1P3ID

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
95
structure length
95
Chain Sequence
KSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 34
structure length 95
sequence length 95
chains with identical sequence H
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3iD00
4ZUXA 5B31C 5B2ID 3TU4A 3MGQC 5CPJD 4X23B 3AFAC 1ZLAD 4KUDA 5B0ZB 1TZYD 3AZJD 4J8VB 3AV1D 3B6FC 2NZDB 3C1BD 2FJ7D 4J8XA 4CSRA 3C1CC 3RELB 5B1LD 4Z2MG 3R45A 4YS3B 4J8WC 2F8NB 3MGSA 2CV5D 1P3PD 3MVDC 1HQ3D 4J8UD 3WTPA 3W96C 4WU9A 4XZQB 5BT1C 1P3FC 3V9RA 2CWEA 3LELA 3UT9A 5F99B 2BYMB 5DNNB 3REHA 1AOIA 3W97B 4YM6C 3O62A 3MNNA 5JRGC 4ZUXB 4H9NA 3TU4B 1M19A 3AYWB 5AV9C 1P3GA 3REIC 1F1EA 3MGRC 1KX3C 4KUDB 5AV5C 5B2JC 5B32D 3AV2A 4R8PD 3B0CT 3B6FD 4H9SA 3W98A 4J8XB 4CSRB 5AV6B 4ZBJC 1P3OA 4H9OA 5AVBC 1P34D 3X1UA 3AZKD 3R45B 5C3IC 1KX4A 4JJNB 4J8WD 5GT3C 4XUJB 1P3AA 3X1VA 3WTPB 3UTBB 5BNXA 4WU9B 5JA4A 1EQZD 2LY8A 5CPIA 2IO5C 3AZFA 1P3FD 1KX5D 3WA9B 3LELB 3UT9B 3KXBA 4EO5C 3B0BA 5B1MD 5CPKA 3REHB 3X1TC 3O62B 3MNNB 5B33C 4LD9C 1P3LD 3MGPB 1WWSA 3LZ0B 3LJAC 2PYOC 4H9NB 1P3KC 1M19B 4G92C 5CPJA 2YFVB 4KGCC 1P3GB 5AV9D 1ZLAA 1AOIC 1TZYA 5B32G 3AZNB 3MGRD 3AV1A 1BH8A 3C1BA 1KX3D 3AV2B 2FJ7A 3VH5T 2L5AA 2NQBA 3W99B 3X1SC 1U35D 3B6GA 3AN2C 1P3OB 4H9OB 5B0YD 5AVBD 1M18C 1KX4B 5GT0D 3W98C 1HQ3A 5B24C 1P3AB 3AZEC 5AY8D 3X1VB 5BNXB 5JA4B 5FUGA 3KWQD 5CPIB 3B0DB 3AZFB 1M1AC 3KXBB 5AV8C 5GXQB 4E45A 4J8VA 3REJD 1S32C 5B2IB 3RELA 5CPJB 1P3KD 3KUYD 4KGCD 1ZLAB 3WAAC 2HUEB 1TZYB 5B32A 2HIOC 3AV1B 4QLCC 1BH8B 5DNMC 4HGAB 5B40D 4R8PA 3C1BB 1P3BA 2FJ7B 2AROD 2NQBB 3VH6T 4CAYA 3B6GB 1P34A 2JSSA 3AZKA 3AN2D 4Z66C 5F99A 1P3MC 5E5AD 3KSYA 4NE3A 4AWLB 3AZMC 2CV5B 1P3PB 1HQ3B 3AZIC 4J8UB 1EQZA 3WKJC 3REKD 4Z5TC 5GSUA 3AYWA 1KX5A 5FUGB 3AZGC 5B1MA 2F8NH 1M1AD 1TAFA 5BS7C 1P3LA 5AV8D 1P3ID 5AV6A 4X23C 3LZ1D 1F66D 5B0ZC 3WAAD 5B32B 4JJNA 2NZDC 5AVCD 4R8PB 1P3BB 1ID3D 2HIOD 4WU8D 1Q9CA 5CP6A 1U35A 4XUJA 4CAYB 1P34B 5B0YA 3UTBA 3AZKB 3UTAD 4YS3C 3WA9A 4J8WB 4DRAA 4Z66D 3AZLD 1P3MD 5GT0A 1BFMA 5GT3D 3MGPA 3AZMD 3AZHD 5AY8A 3LZ0A 1EQZB 4XZQC 5GSUB 3KWQA 1KX5B 5B31D 2YFVA 3MGQD 5B1MB 3AZGD 5DNNC 3W97C 1TAFB 3AZNA 3AFAD 1P3LB 2BYKA 4ZUXC 3REJA 4M6BA 1HTAA 3TU4C 4NFTA 3W99A 4WNNB 3C1CD 5AV9B 4X23D 4KUDC 5B40A 2AROA 5G49B 3A6NA 2NZDD 4J8XC 5CP6B 1U35B 1BH9A 3MVDD 5B0YB 5AVBB 3W96D 5BT1D 5E5AA 5GXQA 5GT0B 3MGSC 4XUJC 3NQJA 4YM6D 5JRGD 3REKA 3WTPC 5AY8B 5B2IA 5B31G 4WU9C 3KWQB 4XZQD 3LELC 2YFWB 3UT9C 3REHC 3NQUA 3REID 3O62C 3AZJA 5DNND 3MNNC 3W97D 2BYKB 4G91B 5KDMB 3REJB 1B6WA 4UUZB 5AV5D 1P3IA 5B2JD 3LZ0C 1M19C 3LZ1A 1P3GC 1P3KB 3KUYB 5B1LA 1F66A 1B67A 5AVCA 1ID3A 5B40B 3AV2C 2AROB 4WU8A 3A6NB 4H9SC 2CV5A 1P3PA 4J8UA 1P3OC 1BH9B 3X1UC 3UTAA 1KX4C 5E5AB 3AZLA 5GT3A 3AZHA 3NQJB 3X1TD 1P3AC 3MGSD 4LD9D 5B33D 3X1VC 3REKB 5B31A 5CPIC 3WTPD 3LJAD 3VH5W 3B0DC 3AZFC 2PYOD 3KXBC 5CPKC 5GXQC 1M1AB 3NQUB 3AFAA 3AZJB 5AV8B 1AOID 1P3IB 3B6FA 4H9QA 1H3OA 5CPJC 3LZ1B 3C1CA 3X1SD 5B1LB 1F66B 2HUEC 4WV4B 4DRBA 1TZYC 1ZLAC 3AV1C 5AVCB 3C1BC 4J8WA 1M18D 2HIOB 1ID3B 2FJ7C 4WU8B 2NQBC 4NE6A 3B6GC 3W98D 3MVDA 5B24D 3W96A 3UTAB 1P3FA 3AZED 3X1UD 4Z66B 3AZLB 4NE5A 1P3MB 4AWLC 5GT3B 4YM6A 1HQ3C 3AZHB 3AZMB 5JRGA 2F8NK 1P3AD 1S32D 5B31B 4WNNA 3MGQB 5AV9A 3VH6W 3AZFD 3REIA 3AFAB 5CPKD 3MGRA 1KX3A 5AV5A 4J8VC 5B2JA 5G49A 4QLCD 3B6FB 5DNMD 4H9QB 1H3OB 3RELC 3C1CB 5AVBA 5B32C 4R8PC 1P3BC 2NQBD 5BO0A 1P34C 1JFIA 3MVDB 3AZKC 3B6GD 3AZID 3WKJD 3W96B 1KU5A 1P3FB 4Z5TD 2YFWA 5F99C 3X1TA 4YM6B 5KDMA 4LD9A 5B33A 4UUZA 5JRGB 2RVQC 1EQZC 5GSUC 3LJAA 3AYWC 2PYOA 1KX5C 1P3KA 3KUYA 5B1MC 4KGCA 3REIB 1P3LC 3MGRB 4H9RA 5B0ZD 1KX3B 5AV5B 5B2JB 5CHLB 4J8VD 5AV6C 3X1SA 3RELD 4ZBJB 3AN2A 1M18A 4YS3D 4JJNC 5C3IB 4KHAA 1WWIA 2F8ND 1P3BD 5CP6C 1U35C 4H9PA 5BO0B 5B24A 1A7WA 1JFIB 5B0YC 3UTBC 3AZEA 3B0CW 3WA9C 4Z2MH 2IO5B 1M1AA 5F99D 4EO5B 5GT0C 5AV8A 3X1TB 3MGPC 3MGSB 4LD9B 5B33B 5AY8C 4ZUXD 1S32A 2RVQD 3KWQC 3LJAB 2PYOB 5GSUD 3TU4D 3V9RB 3AYWD 4G92B 4KGCB 3AZNC 3WAAA 1AOIB 4G91C 3REJC 4H9RB 4KUDD 2HIOA 4QLCA 5DNMA 3W99C 1ULYA 3KUYC 3X1SB 4J8XD 5AV6D 3AN2B 3WTPE 5BNVA 5B40C 4Z66A 1M18B 2F8NG 1P3MA 2AROC 4KHAB 3A6NC 4JJND 3AZMA 4H9PB 1N1JA 3W98B 5CP6D 4XUJD 5B24B 3AZIA 3WKJA 3AZEB 4Z5TA 3VH5A 3X1UB 4WU9D 3UTBD 4E44A 4WZSB 3MGQA 3AZGA 5E5AC 3WA9D 3LELD 3UT9D 3REHD 5BS7A 3O62D 3MNND 3REKC 5B2IC 3MGPD 1S32B 3LZ0D 1M19D 4X23A 1P3GD 3AZJC 5CPKB 3WAAB 5B0ZA 3AZND 4HGAC 1P3IC 4QLCB 2NZDA 5DNMB 3AV2D 1R4VA 3W99D 3LZ1C 5B1LC 1P3OD 1F66C 4YS3A 5AVCC 1ID3C 5BNVB 2F8NA 4WU8C 1KX4D 2CV5C 1P3PC 3A6ND 4J8UC 1N1JB 3AZIB 3WKJB 3UTAC 4XZQA 3X1VD 4Z5TB 3VH6A 5CPID 3AZGB 3AZLC 2BYMA 3KXBD 5DNNA 3W97A 5GXQD 3AZHC
chains in the Genus database with same CATH superfamily
4ZUXA 5B31C 5B2ID 3TU4A 3MGQC 5CPJD 4X23B 3AFAC 1ZLAD 4KUDA 5B0ZB 1TZYD 3AZJD 2DQNC 4J8VB 3AV1D 3B6FC 2NZDB 3C1BD 3P5JB 2FJ7D 4J8XA 4CSRA 3C1CC 3RELB 5B1LD 4Z2MG 3R45A 4YS3B 4J8WC 2UWXA 2F8NB 3MGSA 2CV5D 1P3PD 3MVDC 1HQ3D 2JCHA 4J8UD 3A1KA 3WTPA 3W96C 4WU9A 4XZQB 5BT1C 1P3FC 3V9RA 2CWEA 2BG1A 3LELA 3UT9A 5F99B 2BYMB 5DNNB 3REHA 1AOIA 3W97B 4YM6C 3O62A 3MNNA 5JRGC 4ZUXB 4H9NA 3TU4B 1M19A 3AYWB 5AV9C 1P3GA 3REIC 1F1EA 3MGRC 1KX3C 4KUDB 5AV5C 5B2JC 4WJ3C 5B32D 3AV2A 4R8PD 3B0CT 3B6FD 4H9SA 3W98A 4J8XB 4CSRB 5AV6B 4ZBJC 1P3OA 4H9OA 2F2AC 1PZRA 5AVBC 1P34D 3X1UA 3AZKD 3R45B 5C3IC 1KX4A 4JJNB 4J8WD 5GT3C 4XUJB 1P3AA 2G5IC 3X1VA 3WTPB 3UTBB 5BNXA 4WU9B 5JA4A 1EQZD 2LY8A 5CPIA 2IO5C 3AZFA 1P3FD 1KX5D 3WA9B 3LELB 3UT9B 3KXBA 2Y2PA 4EO5C 3B0BA 5B1MD 5CPKA 3REHB 4DQYB 3X1TC 3O62B 3MNNB 5B33C 4LD9C 1P3LD 3MGPB 1WWSA 3LZ0B 3LJAC 1W2EA 2PYOC 4H9NB 1P3KC 1M19B 4G92C 5CPJA 2YFVB 4KGCC 1P3GB 5AV9D 1ZLAA 1AOIC 1TZYA 5B32G 3AZNB 3MGRD 3AV1A 1BH8A 3C1BA 1KX3D 3AV2B 2FJ7A 3VH5T 2L5AA 2NQBA 3W99B 3X1SC 1U35D 3B6GA 3AN2C 1P3OB 4H9OB 2W8SA 5B0YD 5AVBD 1M18C 3EPJA 1KX4B 5GT0D 3W98C 1HQ3A 5B24C 1P3AB 3AZEC 5AY8D 3X1VB 5BNXB 5JA4B 2XD5A 5FUGA 3KWQD 5CPIB 3B0DB 3AZFB 2JE5A 1M1AC 3KXBB 5AV8C 5GXQB 4E45A 4J8VA 3REJD 1S32C 5B2IB 3RELA 5CPJB 1P3KD 3KUYD 4KGCD 1ZLAB 3WAAC 2HUEB 1TZYB 5B32A 2HIOC 3AV1B 4QLCC 1BH8B 3KFUG 5DNMC 4HGAB 5B40D 4R8PA 3C1BB 1P3BA 2FJ7B 2AROD 2NQBB 3VH6T 2Y2OA 4CAYA 3B6GB 1P34A 2JSSA 3AZKA 3AN2D 2FFFB 3EPHA 4Z66C 5F99A 1P3MC 5E5AD 3KSYA 4NE3A 4AWLB 3AZMC 2CV5B 1P3PB 1HQ3B 3AZIC 4J8UB 1EQZA 3WKJC 3REKD 4Z5TC 5GSUA 3AYWA 1KX5A 5FUGB 3AZGC 5B1MA 2F8NH 2Y2IA 1M1AD 1TAFA 5BS7C 1P3LA 5AV8D 2G5HC 1P3ID 5AV6A 4X23C 3LZ1D 1F66D 5B0ZC 4UPKA 3WAAD 5B32B 4JJNA 2NZDC 5AVCD 4R8PB 1P3BB 1ID3D 2HIOD 4WU8D 1Q9CA 5CP6A 1U35A 4XUJA 4CAYB 1P34B 5B0YA 3UTBA 3AZKB 3UTAD 4YS3C 3WA9A 2DF4C 4J8WB 4DRAA 4Z66D 3AZLD 1P3MD 5GT0A 1BFMA 5GT3D 3MGPA 3AZMD 3AZHD 5AY8A 3LZ0A 1EQZB 4XZQC 5GSUB 3KWQA 1KX5B 5B31D 2YFVA 3MGQD 5B1MB 3AZGD 5DNNC 3W97C 1TAFB 3AZNA 3AFAD 1P3LB 2BYKA 4ZUXC 3REJA 4M6BA 1HTAA 3TU4C 4NFTA 3W99A 2Y2MA 4WNNB 3C1CD 5AV9B 4X23D 4KUDC 5B40A 2AROA 5G49B 3A6NA 2NZDD 4J8XC 5CP6B 1U35B 1BH9A 3MVDD 5B0YB 5AVBB 3W96D 5BT1D 5E5AA 3IP4C 5GXQA 2Y2HA 5GT0B 3MGSC 4XUJC 3NQJA 4YM6D 5JRGD 3REKA 5B2IA 5AY8B 5B31G 3WTPC 4WU9C 3KWQB 4XZQD 3LELC 2YFWB 3UT9C 3REHC 3NQUA 2ZY3A 3REID 3O62C 3AZJA 5DNND 3MNNC 3W97D 2BYKB 4G91B 5KDMB 3REJB 1B6WA 4UUZB 5AV5D 1P3IA 5B2JD 3LZ0C 1M19C 3LZ1A 1P3GC 1P3KB 3KUYB 5B1LA 1F66A 1B67A 5AVCA 1ID3A 5B40B 3AV2C 2AROB 4WU8A 3A6NB 4H9SC 2CV5A 1P3PA 4J8UA 1P3OC 1BH9B 3X1UC 3UTAA 3F6TA 1KX4C 5E5AB 3AZLA 5GT3A 3AZHA 3NQJB 3X1TD 1P3AC 3MGSD 4LD9D 5B33D 3X1VC 3REKB 5B31A 5CPIC 3WTPD 3LJAD 3VH5W 3B0DC 3AZFC 2PYOD 3KXBC 5CPKC 5GXQC 1M1AB 3NQUB 3AFAA 3AZJB 5AV8B 1AOID 1P3IB 3B6FA 4H9QA 1H3OA 1Z2CB 5CPJC 3LZ1B 3C1CA 3X1SD 5B1LB 1F66B 2HUEC 4WV4B 4DRBA 1TZYC 1ZLAC 3AV1C 5AVCB 2ZM5A 3C1BC 4J8WA 2HIOB 1M18D 1ID3B 2FJ7C 4WU8B 2NQBC 4NE6A 3B6GC 3W98D 3MVDA 5B24D 3W96A 3UTAB 1P3FA 3AZED 3X1UD 4Z66B 3AZLB 4NE5A 1P3MB 4AWLC 2RIQA 5GT3B 4YM6A 1HQ3C 3AZHB 3AZMB 5JRGA 2Y2JA 1P3AD 2F8NK 1S32D 5B31B 4WNNA 3MGQB 5AV9A 2VQRA 3VH6W 3AZFD 3REIA 3H0MC 2Y2QA 3AFAB 5CPKD 3MGRA 1KX3A 2Y2KA 5AV5A 4J8VC 5B2JA 5G49A 4QLCD 3B6FB 5DNMD 4H9QB 1H3OB 3RELC 3C1CB 5AVBA 5B32C 4R8PC 1P3BC 2NQBD 5BO0A 1P34C 3EPLA 3MVDB 1JFIA 3AZKC 3B6GD 3AZID 3WKJD 3W96B 1KU5A 1P3FB 4Z5TD 2YFWA 5F99C 3X1TA 4YM6B 5KDMA 4LD9A 5B33A 4UUZA 5JRGB 2RVQC 1EQZC 5GSUC 3LJAA 3AYWC 2PYOA 1KX5C 3AL0C 1P3KA 3KUYA 5B1MC 4KGCA 3REIB 3FDDA 1P3LC 3MGRB 4H9RA 5B0ZD 1KX3B 5AV5B 3EG5B 5B2JB 5CHLB 4J8VD 5AV6C 2ZY2A 3X1SA 3RELD 4ZBJB 3AN2A 1M18A 4YS3D 4JJNC 2ZY4A 5C3IB 4KHAA 1WWIA 2F8ND 1P3BD 5CP6C 1U35C 4H9PA 5BO0B 2J8PA 1A7WA 5B24A 5B0YC 3UTBC 1JFIB 3AZEA 3B0CW 3WA9C 4Z2MH 2IO5B 1M1AA 5F99D 4EO5B 5GT0C 5AV8A 3X1TB 3MGPC 3MGSB 4LD9B 5B33B 5AY8C 4ZUXD 1S32A 2RVQD 3KWQC 3LJAB 2PYOB 5GSUD 3TU4D 3V9RB 3AYWD 4G92B 4KGCB 3AZNC 3WAAA 1AOIB 4G91C 3REJC 4H9RB 1T3UA 4KUDD 2HIOA 4QLCA 5DNMA 3W99C 1ULYA 3KUYC 3X1SB 4J8XD 5AV6D 3AN2B 3WTPE 3A1IA 5BNVA 5B40C 4Z66A 1M18B 2F8NG 1P3MA 2AROC 4KHAB 3A6NC 4JJND 3AZMA 4H9PB 1N1JA 3W98B 5CP6D 4XUJD 5B24B 3AZIA 3WKJA 3AZEB 2Y2LA 4Z5TA 2Y2GA 3VH5A 4WU9D 3H0LC 3X1UB 3UTBD 4E44A 4WZSB 3MGQA 3AZGA 5E5AC 3WA9D 3LELD 3UT9D 3REHD 5BS7A 3O62D 3MNND 3REKC 5B2IC 3MGPD 1S32B 3LZ0D 1M19D 4X23A 1P3GD 3AZJC 5CPKB 3WAAB 5B0ZA 3AZND 4HGAC 1P3IC 3EPKA 4QLCB 2NZDA 5DNMB 3AV2D 1R4VA 3W99D 3LZ1C 5B1LC 1P3OD 1F66C 4YS3A 5AVCC 2XD1A 5BNVB 2Y2NA 1ID3C 2F8NA 4WU8C 1KX4D 2CV5C 1P3PC 3A6ND 4J8UC 1N1JB 2ZY5A 3AZIB 3WKJB 3UTAC 4XZQA 3X1VD 3H0RC 4Z5TB 3VH6A 5CPID 3AZGB 3AZLC 2BYMA 3KXBD 5DNNA 3W97A 5GXQD 3AZHC
chains in the Genus database with same CATH topology
4ZUXA 5B31C 5B2ID 3TU4A 3MGQC 5CPJD 4X23B 3AFAC 1ZLAD 4KUDA 5B0ZB 1TZYD 3AZJD 2DQNC 4J8VB 3AV1D 3B6FC 2NZDB 3C1BD 3P5JB 2FJ7D 4J8XA 4CSRA 3C1CC 3RELB 5B1LD 4Z2MG 3R45A 4YS3B 4J8WC 2UWXA 2F8NB 3MGSA 2CV5D 1P3PD 3MVDC 1HQ3D 2JCHA 4J8UD 3A1KA 3WTPA 3W96C 4WU9A 4XZQB 5BT1C 1P3FC 3V9RA 2CWEA 2BG1A 3LELA 3UT9A 5F99B 2BYMB 5DNNB 3REHA 1AOIA 3W97B 4YM6C 3O62A 3MNNA 5JRGC 4ZUXB 4H9NA 3TU4B 1M19A 3AYWB 5AV9C 1P3GA 3REIC 1F1EA 3MGRC 1KX3C 4KUDB 5AV5C 5B2JC 4WJ3C 5B32D 3AV2A 4R8PD 3B0CT 3B6FD 4H9SA 3W98A 4J8XB 4CSRB 5AV6B 4ZBJC 1P3OA 4H9OA 2F2AC 1PZRA 5AVBC 1P34D 3X1UA 3AZKD 3R45B 5C3IC 1KX4A 4JJNB 4J8WD 5GT3C 4XUJB 1P3AA 2G5IC 3X1VA 3WTPB 3UTBB 5BNXA 4WU9B 5JA4A 1EQZD 2LY8A 5CPIA 2IO5C 3AZFA 1P3FD 1KX5D 3WA9B 3LELB 3UT9B 3KXBA 2Y2PA 4EO5C 3B0BA 5B1MD 5CPKA 3REHB 4DQYB 3X1TC 3O62B 3MNNB 5B33C 4LD9C 1P3LD 3MGPB 1WWSA 3LZ0B 3LJAC 1W2EA 2PYOC 4H9NB 1P3KC 1M19B 4G92C 5CPJA 2YFVB 4KGCC 1P3GB 5AV9D 1ZLAA 1AOIC 1TZYA 5B32G 3AZNB 3MGRD 3AV1A 1BH8A 3C1BA 1KX3D 3AV2B 2FJ7A 3VH5T 2L5AA 2NQBA 3W99B 3X1SC 1U35D 3B6GA 3AN2C 1P3OB 4H9OB 2W8SA 5B0YD 5AVBD 1M18C 3EPJA 1KX4B 5GT0D 3W98C 1HQ3A 5B24C 1P3AB 3AZEC 5AY8D 3X1VB 5BNXB 5JA4B 2XD5A 5FUGA 3KWQD 5CPIB 3B0DB 3AZFB 2JE5A 1M1AC 3KXBB 5AV8C 5GXQB 4E45A 4J8VA 3REJD 1S32C 5B2IB 3RELA 5CPJB 1P3KD 3KUYD 4KGCD 1ZLAB 3WAAC 2HUEB 1TZYB 5B32A 2HIOC 3AV1B 4QLCC 1BH8B 3KFUG 5DNMC 4HGAB 5B40D 4R8PA 3C1BB 1P3BA 2FJ7B 2AROD 2NQBB 3VH6T 2Y2OA 4CAYA 3B6GB 1P34A 2JSSA 3AZKA 3AN2D 2FFFB 3EPHA 4Z66C 5F99A 1P3MC 5E5AD 3KSYA 4NE3A 4AWLB 3AZMC 2CV5B 1P3PB 1HQ3B 3AZIC 4J8UB 1EQZA 3WKJC 3REKD 4Z5TC 5GSUA 3AYWA 1KX5A 5FUGB 3AZGC 5B1MA 2F8NH 2Y2IA 1M1AD 1TAFA 5BS7C 1P3LA 5AV8D 2G5HC 1P3ID 5AV6A 4X23C 3LZ1D 1F66D 5B0ZC 4UPKA 3WAAD 5B32B 4JJNA 2NZDC 5AVCD 4R8PB 1P3BB 1ID3D 2HIOD 4WU8D 1Q9CA 5CP6A 1U35A 4XUJA 4CAYB 1P34B 5B0YA 3UTBA 3AZKB 3UTAD 4YS3C 3WA9A 2DF4C 4J8WB 4DRAA 4Z66D 3AZLD 1P3MD 5GT0A 1BFMA 5GT3D 3MGPA 3AZMD 3AZHD 5AY8A 3LZ0A 1EQZB 4XZQC 5GSUB 3KWQA 1KX5B 5B31D 2YFVA 3MGQD 5B1MB 3AZGD 5DNNC 3W97C 1TAFB 3AZNA 3AFAD 1P3LB 2BYKA 4ZUXC 3REJA 4M6BA 1HTAA 3TU4C 4NFTA 3W99A 2Y2MA 4WNNB 3C1CD 5AV9B 4X23D 4KUDC 5B40A 2AROA 5G49B 3A6NA 2NZDD 4J8XC 5CP6B 1U35B 1BH9A 3MVDD 5B0YB 5AVBB 3W96D 5BT1D 5E5AA 3IP4C 5GXQA 2Y2HA 5GT0B 3MGSC 4XUJC 3NQJA 4YM6D 5JRGD 3REKA 5B2IA 5AY8B 5B31G 3WTPC 4WU9C 3KWQB 4XZQD 3LELC 2YFWB 3UT9C 3REHC 3NQUA 2ZY3A 3REID 3O62C 3AZJA 5DNND 3MNNC 3W97D 2BYKB 4G91B 5KDMB 3REJB 1B6WA 4UUZB 5AV5D 1P3IA 5B2JD 3LZ0C 1M19C 3LZ1A 1P3GC 1P3KB 3KUYB 5B1LA 1F66A 1B67A 5AVCA 1ID3A 5B40B 3AV2C 2AROB 4WU8A 3A6NB 4H9SC 2CV5A 1P3PA 4J8UA 1P3OC 1BH9B 3X1UC 3UTAA 3F6TA 1KX4C 5E5AB 3AZLA 5GT3A 3AZHA 3NQJB 3X1TD 1P3AC 3MGSD 4LD9D 5B33D 3X1VC 3REKB 5B31A 5CPIC 3WTPD 3LJAD 3VH5W 3B0DC 3AZFC 2PYOD 3KXBC 5CPKC 5GXQC 1M1AB 3NQUB 3AFAA 3AZJB 5AV8B 1AOID 1P3IB 3B6FA 4H9QA 1H3OA 1Z2CB 5CPJC 3LZ1B 3C1CA 3X1SD 5B1LB 1F66B 2HUEC 4WV4B 4DRBA 1TZYC 1ZLAC 3AV1C 5AVCB 2ZM5A 3C1BC 4J8WA 2HIOB 1M18D 1ID3B 2FJ7C 4WU8B 2NQBC 4NE6A 3B6GC 3W98D 3MVDA 5B24D 3W96A 3UTAB 1P3FA 3AZED 3X1UD 4Z66B 3AZLB 4NE5A 1P3MB 4AWLC 2RIQA 5GT3B 4YM6A 1HQ3C 3AZHB 3AZMB 5JRGA 2Y2JA 1P3AD 2F8NK 1S32D 5B31B 4WNNA 3MGQB 5AV9A 2VQRA 3VH6W 3AZFD 3REIA 3H0MC 2Y2QA 3AFAB 5CPKD 3MGRA 1KX3A 2Y2KA 5AV5A 4J8VC 5B2JA 5G49A 4QLCD 3B6FB 5DNMD 4H9QB 1H3OB 3RELC 3C1CB 5AVBA 5B32C 4R8PC 1P3BC 2NQBD 5BO0A 1P34C 3EPLA 3MVDB 1JFIA 3AZKC 3B6GD 3AZID 3WKJD 3W96B 1KU5A 1P3FB 4Z5TD 2YFWA 5F99C 3X1TA 4YM6B 5KDMA 4LD9A 5B33A 4UUZA 5JRGB 2RVQC 1EQZC 5GSUC 3LJAA 3AYWC 2PYOA 1KX5C 3AL0C 1P3KA 3KUYA 5B1MC 4KGCA 3REIB 3FDDA 1P3LC 3MGRB 4H9RA 5B0ZD 1KX3B 5AV5B 3EG5B 5B2JB 5CHLB 4J8VD 5AV6C 2ZY2A 3X1SA 3RELD 4ZBJB 3AN2A 1M18A 4YS3D 4JJNC 2ZY4A 5C3IB 4KHAA 1WWIA 2F8ND 1P3BD 5CP6C 1U35C 4H9PA 5BO0B 2J8PA 1A7WA 5B24A 5B0YC 3UTBC 1JFIB 3AZEA 3B0CW 3WA9C 4Z2MH 2IO5B 1M1AA 5F99D 4EO5B 5GT0C 5AV8A 3X1TB 3MGPC 3MGSB 4LD9B 5B33B 5AY8C 4ZUXD 1S32A 2RVQD 3KWQC 3LJAB 2PYOB 5GSUD 3TU4D 3V9RB 3AYWD 4G92B 4KGCB 3AZNC 3WAAA 1AOIB 4G91C 3REJC 4H9RB 1T3UA 4KUDD 2HIOA 4QLCA 5DNMA 3W99C 1ULYA 3KUYC 3X1SB 4J8XD 5AV6D 3AN2B 3WTPE 3A1IA 5BNVA 5B40C 4Z66A 1M18B 2F8NG 1P3MA 2AROC 4KHAB 3A6NC 4JJND 3AZMA 4H9PB 1N1JA 3W98B 5CP6D 4XUJD 5B24B 3AZIA 3WKJA 3AZEB 2Y2LA 4Z5TA 2Y2GA 3VH5A 4WU9D 3H0LC 3X1UB 3UTBD 4E44A 4WZSB 3MGQA 3AZGA 5E5AC 3WA9D 3LELD 3UT9D 3REHD 5BS7A 3O62D 3MNND 3REKC 5B2IC 3MGPD 1S32B 3LZ0D 1M19D 4X23A 1P3GD 3AZJC 5CPKB 3WAAB 5B0ZA 3AZND 4HGAC 1P3IC 3EPKA 4QLCB 2NZDA 5DNMB 3AV2D 1R4VA 3W99D 3LZ1C 5B1LC 1P3OD 1F66C 4YS3A 5AVCC 2XD1A 5BNVB 2Y2NA 1ID3C 2F8NA 4WU8C 1KX4D 2CV5C 1P3PC 3A6ND 4J8UC 1N1JB 2ZY5A 3AZIB 3WKJB 3UTAC 4XZQA 3X1VD 3H0RC 4Z5TB 3VH6A 5CPID 3AZGB 3AZLC 2BYMA 3KXBD 5DNNA 3W97A 5GXQD 3AZHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZUX A;  5B31 C;  5B2I D;  3TU4 A;  3MGQ C;  5CPJ D;  4X23 B;  3AFA C;  1ZLA D;  4KUD A;  5B0Z B;  1TZY D;  3AZJ D;  4J8V B;  3AV1 D;  3B6F C;  2NZD B;  3C1B D;  2FJ7 D;  4J8X A;  4CSR A;  3C1C C;  3REL B;  5B1L D;  4Z2M G;  3R45 A;  4YS3 B;  4J8W C;  2F8N B;  3MGS A;  2CV5 D;  1P3P D;  3MVD C;  1HQ3 D;  4J8U D;  3WTP A;  3W96 C;  4WU9 A;  4XZQ B;  5BT1 C;  1P3F C;  3V9R A;  2CWE A;  3LEL A;  3UT9 A;  5F99 B;  2BYM B;  5DNN B;  3REH A;  1AOI A;  3W97 B;  4YM6 C;  3O62 A;  3MNN A;  5JRG C;  4ZUX B;  4H9N A;  3TU4 B;  1M19 A;  3AYW B;  5AV9 C;  1P3G A;  3REI C;  1F1E A;  3MGR C;  1KX3 C;  4KUD B;  5AV5 C;  5B2J C;  5B32 D;  3AV2 A;  4R8P D;  3B0C T;  3B6F D;  4H9S A;  3W98 A;  4J8X B;  4CSR B;  5AV6 B;  4ZBJ C;  1P3O A;  4H9O A;  5AVB C;  1P34 D;  3X1U A;  3AZK D;  3R45 B;  5C3I C;  1KX4 A;  4JJN B;  4J8W D;  5GT3 C;  4XUJ B;  1P3A A;  3X1V A;  3WTP B;  3UTB B;  5BNX A;  4WU9 B;  5JA4 A;  1EQZ D;  2LY8 A;  5CPI A;  2IO5 C;  3AZF A;  1P3F D;  1KX5 D;  3WA9 B;  3LEL B;  3UT9 B;  3KXB A;  4EO5 C;  3B0B A;  5B1M D;  5CPK A;  3REH B;  3X1T C;  3O62 B;  3MNN B;  5B33 C;  4LD9 C;  1P3L D;  3MGP B;  1WWS A;  3LZ0 B;  3LJA C;  2PYO C;  4H9N B;  1P3K C;  1M19 B;  4G92 C;  5CPJ A;  2YFV B;  4KGC C;  1P3G B;  5AV9 D;  1ZLA A;  1AOI C;  1TZY A;  5B32 G;  3AZN B;  3MGR D;  3AV1 A;  1BH8 A;  3C1B A;  1KX3 D;  3AV2 B;  2FJ7 A;  3VH5 T;  2L5A A;  2NQB A;  3W99 B;  3X1S C;  1U35 D;  3B6G A;  3AN2 C;  1P3O B;  4H9O B;  5B0Y D;  5AVB D;  1M18 C;  1KX4 B;  5GT0 D;  3W98 C;  1HQ3 A;  5B24 C;  1P3A B;  3AZE C;  5AY8 D;  3X1V B;  5BNX B;  5JA4 B;  5FUG A;  3KWQ D;  5CPI B;  3B0D B;  3AZF B;  1M1A C;  3KXB B;  5AV8 C;  5GXQ B;  4E45 A;  4J8V A;  3REJ D;  1S32 C;  5B2I B;  3REL A;  5CPJ B;  1P3K D;  3KUY D;  4KGC D;  1ZLA B;  3WAA C;  2HUE B;  1TZY B;  5B32 A;  2HIO C;  3AV1 B;  4QLC C;  1BH8 B;  5DNM C;  4HGA B;  5B40 D;  4R8P A;  3C1B B;  1P3B A;  2FJ7 B;  2ARO D;  2NQB B;  3VH6 T;  4CAY A;  3B6G B;  1P34 A;  2JSS A;  3AZK A;  3AN2 D;  4Z66 C;  5F99 A;  1P3M C;  5E5A D;  3KSY A;  4NE3 A;  4AWL B;  3AZM C;  2CV5 B;  1P3P B;  1HQ3 B;  3AZI C;  4J8U B;  1EQZ A;  3WKJ C;  3REK D;  4Z5T C;  5GSU A;  3AYW A;  1KX5 A;  5FUG B;  3AZG C;  5B1M A;  2F8N H;  1M1A D;  1TAF A;  5BS7 C;  1P3L A;  5AV8 D;  1P3I D;  5AV6 A;  4X23 C;  3LZ1 D;  1F66 D;  5B0Z C;  3WAA D;  5B32 B;  4JJN A;  2NZD C;  5AVC D;  4R8P B;  1P3B B;  1ID3 D;  2HIO D;  4WU8 D;  1Q9C A;  5CP6 A;  1U35 A;  4XUJ A;  4CAY B;  1P34 B;  5B0Y A;  3UTB A;  3AZK B;  3UTA D;  4YS3 C;  3WA9 A;  4J8W B;  4DRA A;  4Z66 D;  3AZL D;  1P3M D;  5GT0 A;  1BFM A;  5GT3 D;  3MGP A;  3AZM D;  3AZH D;  5AY8 A;  3LZ0 A;  1EQZ B;  4XZQ C;  5GSU B;  3KWQ A;  1KX5 B;  5B31 D;  2YFV A;  3MGQ D;  5B1M B;  3AZG D;  5DNN C;  3W97 C;  1TAF B;  3AZN A;  3AFA D;  1P3L B;  2BYK A;  4ZUX C;  3REJ A;  4M6B A;  1HTA A;  3TU4 C;  4NFT A;  3W99 A;  4WNN B;  3C1C D;  5AV9 B;  4X23 D;  4KUD C;  5B40 A;  2ARO A;  5G49 B;  3A6N A;  2NZD D;  4J8X C;  5CP6 B;  1U35 B;  1BH9 A;  3MVD D;  5B0Y B;  5AVB B;  3W96 D;  5BT1 D;  5E5A A;  5GXQ A;  5GT0 B;  3MGS C;  4XUJ C;  3NQJ A;  4YM6 D;  5JRG D;  3REK A;  3WTP C;  5AY8 B;  5B2I A;  5B31 G;  4WU9 C;  3KWQ B;  4XZQ D;  3LEL C;  2YFW B;  3UT9 C;  3REH C;  3NQU A;  3REI D;  3O62 C;  3AZJ A;  5DNN D;  3MNN C;  3W97 D;  2BYK B;  4G91 B;  5KDM B;  3REJ B;  1B6W A;  4UUZ B;  5AV5 D;  1P3I A;  5B2J D;  3LZ0 C;  1M19 C;  3LZ1 A;  1P3G C;  1P3K B;  3KUY B;  5B1L A;  1F66 A;  1B67 A;  5AVC A;  1ID3 A;  5B40 B;  3AV2 C;  2ARO B;  4WU8 A;  3A6N B;  4H9S C;  2CV5 A;  1P3P A;  4J8U A;  1P3O C;  1BH9 B;  3X1U C;  3UTA A;  1KX4 C;  5E5A B;  3AZL A;  5GT3 A;  3AZH A;  3NQJ B;  3X1T D;  1P3A C;  3MGS D;  4LD9 D;  5B33 D;  3X1V C;  3REK B;  5B31 A;  5CPI C;  3WTP D;  3LJA D;  3VH5 W;  3B0D C;  3AZF C;  2PYO D;  3KXB C;  5CPK C;  5GXQ C;  1M1A B;  3NQU B;  3AFA A;  3AZJ B;  5AV8 B;  1AOI D;  1P3I B;  3B6F A;  4H9Q A;  1H3O A;  5CPJ C;  3LZ1 B;  3C1C A;  3X1S D;  5B1L B;  1F66 B;  2HUE C;  4WV4 B;  4DRB A;  1TZY C;  1ZLA C;  3AV1 C;  5AVC B;  3C1B C;  4J8W A;  1M18 D;  2HIO B;  1ID3 B;  2FJ7 C;  4WU8 B;  2NQB C;  4NE6 A;  3B6G C;  3W98 D;  3MVD A;  5B24 D;  3W96 A;  3UTA B;  1P3F A;  3AZE D;  3X1U D;  4Z66 B;  3AZL B;  4NE5 A;  1P3M B;  4AWL C;  5GT3 B;  4YM6 A;  1HQ3 C;  3AZH B;  3AZM B;  5JRG A;  2F8N K;  1P3A D;  1S32 D;  5B31 B;  4WNN A;  3MGQ B;  5AV9 A;  3VH6 W;  3AZF D;  3REI A;  3AFA B;  5CPK D;  3MGR A;  1KX3 A;  5AV5 A;  4J8V C;  5B2J A;  5G49 A;  4QLC D;  3B6F B;  5DNM D;  4H9Q B;  1H3O B;  3REL C;  3C1C B;  5AVB A;  5B32 C;  4R8P C;  1P3B C;  2NQB D;  5BO0 A;  1P34 C;  1JFI A;  3MVD B;  3AZK C;  3B6G D;  3AZI D;  3WKJ D;  3W96 B;  1KU5 A;  1P3F B;  4Z5T D;  2YFW A;  5F99 C;  3X1T A;  4YM6 B;  5KDM A;  4LD9 A;  5B33 A;  4UUZ A;  5JRG B;  2RVQ C;  1EQZ C;  5GSU C;  3LJA A;  3AYW C;  2PYO A;  1KX5 C;  1P3K A;  3KUY A;  5B1M C;  4KGC A;  3REI B;  1P3L C;  3MGR B;  4H9R A;  5B0Z D;  1KX3 B;  5AV5 B;  5B2J B;  5CHL B;  4J8V D;  5AV6 C;  3X1S A;  3REL D;  4ZBJ B;  3AN2 A;  1M18 A;  4YS3 D;  4JJN C;  5C3I B;  4KHA A;  1WWI A;  2F8N D;  1P3B D;  5CP6 C;  1U35 C;  4H9P A;  5BO0 B;  5B24 A;  1A7W A;  1JFI B;  5B0Y C;  3UTB C;  3AZE A;  3B0C W;  3WA9 C;  4Z2M H;  2IO5 B;  1M1A A;  5F99 D;  4EO5 B;  5GT0 C;  5AV8 A;  3X1T B;  3MGP C;  3MGS B;  4LD9 B;  5B33 B;  5AY8 C;  4ZUX D;  1S32 A;  2RVQ D;  3KWQ C;  3LJA B;  2PYO B;  5GSU D;  3TU4 D;  3V9R B;  3AYW D;  4G92 B;  4KGC B;  3AZN C;  3WAA A;  1AOI B;  4G91 C;  3REJ C;  4H9R B;  4KUD D;  2HIO A;  4QLC A;  5DNM A;  3W99 C;  1ULY A;  3KUY C;  3X1S B;  4J8X D;  5AV6 D;  3AN2 B;  3WTP E;  5BNV A;  5B40 C;  4Z66 A;  1M18 B;  2F8N G;  1P3M A;  2ARO C;  4KHA B;  3A6N C;  4JJN D;  3AZM A;  4H9P B;  1N1J A;  3W98 B;  5CP6 D;  4XUJ D;  5B24 B;  3AZI A;  3WKJ A;  3AZE B;  4Z5T A;  3VH5 A;  3X1U B;  4WU9 D;  3UTB D;  4E44 A;  4WZS B;  3MGQ A;  3AZG A;  5E5A C;  3WA9 D;  3LEL D;  3UT9 D;  3REH D;  5BS7 A;  3O62 D;  3MNN D;  3REK C;  5B2I C;  3MGP D;  1S32 B;  3LZ0 D;  1M19 D;  4X23 A;  1P3G D;  3AZJ C;  5CPK B;  3WAA B;  5B0Z A;  3AZN D;  4HGA C;  1P3I C;  4QLC B;  2NZD A;  5DNM B;  3AV2 D;  1R4V A;  3W99 D;  3LZ1 C;  5B1L C;  1P3O D;  1F66 C;  4YS3 A;  5AVC C;  1ID3 C;  5BNV B;  2F8N A;  4WU8 C;  1KX4 D;  2CV5 C;  1P3P C;  3A6N D;  4J8U C;  1N1J B;  3AZI B;  3WKJ B;  3UTA C;  4XZQ A;  3X1V D;  4Z5T B;  3VH6 A;  5CPI D;  3AZG B;  3AZL C;  2BYM A;  3KXB D;  5DNN A;  3W97 A;  5GXQ D;  3AZH C; 
#chains in the Genus database with same CATH topology
 4ZUX A;  5B31 C;  5B2I D;  3TU4 A;  3MGQ C;  5CPJ D;  4X23 B;  3AFA C;  1ZLA D;  4KUD A;  5B0Z B;  1TZY D;  3AZJ D;  2DQN C;  4J8V B;  3AV1 D;  3B6F C;  2NZD B;  3C1B D;  3P5J B;  2FJ7 D;  4J8X A;  4CSR A;  3C1C C;  3REL B;  5B1L D;  4Z2M G;  3R45 A;  4YS3 B;  4J8W C;  2UWX A;  2F8N B;  3MGS A;  2CV5 D;  1P3P D;  3MVD C;  1HQ3 D;  2JCH A;  4J8U D;  3A1K A;  3WTP A;  3W96 C;  4WU9 A;  4XZQ B;  5BT1 C;  1P3F C;  3V9R A;  2CWE A;  2BG1 A;  3LEL A;  3UT9 A;  5F99 B;  2BYM B;  5DNN B;  3REH A;  1AOI A;  3W97 B;  4YM6 C;  3O62 A;  3MNN A;  5JRG C;  4ZUX B;  4H9N A;  3TU4 B;  1M19 A;  3AYW B;  5AV9 C;  1P3G A;  3REI C;  1F1E A;  3MGR C;  1KX3 C;  4KUD B;  5AV5 C;  5B2J C;  4WJ3 C;  5B32 D;  3AV2 A;  4R8P D;  3B0C T;  3B6F D;  4H9S A;  3W98 A;  4J8X B;  4CSR B;  5AV6 B;  4ZBJ C;  1P3O A;  4H9O A;  2F2A C;  1PZR A;  5AVB C;  1P34 D;  3X1U A;  3AZK D;  3R45 B;  5C3I C;  1KX4 A;  4JJN B;  4J8W D;  5GT3 C;  4XUJ B;  1P3A A;  2G5I C;  3X1V A;  3WTP B;  3UTB B;  5BNX A;  4WU9 B;  5JA4 A;  1EQZ D;  2LY8 A;  5CPI A;  2IO5 C;  3AZF A;  1P3F D;  1KX5 D;  3WA9 B;  3LEL B;  3UT9 B;  3KXB A;  2Y2P A;  4EO5 C;  3B0B A;  5B1M D;  5CPK A;  3REH B;  4DQY B;  3X1T C;  3O62 B;  3MNN B;  5B33 C;  4LD9 C;  1P3L D;  3MGP B;  1WWS A;  3LZ0 B;  3LJA C;  1W2E A;  2PYO C;  4H9N B;  1P3K C;  1M19 B;  4G92 C;  5CPJ A;  2YFV B;  4KGC C;  1P3G B;  5AV9 D;  1ZLA A;  1AOI C;  1TZY A;  5B32 G;  3AZN B;  3MGR D;  3AV1 A;  1BH8 A;  3C1B A;  1KX3 D;  3AV2 B;  2FJ7 A;  3VH5 T;  2L5A A;  2NQB A;  3W99 B;  3X1S C;  1U35 D;  3B6G A;  3AN2 C;  1P3O B;  4H9O B;  2W8S A;  5B0Y D;  5AVB D;  1M18 C;  3EPJ A;  1KX4 B;  5GT0 D;  3W98 C;  1HQ3 A;  5B24 C;  1P3A B;  3AZE C;  5AY8 D;  3X1V B;  5BNX B;  5JA4 B;  2XD5 A;  5FUG A;  3KWQ D;  5CPI B;  3B0D B;  3AZF B;  2JE5 A;  1M1A C;  3KXB B;  5AV8 C;  5GXQ B;  4E45 A;  4J8V A;  3REJ D;  1S32 C;  5B2I B;  3REL A;  5CPJ B;  1P3K D;  3KUY D;  4KGC D;  1ZLA B;  3WAA C;  2HUE B;  1TZY B;  5B32 A;  2HIO C;  3AV1 B;  4QLC C;  1BH8 B;  3KFU G;  5DNM C;  4HGA B;  5B40 D;  4R8P A;  3C1B B;  1P3B A;  2FJ7 B;  2ARO D;  2NQB B;  3VH6 T;  2Y2O A;  4CAY A;  3B6G B;  1P34 A;  2JSS A;  3AZK A;  3AN2 D;  2FFF B;  3EPH A;  4Z66 C;  5F99 A;  1P3M C;  5E5A D;  3KSY A;  4NE3 A;  4AWL B;  3AZM C;  2CV5 B;  1P3P B;  1HQ3 B;  3AZI C;  4J8U B;  1EQZ A;  3WKJ C;  3REK D;  4Z5T C;  5GSU A;  3AYW A;  1KX5 A;  5FUG B;  3AZG C;  5B1M A;  2F8N H;  2Y2I A;  1M1A D;  1TAF A;  5BS7 C;  1P3L A;  5AV8 D;  2G5H C;  1P3I D;  5AV6 A;  4X23 C;  3LZ1 D;  1F66 D;  5B0Z C;  4UPK A;  3WAA D;  5B32 B;  4JJN A;  2NZD C;  5AVC D;  4R8P B;  1P3B B;  1ID3 D;  2HIO D;  4WU8 D;  1Q9C A;  5CP6 A;  1U35 A;  4XUJ A;  4CAY B;  1P34 B;  5B0Y A;  3UTB A;  3AZK B;  3UTA D;  4YS3 C;  3WA9 A;  2DF4 C;  4J8W B;  4DRA A;  4Z66 D;  3AZL D;  1P3M D;  5GT0 A;  1BFM A;  5GT3 D;  3MGP A;  3AZM D;  3AZH D;  5AY8 A;  3LZ0 A;  1EQZ B;  4XZQ C;  5GSU B;  3KWQ A;  1KX5 B;  5B31 D;  2YFV A;  3MGQ D;  5B1M B;  3AZG D;  5DNN C;  3W97 C;  1TAF B;  3AZN A;  3AFA D;  1P3L B;  2BYK A;  4ZUX C;  3REJ A;  4M6B A;  1HTA A;  3TU4 C;  4NFT A;  3W99 A;  2Y2M A;  4WNN B;  3C1C D;  5AV9 B;  4X23 D;  4KUD C;  5B40 A;  2ARO A;  5G49 B;  3A6N A;  2NZD D;  4J8X C;  5CP6 B;  1U35 B;  1BH9 A;  3MVD D;  5B0Y B;  5AVB B;  3W96 D;  5BT1 D;  5E5A A;  3IP4 C;  5GXQ A;  2Y2H A;  5GT0 B;  3MGS C;  4XUJ C;  3NQJ A;  4YM6 D;  5JRG D;  3REK A;  5B2I A;  5AY8 B;  5B31 G;  3WTP C;  4WU9 C;  3KWQ B;  4XZQ D;  3LEL C;  2YFW B;  3UT9 C;  3REH C;  3NQU A;  2ZY3 A;  3REI D;  3O62 C;  3AZJ A;  5DNN D;  3MNN C;  3W97 D;  2BYK B;  4G91 B;  5KDM B;  3REJ B;  1B6W A;  4UUZ B;  5AV5 D;  1P3I A;  5B2J D;  3LZ0 C;  1M19 C;  3LZ1 A;  1P3G C;  1P3K B;  3KUY B;  5B1L A;  1F66 A;  1B67 A;  5AVC A;  1ID3 A;  5B40 B;  3AV2 C;  2ARO B;  4WU8 A;  3A6N B;  4H9S C;  2CV5 A;  1P3P A;  4J8U A;  1P3O C;  1BH9 B;  3X1U C;  3UTA A;  3F6T A;  1KX4 C;  5E5A B;  3AZL A;  5GT3 A;  3AZH A;  3NQJ B;  3X1T D;  1P3A C;  3MGS D;  4LD9 D;  5B33 D;  3X1V C;  3REK B;  5B31 A;  5CPI C;  3WTP D;  3LJA D;  3VH5 W;  3B0D C;  3AZF C;  2PYO D;  3KXB C;  5CPK C;  5GXQ C;  1M1A B;  3NQU B;  3AFA A;  3AZJ B;  5AV8 B;  1AOI D;  1P3I B;  3B6F A;  4H9Q A;  1H3O A;  1Z2C B;  5CPJ C;  3LZ1 B;  3C1C A;  3X1S D;  5B1L B;  1F66 B;  2HUE C;  4WV4 B;  4DRB A;  1TZY C;  1ZLA C;  3AV1 C;  5AVC B;  2ZM5 A;  3C1B C;  4J8W A;  2HIO B;  1M18 D;  1ID3 B;  2FJ7 C;  4WU8 B;  2NQB C;  4NE6 A;  3B6G C;  3W98 D;  3MVD A;  5B24 D;  3W96 A;  3UTA B;  1P3F A;  3AZE D;  3X1U D;  4Z66 B;  3AZL B;  4NE5 A;  1P3M B;  4AWL C;  2RIQ A;  5GT3 B;  4YM6 A;  1HQ3 C;  3AZH B;  3AZM B;  5JRG A;  2Y2J A;  1P3A D;  2F8N K;  1S32 D;  5B31 B;  4WNN A;  3MGQ B;  5AV9 A;  2VQR A;  3VH6 W;  3AZF D;  3REI A;  3H0M C;  2Y2Q A;  3AFA B;  5CPK D;  3MGR A;  1KX3 A;  2Y2K A;  5AV5 A;  4J8V C;  5B2J A;  5G49 A;  4QLC D;  3B6F B;  5DNM D;  4H9Q B;  1H3O B;  3REL C;  3C1C B;  5AVB A;  5B32 C;  4R8P C;  1P3B C;  2NQB D;  5BO0 A;  1P34 C;  3EPL A;  3MVD B;  1JFI A;  3AZK C;  3B6G D;  3AZI D;  3WKJ D;  3W96 B;  1KU5 A;  1P3F B;  4Z5T D;  2YFW A;  5F99 C;  3X1T A;  4YM6 B;  5KDM A;  4LD9 A;  5B33 A;  4UUZ A;  5JRG B;  2RVQ C;  1EQZ C;  5GSU C;  3LJA A;  3AYW C;  2PYO A;  1KX5 C;  3AL0 C;  1P3K A;  3KUY A;  5B1M C;  4KGC A;  3REI B;  3FDD A;  1P3L C;  3MGR B;  4H9R A;  5B0Z D;  1KX3 B;  5AV5 B;  3EG5 B;  5B2J B;  5CHL B;  4J8V D;  5AV6 C;  2ZY2 A;  3X1S A;  3REL D;  4ZBJ B;  3AN2 A;  1M18 A;  4YS3 D;  4JJN C;  2ZY4 A;  5C3I B;  4KHA A;  1WWI A;  2F8N D;  1P3B D;  5CP6 C;  1U35 C;  4H9P A;  5BO0 B;  2J8P A;  1A7W A;  5B24 A;  5B0Y C;  3UTB C;  1JFI B;  3AZE A;  3B0C W;  3WA9 C;  4Z2M H;  2IO5 B;  1M1A A;  5F99 D;  4EO5 B;  5GT0 C;  5AV8 A;  3X1T B;  3MGP C;  3MGS B;  4LD9 B;  5B33 B;  5AY8 C;  4ZUX D;  1S32 A;  2RVQ D;  3KWQ C;  3LJA B;  2PYO B;  5GSU D;  3TU4 D;  3V9R B;  3AYW D;  4G92 B;  4KGC B;  3AZN C;  3WAA A;  1AOI B;  4G91 C;  3REJ C;  4H9R B;  1T3U A;  4KUD D;  2HIO A;  4QLC A;  5DNM A;  3W99 C;  1ULY A;  3KUY C;  3X1S B;  4J8X D;  5AV6 D;  3AN2 B;  3WTP E;  3A1I A;  5BNV A;  5B40 C;  4Z66 A;  1M18 B;  2F8N G;  1P3M A;  2ARO C;  4KHA B;  3A6N C;  4JJN D;  3AZM A;  4H9P B;  1N1J A;  3W98 B;  5CP6 D;  4XUJ D;  5B24 B;  3AZI A;  3WKJ A;  3AZE B;  2Y2L A;  4Z5T A;  2Y2G A;  3VH5 A;  4WU9 D;  3H0L C;  3X1U B;  3UTB D;  4E44 A;  4WZS B;  3MGQ A;  3AZG A;  5E5A C;  3WA9 D;  3LEL D;  3UT9 D;  3REH D;  5BS7 A;  3O62 D;  3MNN D;  3REK C;  5B2I C;  3MGP D;  1S32 B;  3LZ0 D;  1M19 D;  4X23 A;  1P3G D;  3AZJ C;  5CPK B;  3WAA B;  5B0Z A;  3AZN D;  4HGA C;  1P3I C;  3EPK A;  4QLC B;  2NZD A;  5DNM B;  3AV2 D;  1R4V A;  3W99 D;  3LZ1 C;  5B1L C;  1P3O D;  1F66 C;  4YS3 A;  5AVC C;  2XD1 A;  5BNV B;  2Y2N A;  1ID3 C;  2F8N A;  4WU8 C;  1KX4 D;  2CV5 C;  1P3P C;  3A6N D;  4J8U C;  1N1J B;  2ZY5 A;  3AZI B;  3WKJ B;  3UTA C;  4XZQ A;  3X1V D;  3H0R C;  4Z5T B;  3VH6 A;  5CPI D;  3AZG B;  3AZL C;  2BYM A;  3KXB D;  5DNN A;  3W97 A;  5GXQ D;  3AZH C; 
#chains in the Genus database with same CATH homology
 4ZUX A;  5B31 C;  5B2I D;  3TU4 A;  3MGQ C;  5CPJ D;  4X23 B;  3AFA C;  1ZLA D;  4KUD A;  5B0Z B;  1TZY D;  3AZJ D;  2DQN C;  4J8V B;  3AV1 D;  3B6F C;  2NZD B;  3C1B D;  3P5J B;  2FJ7 D;  4J8X A;  4CSR A;  3C1C C;  3REL B;  5B1L D;  4Z2M G;  3R45 A;  4YS3 B;  4J8W C;  2UWX A;  2F8N B;  3MGS A;  2CV5 D;  1P3P D;  3MVD C;  1HQ3 D;  2JCH A;  4J8U D;  3A1K A;  3WTP A;  3W96 C;  4WU9 A;  4XZQ B;  5BT1 C;  1P3F C;  3V9R A;  2CWE A;  2BG1 A;  3LEL A;  3UT9 A;  5F99 B;  2BYM B;  5DNN B;  3REH A;  1AOI A;  3W97 B;  4YM6 C;  3O62 A;  3MNN A;  5JRG C;  4ZUX B;  4H9N A;  3TU4 B;  1M19 A;  3AYW B;  5AV9 C;  1P3G A;  3REI C;  1F1E A;  3MGR C;  1KX3 C;  4KUD B;  5AV5 C;  5B2J C;  4WJ3 C;  5B32 D;  3AV2 A;  4R8P D;  3B0C T;  3B6F D;  4H9S A;  3W98 A;  4J8X B;  4CSR B;  5AV6 B;  4ZBJ C;  1P3O A;  4H9O A;  2F2A C;  1PZR A;  5AVB C;  1P34 D;  3X1U A;  3AZK D;  3R45 B;  5C3I C;  1KX4 A;  4JJN B;  4J8W D;  5GT3 C;  4XUJ B;  1P3A A;  2G5I C;  3X1V A;  3WTP B;  3UTB B;  5BNX A;  4WU9 B;  5JA4 A;  1EQZ D;  2LY8 A;  5CPI A;  2IO5 C;  3AZF A;  1P3F D;  1KX5 D;  3WA9 B;  3LEL B;  3UT9 B;  3KXB A;  2Y2P A;  4EO5 C;  3B0B A;  5B1M D;  5CPK A;  3REH B;  4DQY B;  3X1T C;  3O62 B;  3MNN B;  5B33 C;  4LD9 C;  1P3L D;  3MGP B;  1WWS A;  3LZ0 B;  3LJA C;  1W2E A;  2PYO C;  4H9N B;  1P3K C;  1M19 B;  4G92 C;  5CPJ A;  2YFV B;  4KGC C;  1P3G B;  5AV9 D;  1ZLA A;  1AOI C;  1TZY A;  5B32 G;  3AZN B;  3MGR D;  3AV1 A;  1BH8 A;  3C1B A;  1KX3 D;  3AV2 B;  2FJ7 A;  3VH5 T;  2L5A A;  2NQB A;  3W99 B;  3X1S C;  1U35 D;  3B6G A;  3AN2 C;  1P3O B;  4H9O B;  2W8S A;  5B0Y D;  5AVB D;  1M18 C;  3EPJ A;  1KX4 B;  5GT0 D;  3W98 C;  1HQ3 A;  5B24 C;  1P3A B;  3AZE C;  5AY8 D;  3X1V B;  5BNX B;  5JA4 B;  2XD5 A;  5FUG A;  3KWQ D;  5CPI B;  3B0D B;  3AZF B;  2JE5 A;  1M1A C;  3KXB B;  5AV8 C;  5GXQ B;  4E45 A;  4J8V A;  3REJ D;  1S32 C;  5B2I B;  3REL A;  5CPJ B;  1P3K D;  3KUY D;  4KGC D;  1ZLA B;  3WAA C;  2HUE B;  1TZY B;  5B32 A;  2HIO C;  3AV1 B;  4QLC C;  1BH8 B;  3KFU G;  5DNM C;  4HGA B;  5B40 D;  4R8P A;  3C1B B;  1P3B A;  2FJ7 B;  2ARO D;  2NQB B;  3VH6 T;  2Y2O A;  4CAY A;  3B6G B;  1P34 A;  2JSS A;  3AZK A;  3AN2 D;  2FFF B;  3EPH A;  4Z66 C;  5F99 A;  1P3M C;  5E5A D;  3KSY A;  4NE3 A;  4AWL B;  3AZM C;  2CV5 B;  1P3P B;  1HQ3 B;  3AZI C;  4J8U B;  1EQZ A;  3WKJ C;  3REK D;  4Z5T C;  5GSU A;  3AYW A;  1KX5 A;  5FUG B;  3AZG C;  5B1M A;  2F8N H;  2Y2I A;  1M1A D;  1TAF A;  5BS7 C;  1P3L A;  5AV8 D;  2G5H C;  1P3I D;  5AV6 A;  4X23 C;  3LZ1 D;  1F66 D;  5B0Z C;  4UPK A;  3WAA D;  5B32 B;  4JJN A;  2NZD C;  5AVC D;  4R8P B;  1P3B B;  1ID3 D;  2HIO D;  4WU8 D;  1Q9C A;  5CP6 A;  1U35 A;  4XUJ A;  4CAY B;  1P34 B;  5B0Y A;  3UTB A;  3AZK B;  3UTA D;  4YS3 C;  3WA9 A;  2DF4 C;  4J8W B;  4DRA A;  4Z66 D;  3AZL D;  1P3M D;  5GT0 A;  1BFM A;  5GT3 D;  3MGP A;  3AZM D;  3AZH D;  5AY8 A;  3LZ0 A;  1EQZ B;  4XZQ C;  5GSU B;  3KWQ A;  1KX5 B;  5B31 D;  2YFV A;  3MGQ D;  5B1M B;  3AZG D;  5DNN C;  3W97 C;  1TAF B;  3AZN A;  3AFA D;  1P3L B;  2BYK A;  4ZUX C;  3REJ A;  4M6B A;  1HTA A;  3TU4 C;  4NFT A;  3W99 A;  2Y2M A;  4WNN B;  3C1C D;  5AV9 B;  4X23 D;  4KUD C;  5B40 A;  2ARO A;  5G49 B;  3A6N A;  2NZD D;  4J8X C;  5CP6 B;  1U35 B;  1BH9 A;  3MVD D;  5B0Y B;  5AVB B;  3W96 D;  5BT1 D;  5E5A A;  3IP4 C;  5GXQ A;  2Y2H A;  5GT0 B;  3MGS C;  4XUJ C;  3NQJ A;  4YM6 D;  5JRG D;  3REK A;  5B2I A;  5AY8 B;  5B31 G;  3WTP C;  4WU9 C;  3KWQ B;  4XZQ D;  3LEL C;  2YFW B;  3UT9 C;  3REH C;  3NQU A;  2ZY3 A;  3REI D;  3O62 C;  3AZJ A;  5DNN D;  3MNN C;  3W97 D;  2BYK B;  4G91 B;  5KDM B;  3REJ B;  1B6W A;  4UUZ B;  5AV5 D;  1P3I A;  5B2J D;  3LZ0 C;  1M19 C;  3LZ1 A;  1P3G C;  1P3K B;  3KUY B;  5B1L A;  1F66 A;  1B67 A;  5AVC A;  1ID3 A;  5B40 B;  3AV2 C;  2ARO B;  4WU8 A;  3A6N B;  4H9S C;  2CV5 A;  1P3P A;  4J8U A;  1P3O C;  1BH9 B;  3X1U C;  3UTA A;  3F6T A;  1KX4 C;  5E5A B;  3AZL A;  5GT3 A;  3AZH A;  3NQJ B;  3X1T D;  1P3A C;  3MGS D;  4LD9 D;  5B33 D;  3X1V C;  3REK B;  5B31 A;  5CPI C;  3WTP D;  3LJA D;  3VH5 W;  3B0D C;  3AZF C;  2PYO D;  3KXB C;  5CPK C;  5GXQ C;  1M1A B;  3NQU B;  3AFA A;  3AZJ B;  5AV8 B;  1AOI D;  1P3I B;  3B6F A;  4H9Q A;  1H3O A;  1Z2C B;  5CPJ C;  3LZ1 B;  3C1C A;  3X1S D;  5B1L B;  1F66 B;  2HUE C;  4WV4 B;  4DRB A;  1TZY C;  1ZLA C;  3AV1 C;  5AVC B;  2ZM5 A;  3C1B C;  4J8W A;  2HIO B;  1M18 D;  1ID3 B;  2FJ7 C;  4WU8 B;  2NQB C;  4NE6 A;  3B6G C;  3W98 D;  3MVD A;  5B24 D;  3W96 A;  3UTA B;  1P3F A;  3AZE D;  3X1U D;  4Z66 B;  3AZL B;  4NE5 A;  1P3M B;  4AWL C;  2RIQ A;  5GT3 B;  4YM6 A;  1HQ3 C;  3AZH B;  3AZM B;  5JRG A;  2Y2J A;  1P3A D;  2F8N K;  1S32 D;  5B31 B;  4WNN A;  3MGQ B;  5AV9 A;  2VQR A;  3VH6 W;  3AZF D;  3REI A;  3H0M C;  2Y2Q A;  3AFA B;  5CPK D;  3MGR A;  1KX3 A;  2Y2K A;  5AV5 A;  4J8V C;  5B2J A;  5G49 A;  4QLC D;  3B6F B;  5DNM D;  4H9Q B;  1H3O B;  3REL C;  3C1C B;  5AVB A;  5B32 C;  4R8P C;  1P3B C;  2NQB D;  5BO0 A;  1P34 C;  3EPL A;  3MVD B;  1JFI A;  3AZK C;  3B6G D;  3AZI D;  3WKJ D;  3W96 B;  1KU5 A;  1P3F B;  4Z5T D;  2YFW A;  5F99 C;  3X1T A;  4YM6 B;  5KDM A;  4LD9 A;  5B33 A;  4UUZ A;  5JRG B;  2RVQ C;  1EQZ C;  5GSU C;  3LJA A;  3AYW C;  2PYO A;  1KX5 C;  3AL0 C;  1P3K A;  3KUY A;  5B1M C;  4KGC A;  3REI B;  3FDD A;  1P3L C;  3MGR B;  4H9R A;  5B0Z D;  1KX3 B;  5AV5 B;  3EG5 B;  5B2J B;  5CHL B;  4J8V D;  5AV6 C;  2ZY2 A;  3X1S A;  3REL D;  4ZBJ B;  3AN2 A;  1M18 A;  4YS3 D;  4JJN C;  2ZY4 A;  5C3I B;  4KHA A;  1WWI A;  2F8N D;  1P3B D;  5CP6 C;  1U35 C;  4H9P A;  5BO0 B;  2J8P A;  1A7W A;  5B24 A;  5B0Y C;  3UTB C;  1JFI B;  3AZE A;  3B0C W;  3WA9 C;  4Z2M H;  2IO5 B;  1M1A A;  5F99 D;  4EO5 B;  5GT0 C;  5AV8 A;  3X1T B;  3MGP C;  3MGS B;  4LD9 B;  5B33 B;  5AY8 C;  4ZUX D;  1S32 A;  2RVQ D;  3KWQ C;  3LJA B;  2PYO B;  5GSU D;  3TU4 D;  3V9R B;  3AYW D;  4G92 B;  4KGC B;  3AZN C;  3WAA A;  1AOI B;  4G91 C;  3REJ C;  4H9R B;  1T3U A;  4KUD D;  2HIO A;  4QLC A;  5DNM A;  3W99 C;  1ULY A;  3KUY C;  3X1S B;  4J8X D;  5AV6 D;  3AN2 B;  3WTP E;  3A1I A;  5BNV A;  5B40 C;  4Z66 A;  1M18 B;  2F8N G;  1P3M A;  2ARO C;  4KHA B;  3A6N C;  4JJN D;  3AZM A;  4H9P B;  1N1J A;  3W98 B;  5CP6 D;  4XUJ D;  5B24 B;  3AZI A;  3WKJ A;  3AZE B;  2Y2L A;  4Z5T A;  2Y2G A;  3VH5 A;  4WU9 D;  3H0L C;  3X1U B;  3UTB D;  4E44 A;  4WZS B;  3MGQ A;  3AZG A;  5E5A C;  3WA9 D;  3LEL D;  3UT9 D;  3REH D;  5BS7 A;  3O62 D;  3MNN D;  3REK C;  5B2I C;  3MGP D;  1S32 B;  3LZ0 D;  1M19 D;  4X23 A;  1P3G D;  3AZJ C;  5CPK B;  3WAA B;  5B0Z A;  3AZN D;  4HGA C;  1P3I C;  3EPK A;  4QLC B;  2NZD A;  5DNM B;  3AV2 D;  1R4V A;  3W99 D;  3LZ1 C;  5B1L C;  1P3O D;  1F66 C;  4YS3 A;  5AVC C;  2XD1 A;  5BNV B;  2Y2N A;  1ID3 C;  2F8N A;  4WU8 C;  1KX4 D;  2CV5 C;  1P3P C;  3A6N D;  4J8U C;  1N1J B;  2ZY5 A;  3AZI B;  3WKJ B;  3UTA C;  4XZQ A;  3X1V D;  3H0R C;  4Z5T B;  3VH6 A;  5CPI D;  3AZG B;  3AZL C;  2BYM A;  3KXB D;  5DNN A;  3W97 A;  5GXQ D;  3AZH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...