1P3IC

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
103
structure length
103
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 33
structure length 103
sequence length 103
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3iC00
2PYOA 4LD9A 4Z66A 2NQBC 3WA9C 5BS7C 5B40C 5B1MA 3AV1B 3LZ1C 4J8XD 5F99A 4XZQD 4J8WD 1R4VA 4X23B 3LJAC 5DNNA 3A6ND 5B0YC 4Z5TD 5AY8A 1H3OB 3REHC 4LD9C 1P3GD 3UTBB 5B2JB 3UT9B 4WU9C 5GT3A 3AZEA 3AZNA 5F99C 5AV5A 1P3IA 3B0DB 4ZBJC 3NQUA 3X1SD 3AZFA 1EQZD 2NQBB 3WA9B 4R8PB 5JRGD 5AY8C 5DNMD 5B40B 4E45A 3TU4D 1KU5A 4DRBA 4H9RA 4WU8D 1P3PD 5B2IA 2AROD 4M6BA 3B0BA 1HQ3D 3RELA 1P3LA 4H9OA 3LJAB 3MGPD 3AZEC 3AZNC 3AZIB 2YFWB 5AV5C 3LELA 1P3IC 5B0YB 3REHB 3AZFC 2PYOB 4LD9B 1HTAA 5KDMA 5AV8C 3AZMA 1JFIA 3AZKD 5B2IC 3MNND 3KXBA 3C1BD 1WWIA 5F99B 3RELC 1P3LC 4ZBJB 5B0ZD 4CSRA 5DNNB 3LELC 5AY8B 5B24D 1P3FA 3WAAA 1BH8A 3AZMC 5GT3B 3AZEB 3KXBC 3AZNB 3AV1D 5AV5B 1P3IB 3MGQA 1ULYA 1B6WA 3O62C 4AWLC 3AZFB 3B6FA 4X23D 3REIC 5AV8B 3AZJA 4NFTA 4H9RB 3AZHA 5B2IB 4KGCA 3AZLA 3MGSA 3RELB 1P3LB 1M1AA 3UTBD 4H9OB 5B2JD 4DRAA 3UT9D 3LELB 4XZQC 4HGAC 5CPKD 1Q9CA 5KDMB 4J8VA 2NQBD 3WA9D 4R8PD 3AZMB 1JFIB 4KGCC 5B40D 3KXBB 4EO5C 5JA4A 4CSRB 4NE5A 4WV4B 5BO0A 3X1UD 3LJAD 1ID3A 3AZID 2YFVB 5B0YD 3REHD 2PYOD 4LD9D 4Z66D 3TU4C 1BH8B 2BYKA 4XUJA 5B1MD 4WU8C 3MGQB 1AOIA 4HGAB 5F99D 3B6FB 4KUDA 1ID3C 5DNND 3AZJB 5AY8D 3AZHB 4KGCB 4EO5B 3AZLB 1M1AB 5B1LA 3AZKC 3MNNC 3W98A 5GT3D 3AZED 3AZND 1AOIC 5AV5D 1P3ID 5CPIA 3AZFD 4QLCA 3TU4B 5AV8D 5AV6C 5JA4B 5BT1D 5B2ID 5B1LC 3RELD 1P3LD 3W98C 3X1TA 5BO0B 1ID3B 1P3KA 3LELD 2CV5A 4J8UA 4X23C 5GSUA 5GXQA 4QLCC 2BYKB 4XUJB 3AZKB 3AZMD 5BNVA 1AOIB 3KXBD 4CAYA 4KUDB 3X1TC 3VH6T 3UT9C 1P3KC 3REKA 2CV5C 1ZLAA 4J8UC 5GSUC 5GXQC 5AV6B 5CPKC 1P3FD 3WAAD 5B1LB 4R8PC 4ZUXA 3W98B 3C1CA 4G91C 4WNNA 3MGQD 3B6FD 3X1UC 3AZIC 4QLCB 1A7WA 3KWQA 1ZLAC 3AZJD 2PYOC 4Z66C 3AZHD 4KGCD 3AN2A 3AZLD 4ZUXC 1M1AD 5B1MC 3MVDA 4YM6A 3X1TB 3AV2A 2L5AA 1P3KB 3C1CC 2CV5B 3AYWA 4J8UB 1F66A 5GSUB 5GXQB 5CPKB 1P3BA 5DNNC 2NZDA 3KWQC 3W96A 1M18A 4J8VD 2FJ7A 5BNVB 5B31A 3AN2C 1KX3A 4G91B 4YM6C 5GT3C 3X1UB 3REKB 1P3OA 1ZLAB 1ID3D 1P3BC 4Z2MH 5G49A 4Z66B 1M18C 3W99A 1N1JA 2FJ7C 4UUZA 4ZUXB 5B1MB 1B67A 5B31C 4XUJD 1KX3C 5FUGA 5BT1C 3C1CB 3REJA 1AOID 3KSYA 1P34A 4G92C 4KUDD 1P3OC 3KWQB 1TAFA 3AN2B 5AV6D 3MVDB 4YM6B 5B1LD 3W98D 2HIOA 3AYWB 1P34C 3NQUB 1P3BB 4H9PA 1M18B 3W96B 2FJ7B 4QLCD 3WTPA 5B31B 1P3FC 1KX3B 3WAAC 3X1VA 2HIOC 3X1TD 4G92B 1P3OB 1P3KD 3MGQC 1BH9A 2CV5D 3B6FC 4J8UD 3R45A 5G49B 5GSUD 5GXQD 1N1JB 3AZJC 4UUZB 1P3MA 3AZHC 3REJB 4YS3A 3AZLC 3VH6A 3MGSC 1M1AC 1P34B 1TAFB 3REKD 5CPJA 5CP6A 1ZLAD 1P3FB 3WAAB 4J8VC 5AVCA 1P3MC 4ZUXD 2HIOB 5AVBA 3C1CD 4H9NA 5C3IC 4H9PB 5E5AA 5B31G 1EQZA 5CP6C 3KWQD 3WTPB 3VH5W 5AV9A 3MGSB 3VH6W 2AROA 5AVCC 3AN2D 4XUJC 3MVDD 4YM6D 1BH9B 5E5AC 3AYWD 3R45B 4KUDC 2NZDD 1P3BD 4H9SA 4J8VB 1M18D 3W96D 1P3MB 2FJ7D 5B33A 3AFAA 4YS3B 5B31D 1KX3D 5C3IB 3MGRA 3LZ0A 5CPJB 1P3OD 5CP6B 5CPIC 5B32A 4Z2MG 4H9SC 2F8NH 5AVCB 4JJNA 5B33C 4WZSB 3AFAC 5AVBB 3VH5T 3REJD 4H9NB 5E5AB 3KUYA 3MGRC 1P34D 3LZ0C 3B6GA 4KHAA 5B32C 5GT0A 3UTAA 5AV9B 4JJNC 3W97A 2HIOD 1S32A 3KUYC 5CPIB 2F8NA 3B6GC 1U35A 3REKC 3UTAC 3AZGA 5B33B 3AFAB 3WTPD 5BS7A 5B40A 3LZ1A 3MGSD 3W97C 3MGRB 3LZ0B 5B32B 4NE6A 1P3AA 3REHA 2BYMA 4JJNB 3AZGC 3WKJA 1P3MD 1KX5A 3NQJA 4CAYB 4YS3D 4WU9A 3KUYB 3MVDC 3AV2C 3B6GB 1KX4A 4KHAB 5GT0B 3AYWC 5CPJD 3UTAB 1P3AC 5CP6D 1F66C 2NZDC 3W96C 3WKJC 1BFMA 3W97B 5AVCD 1KX5C 1S32B 5AVBD 4WNNB 2F8NB 5E5AD 1KX4C 1U35B 3AZGB 5AV8A 5AV9D 3LZ1B 3W99C 5B32G 2CWEA 3AV2B 1TZYA 3REJC 1F66B 1P3AB 1M19A 5BNXA 2NZDB 5CPID 3B0CW 2BYMB 3WKJB 1KX5B 5B33D 3NQJB 3AFAD 3WTPE 4WU9B 1TZYC 1KX4B 2HUEC 3O62A 3MGRD 3LZ0D 1M19C 2IO5C 3REIA 5B32D 2JSSA 2YFVA 3W99B 2F8NG 3WTPC 4JJND 3VH5A 5FUGB 3X1VC 4J8XA 4XZQA 4J8WA 3KUYD 3V9RA 3B6GD 2RVQD 3A6NA 5GT0D 4Z5TA 3UTAD 1P3GA 3B0CT 1TZYB 3W97D 2HUEB 4YS3C 2F8NK 1S32D 4J8XC 2IO5B 4J8WC 5BNXB 1M19B 2F8ND 3X1SA 1U35D 4H9QA 3A6NC 5CPJC 4Z5TC 5JRGA 5DNMA 3TU4A 3AZGD 1P3GC 4WU8A 3X1VB 1P3PA 3LZ1D 1HQ3A 3O62B 4AWLB 3MGPA 3AV2D 5AVBC 3REIB 1F66D 1P3AD 3X1SC 1EQZC 5JRGC 2LY8A 5DNMC 3WKJD 5AV9C 1P3PC 1KX5D 3AZKA 3MNNA 2AROC 4WU9D 3C1BA 4XZQB 4J8WB 1HQ3C 4J8XB 3MGPC 3V9RB 5B0ZA 1WWSA 1KX4D 3A6NB 4Z5TB 5B24A 1P3GB 5AV6A 3W99D 3C1BC 3AV1A 4E44A 5B0ZC 3X1SB 4H9QB 1EQZB 4X23A 5JRGB 5B24C 5DNMB 1P3PB 4WU8B 1H3OA 2AROB 1HQ3B 3UTBA 3MGPB 5B2JA 1TZYD 3AV1C 3UT9A 1M19D 2RVQC 5CPKA 5GT0C 2NQBA 3WA9A 4R8PA 3MNNB 4NE3A 3C1BB 3X1VD 3UTBC 5B2JC 5B0ZB 3O62D 1F1EA 1S32C 3LJAA 3X1UA 5B24B 3REID 2YFWA 3AZIA 3B0DC 5B0YA 1U35C 5CHLB
chains in the Genus database with same CATH superfamily
2PYOA 4LD9A 4Z66A 2NQBC 3WA9C 5BS7C 5B40C 5B1MA 3AV1B 3LZ1C 4J8XD 5F99A 4XZQD 4J8WD 1R4VA 3FDDA 4X23B 3LJAC 5DNNA 3A6ND 5B0YC 4Z5TD 5AY8A 1H3OB 3REHC 4LD9C 1P3GD 3UTBB 5B2JB 3UT9B 4WU9C 5GT3A 3AZEA 3AZNA 5F99C 5AV5A 1P3IA 3B0DB 4ZBJC 3NQUA 3X1SD 3AZFA 1EQZD 2NQBB 3WA9B 4R8PB 5JRGD 5AY8C 5DNMD 5B40B 4E45A 3TU4D 1KU5A 4DRBA 4H9RA 4WU8D 1P3PD 5B2IA 2AROD 4M6BA 3B0BA 1HQ3D 3RELA 1P3LA 3F6TA 4H9OA 3LJAB 3MGPD 3AZEC 3AZNC 3AZIB 2YFWB 5AV5C 3LELA 1P3IC 5B0YB 3REHB 3AZFC 2PYOB 4LD9B 1HTAA 5KDMA 5AV8C 3AZMA 1JFIA 2G5IC 5B2IC 3MNND 3KXBA 3AZKD 3C1BD 1WWIA 5F99B 3RELC 1P3LC 4ZBJB 5B0ZD 4CSRA 5DNNB 3LELC 5AY8B 5B24D 2Y2JA 1P3FA 3WAAA 1Z2CB 1BH8A 3AZMC 5GT3B 3AZEB 3KXBC 3AZNB 3AV1D 5AV5B 1P3IB 3MGQA 1ULYA 1B6WA 3O62C 4AWLC 3AZFB 3B6FA 4X23D 3REIC 3A1KA 5AV8B 3AZJA 4NFTA 4H9RB 3AZHA 5B2IB 4KGCA 2Y2PA 3MGSA 3AZLA 3RELB 1P3LB 1M1AA 3UTBD 4H9OB 5B2JD 4DRAA 3UT9D 3LELB 4XZQC 4HGAC 2Y2QA 5CPKD 1Q9CA 5KDMB 4J8VA 3EG5B 2NQBD 3WA9D 4R8PD 3AZMB 1JFIB 4KGCC 5B40D 3KXBB 4EO5C 5JA4A 4CSRB 4NE5A 4WV4B 5BO0A 3X1UD 3LJAD 1ID3A 3AZID 2YFVB 5B0YD 3REHD 2PYOD 4LD9D 4Z66D 3TU4C 1BH8B 2BYKA 4XUJA 5B1MD 4WU8C 2Y2KA 4UPKA 3MGQB 1AOIA 4HGAB 3EPJA 5F99D 3B6FB 4KUDA 1ID3C 5DNND 2ZY3A 3AZJB 5AY8D 3AZHB 4KGCB 4EO5B 2ZM5A 3AZLB 1M1AB 5B1LA 3AZKC 3MNNC 3W98A 5GT3D 3AZED 3AZND 1AOIC 5AV5D 1P3ID 5CPIA 3AZFD 4QLCA 3TU4B 2ZY2A 5AV8D 5AV6C 5JA4B 5BT1D 5B2ID 5B1LC 3RELD 1P3LD 3W98C 3X1TA 5BO0B 1ID3B 1P3KA 3LELD 2CV5A 4J8UA 2FFFB 4X23C 5GSUA 5GXQA 4QLCC 2BYKB 4XUJB 3AZKB 3AZMD 1PZRA 5BNVA 1AOIB 3KXBD 4CAYA 4KUDB 3X1TC 3VH6T 3UT9C 1P3KC 3REKA 2CV5C 1ZLAA 4J8UC 5GSUC 5GXQC 5AV6B 5CPKC 1P3FD 3WAAD 5B1LB 4R8PC 1W2EA 4ZUXA 3W98B 3C1CA 4G91C 2Y2HA 4WNNA 3MGQD 3B6FD 3X1UC 3AZIC 4QLCB 1A7WA 3KWQA 1ZLAC 3AZJD 2PYOC 4Z66C 3AZHD 4KGCD 3AN2A 3EPKA 3AZLD 4ZUXC 1M1AD 5B1MC 3MVDA 4YM6A 3X1TB 3AV2A 2L5AA 1P3KB 3C1CC 2CV5B 3AYWA 4J8UB 1F66A 5GSUB 5GXQB 5CPKB 1P3BA 5DNNC 2NZDA 3KWQC 3W96A 1M18A 3H0LC 4J8VD 2FJ7A 5BNVB 5B31A 3AN2C 1KX3A 4G91B 4YM6C 5GT3C 3X1UB 3REKB 1P3OA 1ZLAB 1ID3D 1P3BC 4Z2MH 5G49A 4Z66B 1M18C 3W99A 1N1JA 2FJ7C 4UUZA 4ZUXB 5B1MB 1B67A 5B31C 4XUJD 1KX3C 5FUGA 5BT1C 3C1CB 3REJA 1AOID 3KSYA 1P34A 4G92C 4KUDD 1P3OC 3KWQB 1TAFA 3AN2B 5AV6D 3MVDB 2JCHA 5B1LD 4YM6B 3W98D 2HIOA 2J8PA 3AYWB 1P34C 3NQUB 1P3BB 4H9PA 1M18B 3W96B 3IP4C 2FJ7B 4QLCD 3WTPA 5B31B 1P3FC 1KX3B 3WAAC 3X1VA 3KFUG 2HIOC 3X1TD 4G92B 1P3OB 1P3KD 3MGQC 1BH9A 2CV5D 3B6FC 4J8UD 3R45A 5G49B 5GSUD 5GXQD 1N1JB 3AZJC 4UUZB 1P3MA 3AZHC 3REJB 4YS3A 3AZLC 3VH6A 3MGSC 1M1AC 1P34B 1T3UA 2ZY4A 1TAFB 3REKD 5CPJA 5CP6A 1ZLAD 1P3FB 3WAAB 4J8VC 5AVCA 1P3MC 4DQYB 2G5HC 4ZUXD 2HIOB 2F2AC 5AVBA 3C1CD 4H9NA 5C3IC 4H9PB 5E5AA 5B31G 1EQZA 5CP6C 3KWQD 3WTPB 3VH5W 5AV9A 3MGSB 3VH6W 2AROA 5AVCC 3AN2D 2XD1A 4XUJC 3MVDD 4YM6D 2BG1A 1BH9B 5E5AC 3AYWD 3R45B 4KUDC 2NZDD 1P3BD 4H9SA 4J8VB 1M18D 3W96D 1P3MB 2FJ7D 5B33A 3AFAA 4YS3B 5B31D 1KX3D 5C3IB 3MGRA 3LZ0A 5CPJB 1P3OD 2Y2OA 5CP6B 5CPIC 5B32A 4Z2MG 4H9SC 2F8NH 5AVCB 4JJNA 5B33C 4WZSB 3AFAC 5AVBB 3VH5T 3REJD 4H9NB 5E5AB 3KUYA 3MGRC 1P34D 3LZ0C 3B6GA 4KHAA 3EPHA 5B32C 5GT0A 2VQRA 3UTAA 5AV9B 4JJNC 3W97A 2Y2IA 2HIOD 1S32A 3KUYC 5CPIB 2F8NA 3B6GC 1U35A 3REKC 3UTAC 3AZGA 5B33B 3AFAB 3WTPD 5BS7A 5B40A 3LZ1A 2ZY5A 3MGSD 3W97C 3MGRB 3A1IA 3LZ0B 5B32B 4NE6A 1P3AA 2Y2MA 3REHA 2BYMA 3P5JB 4JJNB 3AZGC 3WKJA 1P3MD 1KX5A 3NQJA 4CAYB 4YS3D 4WU9A 3KUYB 3MVDC 3AV2C 3B6GB 1KX4A 4KHAB 5GT0B 3AYWC 5CPJD 3UTAB 1P3AC 5CP6D 1F66C 2NZDC 3W96C 3WKJC 1BFMA 3W97B 5AVCD 1KX5C 1S32B 5AVBD 4WNNB 2F8NB 5E5AD 1KX4C 1U35B 3AZGB 2Y2GA 5AV8A 5AV9D 3LZ1B 3W99C 5B32G 2CWEA 3AV2B 1TZYA 2RIQA 3REJC 1F66B 1P3AB 1M19A 3H0RC 5BNXA 2NZDB 5CPID 3B0CW 2BYMB 3WKJB 2DF4C 1KX5B 5B33D 3NQJB 3AFAD 3WTPE 4WU9B 3H0MC 1TZYC 1KX4B 2HUEC 3O62A 3MGRD 3LZ0D 1M19C 2IO5C 3REIA 5B32D 2JSSA 2YFVA 2JE5A 3W99B 2F8NG 3WTPC 4JJND 3VH5A 5FUGB 3X1VC 2Y2NA 4J8XA 4XZQA 4J8WA 3KUYD 3V9RA 3B6GD 2RVQD 3A6NA 5GT0D 4Z5TA 3UTAD 1P3GA 3B0CT 1TZYB 3W97D 2HUEB 4YS3C 2XD5A 2F8NK 1S32D 4J8XC 2IO5B 4J8WC 5BNXB 1M19B 2F8ND 3X1SA 1U35D 4H9QA 3A6NC 5CPJC 4Z5TC 5JRGA 2UWXA 5DNMA 3TU4A 3AZGD 1P3GC 4WU8A 3X1VB 1P3PA 3AL0C 3LZ1D 1HQ3A 2DQNC 3O62B 4AWLB 3MGPA 3AV2D 5AVBC 3REIB 1F66D 1P3AD 3X1SC 2Y2LA 1EQZC 5JRGC 2LY8A 5DNMC 3WKJD 5AV9C 1P3PC 1KX5D 3AZKA 3MNNA 2AROC 4WU9D 3C1BA 4XZQB 4J8WB 1HQ3C 4J8XB 3MGPC 3V9RB 5B0ZA 1WWSA 1KX4D 3A6NB 4Z5TB 5B24A 1P3GB 5AV6A 3W99D 2W8SA 3C1BC 3AV1A 4E44A 5B0ZC 3X1SB 4H9QB 1EQZB 4X23A 5JRGB 5B24C 5DNMB 1P3PB 4WU8B 1H3OA 2AROB 3EPLA 1HQ3B 3UTBA 3MGPB 5B2JA 1TZYD 3AV1C 3UT9A 1M19D 2RVQC 5CPKA 5GT0C 2NQBA 3WA9A 4R8PA 3MNNB 4NE3A 3C1BB 3X1VD 3UTBC 5B2JC 5B0ZB 3O62D 1F1EA 1S32C 3LJAA 3X1UA 5B24B 3REID 2YFWA 3AZIA 4WJ3C 3B0DC 5B0YA 1U35C 5CHLB
chains in the Genus database with same CATH topology
2PYOA 4LD9A 4Z66A 2NQBC 3WA9C 5BS7C 5B40C 5B1MA 3AV1B 3LZ1C 4J8XD 5F99A 4XZQD 4J8WD 1R4VA 3FDDA 4X23B 3LJAC 5DNNA 3A6ND 5B0YC 4Z5TD 5AY8A 1H3OB 3REHC 4LD9C 1P3GD 3UTBB 5B2JB 3UT9B 4WU9C 5GT3A 3AZEA 3AZNA 5F99C 5AV5A 1P3IA 3B0DB 4ZBJC 3NQUA 3X1SD 3AZFA 1EQZD 2NQBB 3WA9B 4R8PB 5JRGD 5AY8C 5DNMD 5B40B 4E45A 3TU4D 1KU5A 4DRBA 4H9RA 4WU8D 1P3PD 5B2IA 2AROD 4M6BA 3B0BA 1HQ3D 3RELA 1P3LA 3F6TA 4H9OA 3LJAB 3MGPD 3AZEC 3AZNC 3AZIB 2YFWB 5AV5C 3LELA 1P3IC 5B0YB 3REHB 3AZFC 2PYOB 4LD9B 1HTAA 5KDMA 5AV8C 3AZMA 1JFIA 2G5IC 5B2IC 3MNND 3KXBA 3AZKD 3C1BD 1WWIA 5F99B 3RELC 1P3LC 4ZBJB 5B0ZD 4CSRA 5DNNB 3LELC 5AY8B 5B24D 2Y2JA 1P3FA 3WAAA 1Z2CB 1BH8A 3AZMC 5GT3B 3AZEB 3KXBC 3AZNB 3AV1D 5AV5B 1P3IB 3MGQA 1ULYA 1B6WA 3O62C 4AWLC 3AZFB 3B6FA 4X23D 3REIC 3A1KA 5AV8B 3AZJA 4NFTA 4H9RB 3AZHA 5B2IB 4KGCA 2Y2PA 3MGSA 3AZLA 3RELB 1P3LB 1M1AA 3UTBD 4H9OB 5B2JD 4DRAA 3UT9D 3LELB 4XZQC 4HGAC 2Y2QA 5CPKD 1Q9CA 5KDMB 4J8VA 3EG5B 2NQBD 3WA9D 4R8PD 3AZMB 1JFIB 4KGCC 5B40D 3KXBB 4EO5C 5JA4A 4CSRB 4NE5A 4WV4B 5BO0A 3X1UD 3LJAD 1ID3A 3AZID 2YFVB 5B0YD 3REHD 2PYOD 4LD9D 4Z66D 3TU4C 1BH8B 2BYKA 4XUJA 5B1MD 4WU8C 2Y2KA 4UPKA 3MGQB 1AOIA 4HGAB 3EPJA 5F99D 3B6FB 4KUDA 1ID3C 5DNND 2ZY3A 3AZJB 5AY8D 3AZHB 4KGCB 4EO5B 2ZM5A 3AZLB 1M1AB 5B1LA 3AZKC 3MNNC 3W98A 5GT3D 3AZED 3AZND 1AOIC 5AV5D 1P3ID 5CPIA 3AZFD 4QLCA 3TU4B 2ZY2A 5AV8D 5AV6C 5JA4B 5BT1D 5B2ID 5B1LC 3RELD 1P3LD 3W98C 3X1TA 5BO0B 1ID3B 1P3KA 3LELD 2CV5A 4J8UA 2FFFB 4X23C 5GSUA 5GXQA 4QLCC 2BYKB 4XUJB 3AZKB 3AZMD 1PZRA 5BNVA 1AOIB 3KXBD 4CAYA 4KUDB 3X1TC 3VH6T 3UT9C 1P3KC 3REKA 2CV5C 1ZLAA 4J8UC 5GSUC 5GXQC 5AV6B 5CPKC 1P3FD 3WAAD 5B1LB 4R8PC 1W2EA 4ZUXA 3W98B 3C1CA 4G91C 2Y2HA 4WNNA 3MGQD 3B6FD 3X1UC 3AZIC 4QLCB 1A7WA 3KWQA 1ZLAC 3AZJD 2PYOC 4Z66C 3AZHD 4KGCD 3AN2A 3EPKA 3AZLD 4ZUXC 1M1AD 5B1MC 3MVDA 4YM6A 3X1TB 3AV2A 2L5AA 1P3KB 3C1CC 2CV5B 3AYWA 4J8UB 1F66A 5GSUB 5GXQB 5CPKB 1P3BA 5DNNC 2NZDA 3KWQC 3W96A 1M18A 3H0LC 4J8VD 2FJ7A 5BNVB 5B31A 3AN2C 1KX3A 4G91B 4YM6C 5GT3C 3X1UB 3REKB 1P3OA 1ZLAB 1ID3D 1P3BC 4Z2MH 5G49A 4Z66B 1M18C 3W99A 1N1JA 2FJ7C 4UUZA 4ZUXB 5B1MB 1B67A 5B31C 4XUJD 1KX3C 5FUGA 5BT1C 3C1CB 3REJA 1AOID 3KSYA 1P34A 4G92C 4KUDD 1P3OC 3KWQB 1TAFA 3AN2B 5AV6D 3MVDB 2JCHA 5B1LD 4YM6B 3W98D 2HIOA 2J8PA 3AYWB 1P34C 3NQUB 1P3BB 4H9PA 1M18B 3W96B 3IP4C 2FJ7B 4QLCD 3WTPA 5B31B 1P3FC 1KX3B 3WAAC 3X1VA 3KFUG 2HIOC 3X1TD 4G92B 1P3OB 1P3KD 3MGQC 1BH9A 2CV5D 3B6FC 4J8UD 3R45A 5G49B 5GSUD 5GXQD 1N1JB 3AZJC 4UUZB 1P3MA 3AZHC 3REJB 4YS3A 3AZLC 3VH6A 3MGSC 1M1AC 1P34B 1T3UA 2ZY4A 1TAFB 3REKD 5CPJA 5CP6A 1ZLAD 1P3FB 3WAAB 4J8VC 5AVCA 1P3MC 4DQYB 2G5HC 4ZUXD 2HIOB 2F2AC 5AVBA 3C1CD 4H9NA 5C3IC 4H9PB 5E5AA 5B31G 1EQZA 5CP6C 3KWQD 3WTPB 3VH5W 5AV9A 3MGSB 3VH6W 2AROA 5AVCC 3AN2D 2XD1A 4XUJC 3MVDD 4YM6D 2BG1A 1BH9B 5E5AC 3AYWD 3R45B 4KUDC 2NZDD 1P3BD 4H9SA 4J8VB 1M18D 3W96D 1P3MB 2FJ7D 5B33A 3AFAA 4YS3B 5B31D 1KX3D 5C3IB 3MGRA 3LZ0A 5CPJB 1P3OD 2Y2OA 5CP6B 5CPIC 5B32A 4Z2MG 4H9SC 2F8NH 5AVCB 4JJNA 5B33C 4WZSB 3AFAC 5AVBB 3VH5T 3REJD 4H9NB 5E5AB 3KUYA 3MGRC 1P34D 3LZ0C 3B6GA 4KHAA 3EPHA 5B32C 5GT0A 2VQRA 3UTAA 5AV9B 4JJNC 3W97A 2Y2IA 2HIOD 1S32A 3KUYC 5CPIB 2F8NA 3B6GC 1U35A 3REKC 3UTAC 3AZGA 5B33B 3AFAB 3WTPD 5BS7A 5B40A 3LZ1A 2ZY5A 3MGSD 3W97C 3MGRB 3A1IA 3LZ0B 5B32B 4NE6A 1P3AA 2Y2MA 3REHA 2BYMA 3P5JB 4JJNB 3AZGC 3WKJA 1P3MD 1KX5A 3NQJA 4CAYB 4YS3D 4WU9A 3KUYB 3MVDC 3AV2C 3B6GB 1KX4A 4KHAB 5GT0B 3AYWC 5CPJD 3UTAB 1P3AC 5CP6D 1F66C 2NZDC 3W96C 3WKJC 1BFMA 3W97B 5AVCD 1KX5C 1S32B 5AVBD 4WNNB 2F8NB 5E5AD 1KX4C 1U35B 3AZGB 2Y2GA 5AV8A 5AV9D 3LZ1B 3W99C 5B32G 2CWEA 3AV2B 1TZYA 2RIQA 3REJC 1F66B 1P3AB 1M19A 3H0RC 5BNXA 2NZDB 5CPID 3B0CW 2BYMB 3WKJB 2DF4C 1KX5B 5B33D 3NQJB 3AFAD 3WTPE 4WU9B 3H0MC 1TZYC 1KX4B 2HUEC 3O62A 3MGRD 3LZ0D 1M19C 2IO5C 3REIA 5B32D 2JSSA 2YFVA 2JE5A 3W99B 2F8NG 3WTPC 4JJND 3VH5A 5FUGB 3X1VC 2Y2NA 4J8XA 4XZQA 4J8WA 3KUYD 3V9RA 3B6GD 2RVQD 3A6NA 5GT0D 4Z5TA 3UTAD 1P3GA 3B0CT 1TZYB 3W97D 2HUEB 4YS3C 2XD5A 2F8NK 1S32D 4J8XC 2IO5B 4J8WC 5BNXB 1M19B 2F8ND 3X1SA 1U35D 4H9QA 3A6NC 5CPJC 4Z5TC 5JRGA 2UWXA 5DNMA 3TU4A 3AZGD 1P3GC 4WU8A 3X1VB 1P3PA 3AL0C 3LZ1D 1HQ3A 2DQNC 3O62B 4AWLB 3MGPA 3AV2D 5AVBC 3REIB 1F66D 1P3AD 3X1SC 2Y2LA 1EQZC 5JRGC 2LY8A 5DNMC 3WKJD 5AV9C 1P3PC 1KX5D 3AZKA 3MNNA 2AROC 4WU9D 3C1BA 4XZQB 4J8WB 1HQ3C 4J8XB 3MGPC 3V9RB 5B0ZA 1WWSA 1KX4D 3A6NB 4Z5TB 5B24A 1P3GB 5AV6A 3W99D 2W8SA 3C1BC 3AV1A 4E44A 5B0ZC 3X1SB 4H9QB 1EQZB 4X23A 5JRGB 5B24C 5DNMB 1P3PB 4WU8B 1H3OA 2AROB 3EPLA 1HQ3B 3UTBA 3MGPB 5B2JA 1TZYD 3AV1C 3UT9A 1M19D 2RVQC 5CPKA 5GT0C 2NQBA 3WA9A 4R8PA 3MNNB 4NE3A 3C1BB 3X1VD 3UTBC 5B2JC 5B0ZB 3O62D 1F1EA 1S32C 3LJAA 3X1UA 5B24B 3REID 2YFWA 3AZIA 4WJ3C 3B0DC 5B0YA 1U35C 5CHLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYO A;  4LD9 A;  4Z66 A;  2NQB C;  3WA9 C;  5BS7 C;  5B40 C;  5B1M A;  3AV1 B;  3LZ1 C;  4J8X D;  5F99 A;  4XZQ D;  4J8W D;  1R4V A;  4X23 B;  3LJA C;  5DNN A;  3A6N D;  5B0Y C;  4Z5T D;  5AY8 A;  1H3O B;  3REH C;  4LD9 C;  1P3G D;  3UTB B;  5B2J B;  3UT9 B;  4WU9 C;  5GT3 A;  3AZE A;  3AZN A;  5F99 C;  5AV5 A;  1P3I A;  3B0D B;  4ZBJ C;  3NQU A;  3X1S D;  3AZF A;  1EQZ D;  2NQB B;  3WA9 B;  4R8P B;  5JRG D;  5AY8 C;  5DNM D;  5B40 B;  4E45 A;  3TU4 D;  1KU5 A;  4DRB A;  4H9R A;  4WU8 D;  1P3P D;  5B2I A;  2ARO D;  4M6B A;  3B0B A;  1HQ3 D;  3REL A;  1P3L A;  4H9O A;  3LJA B;  3MGP D;  3AZE C;  3AZN C;  3AZI B;  2YFW B;  5AV5 C;  3LEL A;  1P3I C;  5B0Y B;  3REH B;  3AZF C;  2PYO B;  4LD9 B;  1HTA A;  5KDM A;  5AV8 C;  3AZM A;  1JFI A;  3AZK D;  5B2I C;  3MNN D;  3KXB A;  3C1B D;  1WWI A;  5F99 B;  3REL C;  1P3L C;  4ZBJ B;  5B0Z D;  4CSR A;  5DNN B;  3LEL C;  5AY8 B;  5B24 D;  1P3F A;  3WAA A;  1BH8 A;  3AZM C;  5GT3 B;  3AZE B;  3KXB C;  3AZN B;  3AV1 D;  5AV5 B;  1P3I B;  3MGQ A;  1ULY A;  1B6W A;  3O62 C;  4AWL C;  3AZF B;  3B6F A;  4X23 D;  3REI C;  5AV8 B;  3AZJ A;  4NFT A;  4H9R B;  3AZH A;  5B2I B;  4KGC A;  3AZL A;  3MGS A;  3REL B;  1P3L B;  1M1A A;  3UTB D;  4H9O B;  5B2J D;  4DRA A;  3UT9 D;  3LEL B;  4XZQ C;  4HGA C;  5CPK D;  1Q9C A;  5KDM B;  4J8V A;  2NQB D;  3WA9 D;  4R8P D;  3AZM B;  1JFI B;  4KGC C;  5B40 D;  3KXB B;  4EO5 C;  5JA4 A;  4CSR B;  4NE5 A;  4WV4 B;  5BO0 A;  3X1U D;  3LJA D;  1ID3 A;  3AZI D;  2YFV B;  5B0Y D;  3REH D;  2PYO D;  4LD9 D;  4Z66 D;  3TU4 C;  1BH8 B;  2BYK A;  4XUJ A;  5B1M D;  4WU8 C;  3MGQ B;  1AOI A;  4HGA B;  5F99 D;  3B6F B;  4KUD A;  1ID3 C;  5DNN D;  3AZJ B;  5AY8 D;  3AZH B;  4KGC B;  4EO5 B;  3AZL B;  1M1A B;  5B1L A;  3AZK C;  3MNN C;  3W98 A;  5GT3 D;  3AZE D;  3AZN D;  1AOI C;  5AV5 D;  1P3I D;  5CPI A;  3AZF D;  4QLC A;  3TU4 B;  5AV8 D;  5AV6 C;  5JA4 B;  5BT1 D;  5B2I D;  5B1L C;  3REL D;  1P3L D;  3W98 C;  3X1T A;  5BO0 B;  1ID3 B;  1P3K A;  3LEL D;  2CV5 A;  4J8U A;  4X23 C;  5GSU A;  5GXQ A;  4QLC C;  2BYK B;  4XUJ B;  3AZK B;  3AZM D;  5BNV A;  1AOI B;  3KXB D;  4CAY A;  4KUD B;  3X1T C;  3VH6 T;  3UT9 C;  1P3K C;  3REK A;  2CV5 C;  1ZLA A;  4J8U C;  5GSU C;  5GXQ C;  5AV6 B;  5CPK C;  1P3F D;  3WAA D;  5B1L B;  4R8P C;  4ZUX A;  3W98 B;  3C1C A;  4G91 C;  4WNN A;  3MGQ D;  3B6F D;  3X1U C;  3AZI C;  4QLC B;  1A7W A;  3KWQ A;  1ZLA C;  3AZJ D;  2PYO C;  4Z66 C;  3AZH D;  4KGC D;  3AN2 A;  3AZL D;  4ZUX C;  1M1A D;  5B1M C;  3MVD A;  4YM6 A;  3X1T B;  3AV2 A;  2L5A A;  1P3K B;  3C1C C;  2CV5 B;  3AYW A;  4J8U B;  1F66 A;  5GSU B;  5GXQ B;  5CPK B;  1P3B A;  5DNN C;  2NZD A;  3KWQ C;  3W96 A;  1M18 A;  4J8V D;  2FJ7 A;  5BNV B;  5B31 A;  3AN2 C;  1KX3 A;  4G91 B;  4YM6 C;  5GT3 C;  3X1U B;  3REK B;  1P3O A;  1ZLA B;  1ID3 D;  1P3B C;  4Z2M H;  5G49 A;  4Z66 B;  1M18 C;  3W99 A;  1N1J A;  2FJ7 C;  4UUZ A;  4ZUX B;  5B1M B;  1B67 A;  5B31 C;  4XUJ D;  1KX3 C;  5FUG A;  5BT1 C;  3C1C B;  3REJ A;  1AOI D;  3KSY A;  1P34 A;  4G92 C;  4KUD D;  1P3O C;  3KWQ B;  1TAF A;  3AN2 B;  5AV6 D;  3MVD B;  4YM6 B;  5B1L D;  3W98 D;  2HIO A;  3AYW B;  1P34 C;  3NQU B;  1P3B B;  4H9P A;  1M18 B;  3W96 B;  2FJ7 B;  4QLC D;  3WTP A;  5B31 B;  1P3F C;  1KX3 B;  3WAA C;  3X1V A;  2HIO C;  3X1T D;  4G92 B;  1P3O B;  1P3K D;  3MGQ C;  1BH9 A;  2CV5 D;  3B6F C;  4J8U D;  3R45 A;  5G49 B;  5GSU D;  5GXQ D;  1N1J B;  3AZJ C;  4UUZ B;  1P3M A;  3AZH C;  3REJ B;  4YS3 A;  3AZL C;  3VH6 A;  3MGS C;  1M1A C;  1P34 B;  1TAF B;  3REK D;  5CPJ A;  5CP6 A;  1ZLA D;  1P3F B;  3WAA B;  4J8V C;  5AVC A;  1P3M C;  4ZUX D;  2HIO B;  5AVB A;  3C1C D;  4H9N A;  5C3I C;  4H9P B;  5E5A A;  5B31 G;  1EQZ A;  5CP6 C;  3KWQ D;  3WTP B;  3VH5 W;  5AV9 A;  3MGS B;  3VH6 W;  2ARO A;  5AVC C;  3AN2 D;  4XUJ C;  3MVD D;  4YM6 D;  1BH9 B;  5E5A C;  3AYW D;  3R45 B;  4KUD C;  2NZD D;  1P3B D;  4H9S A;  4J8V B;  1M18 D;  3W96 D;  1P3M B;  2FJ7 D;  5B33 A;  3AFA A;  4YS3 B;  5B31 D;  1KX3 D;  5C3I B;  3MGR A;  3LZ0 A;  5CPJ B;  1P3O D;  5CP6 B;  5CPI C;  5B32 A;  4Z2M G;  4H9S C;  2F8N H;  5AVC B;  4JJN A;  5B33 C;  4WZS B;  3AFA C;  5AVB B;  3VH5 T;  3REJ D;  4H9N B;  5E5A B;  3KUY A;  3MGR C;  1P34 D;  3LZ0 C;  3B6G A;  4KHA A;  5B32 C;  5GT0 A;  3UTA A;  5AV9 B;  4JJN C;  3W97 A;  2HIO D;  1S32 A;  3KUY C;  5CPI B;  2F8N A;  3B6G C;  1U35 A;  3REK C;  3UTA C;  3AZG A;  5B33 B;  3AFA B;  3WTP D;  5BS7 A;  5B40 A;  3LZ1 A;  3MGS D;  3W97 C;  3MGR B;  3LZ0 B;  5B32 B;  4NE6 A;  1P3A A;  3REH A;  2BYM A;  4JJN B;  3AZG C;  3WKJ A;  1P3M D;  1KX5 A;  3NQJ A;  4CAY B;  4YS3 D;  4WU9 A;  3KUY B;  3MVD C;  3AV2 C;  3B6G B;  1KX4 A;  4KHA B;  5GT0 B;  3AYW C;  5CPJ D;  3UTA B;  1P3A C;  5CP6 D;  1F66 C;  2NZD C;  3W96 C;  3WKJ C;  1BFM A;  3W97 B;  5AVC D;  1KX5 C;  1S32 B;  5AVB D;  4WNN B;  2F8N B;  5E5A D;  1KX4 C;  1U35 B;  3AZG B;  5AV8 A;  5AV9 D;  3LZ1 B;  3W99 C;  5B32 G;  2CWE A;  3AV2 B;  1TZY A;  3REJ C;  1F66 B;  1P3A B;  1M19 A;  5BNX A;  2NZD B;  5CPI D;  3B0C W;  2BYM B;  3WKJ B;  1KX5 B;  5B33 D;  3NQJ B;  3AFA D;  3WTP E;  4WU9 B;  1TZY C;  1KX4 B;  2HUE C;  3O62 A;  3MGR D;  3LZ0 D;  1M19 C;  2IO5 C;  3REI A;  5B32 D;  2JSS A;  2YFV A;  3W99 B;  2F8N G;  3WTP C;  4JJN D;  3VH5 A;  5FUG B;  3X1V C;  4J8X A;  4XZQ A;  4J8W A;  3KUY D;  3V9R A;  3B6G D;  2RVQ D;  3A6N A;  5GT0 D;  4Z5T A;  3UTA D;  1P3G A;  3B0C T;  1TZY B;  3W97 D;  2HUE B;  4YS3 C;  2F8N K;  1S32 D;  4J8X C;  2IO5 B;  4J8W C;  5BNX B;  1M19 B;  2F8N D;  3X1S A;  1U35 D;  4H9Q A;  3A6N C;  5CPJ C;  4Z5T C;  5JRG A;  5DNM A;  3TU4 A;  3AZG D;  1P3G C;  4WU8 A;  3X1V B;  1P3P A;  3LZ1 D;  1HQ3 A;  3O62 B;  4AWL B;  3MGP A;  3AV2 D;  5AVB C;  3REI B;  1F66 D;  1P3A D;  3X1S C;  1EQZ C;  5JRG C;  2LY8 A;  5DNM C;  3WKJ D;  5AV9 C;  1P3P C;  1KX5 D;  3AZK A;  3MNN A;  2ARO C;  4WU9 D;  3C1B A;  4XZQ B;  4J8W B;  1HQ3 C;  4J8X B;  3MGP C;  3V9R B;  5B0Z A;  1WWS A;  1KX4 D;  3A6N B;  4Z5T B;  5B24 A;  1P3G B;  5AV6 A;  3W99 D;  3C1B C;  3AV1 A;  4E44 A;  5B0Z C;  3X1S B;  4H9Q B;  1EQZ B;  4X23 A;  5JRG B;  5B24 C;  5DNM B;  1P3P B;  4WU8 B;  1H3O A;  2ARO B;  1HQ3 B;  3UTB A;  3MGP B;  5B2J A;  1TZY D;  3AV1 C;  3UT9 A;  1M19 D;  2RVQ C;  5CPK A;  5GT0 C;  2NQB A;  3WA9 A;  4R8P A;  3MNN B;  4NE3 A;  3C1B B;  3X1V D;  3UTB C;  5B2J C;  5B0Z B;  3O62 D;  1F1E A;  1S32 C;  3LJA A;  3X1U A;  5B24 B;  3REI D;  2YFW A;  3AZI A;  3B0D C;  5B0Y A;  1U35 C;  5CHL B; 
#chains in the Genus database with same CATH topology
 2PYO A;  4LD9 A;  4Z66 A;  2NQB C;  3WA9 C;  5BS7 C;  5B40 C;  5B1M A;  3AV1 B;  3LZ1 C;  4J8X D;  5F99 A;  4XZQ D;  4J8W D;  1R4V A;  3FDD A;  4X23 B;  3LJA C;  5DNN A;  3A6N D;  5B0Y C;  4Z5T D;  5AY8 A;  1H3O B;  3REH C;  4LD9 C;  1P3G D;  3UTB B;  5B2J B;  3UT9 B;  4WU9 C;  5GT3 A;  3AZE A;  3AZN A;  5F99 C;  5AV5 A;  1P3I A;  3B0D B;  4ZBJ C;  3NQU A;  3X1S D;  3AZF A;  1EQZ D;  2NQB B;  3WA9 B;  4R8P B;  5JRG D;  5AY8 C;  5DNM D;  5B40 B;  4E45 A;  3TU4 D;  1KU5 A;  4DRB A;  4H9R A;  4WU8 D;  1P3P D;  5B2I A;  2ARO D;  4M6B A;  3B0B A;  1HQ3 D;  3REL A;  1P3L A;  3F6T A;  4H9O A;  3LJA B;  3MGP D;  3AZE C;  3AZN C;  3AZI B;  2YFW B;  5AV5 C;  3LEL A;  1P3I C;  5B0Y B;  3REH B;  3AZF C;  2PYO B;  4LD9 B;  1HTA A;  5KDM A;  5AV8 C;  3AZM A;  1JFI A;  2G5I C;  5B2I C;  3MNN D;  3KXB A;  3AZK D;  3C1B D;  1WWI A;  5F99 B;  3REL C;  1P3L C;  4ZBJ B;  5B0Z D;  4CSR A;  5DNN B;  3LEL C;  5AY8 B;  5B24 D;  2Y2J A;  1P3F A;  3WAA A;  1Z2C B;  1BH8 A;  3AZM C;  5GT3 B;  3AZE B;  3KXB C;  3AZN B;  3AV1 D;  5AV5 B;  1P3I B;  3MGQ A;  1ULY A;  1B6W A;  3O62 C;  4AWL C;  3AZF B;  3B6F A;  4X23 D;  3REI C;  3A1K A;  5AV8 B;  3AZJ A;  4NFT A;  4H9R B;  3AZH A;  5B2I B;  4KGC A;  2Y2P A;  3MGS A;  3AZL A;  3REL B;  1P3L B;  1M1A A;  3UTB D;  4H9O B;  5B2J D;  4DRA A;  3UT9 D;  3LEL B;  4XZQ C;  4HGA C;  2Y2Q A;  5CPK D;  1Q9C A;  5KDM B;  4J8V A;  3EG5 B;  2NQB D;  3WA9 D;  4R8P D;  3AZM B;  1JFI B;  4KGC C;  5B40 D;  3KXB B;  4EO5 C;  5JA4 A;  4CSR B;  4NE5 A;  4WV4 B;  5BO0 A;  3X1U D;  3LJA D;  1ID3 A;  3AZI D;  2YFV B;  5B0Y D;  3REH D;  2PYO D;  4LD9 D;  4Z66 D;  3TU4 C;  1BH8 B;  2BYK A;  4XUJ A;  5B1M D;  4WU8 C;  2Y2K A;  4UPK A;  3MGQ B;  1AOI A;  4HGA B;  3EPJ A;  5F99 D;  3B6F B;  4KUD A;  1ID3 C;  5DNN D;  2ZY3 A;  3AZJ B;  5AY8 D;  3AZH B;  4KGC B;  4EO5 B;  2ZM5 A;  3AZL B;  1M1A B;  5B1L A;  3AZK C;  3MNN C;  3W98 A;  5GT3 D;  3AZE D;  3AZN D;  1AOI C;  5AV5 D;  1P3I D;  5CPI A;  3AZF D;  4QLC A;  3TU4 B;  2ZY2 A;  5AV8 D;  5AV6 C;  5JA4 B;  5BT1 D;  5B2I D;  5B1L C;  3REL D;  1P3L D;  3W98 C;  3X1T A;  5BO0 B;  1ID3 B;  1P3K A;  3LEL D;  2CV5 A;  4J8U A;  2FFF B;  4X23 C;  5GSU A;  5GXQ A;  4QLC C;  2BYK B;  4XUJ B;  3AZK B;  3AZM D;  1PZR A;  5BNV A;  1AOI B;  3KXB D;  4CAY A;  4KUD B;  3X1T C;  3VH6 T;  3UT9 C;  1P3K C;  3REK A;  2CV5 C;  1ZLA A;  4J8U C;  5GSU C;  5GXQ C;  5AV6 B;  5CPK C;  1P3F D;  3WAA D;  5B1L B;  4R8P C;  1W2E A;  4ZUX A;  3W98 B;  3C1C A;  4G91 C;  2Y2H A;  4WNN A;  3MGQ D;  3B6F D;  3X1U C;  3AZI C;  4QLC B;  1A7W A;  3KWQ A;  1ZLA C;  3AZJ D;  2PYO C;  4Z66 C;  3AZH D;  4KGC D;  3AN2 A;  3EPK A;  3AZL D;  4ZUX C;  1M1A D;  5B1M C;  3MVD A;  4YM6 A;  3X1T B;  3AV2 A;  2L5A A;  1P3K B;  3C1C C;  2CV5 B;  3AYW A;  4J8U B;  1F66 A;  5GSU B;  5GXQ B;  5CPK B;  1P3B A;  5DNN C;  2NZD A;  3KWQ C;  3W96 A;  1M18 A;  3H0L C;  4J8V D;  2FJ7 A;  5BNV B;  5B31 A;  3AN2 C;  1KX3 A;  4G91 B;  4YM6 C;  5GT3 C;  3X1U B;  3REK B;  1P3O A;  1ZLA B;  1ID3 D;  1P3B C;  4Z2M H;  5G49 A;  4Z66 B;  1M18 C;  3W99 A;  1N1J A;  2FJ7 C;  4UUZ A;  4ZUX B;  5B1M B;  1B67 A;  5B31 C;  4XUJ D;  1KX3 C;  5FUG A;  5BT1 C;  3C1C B;  3REJ A;  1AOI D;  3KSY A;  1P34 A;  4G92 C;  4KUD D;  1P3O C;  3KWQ B;  1TAF A;  3AN2 B;  5AV6 D;  3MVD B;  2JCH A;  5B1L D;  4YM6 B;  3W98 D;  2HIO A;  2J8P A;  3AYW B;  1P34 C;  3NQU B;  1P3B B;  4H9P A;  1M18 B;  3W96 B;  3IP4 C;  2FJ7 B;  4QLC D;  3WTP A;  5B31 B;  1P3F C;  1KX3 B;  3WAA C;  3X1V A;  3KFU G;  2HIO C;  3X1T D;  4G92 B;  1P3O B;  1P3K D;  3MGQ C;  1BH9 A;  2CV5 D;  3B6F C;  4J8U D;  3R45 A;  5G49 B;  5GSU D;  5GXQ D;  1N1J B;  3AZJ C;  4UUZ B;  1P3M A;  3AZH C;  3REJ B;  4YS3 A;  3AZL C;  3VH6 A;  3MGS C;  1M1A C;  1P34 B;  1T3U A;  2ZY4 A;  1TAF B;  3REK D;  5CPJ A;  5CP6 A;  1ZLA D;  1P3F B;  3WAA B;  4J8V C;  5AVC A;  1P3M C;  4DQY B;  2G5H C;  4ZUX D;  2HIO B;  2F2A C;  5AVB A;  3C1C D;  4H9N A;  5C3I C;  4H9P B;  5E5A A;  5B31 G;  1EQZ A;  5CP6 C;  3KWQ D;  3WTP B;  3VH5 W;  5AV9 A;  3MGS B;  3VH6 W;  2ARO A;  5AVC C;  3AN2 D;  2XD1 A;  4XUJ C;  3MVD D;  4YM6 D;  2BG1 A;  1BH9 B;  5E5A C;  3AYW D;  3R45 B;  4KUD C;  2NZD D;  1P3B D;  4H9S A;  4J8V B;  1M18 D;  3W96 D;  1P3M B;  2FJ7 D;  5B33 A;  3AFA A;  4YS3 B;  5B31 D;  1KX3 D;  5C3I B;  3MGR A;  3LZ0 A;  5CPJ B;  1P3O D;  2Y2O A;  5CP6 B;  5CPI C;  5B32 A;  4Z2M G;  4H9S C;  2F8N H;  5AVC B;  4JJN A;  5B33 C;  4WZS B;  3AFA C;  5AVB B;  3VH5 T;  3REJ D;  4H9N B;  5E5A B;  3KUY A;  3MGR C;  1P34 D;  3LZ0 C;  3B6G A;  4KHA A;  3EPH A;  5B32 C;  5GT0 A;  2VQR A;  3UTA A;  5AV9 B;  4JJN C;  3W97 A;  2Y2I A;  2HIO D;  1S32 A;  3KUY C;  5CPI B;  2F8N A;  3B6G C;  1U35 A;  3REK C;  3UTA C;  3AZG A;  5B33 B;  3AFA B;  3WTP D;  5BS7 A;  5B40 A;  3LZ1 A;  2ZY5 A;  3MGS D;  3W97 C;  3MGR B;  3A1I A;  3LZ0 B;  5B32 B;  4NE6 A;  1P3A A;  2Y2M A;  3REH A;  2BYM A;  3P5J B;  4JJN B;  3AZG C;  3WKJ A;  1P3M D;  1KX5 A;  3NQJ A;  4CAY B;  4YS3 D;  4WU9 A;  3KUY B;  3MVD C;  3AV2 C;  3B6G B;  1KX4 A;  4KHA B;  5GT0 B;  3AYW C;  5CPJ D;  3UTA B;  1P3A C;  5CP6 D;  1F66 C;  2NZD C;  3W96 C;  3WKJ C;  1BFM A;  3W97 B;  5AVC D;  1KX5 C;  1S32 B;  5AVB D;  4WNN B;  2F8N B;  5E5A D;  1KX4 C;  1U35 B;  3AZG B;  2Y2G A;  5AV8 A;  5AV9 D;  3LZ1 B;  3W99 C;  5B32 G;  2CWE A;  3AV2 B;  1TZY A;  2RIQ A;  3REJ C;  1F66 B;  1P3A B;  1M19 A;  3H0R C;  5BNX A;  2NZD B;  5CPI D;  3B0C W;  2BYM B;  3WKJ B;  2DF4 C;  1KX5 B;  5B33 D;  3NQJ B;  3AFA D;  3WTP E;  4WU9 B;  3H0M C;  1TZY C;  1KX4 B;  2HUE C;  3O62 A;  3MGR D;  3LZ0 D;  1M19 C;  2IO5 C;  3REI A;  5B32 D;  2JSS A;  2YFV A;  2JE5 A;  3W99 B;  2F8N G;  3WTP C;  4JJN D;  3VH5 A;  5FUG B;  3X1V C;  2Y2N A;  4J8X A;  4XZQ A;  4J8W A;  3KUY D;  3V9R A;  3B6G D;  2RVQ D;  3A6N A;  5GT0 D;  4Z5T A;  3UTA D;  1P3G A;  3B0C T;  1TZY B;  3W97 D;  2HUE B;  4YS3 C;  2XD5 A;  2F8N K;  1S32 D;  4J8X C;  2IO5 B;  4J8W C;  5BNX B;  1M19 B;  2F8N D;  3X1S A;  1U35 D;  4H9Q A;  3A6N C;  5CPJ C;  4Z5T C;  5JRG A;  2UWX A;  5DNM A;  3TU4 A;  3AZG D;  1P3G C;  4WU8 A;  3X1V B;  1P3P A;  3AL0 C;  3LZ1 D;  1HQ3 A;  2DQN C;  3O62 B;  4AWL B;  3MGP A;  3AV2 D;  5AVB C;  3REI B;  1F66 D;  1P3A D;  3X1S C;  2Y2L A;  1EQZ C;  5JRG C;  2LY8 A;  5DNM C;  3WKJ D;  5AV9 C;  1P3P C;  1KX5 D;  3AZK A;  3MNN A;  2ARO C;  4WU9 D;  3C1B A;  4XZQ B;  4J8W B;  1HQ3 C;  4J8X B;  3MGP C;  3V9R B;  5B0Z A;  1WWS A;  1KX4 D;  3A6N B;  4Z5T B;  5B24 A;  1P3G B;  5AV6 A;  3W99 D;  2W8S A;  3C1B C;  3AV1 A;  4E44 A;  5B0Z C;  3X1S B;  4H9Q B;  1EQZ B;  4X23 A;  5JRG B;  5B24 C;  5DNM B;  1P3P B;  4WU8 B;  1H3O A;  2ARO B;  3EPL A;  1HQ3 B;  3UTB A;  3MGP B;  5B2J A;  1TZY D;  3AV1 C;  3UT9 A;  1M19 D;  2RVQ C;  5CPK A;  5GT0 C;  2NQB A;  3WA9 A;  4R8P A;  3MNN B;  4NE3 A;  3C1B B;  3X1V D;  3UTB C;  5B2J C;  5B0Z B;  3O62 D;  1F1E A;  1S32 C;  3LJA A;  3X1U A;  5B24 B;  3REI D;  2YFW A;  3AZI A;  4WJ3 C;  3B0D C;  5B0Y A;  1U35 C;  5CHL B; 
#chains in the Genus database with same CATH homology
 2PYO A;  4LD9 A;  4Z66 A;  2NQB C;  3WA9 C;  5BS7 C;  5B40 C;  5B1M A;  3AV1 B;  3LZ1 C;  4J8X D;  5F99 A;  4XZQ D;  4J8W D;  1R4V A;  3FDD A;  4X23 B;  3LJA C;  5DNN A;  3A6N D;  5B0Y C;  4Z5T D;  5AY8 A;  1H3O B;  3REH C;  4LD9 C;  1P3G D;  3UTB B;  5B2J B;  3UT9 B;  4WU9 C;  5GT3 A;  3AZE A;  3AZN A;  5F99 C;  5AV5 A;  1P3I A;  3B0D B;  4ZBJ C;  3NQU A;  3X1S D;  3AZF A;  1EQZ D;  2NQB B;  3WA9 B;  4R8P B;  5JRG D;  5AY8 C;  5DNM D;  5B40 B;  4E45 A;  3TU4 D;  1KU5 A;  4DRB A;  4H9R A;  4WU8 D;  1P3P D;  5B2I A;  2ARO D;  4M6B A;  3B0B A;  1HQ3 D;  3REL A;  1P3L A;  3F6T A;  4H9O A;  3LJA B;  3MGP D;  3AZE C;  3AZN C;  3AZI B;  2YFW B;  5AV5 C;  3LEL A;  1P3I C;  5B0Y B;  3REH B;  3AZF C;  2PYO B;  4LD9 B;  1HTA A;  5KDM A;  5AV8 C;  3AZM A;  1JFI A;  2G5I C;  5B2I C;  3MNN D;  3KXB A;  3AZK D;  3C1B D;  1WWI A;  5F99 B;  3REL C;  1P3L C;  4ZBJ B;  5B0Z D;  4CSR A;  5DNN B;  3LEL C;  5AY8 B;  5B24 D;  2Y2J A;  1P3F A;  3WAA A;  1Z2C B;  1BH8 A;  3AZM C;  5GT3 B;  3AZE B;  3KXB C;  3AZN B;  3AV1 D;  5AV5 B;  1P3I B;  3MGQ A;  1ULY A;  1B6W A;  3O62 C;  4AWL C;  3AZF B;  3B6F A;  4X23 D;  3REI C;  3A1K A;  5AV8 B;  3AZJ A;  4NFT A;  4H9R B;  3AZH A;  5B2I B;  4KGC A;  2Y2P A;  3MGS A;  3AZL A;  3REL B;  1P3L B;  1M1A A;  3UTB D;  4H9O B;  5B2J D;  4DRA A;  3UT9 D;  3LEL B;  4XZQ C;  4HGA C;  2Y2Q A;  5CPK D;  1Q9C A;  5KDM B;  4J8V A;  3EG5 B;  2NQB D;  3WA9 D;  4R8P D;  3AZM B;  1JFI B;  4KGC C;  5B40 D;  3KXB B;  4EO5 C;  5JA4 A;  4CSR B;  4NE5 A;  4WV4 B;  5BO0 A;  3X1U D;  3LJA D;  1ID3 A;  3AZI D;  2YFV B;  5B0Y D;  3REH D;  2PYO D;  4LD9 D;  4Z66 D;  3TU4 C;  1BH8 B;  2BYK A;  4XUJ A;  5B1M D;  4WU8 C;  2Y2K A;  4UPK A;  3MGQ B;  1AOI A;  4HGA B;  3EPJ A;  5F99 D;  3B6F B;  4KUD A;  1ID3 C;  5DNN D;  2ZY3 A;  3AZJ B;  5AY8 D;  3AZH B;  4KGC B;  4EO5 B;  2ZM5 A;  3AZL B;  1M1A B;  5B1L A;  3AZK C;  3MNN C;  3W98 A;  5GT3 D;  3AZE D;  3AZN D;  1AOI C;  5AV5 D;  1P3I D;  5CPI A;  3AZF D;  4QLC A;  3TU4 B;  2ZY2 A;  5AV8 D;  5AV6 C;  5JA4 B;  5BT1 D;  5B2I D;  5B1L C;  3REL D;  1P3L D;  3W98 C;  3X1T A;  5BO0 B;  1ID3 B;  1P3K A;  3LEL D;  2CV5 A;  4J8U A;  2FFF B;  4X23 C;  5GSU A;  5GXQ A;  4QLC C;  2BYK B;  4XUJ B;  3AZK B;  3AZM D;  1PZR A;  5BNV A;  1AOI B;  3KXB D;  4CAY A;  4KUD B;  3X1T C;  3VH6 T;  3UT9 C;  1P3K C;  3REK A;  2CV5 C;  1ZLA A;  4J8U C;  5GSU C;  5GXQ C;  5AV6 B;  5CPK C;  1P3F D;  3WAA D;  5B1L B;  4R8P C;  1W2E A;  4ZUX A;  3W98 B;  3C1C A;  4G91 C;  2Y2H A;  4WNN A;  3MGQ D;  3B6F D;  3X1U C;  3AZI C;  4QLC B;  1A7W A;  3KWQ A;  1ZLA C;  3AZJ D;  2PYO C;  4Z66 C;  3AZH D;  4KGC D;  3AN2 A;  3EPK A;  3AZL D;  4ZUX C;  1M1A D;  5B1M C;  3MVD A;  4YM6 A;  3X1T B;  3AV2 A;  2L5A A;  1P3K B;  3C1C C;  2CV5 B;  3AYW A;  4J8U B;  1F66 A;  5GSU B;  5GXQ B;  5CPK B;  1P3B A;  5DNN C;  2NZD A;  3KWQ C;  3W96 A;  1M18 A;  3H0L C;  4J8V D;  2FJ7 A;  5BNV B;  5B31 A;  3AN2 C;  1KX3 A;  4G91 B;  4YM6 C;  5GT3 C;  3X1U B;  3REK B;  1P3O A;  1ZLA B;  1ID3 D;  1P3B C;  4Z2M H;  5G49 A;  4Z66 B;  1M18 C;  3W99 A;  1N1J A;  2FJ7 C;  4UUZ A;  4ZUX B;  5B1M B;  1B67 A;  5B31 C;  4XUJ D;  1KX3 C;  5FUG A;  5BT1 C;  3C1C B;  3REJ A;  1AOI D;  3KSY A;  1P34 A;  4G92 C;  4KUD D;  1P3O C;  3KWQ B;  1TAF A;  3AN2 B;  5AV6 D;  3MVD B;  2JCH A;  5B1L D;  4YM6 B;  3W98 D;  2HIO A;  2J8P A;  3AYW B;  1P34 C;  3NQU B;  1P3B B;  4H9P A;  1M18 B;  3W96 B;  3IP4 C;  2FJ7 B;  4QLC D;  3WTP A;  5B31 B;  1P3F C;  1KX3 B;  3WAA C;  3X1V A;  3KFU G;  2HIO C;  3X1T D;  4G92 B;  1P3O B;  1P3K D;  3MGQ C;  1BH9 A;  2CV5 D;  3B6F C;  4J8U D;  3R45 A;  5G49 B;  5GSU D;  5GXQ D;  1N1J B;  3AZJ C;  4UUZ B;  1P3M A;  3AZH C;  3REJ B;  4YS3 A;  3AZL C;  3VH6 A;  3MGS C;  1M1A C;  1P34 B;  1T3U A;  2ZY4 A;  1TAF B;  3REK D;  5CPJ A;  5CP6 A;  1ZLA D;  1P3F B;  3WAA B;  4J8V C;  5AVC A;  1P3M C;  4DQY B;  2G5H C;  4ZUX D;  2HIO B;  2F2A C;  5AVB A;  3C1C D;  4H9N A;  5C3I C;  4H9P B;  5E5A A;  5B31 G;  1EQZ A;  5CP6 C;  3KWQ D;  3WTP B;  3VH5 W;  5AV9 A;  3MGS B;  3VH6 W;  2ARO A;  5AVC C;  3AN2 D;  2XD1 A;  4XUJ C;  3MVD D;  4YM6 D;  2BG1 A;  1BH9 B;  5E5A C;  3AYW D;  3R45 B;  4KUD C;  2NZD D;  1P3B D;  4H9S A;  4J8V B;  1M18 D;  3W96 D;  1P3M B;  2FJ7 D;  5B33 A;  3AFA A;  4YS3 B;  5B31 D;  1KX3 D;  5C3I B;  3MGR A;  3LZ0 A;  5CPJ B;  1P3O D;  2Y2O A;  5CP6 B;  5CPI C;  5B32 A;  4Z2M G;  4H9S C;  2F8N H;  5AVC B;  4JJN A;  5B33 C;  4WZS B;  3AFA C;  5AVB B;  3VH5 T;  3REJ D;  4H9N B;  5E5A B;  3KUY A;  3MGR C;  1P34 D;  3LZ0 C;  3B6G A;  4KHA A;  3EPH A;  5B32 C;  5GT0 A;  2VQR A;  3UTA A;  5AV9 B;  4JJN C;  3W97 A;  2Y2I A;  2HIO D;  1S32 A;  3KUY C;  5CPI B;  2F8N A;  3B6G C;  1U35 A;  3REK C;  3UTA C;  3AZG A;  5B33 B;  3AFA B;  3WTP D;  5BS7 A;  5B40 A;  3LZ1 A;  2ZY5 A;  3MGS D;  3W97 C;  3MGR B;  3A1I A;  3LZ0 B;  5B32 B;  4NE6 A;  1P3A A;  2Y2M A;  3REH A;  2BYM A;  3P5J B;  4JJN B;  3AZG C;  3WKJ A;  1P3M D;  1KX5 A;  3NQJ A;  4CAY B;  4YS3 D;  4WU9 A;  3KUY B;  3MVD C;  3AV2 C;  3B6G B;  1KX4 A;  4KHA B;  5GT0 B;  3AYW C;  5CPJ D;  3UTA B;  1P3A C;  5CP6 D;  1F66 C;  2NZD C;  3W96 C;  3WKJ C;  1BFM A;  3W97 B;  5AVC D;  1KX5 C;  1S32 B;  5AVB D;  4WNN B;  2F8N B;  5E5A D;  1KX4 C;  1U35 B;  3AZG B;  2Y2G A;  5AV8 A;  5AV9 D;  3LZ1 B;  3W99 C;  5B32 G;  2CWE A;  3AV2 B;  1TZY A;  2RIQ A;  3REJ C;  1F66 B;  1P3A B;  1M19 A;  3H0R C;  5BNX A;  2NZD B;  5CPI D;  3B0C W;  2BYM B;  3WKJ B;  2DF4 C;  1KX5 B;  5B33 D;  3NQJ B;  3AFA D;  3WTP E;  4WU9 B;  3H0M C;  1TZY C;  1KX4 B;  2HUE C;  3O62 A;  3MGR D;  3LZ0 D;  1M19 C;  2IO5 C;  3REI A;  5B32 D;  2JSS A;  2YFV A;  2JE5 A;  3W99 B;  2F8N G;  3WTP C;  4JJN D;  3VH5 A;  5FUG B;  3X1V C;  2Y2N A;  4J8X A;  4XZQ A;  4J8W A;  3KUY D;  3V9R A;  3B6G D;  2RVQ D;  3A6N A;  5GT0 D;  4Z5T A;  3UTA D;  1P3G A;  3B0C T;  1TZY B;  3W97 D;  2HUE B;  4YS3 C;  2XD5 A;  2F8N K;  1S32 D;  4J8X C;  2IO5 B;  4J8W C;  5BNX B;  1M19 B;  2F8N D;  3X1S A;  1U35 D;  4H9Q A;  3A6N C;  5CPJ C;  4Z5T C;  5JRG A;  2UWX A;  5DNM A;  3TU4 A;  3AZG D;  1P3G C;  4WU8 A;  3X1V B;  1P3P A;  3AL0 C;  3LZ1 D;  1HQ3 A;  2DQN C;  3O62 B;  4AWL B;  3MGP A;  3AV2 D;  5AVB C;  3REI B;  1F66 D;  1P3A D;  3X1S C;  2Y2L A;  1EQZ C;  5JRG C;  2LY8 A;  5DNM C;  3WKJ D;  5AV9 C;  1P3P C;  1KX5 D;  3AZK A;  3MNN A;  2ARO C;  4WU9 D;  3C1B A;  4XZQ B;  4J8W B;  1HQ3 C;  4J8X B;  3MGP C;  3V9R B;  5B0Z A;  1WWS A;  1KX4 D;  3A6N B;  4Z5T B;  5B24 A;  1P3G B;  5AV6 A;  3W99 D;  2W8S A;  3C1B C;  3AV1 A;  4E44 A;  5B0Z C;  3X1S B;  4H9Q B;  1EQZ B;  4X23 A;  5JRG B;  5B24 C;  5DNM B;  1P3P B;  4WU8 B;  1H3O A;  2ARO B;  3EPL A;  1HQ3 B;  3UTB A;  3MGP B;  5B2J A;  1TZY D;  3AV1 C;  3UT9 A;  1M19 D;  2RVQ C;  5CPK A;  5GT0 C;  2NQB A;  3WA9 A;  4R8P A;  3MNN B;  4NE3 A;  3C1B B;  3X1V D;  3UTB C;  5B2J C;  5B0Z B;  3O62 D;  1F1E A;  1S32 C;  3LJA A;  3X1U A;  5B24 B;  3REI D;  2YFW A;  3AZI A;  4WJ3 C;  3B0D C;  5B0Y A;  1U35 C;  5CHL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...