4X23 A;  2PYO B;  3MNN A;  3TU4 D;  3B6F C;  4DRA A;  4WNN B;  2ARO B;  4Z66 A;  5DNM B;  3A6N C;  5B0Y A;  5CHL B;  3X1V D;  5JA4 A;  1M19 C;  3MGR D;  3AZN B;  4H9N B;  3UTB A;  1P3O B;  3VH6 A;  3AFA D;  1M1A D;  1KX3 C;  5B1L A;  2Y2M A;  1AOI A;  1T3U A;  4J8X A;  5CPJ A;  2YFW A;  3AZH C;  3AYW B;  3MGR A;  4YS3 D;  1HQ3 C;  1TZY B;  3AV1 C;  1KX4 D;  3REK B;  3AFA A;  2NZD B;  4XZQ A;  4J8V C;  5CPK C;  2FFF B;  2JSS A;  5BT1 C;  4M6B A;  5B1M A;  5AV8 D;  2BYM A;  5AY8 C;  3AZG D;  3X1U C;  3C1B B;  4YS3 A;  3REI A;  2PYO A;  1KX4 A;  1P3L B;  2XD1 A;  4YM6 C;  4EO5 B;  2ZY5 A;  4JJN C;  4WNN A;  2ARO A;  5CP6 D;  3UTA D;  5AV8 A;  5DNM A;  5GT3 D;  3X1T D;  1P3P C;  5CPI B;  3AZN A;  3AZI B;  1P3O A;  3AZJ C;  1P3I D;  5B24 B;  2FJ7 D;  3F6T A;  4XUJ C;  3AYW A;  5JRG C;  1P3G B;  1P3B B;  4H9P B;  1TZY A;  3B6G B;  4QLC B;  2NZD A;  3AV2 B;  3W96 B;  4AWL B;  4E44 A;  2FJ7 A;  1P3A D;  5F99 D;  3C1B A;  3WTP B;  5C3I C;  3MGQ B;  3AZF D;  1EQZ C;  1H3O B;  2HIO D;  5B40 D;  3AL0 C;  1P3L A;  5AVB D;  1R4V A;  5FUG B;  3AZK D;  3LEL B;  3WKJ D;  3H0R C;  4E45 A;  5CPI A;  5AV6 D;  3VH5 T;  4G92 C;  3AZI A;  1F66 D;  4WU8 B;  3MGP D;  3UT9 C;  5B33 C;  4G91 B;  3LZ0 D;  4WU9 B;  2NQB B;  5B31 B;  3X1S D;  4J8U B;  4WZS B;  1ID3 C;  3MVD D;  4H9P A;  1F66 A;  3B6G A;  1P3F C;  3W96 A;  3LJA D;  4ZBJ B;  3MGP A;  4KGC C;  5B0Z B;  3MGQ A;  5GT0 B;  1M18 B;  3WAA D;  3AZL D;  5BNX A;  3MGS C;  3REH D;  5E5A D;  4HGA B;  1P3K D;  3KWQ B;  3LJA A;  5FUG A;  1Q9C A;  4R8P B;  1ULY A;  1U35 C;  5AV9 C;  3WAA A;  3AZL A;  5B32 D;  2BG1 A;  5E5A A;  5DNN C;  3MNN B;  1P3K A;  4ZUX D;  3KUY D;  3AZE C;  2Y2O A;  3VH6 W;  3REL C;  3B6F D;  2Y2L A;  2F8N D;  3FDD A;  2RIQ A;  3A6N D;  5GSU C;  3W98 C;  4J8U A;  3TU4 B;  1M19 D;  4ZUX A;  4Z2M G;  3WA9 C;  4H9O B;  5B31 G;  4Z5T C;  1S32 D;  2YFW B;  2F8N H;  1KX3 D;  3X1V B;  2BYK A;  3MGR B;  3REJ C;  5B0Z A;  3AZH D;  1ZLA C;  5GT0 A;  1PZR A;  3AFA B;  1M1A B;  1HQ3 D;  3W97 C;  2Y2K A;  2L5A A;  2RVQ C;  3AV1 D;  4J8V D;  5AV5 C;  1P34 C;  5CPK D;  3P5J B;  4UUZ B;  5BT1 D;  3AZM C;  4YS3 B;  5AY8 D;  4CSR A;  3X1U D;  1KX4 B;  1HQ3 A;  3R45 B;  5G49 B;  4LD9 C;  3C1C C;  2DF4 C;  5AV8 B;  4J8V A;  1P3M C;  4YM6 D;  3AZG B;  5GXQ C;  5CPK A;  4JJN D;  1N1J A;  2IO5 C;  2F8N K;  1P3P D;  3X1U A;  5BS7 C;  5C3I B;  5BO0 A;  3TU4 A;  1S32 C;  3V9R B;  2VQR A;  4H9O A;  3UTA B;  5CP6 B;  3AZJ D;  5GT3 B;  2CWE A;  3X1T B;  3X1V A;  5B2I C;  3O62 D;  1P3P A;  3EG5 B;  1KU5 A;  4XUJ D;  5JRG D;  3KXB C;  1M1A A;  1P3I B;  4G92 B;  1BH8 B;  2FJ7 B;  4UUZ A;  5AVC C;  3B0C W;  1EQZ D;  3IP4 C;  3R45 A;  5G49 A;  3W99 C;  1P3A B;  3AZG A;  5F99 B;  3KFU G;  1JFI B;  3AZF B;  4X23 C;  2HIO B;  5B40 B;  4H9S A;  2HUE B;  1EQZ A;  5AVB B;  3V9R A;  3UTA A;  4Z66 C;  5CP6 A;  3AZK B;  4NFT A;  3WKJ B;  5B0Y C;  4KUD C;  3VH6 T;  5GT3 A;  3B0D C;  5B2J C;  3O62 C;  3X1T A;  1BFM A;  5AV6 B;  3UTB C;  3UT9 D;  5B33 D;  1F66 B;  5B1L C;  1P3I A;  1ID3 D;  1AOI C;  4J8X C;  5CPJ C;  3MGP B;  1P3F D;  1BH8 A;  3LZ0 B;  3X1S B;  1BH9 B;  4KGC D;  5BNX B;  3MVD B;  2NZD C;  4J8W C;  4XZQ C;  3LZ1 D;  3MGS D;  4DQY B;  5B1M C;  3LJA B;  3REK D;  3A1K A;  3EPJ A;  1HTA A;  1P3A A;  5F99 A;  3REI C;  2CV5 C;  1KX5 C;  1JFI A;  3AZF A;  3AZL B;  3REH B;  1P3K B;  2HIO A;  5E5A B;  5B40 A;  2PYO C;  1U35 D;  3WAA B;  5AV9 D;  2YFV A;  5AVB A;  2ARO C;  5DNN D;  3H0M C;  5DNM C;  3AZK A;  3AZE D;  3WKJ A;  3REL D;  5AV6 A;  3AZN C;  5B32 B;  2JE5 A;  1F1E A;  4ZUX B;  3KUY B;  5GSU D;  3W98 D;  3B6F B;  3WA9 D;  2F8N B;  4Z5T D;  3MVD A;  2BYK B;  2ZY2 A;  3NQJ B;  3LZ0 A;  3A6N B;  3X1S A;  1BH9 A;  3LZ1 C;  1TZY C;  1M19 B;  3B0B A;  1TAF A;  3REJ D;  2Y2G A; 
#chains in the Genus database with same CATH homology
 1ZLA D;  2Y2P A;  3W97 D;  1KX3 B;  2RVQ D;  3C1B C;  5AV5 D;  1P34 D;  4CSR B;  3AZH B;  3REH A;  2W8S A;  1HQ3 B;  3AZM D;  3REJ A;  1P3L C;  1B67 A;  1ZLA A;  3AV1 B;  3B0C T;  4H9R B;  4J8V B;  5CPK B;  4LD9 D;  3C1C D;  5CPI C;  1P3M D;  1N1J B;  5AY8 B;  5GXQ D;  3X1U B;  4NE3 A;  3AZI C;  5B32 A;  5BO0 B;  3KUY A;  2G5I C;  2ZM5 A;  4YM6 B;  5B24 C;  3B6F A;  4LD9 A;  4JJN B;  2F8N A;  3C1C A;  1P3M A;  3A6N A;  2ZY4 A;  3NQJ A;  4WU8 D;  1P3P B;  1P3G C;  1P3B C;  2Y2J A;  5B2I D;  1M19 A;  3B6G C;  4QLC C;  3AV2 C;  3AZJ B;  4AWL C;  3KXB D;  1S32 A;  4NE5 A;  1KX3 A;  3O62 B;  3WTP C;  3MGQ C;  4Z2M H;  3AZH A;  4XUJ B;  5B2I A;  5JRG B;  5AVC D;  3AN2 D;  3AV1 A;  4H9R A;  3LEL C;  3W99 D;  5AY8 A;  1EQZ B;  4X23 D;  4YM6 A;  4WU8 C;  4Z66 D;  4JJN A;  2LY8 A;  4G91 C;  4WU9 C;  2NQB C;  5B31 C;  4KUD D;  5B0Y D;  5B2J D;  2ZY3 A;  4J8U C;  3UTB D;  3AZJ A;  4ZBJ C;  1B6W A;  5B1L D;  1AOI D;  5CPJ D;  4J8X D;  4KUD A;  3UT9 B;  5B2J A;  5B0Z C;  5B33 B;  3O62 A;  5GT0 C;  3AN2 C;  1M18 C;  4XUJ A;  4HGA C;  5JRG A;  3KWQ C;  1ID3 B;  3EPL A;  3REK C;  4J8W D;  4XZQ D;  1P3F B;  4R8P C;  2XD5 A;  5B1M D;  3WTP E;  4KGC B;  3MNN C;  3REI D;  2CV5 D;  1KX5 D;  2YFV B;  3LZ1 B;  2PYO D;  3MGS B;  5BNV A;  4J8W A;  2ARO D;  4UPK A;  5DNM D;  3TU4 C;  1U35 B;  5AV9 B;  1A7W A;  2CV5 A;  3AZN D;  1KX5 A;  5DNN B;  1P3O D;  2J8P A;  3AZE B;  3X1V C;  3VH5 A;  3REL B;  3MGR C;  3UT9 A;  5B33 A;  3AYW D;  3AFA C;  1TAF B;  5GSU B;  4H9N A;  2JCH A;  1M1A C;  3W98 B;  1TZY D;  1ID3 A;  3WA9 B;  2F2A C;  2NZD D;  4WJ3 C;  1P3F A;  2DQN C;  1W2E A;  4Z5T B;  5KDM B;  4YS3 C;  4KGC A;  3KSY A;  3C1B D;  4H9Q B;  1KX4 C;  3REJ B;  3LZ1 A;  1ZLA B;  3MGS A;  3REK A;  1P3L D;  5AV8 C;  3W97 B;  3AZG C;  4NE6 A;  1Z2C B;  5AV5 B;  1P34 B;  2Y2Q A;  5CPI D;  1P3O C;  4H9S C;  3AZM B;  1U35 A;  5AV9 A;  3NQU B;  3UTA C;  3AZI D;  5DNN A;  5CP6 C;  5GT3 C;  3X1T C;  4LD9 B;  3AZE A;  3C1C B;  1P3M B;  3AYW C;  3REL A;  5B24 D;  5GXQ B;  2IO5 B;  5GSU A;  1P3B D;  1P3G D;  1P3I C;  3W98 A;  3B6G D;  4QLC D;  1S32 B;  3EPK A;  2FJ7 C;  3WA9 A;  3AV2 D;  3W96 D;  4Z5T A;  5KDM A;  5B24 A;  2G5H C;  1WWS A;  5B2I B;  4H9Q A;  4CAY B;  3WTP D;  3MGQ D;  2Y2N A;  1P3B A;  1P3G A;  4EO5 C;  3KXB B;  4QLC A;  3W97 A;  3AV2 A;  1P3A C;  5F99 C;  3LEL D;  5AV5 A;  1P34 A;  3AZF C;  2HIO C;  5B40 C;  1WWI A;  5AVC B;  3WTP A;  2HUE C;  3AZM A;  3AN2 B;  5AVB C;  1H3O A;  3NQU A;  3A1I A;  3AZK C;  5B32 G;  3WKJ C;  3W99 B;  3LEL A;  5AV6 C;  4KHA B;  5GXQ A;  4WU9 D;  2NQB D;  5B31 D;  2F8N G;  1F66 C;  4X23 B;  4J8U D;  2UWX A;  3W96 C;  5BS7 A;  3MGP C;  4Z66 B;  3LZ0 C;  3X1S C;  5B0Y B;  4KUD B;  5B2J B;  4WU8 A;  3B0D B;  5JA4 B;  4WU9 A;  2NQB A;  5B31 A;  4DRB A;  3MVD C;  3UTB B;  5B0Z D;  4CAY A;  5GT0 D;  1M18 D;  2Y2I A;  3LJA C;  3KXB A;  3KWQ D;  5B1L B;  1AOI B;  2Y2H A;  4J8X B;  5CPJ B;  3H0L C;  4R8P D;  3WAA C;  3AZL C;  3REH C;  1P3K C;  3EPH A;  5E5A C;  5AVC A;  3AN2 A;  1M18 A;  3MNN D;  5BNV B;  4XZQ B;  4J8W B;  3KWQ A;  5B1M B;  4WV4 B;  2BYM B;  3W99 A;  4R8P A;  4KHA A;  5B32 C;  3VH5 W;  3REI B;  2CV5 B;  4ZUX C;  3KUY C;  1KX5 B;  4X23 A;  2PYO B;  3MNN A;  3TU4 D;  3B6F C;  4DRA A;  4WNN B;  2ARO B;  4Z66 A;  5DNM B;  3A6N C;  5B0Y A;  5CHL B;  3X1V D;  5JA4 A;  1M19 C;  3MGR D;  3AZN B;  4H9N B;  3UTB A;  1P3O B;  3VH6 A;  3AFA D;  1M1A D;  1KX3 C;  5B1L A;  2Y2M A;  1AOI A;  1T3U A;  4J8X A;  5CPJ A;  2YFW A;  3AZH C;  3AYW B;  3MGR A;  4YS3 D;  1HQ3 C;  1TZY B;  3AV1 C;  1KX4 D;  3REK B;  3AFA A;  2NZD B;  4XZQ A;  4J8V C;  5CPK C;  2FFF B;  2JSS A;  5BT1 C;  4M6B A;  5B1M A;  5AV8 D;  2BYM A;  5AY8 C;  3AZG D;  3X1U C;  3C1B B;  4YS3 A;  3REI A;  2PYO A;  1KX4 A;  1P3L B;  2XD1 A;  4YM6 C;  4EO5 B;  2ZY5 A;  4JJN C;  4WNN A;  2ARO A;  5CP6 D;  3UTA D;  5AV8 A;  5DNM A;  5GT3 D;  3X1T D;  1P3P C;  5CPI B;  3AZN A;  3AZI B;  1P3O A;  3AZJ C;  1P3I D;  5B24 B;  2FJ7 D;  3F6T A;  4XUJ C;  3AYW A;  5JRG C;  1P3G B;  1P3B B;  4H9P B;  1TZY A;  3B6G B;  4QLC B;  2NZD A;  3AV2 B;  3W96 B;  4AWL B;  4E44 A;  2FJ7 A;  1P3A D;  5F99 D;  3C1B A;  3WTP B;  5C3I C;  3MGQ B;  3AZF D;  1EQZ C;  1H3O B;  2HIO D;  5B40 D;  3AL0 C;  1P3L A;  5AVB D;  1R4V A;  5FUG B;  3AZK D;  3LEL B;  3WKJ D;  3H0R C;  4E45 A;  5CPI A;  5AV6 D;  3VH5 T;  4G92 C;  3AZI A;  1F66 D;  4WU8 B;  3MGP D;  3UT9 C;  5B33 C;  4G91 B;  3LZ0 D;  4WU9 B;  2NQB B;  5B31 B;  3X1S D;  4J8U B;  4WZS B;  1ID3 C;  3MVD D;  4H9P A;  1F66 A;  3B6G A;  1P3F C;  3W96 A;  3LJA D;  4ZBJ B;  3MGP A;  4KGC C;  5B0Z B;  3MGQ A;  5GT0 B;  1M18 B;  3WAA D;  3AZL D;  5BNX A;  3MGS C;  3REH D;  5E5A D;  4HGA B;  1P3K D;  3KWQ B;  3LJA A;  5FUG A;  1Q9C A;  4R8P B;  1ULY A;  1U35 C;  5AV9 C;  3WAA A;  3AZL A;  5B32 D;  2BG1 A;  5E5A A;  5DNN C;  3MNN B;  1P3K A;  4ZUX D;  3KUY D;  3AZE C;  2Y2O A;  3VH6 W;  3REL C;  3B6F D;  2Y2L A;  2F8N D;  3FDD A;  2RIQ A;  3A6N D;  5GSU C;  3W98 C;  4J8U A;  3TU4 B;  1M19 D;  4ZUX A;  4Z2M G;  3WA9 C;  4H9O B;  5B31 G;  4Z5T C;  1S32 D;  2YFW B;  2F8N H;  1KX3 D;  3X1V B;  2BYK A;  3MGR B;  3REJ C;  5B0Z A;  3AZH D;  1ZLA C;  5GT0 A;  1PZR A;  3AFA B;  1M1A B;  1HQ3 D;  3W97 C;  2Y2K A;  2L5A A;  2RVQ C;  3AV1 D;  4J8V D;  5AV5 C;  1P34 C;  5CPK D;  3P5J B;  4UUZ B;  5BT1 D;  3AZM C;  4YS3 B;  5AY8 D;  4CSR A;  3X1U D;  1KX4 B;  1HQ3 A;  3R45 B;  5G49 B;  4LD9 C;  3C1C C;  2DF4 C;  5AV8 B;  4J8V A;  1P3M C;  4YM6 D;  3AZG B;  5GXQ C;  5CPK A;  4JJN D;  1N1J A;  2IO5 C;  2F8N K;  1P3P D;  3X1U A;  5BS7 C;  5C3I B;  5BO0 A;  3TU4 A;  1S32 C;  3V9R B;  2VQR A;  4H9O A;  3UTA B;  5CP6 B;  3AZJ D;  5GT3 B;  2CWE A;  3X1T B;  3X1V A;  5B2I C;  3O62 D;  1P3P A;  3EG5 B;  1KU5 A;  4XUJ D;  5JRG D;  3KXB C;  1M1A A;  1P3I B;  4G92 B;  1BH8 B;  2FJ7 B;  4UUZ A;  5AVC C;  3B0C W;  1EQZ D;  3IP4 C;  3R45 A;  5G49 A;  3W99 C;  1P3A B;  3AZG A;  5F99 B;  3KFU G;  1JFI B;  3AZF B;  4X23 C;  2HIO B;  5B40 B;  4H9S A;  2HUE B;  1EQZ A;  5AVB B;  3V9R A;  3UTA A;  4Z66 C;  5CP6 A;  3AZK B;  4NFT A;  3WKJ B;  5B0Y C;  4KUD C;  3VH6 T;  5GT3 A;  3B0D C;  5B2J C;  3O62 C;  3X1T A;  1BFM A;  5AV6 B;  3UTB C;  3UT9 D;  5B33 D;  1F66 B;  5B1L C;  1P3I A;  1ID3 D;  1AOI C;  4J8X C;  5CPJ C;  3MGP B;  1P3F D;  1BH8 A;  3LZ0 B;  3X1S B;  1BH9 B;  4KGC D;  5BNX B;  3MVD B;  2NZD C;  4J8W C;  4XZQ C;  3LZ1 D;  3MGS D;  4DQY B;  5B1M C;  3LJA B;  3REK D;  3A1K A;  3EPJ A;  1HTA A;  1P3A A;  5F99 A;  3REI C;  2CV5 C;  1KX5 C;  1JFI A;  3AZF A;  3AZL B;  3REH B;  1P3K B;  2HIO A;  5E5A B;  5B40 A;  2PYO C;  1U35 D;  3WAA B;  5AV9 D;  2YFV A;  5AVB A;  2ARO C;  5DNN D;  3H0M C;  5DNM C;  3AZK A;  3AZE D;  3WKJ A;  3REL D;  5AV6 A;  3AZN C;  5B32 B;  2JE5 A;  1F1E A;  4ZUX B;  3KUY B;  5GSU D;  3W98 D;  3B6F B;  3WA9 D;  2F8N B;  4Z5T D;  3MVD A;  2BYK B;  2ZY2 A;  3NQJ B;  3LZ0 A;  3A6N B;  3X1S A;  1BH9 A;  3LZ1 C;  1TZY C;  1M19 B;  3B0B A;  1TAF A;  3REJ D;  2Y2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...