1P3IC

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
103
structure length
103
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 33
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3iC00
3MNNB 4QLCA 2JSSA 1M1AC 4KGCC 3B6FC 1KX3C 1ID3A 1BH9A 3AV1A 5CP6C 1A7WA 1P3AB 3X1UD 3MGPA 1N1JA 2YFVB 2NZDB 3MNND 3RELA 4H9SA 2FJ7A 2PYOB 3WA9D 4X23C 1P3FC 3O62C 4J8UA 3A6NA 4QLCB 3WTPB 4LD9A 4YM6B 1BH9B 3UTAA 1P3LD 3AZIC 3LZ0C 3REIC 3MGPB 3B0CW 3KXBB 1P34C 1P3PC 1P3MB 4QLCD 1ID3D 4R8PC 4ZBJB 3AV1D 3MGPD 2BYMA 4J8UB 3X1VA 3A6NB 4YS3A 4J8VB 1M1AA 4LD9B 3VH5W 3RELD 1KX3A 3B6FA 4J8WD 5BNVA 2FJ7D 5CP6A 5B31C 5AVBC 4G91B 2LY8A 4J8UD 4LD9D 3UTAD 4X23A 3AZGA 3O62A 3AZMD 4YS3B 2F8NK 1M1AB 5B2IA 3B6FB 1KX3B 4KGCB 3AZIA 3LZ0A 3REIA 1Q9CA 5CP6B 3MGSC 3AZEC 3X1VD 2CV5A 1U35C 1P34A 4YS3D 1P3PA 1M19A 3B6FD 1KX3D 2F8NB 3WAAA 5AV9C 4X23B 1P3FB 3O62B 3X1TA 5GXQA 3X1UC 3AZIB 3LZ0B 3REIB 2CWEA 5AVBA 4X23D 4H9QA 3AZGD 3O62D 1P34B 5B2ID 3WA9C 4R8PB 3AZID 3LZ0D 3REID 3AV2C 2F8NG 1P3LC 2CV5D 1P34D 1P3PD 1M19D 5AY8C 4Z2MH 3WAAD 5B31B 4H9QB 1ID3C 3AZEA 4NE3A 5FUGA 5E5AB 1U35A 3X1TD 3AV1C 5GXQD 4WU8A 5AV9A 5AVBD 3RELC 1M18C 3AZHC 4J8WC 3MGQC 2FJ7C 4H9RB 3B0BA 3X1UA 5CPID 5JA4A 3MGSB 4XUJD 1P3KA 3AZEB 5FUGB 3UTAC 1U35B 5B31G 3AZMC 3AZFC 5AV5A 5AV9B 4NE6A 1F66C 3AV2A 3C1CC 2RVQD 3AZED 1HQ3A 1U35D 5AV6A 2HUEC 5AY8A 3X1UB 3AN2D 5JA4B 4WNNA 3X1VC 5AV9D 4WU8D 1S32A 5JRGC 3AZKC 4CAYA 3WA9B 1P3ID 4G92C 5BNXB 3AV2B 1M18A 1P3KD 3AZHA 1P3LB 4J8WA 1ZLAA 3MGQA 1AOIC 5AY8B 3AYWC 4XZQC 4HGAC 4WNNB 3UT9C 3AZGC 5AV5D 3MGRC 1TAFA 5B2IC 1ID3B 3AV2D 1KU5A 4CAYB 3AV1B 1HQ3D 3W96C 5AV6D 5AY8D 1N1JB 3AZMA 3AZFA 2CV5C 1S32D 4J8XA 3RELB 1M18B 1M19C 3AZHB 1F66A 4J8WB 3MGQB 3C1CA 2FJ7B 3WAAC 3X1TC 3C1BC 1P3GA 5JRGA 1EQZC 3AZKA 5GXQC 3UTAB 1M18D 3AZHD 1ZLAD 3W99C 3MGQD 5B0YA 1B67A 2BYKA 3AZMB 3AZFB 3KUYD 4WU9C 1F66B 1KX4A 3C1CB 1P3OC 5CPIC 1AOIA 2HUEB 3AYWA 4XZQA 3X1SD 4XUJC 2BYMB 3UT9A 4H9OA 3AZFD 3X1VB 2HIOD 3MGRA 5JRGB 4J8XD 3AZKB 1F66D 4NE5A 5BNVB 3C1CD 5B0ZA 3W96A 4G92B 2RVQC 5GSUC 5BS7C 1P3GD 5JRGD 5CHLB 3AZKD 3AN2C 1AOIB 3AYWB 4WU8C 4UUZA 4XZQB 5B0YD 5C3IC 4ZUXA 4H9OB 3UT9B 5B1LA 3AZGB 2YFWA 3REKC 1JFIA 3MGRB 5B2IB 3C1BA 1H3OA 1EQZA 1KX4D 1P3IC 3W99A 1AOID 3W96B 1WWSA 1B6WA 3AYWD 4Z5TC 4XZQD 4DRAA 1P3KC 3UT9D 2CV5B 4WU9A 1P3PB 3W98A 3MGRD 1M19B 3MVDD 3LJAD 3NQJA 1P3OA 5CPJC 3TU4A 5CPIA 5AV5C 3WAAB 4UUZB 5B0ZD 3W96D 4XUJA 3X1TB 3C1BB 1HQ3C 1H3OB 1EQZB 5AV6C 4NFTA 5GXQB 3W99B 1F1EA 1S32C 3UTBC 4M6BA 5AVBB 5B2JA 4ZUXD 4KHAA 3W97A 5B1LD 4WU9B 1KX5C 5DNND 5GSUA 3LZ1C 5BS7A 3C1BD 1EQZD 3NQJB 3AN2A 1P3OB 5CPIB 3W99D 5GT3C 4XUJB 1ZLAC 3REKA 4WU9D 3W98D 1P3IA 4KUDC 2AROA 3KUYC 1P3OD 3TU4D 4Z5TA 3LELA 5AVCD 1P3BC 5GSUB 3X1SC 3AN2B 5CPJA 5BT1D 2HIOC 4WU8B 5F99A 3B6GC 5C3IB 4J8XC 5AV8A 3REKB 4JJNA 5B2JD 3W97D 3KSYA 3VH6A 5GSUD 1P3IB 1WWIA 5B32C 3AZND 3UTBA 4Z5TB 3WKJC 5GT0C 5DNMC 1P3KB 1P3GC 3REKD 1KX5A 3AFAC 3LZ1A 5B0YC 2NQBC 5CPJB 5AV5B 4Z66C 2AROD 5GT3A 4Z5TD 1P3AA 1KX4C 3WTPE 3LELD 1HQ3B 5AV6B 3B0DC 5B24D 2F8NH 4KUDA 3KUYA 5CPJD 1S32B 3UTBB 5F99D 3REHC 3MVDC 2PYOA 3LJAC 5AV8D 4JJND 1P3BA 1KX5B 4H9NA 3LZ1B 5B0ZC 3WTPA 3X1SA 2IO5C 4YM6A 2HIOA 5GT3B 4E45A 4E44A 3UTBD 3B6GA 1ZLAB 3KXBA 1KX5D 1P3MA 3LZ1D 4KUDB 5B32A 4ZUXC 3KUYB 5B1LC 5DNNC 5GT3D 3WKJA 1TAFB 5GT0A 5DNMA 1P3AD 1P3BB 4H9NB 4WZSB 3AFAA 3X1SB 4J8VA 2NQBA 2NZDD 4Z66A 2HIOB 4KUDD 1TZYC 3B6GB 4J8XB 3V9RA 3W98C 2PYOD 3VH5A 1P3BD 3TU4C 3WTPD 5B32B 4EO5C 5G49A 4YM6D 5AVCC 3WKJB 5GT0B 5DNMB 3VH6T 3REHA 3MVDA 1P3GB 3B6GD 3LJAA 3AFAB 5BT1C 3KXBD 5B0YB 4Z2MG 1P3MD 2NQBB 4KGCA 2BYKB 3AZLC 4Z66B 5B32D 2L5AA 5B2JC 3KWQC 3W97C 3AZJC 3V9RB 3WKJD 5DNMD 5GT0D 1KX4B 5B33C 3B0DB 5E5AC 3AFAD 3A6ND 3AZNC 4J8VD 2NQBD 4HGAB 5G49B 1BFMA 4Z66D 2F8NA 5DNNA 3REHB 3MVDB 5B32G 3LJAB 1P3FA 2AROC 5B0ZB 5CPKC 2IO5B 3LELC 1BH8A 1TZYA 4DRBA 5B24C 4CSRA 3REHD 5B40C 5B1MC 1M1AD 5F99C 1R4VA 3REJC 4KGCD 4ZUXB 5AV8C 5B1LB 4R8PA 2YFWB 4JJNC 5AVCA 1JFIB 5DNNB 5KDMA 5CP6D 4H9PA 4WV4B 3B0CT 4AWLC 3AZLA 3KWQA 1BH8B 1TZYB 3AZJA 2F8ND 4CSRB 3W98B 5B31A 3MNNC 5B33A 1P3FD 3TU4B 5E5AA 3AZNA 4EO5B 1P3AC 5AVCB 3VH5T 5KDMB 1TZYD 4H9PB 3NQUA 2NZDC 5CPKA 4H9RA 3AZLB 2PYOC 5B2JB 4KHAB 4R8PD 3KWQB 3W97B 1ULYA 3AZJB 5B24A 5B33B 4QLCC 5B40A 3MGSA 3WTPC 1HTAA 4YM6C 5B1MA 3AZNB 3REJA 3MGPC 3AZLD 3KWQD 3AZJD 3KXBC 5B31D 1P3MC 3NQUB 5B33D 2AROB 4H9SC 5CPKB 3R45A 4ZBJC 5E5AD 3LELB 4J8UC 5B24B 5BO0A 3A6NC 5B40B 3MNNA 4J8VC 4LD9C 3VH6W 5B1MB 5CPKD 5F99B 3REJB 3WA9A 5AV8B 4JJNB 4G91C 5BNXA 2YFVA 5B40D 3MGSD 2NZDA 1P3LA 3R45B 4AWLB 5B1MD 3REJD 5BO0B 4YS3C
chains in the Genus database with same CATH superfamily
3MNNB 4QLCA 2JSSA 1M1AC 4KGCC 3B6FC 1KX3C 1ID3A 1BH9A 3AV1A 5CP6C 1A7WA 1P3AB 3X1UD 3MGPA 1N1JA 2YFVB 2NZDB 3MNND 3RELA 4H9SA 2FJ7A 2PYOB 3WA9D 4X23C 1P3FC 3O62C 4J8UA 3H0MC 3A6NA 4QLCB 3WTPB 4LD9A 4YM6B 1BH9B 3UTAA 1P3LD 3AZIC 3LZ0C 3REIC 1T3UA 2F2AC 3FDDA 3MGPB 3B0CW 2Y2MA 3KXBB 1P34C 1P3PC 1P3MB 4QLCD 1ID3D 4R8PC 4ZBJB 3AV1D 3MGPD 2BYMA 4J8UB 3X1VA 3A6NB 4YS3A 4J8VB 1M1AA 4LD9B 3VH5W 3RELD 1KX3A 3B6FA 4J8WD 5BNVA 2FJ7D 5CP6A 5B31C 5AVBC 4G91B 2LY8A 4J8UD 2ZY4A 4LD9D 3UTAD 4X23A 3AZGA 3O62A 3AZMD 4YS3B 2F8NK 1M1AB 5B2IA 3B6FB 1KX3B 4KGCB 3AZIA 3LZ0A 3REIA 1Q9CA 5CP6B 3MGSC 3AZEC 3X1VD 2CV5A 1U35C 1P34A 4YS3D 1P3PA 1M19A 3B6FD 1KX3D 2F8NB 3WAAA 5AV9C 4X23B 1P3FB 3O62B 3X1TA 5GXQA 3X1UC 3AZIB 3F6TA 3LZ0B 3REIB 2CWEA 5AVBA 4X23D 4H9QA 3AZGD 3O62D 1P34B 5B2ID 3WA9C 4R8PB 3AZID 3LZ0D 3REID 3EPLA 3AV2C 2F8NG 1P3LC 2CV5D 1P34D 1P3PD 3EPHA 1M19D 5AY8C 4Z2MH 3P5JB 3WAAD 2XD1A 5B31B 4H9QB 1ID3C 3AZEA 4NE3A 5FUGA 5E5AB 1U35A 3X1TD 3AV1C 5GXQD 5AV9A 4WU8A 5AVBD 3RELC 1M18C 3AZHC 4J8WC 3MGQC 2FJ7C 4H9RB 3B0BA 3X1UA 5CPID 5JA4A 3MGSB 4XUJD 1P3KA 3AZEB 5FUGB 3UTAC 1U35B 5B31G 3IP4C 3AZMC 3AZFC 5AV5A 5AV9B 4NE6A 1F66C 3AV2A 3C1CC 2RVQD 3AZED 1HQ3A 1U35D 5AV6A 2HUEC 5AY8A 3X1UB 3AN2D 5JA4B 4WNNA 3X1VC 5AV9D 4WU8D 1S32A 5JRGC 3AZKC 4CAYA 3WA9B 1P3ID 4G92C 5BNXB 2Y2NA 3AV2B 1M18A 1P3KD 3AZHA 1P3LB 4J8WA 1ZLAA 3MGQA 1AOIC 5AY8B 3AYWC 4XZQC 1PZRA 2Y2IA 4HGAC 4WNNB 3UT9C 3AZGC 5AV5D 3MGRC 1Z2CB 1TAFA 5B2IC 1ID3B 2Y2HA 3AV2D 1KU5A 4CAYB 3AV1B 3A1KA 1HQ3D 3W96C 5AV6D 5AY8D 4WJ3C 1N1JB 3AZMA 3AZFA 2CV5C 1S32D 4J8XA 3RELB 1M18B 1M19C 3AZHB 1F66A 4J8WB 3MGQB 3C1CA 2FJ7B 3WAAC 2BG1A 2DQNC 3KFUG 3X1TC 3C1BC 1P3GA 5JRGA 1EQZC 3AZKA 5GXQC 3UTAB 1M18D 3AZHD 1ZLAD 3W99C 3MGQD 5B0YA 1B67A 2BYKA 3AZMB 3AZFB 3KUYD 4WU9C 1F66B 2DF4C 1KX4A 3C1CB 1P3OC 5CPIC 1AOIA 2HUEB 3AYWA 4XZQA 3X1SD 4XUJC 2BYMB 3UT9A 4H9OA 3AZFD 3X1VB 2HIOD 3MGRA 5JRGB 4J8XD 3AZKB 1F66D 4NE5A 5BNVB 3C1CD 2RIQA 5B0ZA 3W96A 4G92B 2RVQC 5GSUC 3A1IA 5BS7C 1P3GD 5JRGD 5CHLB 2VQRA 3AZKD 3AN2C 1AOIB 3AYWB 4WU8C 2G5HC 4UUZA 4XZQB 5B0YD 5C3IC 4ZUXA 4H9OB 3UT9B 5B1LA 3AZGB 2YFWA 3REKC 1JFIA 3MGRB 3AL0C 5B2IB 3C1BA 1H3OA 1EQZA 1KX4D 1P3IC 3W99A 1AOID 3W96B 1WWSA 1B6WA 3AYWD 4Z5TC 4XZQD 4DRAA 1P3KC 3UT9D 2CV5B 4WU9A 1P3PB 2ZM5A 3W98A 3MGRD 1M19B 3MVDD 2ZY2A 3LJAD 3NQJA 1P3OA 5CPJC 3TU4A 5CPIA 5AV5C 3WAAB 4UUZB 5B0ZD 3W96D 4XUJA 2J8PA 3X1TB 3C1BB 1HQ3C 1H3OB 1EQZB 5AV6C 1W2EA 4NFTA 5GXQB 3W99B 1F1EA 1S32C 3UTBC 4M6BA 5AVBB 5B2JA 4ZUXD 4KHAA 3W97A 5B1LD 4WU9B 1KX5C 5DNND 5GSUA 3LZ1C 5BS7A 3C1BD 1EQZD 3NQJB 3AN2A 1P3OB 5CPIB 3W99D 5GT3C 4XUJB 1ZLAC 3REKA 4WU9D 3W98D 1P3IA 4KUDC 2AROA 3KUYC 1P3OD 3TU4D 4Z5TA 3LELA 5AVCD 1P3BC 5GSUB 2UWXA 3AN2B 3X1SC 5CPJA 5BT1D 2HIOC 4WU8B 5F99A 3B6GC 5C3IB 4J8XC 5AV8A 3REKB 4JJNA 5B2JD 3W97D 3KSYA 3VH6A 5GSUD 1P3IB 1WWIA 5B32C 2Y2PA 3AZND 3UTBA 4Z5TB 3WKJC 5GT0C 5DNMC 1P3KB 1P3GC 3REKD 1KX5A 3AFAC 3LZ1A 5B0YC 2NQBC 5CPJB 5AV5B 4Z66C 2AROD 5GT3A 2ZY5A 4Z5TD 1P3AA 1KX4C 3WTPE 3LELD 1HQ3B 5AV6B 3B0DC 5B24D 2F8NH 4KUDA 3KUYA 5CPJD 1S32B 3UTBB 5F99D 3REHC 3MVDC 2PYOA 3LJAC 5AV8D 4JJND 1P3BA 1KX5B 4H9NA 3LZ1B 5B0ZC 3WTPA 3X1SA 2IO5C 4YM6A 3EPKA 2HIOA 5GT3B 4E45A 4E44A 3UTBD 3B6GA 1ZLAB 3KXBA 1KX5D 1P3MA 3LZ1D 4KUDB 5B32A 4ZUXC 3KUYB 5B1LC 5DNNC 5GT3D 3WKJA 1TAFB 5DNMA 5GT0A 1P3AD 1P3BB 4H9NB 4WZSB 3AFAA 3X1SB 3EG5B 4J8VA 2NQBA 2NZDD 4Z66A 2HIOB 4KUDD 1TZYC 3B6GB 4J8XB 3V9RA 2G5IC 2Y2GA 2PYOD 3W98C 3VH5A 1P3BD 3TU4C 3H0LC 3WTPD 5B32B 4EO5C 5G49A 4YM6D 5AVCC 3WKJB 5GT0B 5DNMB 3VH6T 3REHA 3MVDA 1P3GB 3B6GD 3LJAA 3AFAB 5BT1C 3KXBD 5B0YB 4Z2MG 1P3MD 2NQBB 4KGCA 2BYKB 3AZLC 4Z66B 5B32D 2L5AA 5B2JC 3KWQC 3W97C 3AZJC 3V9RB 3WKJD 5DNMD 5GT0D 1KX4B 5B33C 3B0DB 5E5AC 3AFAD 3A6ND 3AZNC 4J8VD 2NQBD 4HGAB 5G49B 1BFMA 4Z66D 2W8SA 2Y2OA 2F8NA 5DNNA 3REHB 4UPKA 3MVDB 5B32G 3LJAB 1P3FA 3H0RC 2AROC 3EPJA 5B0ZB 2ZY3A 5CPKC 2IO5B 2JCHA 3LELC 1BH8A 1TZYA 2Y2JA 4DRBA 5B24C 4CSRA 3REHD 5B40C 5B1MC 4DQYB 1M1AD 2FFFB 1R4VA 5F99C 3REJC 4ZUXB 4KGCD 5AV8C 5B1LB 4R8PA 2YFWB 4JJNC 5AVCA 1JFIB 5DNNB 5KDMA 5CP6D 4H9PA 4WV4B 3B0CT 4AWLC 2Y2QA 2Y2LA 3AZLA 3KWQA 1BH8B 1TZYB 3AZJA 2F8ND 4CSRB 3W98B 5B31A 3MNNC 5B33A 1P3FD 3TU4B 5E5AA 3AZNA 4EO5B 1P3AC 5AVCB 3VH5T 5KDMB 1TZYD 4H9PB 3NQUA 2NZDC 5CPKA 4H9RA 3AZLB 2PYOC 2Y2KA 5B2JB 4KHAB 4R8PD 3KWQB 3W97B 1ULYA 3AZJB 5B24A 2JE5A 4QLCC 5B40A 5B33B 3WTPC 1HTAA 3MGSA 4YM6C 5B1MA 3AZNB 3REJA 3MGPC 3AZLD 3KWQD 3AZJD 3KXBC 5B31D 1P3MC 3NQUB 5B33D 2AROB 4H9SC 5CPKB 3R45A 4ZBJC 5E5AD 3LELB 4J8UC 5B24B 5BO0A 3A6NC 5B40B 3MNNA 4J8VC 4LD9C 3VH6W 2XD5A 5B1MB 5CPKD 5F99B 3REJB 3WA9A 5AV8B 4JJNB 4G91C 5BNXA 2YFVA 5B40D 3MGSD 2NZDA 1P3LA 3R45B 4AWLB 5B1MD 3REJD 5BO0B 4YS3C
chains in the Genus database with same CATH topology
3MNNB 4QLCA 2JSSA 1M1AC 4KGCC 3B6FC 1KX3C 1ID3A 1BH9A 3AV1A 5CP6C 1A7WA 1P3AB 3X1UD 3MGPA 1N1JA 2YFVB 2NZDB 3MNND 3RELA 4H9SA 2FJ7A 2PYOB 3WA9D 4X23C 1P3FC 3O62C 4J8UA 3H0MC 3A6NA 4QLCB 3WTPB 4LD9A 4YM6B 1BH9B 3UTAA 1P3LD 3AZIC 3LZ0C 3REIC 1T3UA 2F2AC 3FDDA 3MGPB 3B0CW 2Y2MA 3KXBB 1P34C 1P3PC 1P3MB 4QLCD 1ID3D 4R8PC 4ZBJB 3AV1D 3MGPD 2BYMA 4J8UB 3X1VA 3A6NB 4YS3A 4J8VB 1M1AA 4LD9B 3VH5W 3RELD 1KX3A 3B6FA 4J8WD 5BNVA 2FJ7D 5CP6A 5B31C 5AVBC 4G91B 2LY8A 4J8UD 2ZY4A 4LD9D 3UTAD 4X23A 3AZGA 3O62A 3AZMD 4YS3B 2F8NK 1M1AB 5B2IA 3B6FB 1KX3B 4KGCB 3AZIA 3LZ0A 3REIA 1Q9CA 5CP6B 3MGSC 3AZEC 3X1VD 2CV5A 1U35C 1P34A 4YS3D 1P3PA 1M19A 3B6FD 1KX3D 2F8NB 3WAAA 5AV9C 4X23B 1P3FB 3O62B 3X1TA 5GXQA 3X1UC 3AZIB 3F6TA 3LZ0B 3REIB 2CWEA 5AVBA 4X23D 4H9QA 3AZGD 3O62D 1P34B 5B2ID 3WA9C 4R8PB 3AZID 3LZ0D 3REID 3EPLA 3AV2C 2F8NG 1P3LC 2CV5D 1P34D 1P3PD 3EPHA 1M19D 5AY8C 4Z2MH 3P5JB 3WAAD 2XD1A 5B31B 4H9QB 1ID3C 3AZEA 4NE3A 5FUGA 5E5AB 1U35A 3X1TD 3AV1C 5GXQD 5AV9A 4WU8A 5AVBD 3RELC 1M18C 3AZHC 4J8WC 3MGQC 2FJ7C 4H9RB 3B0BA 3X1UA 5CPID 5JA4A 3MGSB 4XUJD 1P3KA 3AZEB 5FUGB 3UTAC 1U35B 5B31G 3IP4C 3AZMC 3AZFC 5AV5A 5AV9B 4NE6A 1F66C 3AV2A 3C1CC 2RVQD 3AZED 1HQ3A 1U35D 5AV6A 2HUEC 5AY8A 3X1UB 3AN2D 5JA4B 4WNNA 3X1VC 5AV9D 4WU8D 1S32A 5JRGC 3AZKC 4CAYA 3WA9B 1P3ID 4G92C 5BNXB 2Y2NA 3AV2B 1M18A 1P3KD 3AZHA 1P3LB 4J8WA 1ZLAA 3MGQA 1AOIC 5AY8B 3AYWC 4XZQC 1PZRA 2Y2IA 4HGAC 4WNNB 3UT9C 3AZGC 5AV5D 3MGRC 1Z2CB 1TAFA 5B2IC 1ID3B 2Y2HA 3AV2D 1KU5A 4CAYB 3AV1B 3A1KA 1HQ3D 3W96C 5AV6D 5AY8D 4WJ3C 1N1JB 3AZMA 3AZFA 2CV5C 1S32D 4J8XA 3RELB 1M18B 1M19C 3AZHB 1F66A 4J8WB 3MGQB 3C1CA 2FJ7B 3WAAC 2BG1A 2DQNC 3KFUG 3X1TC 3C1BC 1P3GA 5JRGA 1EQZC 3AZKA 5GXQC 3UTAB 1M18D 3AZHD 1ZLAD 3W99C 3MGQD 5B0YA 1B67A 2BYKA 3AZMB 3AZFB 3KUYD 4WU9C 1F66B 2DF4C 1KX4A 3C1CB 1P3OC 5CPIC 1AOIA 2HUEB 3AYWA 4XZQA 3X1SD 4XUJC 2BYMB 3UT9A 4H9OA 3AZFD 3X1VB 2HIOD 3MGRA 5JRGB 4J8XD 3AZKB 1F66D 4NE5A 5BNVB 3C1CD 2RIQA 5B0ZA 3W96A 4G92B 2RVQC 5GSUC 3A1IA 5BS7C 1P3GD 5JRGD 5CHLB 2VQRA 3AZKD 3AN2C 1AOIB 3AYWB 4WU8C 2G5HC 4UUZA 4XZQB 5B0YD 5C3IC 4ZUXA 4H9OB 3UT9B 5B1LA 3AZGB 2YFWA 3REKC 1JFIA 3MGRB 3AL0C 5B2IB 3C1BA 1H3OA 1EQZA 1KX4D 1P3IC 3W99A 1AOID 3W96B 1WWSA 1B6WA 3AYWD 4Z5TC 4XZQD 4DRAA 1P3KC 3UT9D 2CV5B 4WU9A 1P3PB 2ZM5A 3W98A 3MGRD 1M19B 3MVDD 2ZY2A 3LJAD 3NQJA 1P3OA 5CPJC 3TU4A 5CPIA 5AV5C 3WAAB 4UUZB 5B0ZD 3W96D 4XUJA 2J8PA 3X1TB 3C1BB 1HQ3C 1H3OB 1EQZB 5AV6C 1W2EA 4NFTA 5GXQB 3W99B 1F1EA 1S32C 3UTBC 4M6BA 5AVBB 5B2JA 4ZUXD 4KHAA 3W97A 5B1LD 4WU9B 1KX5C 5DNND 5GSUA 3LZ1C 5BS7A 3C1BD 1EQZD 3NQJB 3AN2A 1P3OB 5CPIB 3W99D 5GT3C 4XUJB 1ZLAC 3REKA 4WU9D 3W98D 1P3IA 4KUDC 2AROA 3KUYC 1P3OD 3TU4D 4Z5TA 3LELA 5AVCD 1P3BC 5GSUB 2UWXA 3AN2B 3X1SC 5CPJA 5BT1D 2HIOC 4WU8B 5F99A 3B6GC 5C3IB 4J8XC 5AV8A 3REKB 4JJNA 5B2JD 3W97D 3KSYA 3VH6A 5GSUD 1P3IB 1WWIA 5B32C 2Y2PA 3AZND 3UTBA 4Z5TB 3WKJC 5GT0C 5DNMC 1P3KB 1P3GC 3REKD 1KX5A 3AFAC 3LZ1A 5B0YC 2NQBC 5CPJB 5AV5B 4Z66C 2AROD 5GT3A 2ZY5A 4Z5TD 1P3AA 1KX4C 3WTPE 3LELD 1HQ3B 5AV6B 3B0DC 5B24D 2F8NH 4KUDA 3KUYA 5CPJD 1S32B 3UTBB 5F99D 3REHC 3MVDC 2PYOA 3LJAC 5AV8D 4JJND 1P3BA 1KX5B 4H9NA 3LZ1B 5B0ZC 3WTPA 3X1SA 2IO5C 4YM6A 3EPKA 2HIOA 5GT3B 4E45A 4E44A 3UTBD 3B6GA 1ZLAB 3KXBA 1KX5D 1P3MA 3LZ1D 4KUDB 5B32A 4ZUXC 3KUYB 5B1LC 5DNNC 5GT3D 3WKJA 1TAFB 5DNMA 5GT0A 1P3AD 1P3BB 4H9NB 4WZSB 3AFAA 3X1SB 3EG5B 4J8VA 2NQBA 2NZDD 4Z66A 2HIOB 4KUDD 1TZYC 3B6GB 4J8XB 3V9RA 2G5IC 2Y2GA 2PYOD 3W98C 3VH5A 1P3BD 3TU4C 3H0LC 3WTPD 5B32B 4EO5C 5G49A 4YM6D 5AVCC 3WKJB 5GT0B 5DNMB 3VH6T 3REHA 3MVDA 1P3GB 3B6GD 3LJAA 3AFAB 5BT1C 3KXBD 5B0YB 4Z2MG 1P3MD 2NQBB 4KGCA 2BYKB 3AZLC 4Z66B 5B32D 2L5AA 5B2JC 3KWQC 3W97C 3AZJC 3V9RB 3WKJD 5DNMD 5GT0D 1KX4B 5B33C 3B0DB 5E5AC 3AFAD 3A6ND 3AZNC 4J8VD 2NQBD 4HGAB 5G49B 1BFMA 4Z66D 2W8SA 2Y2OA 2F8NA 5DNNA 3REHB 4UPKA 3MVDB 5B32G 3LJAB 1P3FA 3H0RC 2AROC 3EPJA 5B0ZB 2ZY3A 5CPKC 2IO5B 2JCHA 3LELC 1BH8A 1TZYA 2Y2JA 4DRBA 5B24C 4CSRA 3REHD 5B40C 5B1MC 4DQYB 1M1AD 2FFFB 1R4VA 5F99C 3REJC 4ZUXB 4KGCD 5AV8C 5B1LB 4R8PA 2YFWB 4JJNC 5AVCA 1JFIB 5DNNB 5KDMA 5CP6D 4H9PA 4WV4B 3B0CT 4AWLC 2Y2QA 2Y2LA 3AZLA 3KWQA 1BH8B 1TZYB 3AZJA 2F8ND 4CSRB 3W98B 5B31A 3MNNC 5B33A 1P3FD 3TU4B 5E5AA 3AZNA 4EO5B 1P3AC 5AVCB 3VH5T 5KDMB 1TZYD 4H9PB 3NQUA 2NZDC 5CPKA 4H9RA 3AZLB 2PYOC 2Y2KA 5B2JB 4KHAB 4R8PD 3KWQB 3W97B 1ULYA 3AZJB 5B24A 2JE5A 4QLCC 5B40A 5B33B 3WTPC 1HTAA 3MGSA 4YM6C 5B1MA 3AZNB 3REJA 3MGPC 3AZLD 3KWQD 3AZJD 3KXBC 5B31D 1P3MC 3NQUB 5B33D 2AROB 4H9SC 5CPKB 3R45A 4ZBJC 5E5AD 3LELB 4J8UC 5B24B 5BO0A 3A6NC 5B40B 3MNNA 4J8VC 4LD9C 3VH6W 2XD5A 5B1MB 5CPKD 5F99B 3REJB 3WA9A 5AV8B 4JJNB 4G91C 5BNXA 2YFVA 5B40D 3MGSD 2NZDA 1P3LA 3R45B 4AWLB 5B1MD 3REJD 5BO0B 4YS3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MNN B;  4QLC A;  2JSS A;  1M1A C;  4KGC C;  3B6F C;  1KX3 C;  1ID3 A;  1BH9 A;  3AV1 A;  5CP6 C;  1A7W A;  1P3A B;  3X1U D;  3MGP A;  1N1J A;  2YFV B;  2NZD B;  3MNN D;  3REL A;  4H9S A;  2FJ7 A;  2PYO B;  3WA9 D;  4X23 C;  1P3F C;  3O62 C;  4J8U A;  3A6N A;  4QLC B;  3WTP B;  4LD9 A;  4YM6 B;  1BH9 B;  3UTA A;  1P3L D;  3AZI C;  3LZ0 C;  3REI C;  3MGP B;  3B0C W;  3KXB B;  1P34 C;  1P3P C;  1P3M B;  4QLC D;  1ID3 D;  4R8P C;  4ZBJ B;  3AV1 D;  3MGP D;  2BYM A;  4J8U B;  3X1V A;  3A6N B;  4YS3 A;  4J8V B;  1M1A A;  4LD9 B;  3VH5 W;  3REL D;  1KX3 A;  3B6F A;  4J8W D;  5BNV A;  2FJ7 D;  5CP6 A;  5B31 C;  5AVB C;  4G91 B;  2LY8 A;  4J8U D;  4LD9 D;  3UTA D;  4X23 A;  3AZG A;  3O62 A;  3AZM D;  4YS3 B;  2F8N K;  1M1A B;  5B2I A;  3B6F B;  1KX3 B;  4KGC B;  3AZI A;  3LZ0 A;  3REI A;  1Q9C A;  5CP6 B;  3MGS C;  3AZE C;  3X1V D;  2CV5 A;  1U35 C;  1P34 A;  4YS3 D;  1P3P A;  1M19 A;  3B6F D;  1KX3 D;  2F8N B;  3WAA A;  5AV9 C;  4X23 B;  1P3F B;  3O62 B;  3X1T A;  5GXQ A;  3X1U C;  3AZI B;  3LZ0 B;  3REI B;  2CWE A;  5AVB A;  4X23 D;  4H9Q A;  3AZG D;  3O62 D;  1P34 B;  5B2I D;  3WA9 C;  4R8P B;  3AZI D;  3LZ0 D;  3REI D;  3AV2 C;  2F8N G;  1P3L C;  2CV5 D;  1P34 D;  1P3P D;  1M19 D;  5AY8 C;  4Z2M H;  3WAA D;  5B31 B;  4H9Q B;  1ID3 C;  3AZE A;  4NE3 A;  5FUG A;  5E5A B;  1U35 A;  3X1T D;  3AV1 C;  5GXQ D;  4WU8 A;  5AV9 A;  5AVB D;  3REL C;  1M18 C;  3AZH C;  4J8W C;  3MGQ C;  2FJ7 C;  4H9R B;  3B0B A;  3X1U A;  5CPI D;  5JA4 A;  3MGS B;  4XUJ D;  1P3K A;  3AZE B;  5FUG B;  3UTA C;  1U35 B;  5B31 G;  3AZM C;  3AZF C;  5AV5 A;  5AV9 B;  4NE6 A;  1F66 C;  3AV2 A;  3C1C C;  2RVQ D;  3AZE D;  1HQ3 A;  1U35 D;  5AV6 A;  2HUE C;  5AY8 A;  3X1U B;  3AN2 D;  5JA4 B;  4WNN A;  3X1V C;  5AV9 D;  4WU8 D;  1S32 A;  5JRG C;  3AZK C;  4CAY A;  3WA9 B;  1P3I D;  4G92 C;  5BNX B;  3AV2 B;  1M18 A;  1P3K D;  3AZH A;  1P3L B;  4J8W A;  1ZLA A;  3MGQ A;  1AOI C;  5AY8 B;  3AYW C;  4XZQ C;  4HGA C;  4WNN B;  3UT9 C;  3AZG C;  5AV5 D;  3MGR C;  1TAF A;  5B2I C;  1ID3 B;  3AV2 D;  1KU5 A;  4CAY B;  3AV1 B;  1HQ3 D;  3W96 C;  5AV6 D;  5AY8 D;  1N1J B;  3AZM A;  3AZF A;  2CV5 C;  1S32 D;  4J8X A;  3REL B;  1M18 B;  1M19 C;  3AZH B;  1F66 A;  4J8W B;  3MGQ B;  3C1C A;  2FJ7 B;  3WAA C;  3X1T C;  3C1B C;  1P3G A;  5JRG A;  1EQZ C;  3AZK A;  5GXQ C;  3UTA B;  1M18 D;  3AZH D;  1ZLA D;  3W99 C;  3MGQ D;  5B0Y A;  1B67 A;  2BYK A;  3AZM B;  3AZF B;  3KUY D;  4WU9 C;  1F66 B;  1KX4 A;  3C1C B;  1P3O C;  5CPI C;  1AOI A;  2HUE B;  3AYW A;  4XZQ A;  3X1S D;  4XUJ C;  2BYM B;  3UT9 A;  4H9O A;  3AZF D;  3X1V B;  2HIO D;  3MGR A;  5JRG B;  4J8X D;  3AZK B;  1F66 D;  4NE5 A;  5BNV B;  3C1C D;  5B0Z A;  3W96 A;  4G92 B;  2RVQ C;  5GSU C;  5BS7 C;  1P3G D;  5JRG D;  5CHL B;  3AZK D;  3AN2 C;  1AOI B;  3AYW B;  4WU8 C;  4UUZ A;  4XZQ B;  5B0Y D;  5C3I C;  4ZUX A;  4H9O B;  3UT9 B;  5B1L A;  3AZG B;  2YFW A;  3REK C;  1JFI A;  3MGR B;  5B2I B;  3C1B A;  1H3O A;  1EQZ A;  1KX4 D;  1P3I C;  3W99 A;  1AOI D;  3W96 B;  1WWS A;  1B6W A;  3AYW D;  4Z5T C;  4XZQ D;  4DRA A;  1P3K C;  3UT9 D;  2CV5 B;  4WU9 A;  1P3P B;  3W98 A;  3MGR D;  1M19 B;  3MVD D;  3LJA D;  3NQJ A;  1P3O A;  5CPJ C;  3TU4 A;  5CPI A;  5AV5 C;  3WAA B;  4UUZ B;  5B0Z D;  3W96 D;  4XUJ A;  3X1T B;  3C1B B;  1HQ3 C;  1H3O B;  1EQZ B;  5AV6 C;  4NFT A;  5GXQ B;  3W99 B;  1F1E A;  1S32 C;  3UTB C;  4M6B A;  5AVB B;  5B2J A;  4ZUX D;  4KHA A;  3W97 A;  5B1L D;  4WU9 B;  1KX5 C;  5DNN D;  5GSU A;  3LZ1 C;  5BS7 A;  3C1B D;  1EQZ D;  3NQJ B;  3AN2 A;  1P3O B;  5CPI B;  3W99 D;  5GT3 C;  4XUJ B;  1ZLA C;  3REK A;  4WU9 D;  3W98 D;  1P3I A;  4KUD C;  2ARO A;  3KUY C;  1P3O D;  3TU4 D;  4Z5T A;  3LEL A;  5AVC D;  1P3B C;  5GSU B;  3X1S C;  3AN2 B;  5CPJ A;  5BT1 D;  2HIO C;  4WU8 B;  5F99 A;  3B6G C;  5C3I B;  4J8X C;  5AV8 A;  3REK B;  4JJN A;  5B2J D;  3W97 D;  3KSY A;  3VH6 A;  5GSU D;  1P3I B;  1WWI A;  5B32 C;  3AZN D;  3UTB A;  4Z5T B;  3WKJ C;  5GT0 C;  5DNM C;  1P3K B;  1P3G C;  3REK D;  1KX5 A;  3AFA C;  3LZ1 A;  5B0Y C;  2NQB C;  5CPJ B;  5AV5 B;  4Z66 C;  2ARO D;  5GT3 A;  4Z5T D;  1P3A A;  1KX4 C;  3WTP E;  3LEL D;  1HQ3 B;  5AV6 B;  3B0D C;  5B24 D;  2F8N H;  4KUD A;  3KUY A;  5CPJ D;  1S32 B;  3UTB B;  5F99 D;  3REH C;  3MVD C;  2PYO A;  3LJA C;  5AV8 D;  4JJN D;  1P3B A;  1KX5 B;  4H9N A;  3LZ1 B;  5B0Z C;  3WTP A;  3X1S A;  2IO5 C;  4YM6 A;  2HIO A;  5GT3 B;  4E45 A;  4E44 A;  3UTB D;  3B6G A;  1ZLA B;  3KXB A;  1KX5 D;  1P3M A;  3LZ1 D;  4KUD B;  5B32 A;  4ZUX C;  3KUY B;  5B1L C;  5DNN C;  5GT3 D;  3WKJ A;  1TAF B;  5GT0 A;  5DNM A;  1P3A D;  1P3B B;  4H9N B;  4WZS B;  3AFA A;  3X1S B;  4J8V A;  2NQB A;  2NZD D;  4Z66 A;  2HIO B;  4KUD D;  1TZY C;  3B6G B;  4J8X B;  3V9R A;  3W98 C;  2PYO D;  3VH5 A;  1P3B D;  3TU4 C;  3WTP D;  5B32 B;  4EO5 C;  5G49 A;  4YM6 D;  5AVC C;  3WKJ B;  5GT0 B;  5DNM B;  3VH6 T;  3REH A;  3MVD A;  1P3G B;  3B6G D;  3LJA A;  3AFA B;  5BT1 C;  3KXB D;  5B0Y B;  4Z2M G;  1P3M D;  2NQB B;  4KGC A;  2BYK B;  3AZL C;  4Z66 B;  5B32 D;  2L5A A;  5B2J C;  3KWQ C;  3W97 C;  3AZJ C;  3V9R B;  3WKJ D;  5DNM D;  5GT0 D;  1KX4 B;  5B33 C;  3B0D B;  5E5A C;  3AFA D;  3A6N D;  3AZN C;  4J8V D;  2NQB D;  4HGA B;  5G49 B;  1BFM A;  4Z66 D;  2F8N A;  5DNN A;  3REH B;  3MVD B;  5B32 G;  3LJA B;  1P3F A;  2ARO C;  5B0Z B;  5CPK C;  2IO5 B;  3LEL C;  1BH8 A;  1TZY A;  4DRB A;  5B24 C;  4CSR A;  3REH D;  5B40 C;  5B1M C;  1M1A D;  5F99 C;  1R4V A;  3REJ C;  4KGC D;  4ZUX B;  5AV8 C;  5B1L B;  4R8P A;  2YFW B;  4JJN C;  5AVC A;  1JFI B;  5DNN B;  5KDM A;  5CP6 D;  4H9P A;  4WV4 B;  3B0C T;  4AWL C;  3AZL A;  3KWQ A;  1BH8 B;  1TZY B;  3AZJ A;  2F8N D;  4CSR B;  3W98 B;  5B31 A;  3MNN C;  5B33 A;  1P3F D;  3TU4 B;  5E5A A;  3AZN A;  4EO5 B;  1P3A C;  5AVC B;  3VH5 T;  5KDM B;  1TZY D;  4H9P B;  3NQU A;  2NZD C;  5CPK A;  4H9R A;  3AZL B;  2PYO C;  5B2J B;  4KHA B;  4R8P D;  3KWQ B;  3W97 B;  1ULY A;  3AZJ B;  5B24 A;  5B33 B;  4QLC C;  5B40 A;  3MGS A;  3WTP C;  1HTA A;  4YM6 C;  5B1M A;  3AZN B;  3REJ A;  3MGP C;  3AZL D;  3KWQ D;  3AZJ D;  3KXB C;  5B31 D;  1P3M C;  3NQU B;  5B33 D;  2ARO B;  4H9S C;  5CPK B;  3R45 A;  4ZBJ C;  5E5A D;  3LEL B;  4J8U C;  5B24 B;  5BO0 A;  3A6N C;  5B40 B;  3MNN A;  4J8V C;  4LD9 C;  3VH6 W;  5B1M B;  5CPK D;  5F99 B;  3REJ B;  3WA9 A;  5AV8 B;  4JJN B;  4G91 C;  5BNX A;  2YFV A;  5B40 D;  3MGS D;  2NZD A;  1P3L A;  3R45 B;  4AWL B;  5B1M D;  3REJ D;  5BO0 B;  4YS3 C; 
#chains in the Genus database with same CATH topology
 3MNN B;  4QLC A;  2JSS A;  1M1A C;  4KGC C;  3B6F C;  1KX3 C;  1ID3 A;  1BH9 A;  3AV1 A;  5CP6 C;  1A7W A;  1P3A B;  3X1U D;  3MGP A;  1N1J A;  2YFV B;  2NZD B;  3MNN D;  3REL A;  4H9S A;  2FJ7 A;  2PYO B;  3WA9 D;  4X23 C;  1P3F C;  3O62 C;  4J8U A;  3H0M C;  3A6N A;  4QLC B;  3WTP B;  4LD9 A;  4YM6 B;  1BH9 B;  3UTA A;  1P3L D;  3AZI C;  3LZ0 C;  3REI C;  1T3U A;  2F2A C;  3FDD A;  3MGP B;  3B0C W;  2Y2M A;  3KXB B;  1P34 C;  1P3P C;  1P3M B;  4QLC D;  1ID3 D;  4R8P C;  4ZBJ B;  3AV1 D;  3MGP D;  2BYM A;  4J8U B;  3X1V A;  3A6N B;  4YS3 A;  4J8V B;  1M1A A;  4LD9 B;  3VH5 W;  3REL D;  1KX3 A;  3B6F A;  4J8W D;  5BNV A;  2FJ7 D;  5CP6 A;  5B31 C;  5AVB C;  4G91 B;  2LY8 A;  4J8U D;  2ZY4 A;  4LD9 D;  3UTA D;  4X23 A;  3AZG A;  3O62 A;  3AZM D;  4YS3 B;  2F8N K;  1M1A B;  5B2I A;  3B6F B;  1KX3 B;  4KGC B;  3AZI A;  3LZ0 A;  3REI A;  1Q9C A;  5CP6 B;  3MGS C;  3AZE C;  3X1V D;  2CV5 A;  1U35 C;  1P34 A;  4YS3 D;  1P3P A;  1M19 A;  3B6F D;  1KX3 D;  2F8N B;  3WAA A;  5AV9 C;  4X23 B;  1P3F B;  3O62 B;  3X1T A;  5GXQ A;  3X1U C;  3AZI B;  3F6T A;  3LZ0 B;  3REI B;  2CWE A;  5AVB A;  4X23 D;  4H9Q A;  3AZG D;  3O62 D;  1P34 B;  5B2I D;  3WA9 C;  4R8P B;  3AZI D;  3LZ0 D;  3REI D;  3EPL A;  3AV2 C;  2F8N G;  1P3L C;  2CV5 D;  1P34 D;  1P3P D;  3EPH A;  1M19 D;  5AY8 C;  4Z2M H;  3P5J B;  3WAA D;  2XD1 A;  5B31 B;  4H9Q B;  1ID3 C;  3AZE A;  4NE3 A;  5FUG A;  5E5A B;  1U35 A;  3X1T D;  3AV1 C;  5GXQ D;  5AV9 A;  4WU8 A;  5AVB D;  3REL C;  1M18 C;  3AZH C;  4J8W C;  3MGQ C;  2FJ7 C;  4H9R B;  3B0B A;  3X1U A;  5CPI D;  5JA4 A;  3MGS B;  4XUJ D;  1P3K A;  3AZE B;  5FUG B;  3UTA C;  1U35 B;  5B31 G;  3IP4 C;  3AZM C;  3AZF C;  5AV5 A;  5AV9 B;  4NE6 A;  1F66 C;  3AV2 A;  3C1C C;  2RVQ D;  3AZE D;  1HQ3 A;  1U35 D;  5AV6 A;  2HUE C;  5AY8 A;  3X1U B;  3AN2 D;  5JA4 B;  4WNN A;  3X1V C;  5AV9 D;  4WU8 D;  1S32 A;  5JRG C;  3AZK C;  4CAY A;  3WA9 B;  1P3I D;  4G92 C;  5BNX B;  2Y2N A;  3AV2 B;  1M18 A;  1P3K D;  3AZH A;  1P3L B;  4J8W A;  1ZLA A;  3MGQ A;  1AOI C;  5AY8 B;  3AYW C;  4XZQ C;  1PZR A;  2Y2I A;  4HGA C;  4WNN B;  3UT9 C;  3AZG C;  5AV5 D;  3MGR C;  1Z2C B;  1TAF A;  5B2I C;  1ID3 B;  2Y2H A;  3AV2 D;  1KU5 A;  4CAY B;  3AV1 B;  3A1K A;  1HQ3 D;  3W96 C;  5AV6 D;  5AY8 D;  4WJ3 C;  1N1J B;  3AZM A;  3AZF A;  2CV5 C;  1S32 D;  4J8X A;  3REL B;  1M18 B;  1M19 C;  3AZH B;  1F66 A;  4J8W B;  3MGQ B;  3C1C A;  2FJ7 B;  3WAA C;  2BG1 A;  2DQN C;  3KFU G;  3X1T C;  3C1B C;  1P3G A;  5JRG A;  1EQZ C;  3AZK A;  5GXQ C;  3UTA B;  1M18 D;  3AZH D;  1ZLA D;  3W99 C;  3MGQ D;  5B0Y A;  1B67 A;  2BYK A;  3AZM B;  3AZF B;  3KUY D;  4WU9 C;  1F66 B;  2DF4 C;  1KX4 A;  3C1C B;  1P3O C;  5CPI C;  1AOI A;  2HUE B;  3AYW A;  4XZQ A;  3X1S D;  4XUJ C;  2BYM B;  3UT9 A;  4H9O A;  3AZF D;  3X1V B;  2HIO D;  3MGR A;  5JRG B;  4J8X D;  3AZK B;  1F66 D;  4NE5 A;  5BNV B;  3C1C D;  2RIQ A;  5B0Z A;  3W96 A;  4G92 B;  2RVQ C;  5GSU C;  3A1I A;  5BS7 C;  1P3G D;  5JRG D;  5CHL B;  2VQR A;  3AZK D;  3AN2 C;  1AOI B;  3AYW B;  4WU8 C;  2G5H C;  4UUZ A;  4XZQ B;  5B0Y D;  5C3I C;  4ZUX A;  4H9O B;  3UT9 B;  5B1L A;  3AZG B;  2YFW A;  3REK C;  1JFI A;  3MGR B;  3AL0 C;  5B2I B;  3C1B A;  1H3O A;  1EQZ A;  1KX4 D;  1P3I C;  3W99 A;  1AOI D;  3W96 B;  1WWS A;  1B6W A;  3AYW D;  4Z5T C;  4XZQ D;  4DRA A;  1P3K C;  3UT9 D;  2CV5 B;  4WU9 A;  1P3P B;  2ZM5 A;  3W98 A;  3MGR D;  1M19 B;  3MVD D;  2ZY2 A;  3LJA D;  3NQJ A;  1P3O A;  5CPJ C;  3TU4 A;  5CPI A;  5AV5 C;  3WAA B;  4UUZ B;  5B0Z D;  3W96 D;  4XUJ A;  2J8P A;  3X1T B;  3C1B B;  1HQ3 C;  1H3O B;  1EQZ B;  5AV6 C;  1W2E A;  4NFT A;  5GXQ B;  3W99 B;  1F1E A;  1S32 C;  3UTB C;  4M6B A;  5AVB B;  5B2J A;  4ZUX D;  4KHA A;  3W97 A;  5B1L D;  4WU9 B;  1KX5 C;  5DNN D;  5GSU A;  3LZ1 C;  5BS7 A;  3C1B D;  1EQZ D;  3NQJ B;  3AN2 A;  1P3O B;  5CPI B;  3W99 D;  5GT3 C;  4XUJ B;  1ZLA C;  3REK A;  4WU9 D;  3W98 D;  1P3I A;  4KUD C;  2ARO A;  3KUY C;  1P3O D;  3TU4 D;  4Z5T A;  3LEL A;  5AVC D;  1P3B C;  5GSU B;  2UWX A;  3AN2 B;  3X1S C;  5CPJ A;  5BT1 D;  2HIO C;  4WU8 B;  5F99 A;  3B6G C;  5C3I B;  4J8X C;  5AV8 A;  3REK B;  4JJN A;  5B2J D;  3W97 D;  3KSY A;  3VH6 A;  5GSU D;  1P3I B;  1WWI A;  5B32 C;  2Y2P A;  3AZN D;  3UTB A;  4Z5T B;  3WKJ C;  5GT0 C;  5DNM C;  1P3K B;  1P3G C;  3REK D;  1KX5 A;  3AFA C;  3LZ1 A;  5B0Y C;  2NQB C;  5CPJ B;  5AV5 B;  4Z66 C;  2ARO D;  5GT3 A;  2ZY5 A;  4Z5T D;  1P3A A;  1KX4 C;  3WTP E;  3LEL D;  1HQ3 B;  5AV6 B;  3B0D C;  5B24 D;  2F8N H;  4KUD A;  3KUY A;  5CPJ D;  1S32 B;  3UTB B;  5F99 D;  3REH C;  3MVD C;  2PYO A;  3LJA C;  5AV8 D;  4JJN D;  1P3B A;  1KX5 B;  4H9N A;  3LZ1 B;  5B0Z C;  3WTP A;  3X1S A;  2IO5 C;  4YM6 A;  3EPK A;  2HIO A;  5GT3 B;  4E45 A;  4E44 A;  3UTB D;  3B6G A;  1ZLA B;  3KXB A;  1KX5 D;  1P3M A;  3LZ1 D;  4KUD B;  5B32 A;  4ZUX C;  3KUY B;  5B1L C;  5DNN C;  5GT3 D;  3WKJ A;  1TAF B;  5DNM A;  5GT0 A;  1P3A D;  1P3B B;  4H9N B;  4WZS B;  3AFA A;  3X1S B;  3EG5 B;  4J8V A;  2NQB A;  2NZD D;  4Z66 A;  2HIO B;  4KUD D;  1TZY C;  3B6G B;  4J8X B;  3V9R A;  2G5I C;  2Y2G A;  2PYO D;  3W98 C;  3VH5 A;  1P3B D;  3TU4 C;  3H0L C;  3WTP D;  5B32 B;  4EO5 C;  5G49 A;  4YM6 D;  5AVC C;  3WKJ B;  5GT0 B;  5DNM B;  3VH6 T;  3REH A;  3MVD A;  1P3G B;  3B6G D;  3LJA A;  3AFA B;  5BT1 C;  3KXB D;  5B0Y B;  4Z2M G;  1P3M D;  2NQB B;  4KGC A;  2BYK B;  3AZL C;  4Z66 B;  5B32 D;  2L5A A;  5B2J C;  3KWQ C;  3W97 C;  3AZJ C;  3V9R B;  3WKJ D;  5DNM D;  5GT0 D;  1KX4 B;  5B33 C;  3B0D B;  5E5A C;  3AFA D;  3A6N D;  3AZN C;  4J8V D;  2NQB D;  4HGA B;  5G49 B;  1BFM A;  4Z66 D;  2W8S A;  2Y2O A;  2F8N A;  5DNN A;  3REH B;  4UPK A;  3MVD B;  5B32 G;  3LJA B;  1P3F A;  3H0R C;  2ARO C;  3EPJ A;  5B0Z B;  2ZY3 A;  5CPK C;  2IO5 B;  2JCH A;  3LEL C;  1BH8 A;  1TZY A;  2Y2J A;  4DRB A;  5B24 C;  4CSR A;  3REH D;  5B40 C;  5B1M C;  4DQY B;  1M1A D;  2FFF B;  1R4V A;  5F99 C;  3REJ C;  4ZUX B;  4KGC D;  5AV8 C;  5B1L B;  4R8P A;  2YFW B;  4JJN C;  5AVC A;  1JFI B;  5DNN B;  5KDM A;  5CP6 D;  4H9P A;  4WV4 B;  3B0C T;  4AWL C;  2Y2Q A;  2Y2L A;  3AZL A;  3KWQ A;  1BH8 B;  1TZY B;  3AZJ A;  2F8N D;  4CSR B;  3W98 B;  5B31 A;  3MNN C;  5B33 A;  1P3F D;  3TU4 B;  5E5A A;  3AZN A;  4EO5 B;  1P3A C;  5AVC B;  3VH5 T;  5KDM B;  1TZY D;  4H9P B;  3NQU A;  2NZD C;  5CPK A;  4H9R A;  3AZL B;  2PYO C;  2Y2K A;  5B2J B;  4KHA B;  4R8P D;  3KWQ B;  3W97 B;  1ULY A;  3AZJ B;  5B24 A;  2JE5 A;  4QLC C;  5B40 A;  5B33 B;  3WTP C;  1HTA A;  3MGS A;  4YM6 C;  5B1M A;  3AZN B;  3REJ A;  3MGP C;  3AZL D;  3KWQ D;  3AZJ D;  3KXB C;  5B31 D;  1P3M C;  3NQU B;  5B33 D;  2ARO B;  4H9S C;  5CPK B;  3R45 A;  4ZBJ C;  5E5A D;  3LEL B;  4J8U C;  5B24 B;  5BO0 A;  3A6N C;  5B40 B;  3MNN A;  4J8V C;  4LD9 C;  3VH6 W;  2XD5 A;  5B1M B;  5CPK D;  5F99 B;  3REJ B;  3WA9 A;  5AV8 B;  4JJN B;  4G91 C;  5BNX A;  2YFV A;  5B40 D;  3MGS D;  2NZD A;  1P3L A;  3R45 B;  4AWL B;  5B1M D;  3REJ D;  5BO0 B;  4YS3 C; 
#chains in the Genus database with same CATH homology
 3MNN B;  4QLC A;  2JSS A;  1M1A C;  4KGC C;  3B6F C;  1KX3 C;  1ID3 A;  1BH9 A;  3AV1 A;  5CP6 C;  1A7W A;  1P3A B;  3X1U D;  3MGP A;  1N1J A;  2YFV B;  2NZD B;  3MNN D;  3REL A;  4H9S A;  2FJ7 A;  2PYO B;  3WA9 D;  4X23 C;  1P3F C;  3O62 C;  4J8U A;  3H0M C;  3A6N A;  4QLC B;  3WTP B;  4LD9 A;  4YM6 B;  1BH9 B;  3UTA A;  1P3L D;  3AZI C;  3LZ0 C;  3REI C;  1T3U A;  2F2A C;  3FDD A;  3MGP B;  3B0C W;  2Y2M A;  3KXB B;  1P34 C;  1P3P C;  1P3M B;  4QLC D;  1ID3 D;  4R8P C;  4ZBJ B;  3AV1 D;  3MGP D;  2BYM A;  4J8U B;  3X1V A;  3A6N B;  4YS3 A;  4J8V B;  1M1A A;  4LD9 B;  3VH5 W;  3REL D;  1KX3 A;  3B6F A;  4J8W D;  5BNV A;  2FJ7 D;  5CP6 A;  5B31 C;  5AVB C;  4G91 B;  2LY8 A;  4J8U D;  2ZY4 A;  4LD9 D;  3UTA D;  4X23 A;  3AZG A;  3O62 A;  3AZM D;  4YS3 B;  2F8N K;  1M1A B;  5B2I A;  3B6F B;  1KX3 B;  4KGC B;  3AZI A;  3LZ0 A;  3REI A;  1Q9C A;  5CP6 B;  3MGS C;  3AZE C;  3X1V D;  2CV5 A;  1U35 C;  1P34 A;  4YS3 D;  1P3P A;  1M19 A;  3B6F D;  1KX3 D;  2F8N B;  3WAA A;  5AV9 C;  4X23 B;  1P3F B;  3O62 B;  3X1T A;  5GXQ A;  3X1U C;  3AZI B;  3F6T A;  3LZ0 B;  3REI B;  2CWE A;  5AVB A;  4X23 D;  4H9Q A;  3AZG D;  3O62 D;  1P34 B;  5B2I D;  3WA9 C;  4R8P B;  3AZI D;  3LZ0 D;  3REI D;  3EPL A;  3AV2 C;  2F8N G;  1P3L C;  2CV5 D;  1P34 D;  1P3P D;  3EPH A;  1M19 D;  5AY8 C;  4Z2M H;  3P5J B;  3WAA D;  2XD1 A;  5B31 B;  4H9Q B;  1ID3 C;  3AZE A;  4NE3 A;  5FUG A;  5E5A B;  1U35 A;  3X1T D;  3AV1 C;  5GXQ D;  5AV9 A;  4WU8 A;  5AVB D;  3REL C;  1M18 C;  3AZH C;  4J8W C;  3MGQ C;  2FJ7 C;  4H9R B;  3B0B A;  3X1U A;  5CPI D;  5JA4 A;  3MGS B;  4XUJ D;  1P3K A;  3AZE B;  5FUG B;  3UTA C;  1U35 B;  5B31 G;  3IP4 C;  3AZM C;  3AZF C;  5AV5 A;  5AV9 B;  4NE6 A;  1F66 C;  3AV2 A;  3C1C C;  2RVQ D;  3AZE D;  1HQ3 A;  1U35 D;  5AV6 A;  2HUE C;  5AY8 A;  3X1U B;  3AN2 D;  5JA4 B;  4WNN A;  3X1V C;  5AV9 D;  4WU8 D;  1S32 A;  5JRG C;  3AZK C;  4CAY A;  3WA9 B;  1P3I D;  4G92 C;  5BNX B;  2Y2N A;  3AV2 B;  1M18 A;  1P3K D;  3AZH A;  1P3L B;  4J8W A;  1ZLA A;  3MGQ A;  1AOI C;  5AY8 B;  3AYW C;  4XZQ C;  1PZR A;  2Y2I A;  4HGA C;  4WNN B;  3UT9 C;  3AZG C;  5AV5 D;  3MGR C;  1Z2C B;  1TAF A;  5B2I C;  1ID3 B;  2Y2H A;  3AV2 D;  1KU5 A;  4CAY B;  3AV1 B;  3A1K A;  1HQ3 D;  3W96 C;  5AV6 D;  5AY8 D;  4WJ3 C;  1N1J B;  3AZM A;  3AZF A;  2CV5 C;  1S32 D;  4J8X A;  3REL B;  1M18 B;  1M19 C;  3AZH B;  1F66 A;  4J8W B;  3MGQ B;  3C1C A;  2FJ7 B;  3WAA C;  2BG1 A;  2DQN C;  3KFU G;  3X1T C;  3C1B C;  1P3G A;  5JRG A;  1EQZ C;  3AZK A;  5GXQ C;  3UTA B;  1M18 D;  3AZH D;  1ZLA D;  3W99 C;  3MGQ D;  5B0Y A;  1B67 A;  2BYK A;  3AZM B;  3AZF B;  3KUY D;  4WU9 C;  1F66 B;  2DF4 C;  1KX4 A;  3C1C B;  1P3O C;  5CPI C;  1AOI A;  2HUE B;  3AYW A;  4XZQ A;  3X1S D;  4XUJ C;  2BYM B;  3UT9 A;  4H9O A;  3AZF D;  3X1V B;  2HIO D;  3MGR A;  5JRG B;  4J8X D;  3AZK B;  1F66 D;  4NE5 A;  5BNV B;  3C1C D;  2RIQ A;  5B0Z A;  3W96 A;  4G92 B;  2RVQ C;  5GSU C;  3A1I A;  5BS7 C;  1P3G D;  5JRG D;  5CHL B;  2VQR A;  3AZK D;  3AN2 C;  1AOI B;  3AYW B;  4WU8 C;  2G5H C;  4UUZ A;  4XZQ B;  5B0Y D;  5C3I C;  4ZUX A;  4H9O B;  3UT9 B;  5B1L A;  3AZG B;  2YFW A;  3REK C;  1JFI A;  3MGR B;  3AL0 C;  5B2I B;  3C1B A;  1H3O A;  1EQZ A;  1KX4 D;  1P3I C;  3W99 A;  1AOI D;  3W96 B;  1WWS A;  1B6W A;  3AYW D;  4Z5T C;  4XZQ D;  4DRA A;  1P3K C;  3UT9 D;  2CV5 B;  4WU9 A;  1P3P B;  2ZM5 A;  3W98 A;  3MGR D;  1M19 B;  3MVD D;  2ZY2 A;  3LJA D;  3NQJ A;  1P3O A;  5CPJ C;  3TU4 A;  5CPI A;  5AV5 C;  3WAA B;  4UUZ B;  5B0Z D;  3W96 D;  4XUJ A;  2J8P A;  3X1T B;  3C1B B;  1HQ3 C;  1H3O B;  1EQZ B;  5AV6 C;  1W2E A;  4NFT A;  5GXQ B;  3W99 B;  1F1E A;  1S32 C;  3UTB C;  4M6B A;  5AVB B;  5B2J A;  4ZUX D;  4KHA A;  3W97 A;  5B1L D;  4WU9 B;  1KX5 C;  5DNN D;  5GSU A;  3LZ1 C;  5BS7 A;  3C1B D;  1EQZ D;  3NQJ B;  3AN2 A;  1P3O B;  5CPI B;  3W99 D;  5GT3 C;  4XUJ B;  1ZLA C;  3REK A;  4WU9 D;  3W98 D;  1P3I A;  4KUD C;  2ARO A;  3KUY C;  1P3O D;  3TU4 D;  4Z5T A;  3LEL A;  5AVC D;  1P3B C;  5GSU B;  2UWX A;  3AN2 B;  3X1S C;  5CPJ A;  5BT1 D;  2HIO C;  4WU8 B;  5F99 A;  3B6G C;  5C3I B;  4J8X C;  5AV8 A;  3REK B;  4JJN A;  5B2J D;  3W97 D;  3KSY A;  3VH6 A;  5GSU D;  1P3I B;  1WWI A;  5B32 C;  2Y2P A;  3AZN D;  3UTB A;  4Z5T B;  3WKJ C;  5GT0 C;  5DNM C;  1P3K B;  1P3G C;  3REK D;  1KX5 A;  3AFA C;  3LZ1 A;  5B0Y C;  2NQB C;  5CPJ B;  5AV5 B;  4Z66 C;  2ARO D;  5GT3 A;  2ZY5 A;  4Z5T D;  1P3A A;  1KX4 C;  3WTP E;  3LEL D;  1HQ3 B;  5AV6 B;  3B0D C;  5B24 D;  2F8N H;  4KUD A;  3KUY A;  5CPJ D;  1S32 B;  3UTB B;  5F99 D;  3REH C;  3MVD C;  2PYO A;  3LJA C;  5AV8 D;  4JJN D;  1P3B A;  1KX5 B;  4H9N A;  3LZ1 B;  5B0Z C;  3WTP A;  3X1S A;  2IO5 C;  4YM6 A;  3EPK A;  2HIO A;  5GT3 B;  4E45 A;  4E44 A;  3UTB D;  3B6G A;  1ZLA B;  3KXB A;  1KX5 D;  1P3M A;  3LZ1 D;  4KUD B;  5B32 A;  4ZUX C;  3KUY B;  5B1L C;  5DNN C;  5GT3 D;  3WKJ A;  1TAF B;  5DNM A;  5GT0 A;  1P3A D;  1P3B B;  4H9N B;  4WZS B;  3AFA A;  3X1S B;  3EG5 B;  4J8V A;  2NQB A;  2NZD D;  4Z66 A;  2HIO B;  4KUD D;  1TZY C;  3B6G B;  4J8X B;  3V9R A;  2G5I C;  2Y2G A;  2PYO D;  3W98 C;  3VH5 A;  1P3B D;  3TU4 C;  3H0L C;  3WTP D;  5B32 B;  4EO5 C;  5G49 A;  4YM6 D;  5AVC C;  3WKJ B;  5GT0 B;  5DNM B;  3VH6 T;  3REH A;  3MVD A;  1P3G B;  3B6G D;  3LJA A;  3AFA B;  5BT1 C;  3KXB D;  5B0Y B;  4Z2M G;  1P3M D;  2NQB B;  4KGC A;  2BYK B;  3AZL C;  4Z66 B;  5B32 D;  2L5A A;  5B2J C;  3KWQ C;  3W97 C;  3AZJ C;  3V9R B;  3WKJ D;  5DNM D;  5GT0 D;  1KX4 B;  5B33 C;  3B0D B;  5E5A C;  3AFA D;  3A6N D;  3AZN C;  4J8V D;  2NQB D;  4HGA B;  5G49 B;  1BFM A;  4Z66 D;  2W8S A;  2Y2O A;  2F8N A;  5DNN A;  3REH B;  4UPK A;  3MVD B;  5B32 G;  3LJA B;  1P3F A;  3H0R C;  2ARO C;  3EPJ A;  5B0Z B;  2ZY3 A;  5CPK C;  2IO5 B;  2JCH A;  3LEL C;  1BH8 A;  1TZY A;  2Y2J A;  4DRB A;  5B24 C;  4CSR A;  3REH D;  5B40 C;  5B1M C;  4DQY B;  1M1A D;  2FFF B;  1R4V A;  5F99 C;  3REJ C;  4ZUX B;  4KGC D;  5AV8 C;  5B1L B;  4R8P A;  2YFW B;  4JJN C;  5AVC A;  1JFI B;  5DNN B;  5KDM A;  5CP6 D;  4H9P A;  4WV4 B;  3B0C T;  4AWL C;  2Y2Q A;  2Y2L A;  3AZL A;  3KWQ A;  1BH8 B;  1TZY B;  3AZJ A;  2F8N D;  4CSR B;  3W98 B;  5B31 A;  3MNN C;  5B33 A;  1P3F D;  3TU4 B;  5E5A A;  3AZN A;  4EO5 B;  1P3A C;  5AVC B;  3VH5 T;  5KDM B;  1TZY D;  4H9P B;  3NQU A;  2NZD C;  5CPK A;  4H9R A;  3AZL B;  2PYO C;  2Y2K A;  5B2J B;  4KHA B;  4R8P D;  3KWQ B;  3W97 B;  1ULY A;  3AZJ B;  5B24 A;  2JE5 A;  4QLC C;  5B40 A;  5B33 B;  3WTP C;  1HTA A;  3MGS A;  4YM6 C;  5B1M A;  3AZN B;  3REJ A;  3MGP C;  3AZL D;  3KWQ D;  3AZJ D;  3KXB C;  5B31 D;  1P3M C;  3NQU B;  5B33 D;  2ARO B;  4H9S C;  5CPK B;  3R45 A;  4ZBJ C;  5E5A D;  3LEL B;  4J8U C;  5B24 B;  5BO0 A;  3A6N C;  5B40 B;  3MNN A;  4J8V C;  4LD9 C;  3VH6 W;  2XD5 A;  5B1M B;  5CPK D;  5F99 B;  3REJ B;  3WA9 A;  5AV8 B;  4JJN B;  4G91 C;  5BNX A;  2YFV A;  5B40 D;  3MGS D;  2NZD A;  1P3L A;  3R45 B;  4AWL B;  5B1M D;  3REJ D;  5BO0 B;  4YS3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...