1P3LC

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
b'KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 31
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3lC00
3VH5A 4WU8B 5AVCD 5AY8C 3X1SD 3A6NA 5KDMA 3UTAD 1U35D 3X1VC 1P3KD 3AYWD 3MGSB 5F99A 1P3OC 3REID 3KXBB 5B31G 5B1MA 3B6FA 3VH5W 3AZLD 2CV5B 1TAFB 3WTPB 3AZND 1JFIA 5JRGB 1P3AC 4ZUXB 1KX3B 3REHA 4KUDB 4H9SC 1ZLAB 4HGAC 4Z5TC 2JSSA 1R4VA 3B6GA 4KGCD 4XUJD 5CPKA 4J8WD 2IO5B 3UTBB 5CHLB 5AVBB 4XZQB 3AZHC 5AVCC 2F8NB 3X1SC 3AN2A 1U35C 1P3KC 3AYWC 4UUZB 1N1JA 3R45A 4KHAB 3LZ0D 3VH6T 1AOIA 2LY8A 1KX5D 3KWQC 3WAAA 3MGPA 5BNXA 3O62B 3AV1B 1P3LD 3AZNC 4G91C 1M18C 4QLCA 3X1TA 1TZYC 5B40A 4H9RA 4KGCC 4XUJC 4J8WC 1P3BC 5AV9D 3AFAD 3AZGC 4CSRB 3LELD 5B1LD 1EQZB 5BO0A 1KX5C 1P3LC 3KUYB 3MGRA 3AV2A 5BS7A 5AY8B 5B33D 1P3PD 3X1VB 4NE3A 3AZFA 4YS3D 2PYOC 4G92C 5AV9C 1P3OB 3AFAC 3MGQD 4J8XD 2AROD 3LELC 2BYMA 5C3IC 5B1LC 3NQJA 3NQUB 1P3AB 4JJNC 4HGAB 2NZDA 4ZBJC 4Z5TB 3C1BC 2BYKB 5AVCB 3X1SB 5B33C 5DNND 3UTAB 3LZ1A 1U35B 1P3KB 1P3PC 3AYWB 4WZSB 4YS3C 5G49B 3MGQC 5B0YD 4J8XC 5DNMD 5F99D 2AROC 1M19A 3AZLB 3REJA 3W99D 5B1MD 4G91B 3AZNB 1M18B 5BNVA 4H9NA 1F66A 3MVDD 1TZYB 4NE5A 4ZUXC 5AV8A 3REHD 4KGCB 4XUJB 4J8WB 1P3BB 3B6GD 3AZGB 5CPKD 3B0CT 5DNNC 4LD9A 5B24A 5CPJA 3LZ0B 3REKA 1S32D 3AN2D 1KX4D 2CWEA 5B0YC 2RVQC 5DNMC 3LJAD 1KX5B 1P3FA 3WKJA 3WAAD 1P3LB 3W99C 3MGPD 4Z66A 4CAYA 1P34A 3MVDC 3AZKA 4QLCD 1ID3D 3REHC 5B40D 3X1UA 1P3MA 3UT9A 2PYOB 4G92B 5AV9B 3AFAB 3B6GC 5B2JA 5CPKC 1A7WA 3LELB 4AWLB 5C3IB 1S32C 3AZMA 5B1LB 3AN2C 5B2IA 1HQ3A 1KX4C 4JJNB 3LJAC 2YFVB 4ZBJB 5CPIA 5B32A 3WAAC 3MGPC 3C1BB 2L5AA 5E5AD 4WU9A 3V9RB 3W96D 3WA9A 5B33B 3AZJA 1P3PB 3MGRD 2F8NH 4H9PA 4QLCC 4WU8A 1ID3C 5JA4B 4YM6A 4YS3B 3C1CD 3MGQB 3AZFD 4J8XB 4H9OA 2AROB 5GXQA 1B67A 5FUGB 2CV5A 2FJ7D 4E45A 3AZID 2NZDD 5E5AC 3WTPE 3W96C 5B31C 4Z2MH 3TU4D 5DNNB 4EO5B 3MGRC 3VH5T 3UTAC 1M1AA 4R8PA 4UUZA 3C1CC 3AZFC 5B0YB 5DNMB 5F99B 4WV4B 3REIC 1BH9B 5B1MB 1M19D 3W99B 4J8UD 3AZLC 4H9QA 3MVDB 2FJ7C 1F66D 3REHB 5GT0A 3AZIC 2NZDC 5AV8D 3B6GB 5CPKB 3TU4C 1S32B 4LD9D 3AN2B 5B24D 1N1JB 5CPJD 3LZ0C 1KX4B 3REKD 1P3IA 2NQBA 3LJAB 1BH8A 3WAAB 1Q9CA 1EQZA 3MGPB 5CP6D 1P3FD 4J8UC 4QLCB 3KUYA 1F66C 1ID3B 3AZKD 5AV8C 4H9RB 3X1UD 1P3MD 3B0DC 3UT9D 1P3OA 5B2JD 5BT1D 3RELA 4J8VA 4AWLC 4LD9C 5B24C 5CPJC 3REKC 3AZMD 5B2ID 3NQUA 1P3AA 4H9SA 4X23D 1P3FC 5CP6C 5CPID 5E5AB 4Z5TA 5B32D 3W96B 5B31B 3MNNA 3KSYA 3MGRB 4WU9D 3AZKC 3AZHA 1P3GD 3WA9D 1U35A 3A6ND 4YM6D 3C1CB 3AZFB 1P3MC 3UT9C 1B6WA 3REIB 5B32G 5B2JC 5BT1C 3KWQA 3AZMC 3B6FD 5GXQD 3NQJB 3AZNA 5B2IC 2FJ7B 1M18A 3AZIB 4WNNA 1TZYA 4X23C 2NZDB 5B0ZA 5B32C 4KGCA 5GSUA 3TU4B 1P3BA 4WU9C 3AZGA 3WA9C 1H3OA 1P3GC 4EO5C 5AV5A 5GT3A 3A6NC 4YM6C 3B0BA 1M1AD 4R8PD 5F99C 1M19B 1AOID 4J8UB 5B1MC 3B6FC 5GXQC 1P3LA 5BNVB 1F66B 5AV6A 4NE6A 5AV8B 3X1TD 1F1EA 5GT0D 3W97A 3B0DB 2PYOA 4LD9B 3AZEA 5B24B 3LELA 5CPJB 2HIOA 3REKB 3W98A 1M1AC 4R8PC 1P3ID 2NQBD 2YFWA 4JJNA 1P3FB 5CP6B 2YFVA 1AOIC 1BFMA 3C1BA 3V9RA 3AZKB 3AV2D 3KUYD 3X1TC 5B40C 1P3MB 3UT9B 5B2JB 3MGSA 2AROA 3KXBA 3RELD 3AZMB 4J8VD 5B2IB 1TAFA 3WTPA 2NQBC 4X23B 5JRGA 4ZUXA 5CPIB 1KX3A 4KUDA 5B32B 1ZLAA 2HUEC 4WU9B 3WA9B 3MNND 3UTBA 1P3GB 4DRBA 3AV2C 4H9PB 5DNNA 5BS7C 5AVBA 4XZQA 3A6NB 5KDMB 3AZHD 4YM6B 3LZ1D 2F8NA 4KHAA 3VH6A 4H9OB 5B0YA 5DNMA 1BH9A 3RELC 4J8VC 3KWQD 5GXQB 3B6FB 3W99A 3O62A 3REJD 3AV1A 1WWSA 1JFIB 3MVDA 1M18D 1TZYD 3VH6W 5B0ZD 5GSUD 3MNNC 1P3BD 3AZGD 4CSRA 3LZ1C 1S32A 5AV5D 3R45B 5GT3D 4R8PB 1M1AB 1KX4A 1P3GA 3LJAA 1AOIB 1M19C 5BNXB 2F8NK 3REJC 3WKJD 4H9QB 4Z66D 3X1TB 1P34D 5AV6D 5GT0B 1ID3A 5AY8A 5B40B 5B0ZC 3X1VA 3W97D 5GSUC 2PYOD 3AZED 5AV5C 5GT3C 2HIOD 1P3IB 2NQBB 3W98D 1HQ3D 1BH8B 4E44A 5BO0B 4JJND 2HUEB 5E5AA 3WKJC 3W96A 5B31A 4Z66C 3C1BD 3AV2B 2BYKA 1P34C 5AV6C 5AVCA 3AZJD 3X1SA 3UTAA 4WU8D 1P3KA 3AYWA 3W97C 3X1UC 3C1CA 5G49A 3REIA 3MGSD 3RELB 4J8VB 3AZEC 2BYMB 3KXBD 2HIOC 3AZLA 3W98C 1HQ3C 2FJ7A 2CV5D 3WTPD 5JRGD 3AZIA 5CPIC 4ZUXD 1KX3D 4KUDD 1ZLAD 4XUJA 4J8WA 3MNNB 3TU4A 3AZHB 3AZJC 3UTBD 3LZ1B 4WU8C 5AVBD 4XZQD 2F8ND 3LZ0A 3MGSC 2RVQD 1KX5A 3KWQB 3REJB 3KXBC 4J8UA 4DRAA 3B0CW 3O62D 4H9NB 3AV1D 2F8NG 2CV5C 3WTPC 4WNNB 5JRGC 5B0ZB 1KX3C 4KUDC 1ZLAC 5GSUB 5AV9A 3AFAA 2IO5C 1H3OB 3UTBC 1HTAA 5AV5B 5AVBC 5GT3B 4XZQC 5B1LA 1WWIA 5CP6A 3WKJB 1EQZD 4Z66B 4CAYB 4Z2MG 3O62C 3AV1C 1P34B 5AV6B 1KU5A 5B33A 1P3PA 5GT0C 3W97B 5AY8D 5JA4A 3X1UB 1ULYA 3X1VD 4YS3A 3MGQA 4J8XA 3AZEB 1P3OD 2HIOB 3W98B 1HQ3B 4M6BA 4NFTA 5FUGA 1P3IC 2YFWB 1P3AD 4X23A 1EQZC 4Z5TD 3AZJB 5B31D 3KUYC
chains in the Genus database with same CATH superfamily
3VH5A 4WU8B 5AVCD 5AY8C 3X1SD 3A6NA 5KDMA 3UTAD 2DQNC 1U35D 3X1VC 1P3KD 3AYWD 3MGSB 5F99A 1P3OC 3REID 3KXBB 5B31G 5B1MA 3B6FA 2Y2IA 3VH5W 3AZLD 2CV5B 1TAFB 3WTPB 3AZND 1JFIA 5JRGB 1P3AC 4ZUXB 1KX3B 3REHA 4KUDB 4H9SC 1ZLAB 4HGAC 4Z5TC 2JSSA 2Y2PA 1R4VA 3B6GA 4KGCD 4XUJD 5CPKA 4J8WD 2IO5B 3UTBB 5CHLB 5AVBB 4XZQB 3AZHC 5AVCC 2F8NB 3X1SC 3AN2A 1U35C 1P3KC 3AYWC 4UUZB 1N1JA 3R45A 4KHAB 3LZ0D 3VH6T 1AOIA 2LY8A 1T3UA 1KX5D 3KWQC 3WAAA 3MGPA 5BNXA 3O62B 3AV1B 1P3LD 3AZNC 4G91C 1M18C 4QLCA 2VQRA 3X1TA 1TZYC 5B40A 4H9RA 4KGCC 2Y2LA 4XUJC 4J8WC 2F2AC 1P3BC 5AV9D 3AFAD 3AZGC 4CSRB 3LELD 1Z2CB 5B1LD 1EQZB 5BO0A 1KX5C 2ZY4A 1P3LC 3KUYB 3MGRA 3AV2A 2W8SA 5BS7A 5AY8B 5B33D 1P3PD 3X1VB 4NE3A 3AZFA 4YS3D 2PYOC 4G92C 5AV9C 1P3OB 3AFAC 3MGQD 4J8XD 2AROD 3LELC 2UWXA 2BYMA 5C3IC 5B1LC 3NQJA 3NQUB 1P3AB 4JJNC 4HGAB 2NZDA 4ZBJC 4Z5TB 3C1BC 2BYKB 5AVCB 3X1SB 5B33C 5DNND 3UTAB 3LZ1A 1U35B 1P3KB 1P3PC 3AYWB 4WZSB 2DF4C 4YS3C 5G49B 3MGQC 5B0YD 4J8XC 5DNMD 5F99D 4WJ3C 2AROC 1M19A 2JE5A 3AZLB 3REJA 3W99D 5B1MD 4G91B 3AZNB 1M18B 5BNVA 4H9NA 1F66A 3MVDD 2J8PA 1TZYB 4NE5A 4ZUXC 5AV8A 3REHD 4KGCB 4XUJB 4J8WB 1P3BB 3B6GD 3AZGB 2Y2QA 5CPKD 3B0CT 5DNNC 4LD9A 5B24A 5CPJA 3LZ0B 3REKA 1S32D 3AN2D 1KX4D 2CWEA 5B0YC 2RVQC 5DNMC 3LJAD 1KX5B 1P3FA 3WKJA 3WAAD 1P3LB 3W99C 3MGPD 4Z66A 4CAYA 1P34A 3MVDC 3F6TA 3AZKA 4QLCD 1ID3D 3REHC 5B40D 3X1UA 1P3MA 2ZY2A 3UT9A 2PYOB 4G92B 5AV9B 3AFAB 3B6GC 5B2JA 5CPKC 1A7WA 3LELB 4AWLB 5C3IB 1S32C 3AZMA 5B1LB 3AN2C 2BG1A 5B2IA 1HQ3A 1KX4C 4JJNB 3LJAC 2YFVB 4ZBJB 5CPIA 5B32A 3WAAC 3MGPC 3C1BB 2L5AA 5E5AD 4WU9A 3V9RB 3W96D 3WA9A 5B33B 3AZJA 1P3PB 3MGRD 2F8NH 4H9PA 4QLCC 4WU8A 1ID3C 5JA4B 4YM6A 4YS3B 3C1CD 3MGQB 3AZFD 2Y2OA 4H9OA 4J8XB 2AROB 2Y2JA 5GXQA 1B67A 5FUGB 2CV5A 2FJ7D 4E45A 3AZID 2NZDD 5E5AC 3WTPE 3W96C 5B31C 4Z2MH 3TU4D 5DNNB 4EO5B 3MGRC 3VH5T 3UTAC 1M1AA 4R8PA 4UUZA 3C1CC 3AZFC 5B0YB 2ZY3A 5F99B 5DNMB 4WV4B 3REIC 1BH9B 5B1MB 1M19D 3W99B 4J8UD 3AZLC 4H9QA 3MVDB 2FJ7C 1F66D 3REHB 3P5JB 5GT0A 3AZIC 1PZRA 2NZDC 5AV8D 3B6GB 5CPKB 3EG5B 3TU4C 1S32B 4LD9D 3AN2B 5B24D 1N1JB 5CPJD 3LZ0C 1KX4B 3REKD 1P3IA 2NQBA 3LJAB 1BH8A 3WAAB 1Q9CA 1EQZA 3MGPB 5CP6D 1P3FD 4J8UC 2Y2MA 4QLCB 3KUYA 1F66C 1ID3B 3AZKD 5AV8C 4H9RB 3X1UD 2G5IC 1P3MD 3B0DC 3UT9D 1P3OA 5B2JD 5BT1D 3RELA 4J8VA 4AWLC 4LD9C 5B24C 5CPJC 3REKC 3AZMD 5B2ID 3NQUA 1P3AA 4H9SA 4X23D 1P3FC 5CP6C 5CPID 5E5AB 4Z5TA 5B32D 3W96B 5B31B 2FFFB 3MNNA 3KSYA 3MGRB 4WU9D 3A1IA 3AZKC 3AZHA 1P3GD 3WA9D 1U35A 3A6ND 4YM6D 3C1CB 3AZFB 1P3MC 2RIQA 3UT9C 1B6WA 2XD5A 3REIB 5B32G 5B2JC 5BT1C 3KWQA 3AZMC 3B6FD 5GXQD 3NQJB 3AZNA 5B2IC 2FJ7B 1M18A 3AZIB 4WNNA 1TZYA 4X23C 2NZDB 5B0ZA 5B32C 4KGCA 5GSUA 3TU4B 1P3BA 4WU9C 3AZGA 3WA9C 1H3OA 1P3GC 4EO5C 5AV5A 5GT3A 3A6NC 4YM6C 3B0BA 1M1AD 4R8PD 5F99C 1M19B 1AOID 4J8UB 5B1MC 3B6FC 5GXQC 1P3LA 3EPLA 5BNVB 1F66B 5AV6A 4NE6A 5AV8B 3X1TD 1F1EA 5GT0D 3W97A 3B0DB 3H0MC 2PYOA 4LD9B 3AZEA 5B24B 3LELA 5CPJB 2HIOA 3REKB 3W98A 1M1AC 4R8PC 1P3ID 2NQBD 2YFWA 4JJNA 1P3FB 5CP6B 2YFVA 1AOIC 1BFMA 3C1BA 3V9RA 3AZKB 3AV2D 3KUYD 3X1TC 5B40C 1P3MB 3EPKA 3UT9B 2G5HC 5B2JB 3MGSA 2AROA 3KXBA 3RELD 3AZMB 4J8VD 5B2IB 1TAFA 3WTPA 2NQBC 4X23B 5JRGA 4ZUXA 5CPIB 1KX3A 4KUDA 5B32B 1ZLAA 2HUEC 4WU9B 3WA9B 3MNND 3UTBA 1P3GB 4DRBA 3AV2C 4H9PB 5DNNA 5BS7C 5AVBA 4XZQA 3A6NB 5KDMB 3AZHD 4YM6B 3LZ1D 2F8NA 4KHAA 3A1KA 3VH6A 4H9OB 5B0YA 5DNMA 1BH9A 3RELC 4J8VC 3KWQD 5GXQB 3B6FB 3W99A 3O62A 3REJD 3AV1A 1WWSA 1JFIB 3MVDA 1M18D 1TZYD 3VH6W 4DQYB 5B0ZD 5GSUD 3MNNC 1P3BD 3AZGD 4CSRA 3LZ1C 1S32A 5AV5D 3R45B 5GT3D 4R8PB 1M1AB 1KX4A 3EPHA 1P3GA 2Y2HA 3LJAA 1AOIB 1M19C 5BNXB 2F8NK 3REJC 3WKJD 4H9QB 4Z66D 3X1TB 1P34D 5AV6D 5GT0B 1ID3A 5AY8A 5B40B 5B0ZC 3X1VA 3W97D 5GSUC 2PYOD 3AZED 5AV5C 5GT3C 2HIOD 1P3IB 2NQBB 3W98D 1HQ3D 2ZY5A 1BH8B 4E44A 5BO0B 4JJND 2HUEB 5E5AA 3WKJC 3W96A 5B31A 4Z66C 3C1BD 3AV2B 2BYKA 1P34C 5AV6C 5AVCA 3AZJD 3X1SA 3UTAA 4WU8D 1P3KA 3AYWA 3KFUG 3W97C 3X1UC 3C1CA 5G49A 3REIA 3MGSD 2JCHA 3RELB 4J8VB 3AZEC 2BYMB 3KXBD 2HIOC 3AZLA 3W98C 1HQ3C 2FJ7A 2CV5D 3WTPD 5JRGD 3IP4C 3AZIA 5CPIC 4ZUXD 1W2EA 3EPJA 1KX3D 4KUDD 1ZLAD 4XUJA 4J8WA 3MNNB 3TU4A 3AZHB 3AZJC 3UTBD 3LZ1B 4WU8C 5AVBD 4XZQD 2F8ND 3LZ0A 3MGSC 2Y2NA 2ZM5A 2RVQD 1KX5A 3KWQB 3REJB 3KXBC 4J8UA 4DRAA 3B0CW 3O62D 4H9NB 3AV1D 2F8NG 2CV5C 3WTPC 4WNNB 2Y2KA 5JRGC 5B0ZB 1KX3C 3AL0C 4KUDC 3FDDA 1ZLAC 5GSUB 5AV9A 3AFAA 2IO5C 1H3OB 3UTBC 1HTAA 2XD1A 5AV5B 5AVBC 5GT3B 4XZQC 3H0LC 5B1LA 3H0RC 1WWIA 5CP6A 3WKJB 1EQZD 4Z66B 4CAYB 4Z2MG 3O62C 3AV1C 1P34B 5AV6B 1KU5A 5B33A 1P3PA 5GT0C 3W97B 5AY8D 5JA4A 3X1UB 1ULYA 3X1VD 4YS3A 3MGQA 4J8XA 3AZEB 1P3OD 2Y2GA 2HIOB 3W98B 1HQ3B 4UPKA 4M6BA 4NFTA 5FUGA 1P3IC 2YFWB 1P3AD 4X23A 1EQZC 4Z5TD 3AZJB 5B31D 3KUYC
chains in the Genus database with same CATH topology
3VH5A 4WU8B 5AVCD 5AY8C 3X1SD 3A6NA 5KDMA 3UTAD 2DQNC 1U35D 3X1VC 1P3KD 3AYWD 3MGSB 5F99A 1P3OC 3REID 3KXBB 5B31G 5B1MA 3B6FA 2Y2IA 3VH5W 3AZLD 2CV5B 1TAFB 3WTPB 3AZND 1JFIA 5JRGB 1P3AC 4ZUXB 1KX3B 3REHA 4KUDB 4H9SC 1ZLAB 4HGAC 4Z5TC 2JSSA 2Y2PA 1R4VA 3B6GA 4KGCD 4XUJD 5CPKA 4J8WD 2IO5B 3UTBB 5CHLB 5AVBB 4XZQB 3AZHC 5AVCC 2F8NB 3X1SC 3AN2A 1U35C 1P3KC 3AYWC 4UUZB 1N1JA 3R45A 4KHAB 3LZ0D 3VH6T 1AOIA 2LY8A 1T3UA 1KX5D 3KWQC 3WAAA 3MGPA 5BNXA 3O62B 3AV1B 1P3LD 3AZNC 4G91C 1M18C 4QLCA 2VQRA 3X1TA 1TZYC 5B40A 4H9RA 4KGCC 2Y2LA 4XUJC 4J8WC 2F2AC 1P3BC 5AV9D 3AFAD 3AZGC 4CSRB 3LELD 1Z2CB 5B1LD 1EQZB 5BO0A 1KX5C 2ZY4A 1P3LC 3KUYB 3MGRA 3AV2A 2W8SA 5BS7A 5AY8B 5B33D 1P3PD 3X1VB 4NE3A 3AZFA 4YS3D 2PYOC 4G92C 5AV9C 1P3OB 3AFAC 3MGQD 4J8XD 2AROD 3LELC 2UWXA 2BYMA 5C3IC 5B1LC 3NQJA 3NQUB 1P3AB 4JJNC 4HGAB 2NZDA 4ZBJC 4Z5TB 3C1BC 2BYKB 5AVCB 3X1SB 5B33C 5DNND 3UTAB 3LZ1A 1U35B 1P3KB 1P3PC 3AYWB 4WZSB 2DF4C 4YS3C 5G49B 3MGQC 5B0YD 4J8XC 5DNMD 5F99D 4WJ3C 2AROC 1M19A 2JE5A 3AZLB 3REJA 3W99D 5B1MD 4G91B 3AZNB 1M18B 5BNVA 4H9NA 1F66A 3MVDD 2J8PA 1TZYB 4NE5A 4ZUXC 5AV8A 3REHD 4KGCB 4XUJB 4J8WB 1P3BB 3B6GD 3AZGB 2Y2QA 5CPKD 3B0CT 5DNNC 4LD9A 5B24A 5CPJA 3LZ0B 3REKA 1S32D 3AN2D 1KX4D 2CWEA 5B0YC 2RVQC 5DNMC 3LJAD 1KX5B 1P3FA 3WKJA 3WAAD 1P3LB 3W99C 3MGPD 4Z66A 4CAYA 1P34A 3MVDC 3F6TA 3AZKA 4QLCD 1ID3D 3REHC 5B40D 3X1UA 1P3MA 2ZY2A 3UT9A 2PYOB 4G92B 5AV9B 3AFAB 3B6GC 5B2JA 5CPKC 1A7WA 3LELB 4AWLB 5C3IB 1S32C 3AZMA 5B1LB 3AN2C 2BG1A 5B2IA 1HQ3A 1KX4C 4JJNB 3LJAC 2YFVB 4ZBJB 5CPIA 5B32A 3WAAC 3MGPC 3C1BB 2L5AA 5E5AD 4WU9A 3V9RB 3W96D 3WA9A 5B33B 3AZJA 1P3PB 3MGRD 2F8NH 4H9PA 4QLCC 4WU8A 1ID3C 5JA4B 4YM6A 4YS3B 3C1CD 3MGQB 3AZFD 2Y2OA 4H9OA 4J8XB 2AROB 2Y2JA 5GXQA 1B67A 5FUGB 2CV5A 2FJ7D 4E45A 3AZID 2NZDD 5E5AC 3WTPE 3W96C 5B31C 4Z2MH 3TU4D 5DNNB 4EO5B 3MGRC 3VH5T 3UTAC 1M1AA 4R8PA 4UUZA 3C1CC 3AZFC 5B0YB 2ZY3A 5F99B 5DNMB 4WV4B 3REIC 1BH9B 5B1MB 1M19D 3W99B 4J8UD 3AZLC 4H9QA 3MVDB 2FJ7C 1F66D 3REHB 3P5JB 5GT0A 3AZIC 1PZRA 2NZDC 5AV8D 3B6GB 5CPKB 3EG5B 3TU4C 1S32B 4LD9D 3AN2B 5B24D 1N1JB 5CPJD 3LZ0C 1KX4B 3REKD 1P3IA 2NQBA 3LJAB 1BH8A 3WAAB 1Q9CA 1EQZA 3MGPB 5CP6D 1P3FD 4J8UC 2Y2MA 4QLCB 3KUYA 1F66C 1ID3B 3AZKD 5AV8C 4H9RB 3X1UD 2G5IC 1P3MD 3B0DC 3UT9D 1P3OA 5B2JD 5BT1D 3RELA 4J8VA 4AWLC 4LD9C 5B24C 5CPJC 3REKC 3AZMD 5B2ID 3NQUA 1P3AA 4H9SA 4X23D 1P3FC 5CP6C 5CPID 5E5AB 4Z5TA 5B32D 3W96B 5B31B 2FFFB 3MNNA 3KSYA 3MGRB 4WU9D 3A1IA 3AZKC 3AZHA 1P3GD 3WA9D 1U35A 3A6ND 4YM6D 3C1CB 3AZFB 1P3MC 2RIQA 3UT9C 1B6WA 2XD5A 3REIB 5B32G 5B2JC 5BT1C 3KWQA 3AZMC 3B6FD 5GXQD 3NQJB 3AZNA 5B2IC 2FJ7B 1M18A 3AZIB 4WNNA 1TZYA 4X23C 2NZDB 5B0ZA 5B32C 4KGCA 5GSUA 3TU4B 1P3BA 4WU9C 3AZGA 3WA9C 1H3OA 1P3GC 4EO5C 5AV5A 5GT3A 3A6NC 4YM6C 3B0BA 1M1AD 4R8PD 5F99C 1M19B 1AOID 4J8UB 5B1MC 3B6FC 5GXQC 1P3LA 3EPLA 5BNVB 1F66B 5AV6A 4NE6A 5AV8B 3X1TD 1F1EA 5GT0D 3W97A 3B0DB 3H0MC 2PYOA 4LD9B 3AZEA 5B24B 3LELA 5CPJB 2HIOA 3REKB 3W98A 1M1AC 4R8PC 1P3ID 2NQBD 2YFWA 4JJNA 1P3FB 5CP6B 2YFVA 1AOIC 1BFMA 3C1BA 3V9RA 3AZKB 3AV2D 3KUYD 3X1TC 5B40C 1P3MB 3EPKA 3UT9B 2G5HC 5B2JB 3MGSA 2AROA 3KXBA 3RELD 3AZMB 4J8VD 5B2IB 1TAFA 3WTPA 2NQBC 4X23B 5JRGA 4ZUXA 5CPIB 1KX3A 4KUDA 5B32B 1ZLAA 2HUEC 4WU9B 3WA9B 3MNND 3UTBA 1P3GB 4DRBA 3AV2C 4H9PB 5DNNA 5BS7C 5AVBA 4XZQA 3A6NB 5KDMB 3AZHD 4YM6B 3LZ1D 2F8NA 4KHAA 3A1KA 3VH6A 4H9OB 5B0YA 5DNMA 1BH9A 3RELC 4J8VC 3KWQD 5GXQB 3B6FB 3W99A 3O62A 3REJD 3AV1A 1WWSA 1JFIB 3MVDA 1M18D 1TZYD 3VH6W 4DQYB 5B0ZD 5GSUD 3MNNC 1P3BD 3AZGD 4CSRA 3LZ1C 1S32A 5AV5D 3R45B 5GT3D 4R8PB 1M1AB 1KX4A 3EPHA 1P3GA 2Y2HA 3LJAA 1AOIB 1M19C 5BNXB 2F8NK 3REJC 3WKJD 4H9QB 4Z66D 3X1TB 1P34D 5AV6D 5GT0B 1ID3A 5AY8A 5B40B 5B0ZC 3X1VA 3W97D 5GSUC 2PYOD 3AZED 5AV5C 5GT3C 2HIOD 1P3IB 2NQBB 3W98D 1HQ3D 2ZY5A 1BH8B 4E44A 5BO0B 4JJND 2HUEB 5E5AA 3WKJC 3W96A 5B31A 4Z66C 3C1BD 3AV2B 2BYKA 1P34C 5AV6C 5AVCA 3AZJD 3X1SA 3UTAA 4WU8D 1P3KA 3AYWA 3KFUG 3W97C 3X1UC 3C1CA 5G49A 3REIA 3MGSD 2JCHA 3RELB 4J8VB 3AZEC 2BYMB 3KXBD 2HIOC 3AZLA 3W98C 1HQ3C 2FJ7A 2CV5D 3WTPD 5JRGD 3IP4C 3AZIA 5CPIC 4ZUXD 1W2EA 3EPJA 1KX3D 4KUDD 1ZLAD 4XUJA 4J8WA 3MNNB 3TU4A 3AZHB 3AZJC 3UTBD 3LZ1B 4WU8C 5AVBD 4XZQD 2F8ND 3LZ0A 3MGSC 2Y2NA 2ZM5A 2RVQD 1KX5A 3KWQB 3REJB 3KXBC 4J8UA 4DRAA 3B0CW 3O62D 4H9NB 3AV1D 2F8NG 2CV5C 3WTPC 4WNNB 2Y2KA 5JRGC 5B0ZB 1KX3C 3AL0C 4KUDC 3FDDA 1ZLAC 5GSUB 5AV9A 3AFAA 2IO5C 1H3OB 3UTBC 1HTAA 2XD1A 5AV5B 5AVBC 5GT3B 4XZQC 3H0LC 5B1LA 3H0RC 1WWIA 5CP6A 3WKJB 1EQZD 4Z66B 4CAYB 4Z2MG 3O62C 3AV1C 1P34B 5AV6B 1KU5A 5B33A 1P3PA 5GT0C 3W97B 5AY8D 5JA4A 3X1UB 1ULYA 3X1VD 4YS3A 3MGQA 4J8XA 3AZEB 1P3OD 2Y2GA 2HIOB 3W98B 1HQ3B 4UPKA 4M6BA 4NFTA 5FUGA 1P3IC 2YFWB 1P3AD 4X23A 1EQZC 4Z5TD 3AZJB 5B31D 3KUYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VH5 A;  4WU8 B;  5AVC D;  5AY8 C;  3X1S D;  3A6N A;  5KDM A;  3UTA D;  1U35 D;  3X1V C;  1P3K D;  3AYW D;  3MGS B;  5F99 A;  1P3O C;  3REI D;  3KXB B;  5B31 G;  5B1M A;  3B6F A;  3VH5 W;  3AZL D;  2CV5 B;  1TAF B;  3WTP B;  3AZN D;  1JFI A;  5JRG B;  1P3A C;  4ZUX B;  1KX3 B;  3REH A;  4KUD B;  4H9S C;  1ZLA B;  4HGA C;  4Z5T C;  2JSS A;  1R4V A;  3B6G A;  4KGC D;  4XUJ D;  5CPK A;  4J8W D;  2IO5 B;  3UTB B;  5CHL B;  5AVB B;  4XZQ B;  3AZH C;  5AVC C;  2F8N B;  3X1S C;  3AN2 A;  1U35 C;  1P3K C;  3AYW C;  4UUZ B;  1N1J A;  3R45 A;  4KHA B;  3LZ0 D;  3VH6 T;  1AOI A;  2LY8 A;  1KX5 D;  3KWQ C;  3WAA A;  3MGP A;  5BNX A;  3O62 B;  3AV1 B;  1P3L D;  3AZN C;  4G91 C;  1M18 C;  4QLC A;  3X1T A;  1TZY C;  5B40 A;  4H9R A;  4KGC C;  4XUJ C;  4J8W C;  1P3B C;  5AV9 D;  3AFA D;  3AZG C;  4CSR B;  3LEL D;  5B1L D;  1EQZ B;  5BO0 A;  1KX5 C;  1P3L C;  3KUY B;  3MGR A;  3AV2 A;  5BS7 A;  5AY8 B;  5B33 D;  1P3P D;  3X1V B;  4NE3 A;  3AZF A;  4YS3 D;  2PYO C;  4G92 C;  5AV9 C;  1P3O B;  3AFA C;  3MGQ D;  4J8X D;  2ARO D;  3LEL C;  2BYM A;  5C3I C;  5B1L C;  3NQJ A;  3NQU B;  1P3A B;  4JJN C;  4HGA B;  2NZD A;  4ZBJ C;  4Z5T B;  3C1B C;  2BYK B;  5AVC B;  3X1S B;  5B33 C;  5DNN D;  3UTA B;  3LZ1 A;  1U35 B;  1P3K B;  1P3P C;  3AYW B;  4WZS B;  4YS3 C;  5G49 B;  3MGQ C;  5B0Y D;  4J8X C;  5DNM D;  5F99 D;  2ARO C;  1M19 A;  3AZL B;  3REJ A;  3W99 D;  5B1M D;  4G91 B;  3AZN B;  1M18 B;  5BNV A;  4H9N A;  1F66 A;  3MVD D;  1TZY B;  4NE5 A;  4ZUX C;  5AV8 A;  3REH D;  4KGC B;  4XUJ B;  4J8W B;  1P3B B;  3B6G D;  3AZG B;  5CPK D;  3B0C T;  5DNN C;  4LD9 A;  5B24 A;  5CPJ A;  3LZ0 B;  3REK A;  1S32 D;  3AN2 D;  1KX4 D;  2CWE A;  5B0Y C;  2RVQ C;  5DNM C;  3LJA D;  1KX5 B;  1P3F A;  3WKJ A;  3WAA D;  1P3L B;  3W99 C;  3MGP D;  4Z66 A;  4CAY A;  1P34 A;  3MVD C;  3AZK A;  4QLC D;  1ID3 D;  3REH C;  5B40 D;  3X1U A;  1P3M A;  3UT9 A;  2PYO B;  4G92 B;  5AV9 B;  3AFA B;  3B6G C;  5B2J A;  5CPK C;  1A7W A;  3LEL B;  4AWL B;  5C3I B;  1S32 C;  3AZM A;  5B1L B;  3AN2 C;  5B2I A;  1HQ3 A;  1KX4 C;  4JJN B;  3LJA C;  2YFV B;  4ZBJ B;  5CPI A;  5B32 A;  3WAA C;  3MGP C;  3C1B B;  2L5A A;  5E5A D;  4WU9 A;  3V9R B;  3W96 D;  3WA9 A;  5B33 B;  3AZJ A;  1P3P B;  3MGR D;  2F8N H;  4H9P A;  4QLC C;  4WU8 A;  1ID3 C;  5JA4 B;  4YM6 A;  4YS3 B;  3C1C D;  3MGQ B;  3AZF D;  4J8X B;  4H9O A;  2ARO B;  5GXQ A;  1B67 A;  5FUG B;  2CV5 A;  2FJ7 D;  4E45 A;  3AZI D;  2NZD D;  5E5A C;  3WTP E;  3W96 C;  5B31 C;  4Z2M H;  3TU4 D;  5DNN B;  4EO5 B;  3MGR C;  3VH5 T;  3UTA C;  1M1A A;  4R8P A;  4UUZ A;  3C1C C;  3AZF C;  5B0Y B;  5DNM B;  5F99 B;  4WV4 B;  3REI C;  1BH9 B;  5B1M B;  1M19 D;  3W99 B;  4J8U D;  3AZL C;  4H9Q A;  3MVD B;  2FJ7 C;  1F66 D;  3REH B;  5GT0 A;  3AZI C;  2NZD C;  5AV8 D;  3B6G B;  5CPK B;  3TU4 C;  1S32 B;  4LD9 D;  3AN2 B;  5B24 D;  1N1J B;  5CPJ D;  3LZ0 C;  1KX4 B;  3REK D;  1P3I A;  2NQB A;  3LJA B;  1BH8 A;  3WAA B;  1Q9C A;  1EQZ A;  3MGP B;  5CP6 D;  1P3F D;  4J8U C;  4QLC B;  3KUY A;  1F66 C;  1ID3 B;  3AZK D;  5AV8 C;  4H9R B;  3X1U D;  1P3M D;  3B0D C;  3UT9 D;  1P3O A;  5B2J D;  5BT1 D;  3REL A;  4J8V A;  4AWL C;  4LD9 C;  5B24 C;  5CPJ C;  3REK C;  3AZM D;  5B2I D;  3NQU A;  1P3A A;  4H9S A;  4X23 D;  1P3F C;  5CP6 C;  5CPI D;  5E5A B;  4Z5T A;  5B32 D;  3W96 B;  5B31 B;  3MNN A;  3KSY A;  3MGR B;  4WU9 D;  3AZK C;  3AZH A;  1P3G D;  3WA9 D;  1U35 A;  3A6N D;  4YM6 D;  3C1C B;  3AZF B;  1P3M C;  3UT9 C;  1B6W A;  3REI B;  5B32 G;  5B2J C;  5BT1 C;  3KWQ A;  3AZM C;  3B6F D;  5GXQ D;  3NQJ B;  3AZN A;  5B2I C;  2FJ7 B;  1M18 A;  3AZI B;  4WNN A;  1TZY A;  4X23 C;  2NZD B;  5B0Z A;  5B32 C;  4KGC A;  5GSU A;  3TU4 B;  1P3B A;  4WU9 C;  3AZG A;  3WA9 C;  1H3O A;  1P3G C;  4EO5 C;  5AV5 A;  5GT3 A;  3A6N C;  4YM6 C;  3B0B A;  1M1A D;  4R8P D;  5F99 C;  1M19 B;  1AOI D;  4J8U B;  5B1M C;  3B6F C;  5GXQ C;  1P3L A;  5BNV B;  1F66 B;  5AV6 A;  4NE6 A;  5AV8 B;  3X1T D;  1F1E A;  5GT0 D;  3W97 A;  3B0D B;  2PYO A;  4LD9 B;  3AZE A;  5B24 B;  3LEL A;  5CPJ B;  2HIO A;  3REK B;  3W98 A;  1M1A C;  4R8P C;  1P3I D;  2NQB D;  2YFW A;  4JJN A;  1P3F B;  5CP6 B;  2YFV A;  1AOI C;  1BFM A;  3C1B A;  3V9R A;  3AZK B;  3AV2 D;  3KUY D;  3X1T C;  5B40 C;  1P3M B;  3UT9 B;  5B2J B;  3MGS A;  2ARO A;  3KXB A;  3REL D;  3AZM B;  4J8V D;  5B2I B;  1TAF A;  3WTP A;  2NQB C;  4X23 B;  5JRG A;  4ZUX A;  5CPI B;  1KX3 A;  4KUD A;  5B32 B;  1ZLA A;  2HUE C;  4WU9 B;  3WA9 B;  3MNN D;  3UTB A;  1P3G B;  4DRB A;  3AV2 C;  4H9P B;  5DNN A;  5BS7 C;  5AVB A;  4XZQ A;  3A6N B;  5KDM B;  3AZH D;  4YM6 B;  3LZ1 D;  2F8N A;  4KHA A;  3VH6 A;  4H9O B;  5B0Y A;  5DNM A;  1BH9 A;  3REL C;  4J8V C;  3KWQ D;  5GXQ B;  3B6F B;  3W99 A;  3O62 A;  3REJ D;  3AV1 A;  1WWS A;  1JFI B;  3MVD A;  1M18 D;  1TZY D;  3VH6 W;  5B0Z D;  5GSU D;  3MNN C;  1P3B D;  3AZG D;  4CSR A;  3LZ1 C;  1S32 A;  5AV5 D;  3R45 B;  5GT3 D;  4R8P B;  1M1A B;  1KX4 A;  1P3G A;  3LJA A;  1AOI B;  1M19 C;  5BNX B;  2F8N K;  3REJ C;  3WKJ D;  4H9Q B;  4Z66 D;  3X1T B;  1P34 D;  5AV6 D;  5GT0 B;  1ID3 A;  5AY8 A;  5B40 B;  5B0Z C;  3X1V A;  3W97 D;  5GSU C;  2PYO D;  3AZE D;  5AV5 C;  5GT3 C;  2HIO D;  1P3I B;  2NQB B;  3W98 D;  1HQ3 D;  1BH8 B;  4E44 A;  5BO0 B;  4JJN D;  2HUE B;  5E5A A;  3WKJ C;  3W96 A;  5B31 A;  4Z66 C;  3C1B D;  3AV2 B;  2BYK A;  1P34 C;  5AV6 C;  5AVC A;  3AZJ D;  3X1S A;  3UTA A;  4WU8 D;  1P3K A;  3AYW A;  3W97 C;  3X1U C;  3C1C A;  5G49 A;  3REI A;  3MGS D;  3REL B;  4J8V B;  3AZE C;  2BYM B;  3KXB D;  2HIO C;  3AZL A;  3W98 C;  1HQ3 C;  2FJ7 A;  2CV5 D;  3WTP D;  5JRG D;  3AZI A;  5CPI C;  4ZUX D;  1KX3 D;  4KUD D;  1ZLA D;  4XUJ A;  4J8W A;  3MNN B;  3TU4 A;  3AZH B;  3AZJ C;  3UTB D;  3LZ1 B;  4WU8 C;  5AVB D;  4XZQ D;  2F8N D;  3LZ0 A;  3MGS C;  2RVQ D;  1KX5 A;  3KWQ B;  3REJ B;  3KXB C;  4J8U A;  4DRA A;  3B0C W;  3O62 D;  4H9N B;  3AV1 D;  2F8N G;  2CV5 C;  3WTP C;  4WNN B;  5JRG C;  5B0Z B;  1KX3 C;  4KUD C;  1ZLA C;  5GSU B;  5AV9 A;  3AFA A;  2IO5 C;  1H3O B;  3UTB C;  1HTA A;  5AV5 B;  5AVB C;  5GT3 B;  4XZQ C;  5B1L A;  1WWI A;  5CP6 A;  3WKJ B;  1EQZ D;  4Z66 B;  4CAY B;  4Z2M G;  3O62 C;  3AV1 C;  1P34 B;  5AV6 B;  1KU5 A;  5B33 A;  1P3P A;  5GT0 C;  3W97 B;  5AY8 D;  5JA4 A;  3X1U B;  1ULY A;  3X1V D;  4YS3 A;  3MGQ A;  4J8X A;  3AZE B;  1P3O D;  2HIO B;  3W98 B;  1HQ3 B;  4M6B A;  4NFT A;  5FUG A;  1P3I C;  2YFW B;  1P3A D;  4X23 A;  1EQZ C;  4Z5T D;  3AZJ B;  5B31 D;  3KUY C; 
#chains in the Genus database with same CATH topology
 3VH5 A;  4WU8 B;  5AVC D;  5AY8 C;  3X1S D;  3A6N A;  5KDM A;  3UTA D;  2DQN C;  1U35 D;  3X1V C;  1P3K D;  3AYW D;  3MGS B;  5F99 A;  1P3O C;  3REI D;  3KXB B;  5B31 G;  5B1M A;  3B6F A;  2Y2I A;  3VH5 W;  3AZL D;  2CV5 B;  1TAF B;  3WTP B;  3AZN D;  1JFI A;  5JRG B;  1P3A C;  4ZUX B;  1KX3 B;  3REH A;  4KUD B;  4H9S C;  1ZLA B;  4HGA C;  4Z5T C;  2JSS A;  2Y2P A;  1R4V A;  3B6G A;  4KGC D;  4XUJ D;  5CPK A;  4J8W D;  2IO5 B;  3UTB B;  5CHL B;  5AVB B;  4XZQ B;  3AZH C;  5AVC C;  2F8N B;  3X1S C;  3AN2 A;  1U35 C;  1P3K C;  3AYW C;  4UUZ B;  1N1J A;  3R45 A;  4KHA B;  3LZ0 D;  3VH6 T;  1AOI A;  2LY8 A;  1T3U A;  1KX5 D;  3KWQ C;  3WAA A;  3MGP A;  5BNX A;  3O62 B;  3AV1 B;  1P3L D;  3AZN C;  4G91 C;  1M18 C;  4QLC A;  2VQR A;  3X1T A;  1TZY C;  5B40 A;  4H9R A;  4KGC C;  2Y2L A;  4XUJ C;  4J8W C;  2F2A C;  1P3B C;  5AV9 D;  3AFA D;  3AZG C;  4CSR B;  3LEL D;  1Z2C B;  5B1L D;  1EQZ B;  5BO0 A;  1KX5 C;  2ZY4 A;  1P3L C;  3KUY B;  3MGR A;  3AV2 A;  2W8S A;  5BS7 A;  5AY8 B;  5B33 D;  1P3P D;  3X1V B;  4NE3 A;  3AZF A;  4YS3 D;  2PYO C;  4G92 C;  5AV9 C;  1P3O B;  3AFA C;  3MGQ D;  4J8X D;  2ARO D;  3LEL C;  2UWX A;  2BYM A;  5C3I C;  5B1L C;  3NQJ A;  3NQU B;  1P3A B;  4JJN C;  4HGA B;  2NZD A;  4ZBJ C;  4Z5T B;  3C1B C;  2BYK B;  5AVC B;  3X1S B;  5B33 C;  5DNN D;  3UTA B;  3LZ1 A;  1U35 B;  1P3K B;  1P3P C;  3AYW B;  4WZS B;  2DF4 C;  4YS3 C;  5G49 B;  3MGQ C;  5B0Y D;  4J8X C;  5DNM D;  5F99 D;  4WJ3 C;  2ARO C;  1M19 A;  2JE5 A;  3AZL B;  3REJ A;  3W99 D;  5B1M D;  4G91 B;  3AZN B;  1M18 B;  5BNV A;  4H9N A;  1F66 A;  3MVD D;  2J8P A;  1TZY B;  4NE5 A;  4ZUX C;  5AV8 A;  3REH D;  4KGC B;  4XUJ B;  4J8W B;  1P3B B;  3B6G D;  3AZG B;  2Y2Q A;  5CPK D;  3B0C T;  5DNN C;  4LD9 A;  5B24 A;  5CPJ A;  3LZ0 B;  3REK A;  1S32 D;  3AN2 D;  1KX4 D;  2CWE A;  5B0Y C;  2RVQ C;  5DNM C;  3LJA D;  1KX5 B;  1P3F A;  3WKJ A;  3WAA D;  1P3L B;  3W99 C;  3MGP D;  4Z66 A;  4CAY A;  1P34 A;  3MVD C;  3F6T A;  3AZK A;  4QLC D;  1ID3 D;  3REH C;  5B40 D;  3X1U A;  1P3M A;  2ZY2 A;  3UT9 A;  2PYO B;  4G92 B;  5AV9 B;  3AFA B;  3B6G C;  5B2J A;  5CPK C;  1A7W A;  3LEL B;  4AWL B;  5C3I B;  1S32 C;  3AZM A;  5B1L B;  3AN2 C;  2BG1 A;  5B2I A;  1HQ3 A;  1KX4 C;  4JJN B;  3LJA C;  2YFV B;  4ZBJ B;  5CPI A;  5B32 A;  3WAA C;  3MGP C;  3C1B B;  2L5A A;  5E5A D;  4WU9 A;  3V9R B;  3W96 D;  3WA9 A;  5B33 B;  3AZJ A;  1P3P B;  3MGR D;  2F8N H;  4H9P A;  4QLC C;  4WU8 A;  1ID3 C;  5JA4 B;  4YM6 A;  4YS3 B;  3C1C D;  3MGQ B;  3AZF D;  2Y2O A;  4H9O A;  4J8X B;  2ARO B;  2Y2J A;  5GXQ A;  1B67 A;  5FUG B;  2CV5 A;  2FJ7 D;  4E45 A;  3AZI D;  2NZD D;  5E5A C;  3WTP E;  3W96 C;  5B31 C;  4Z2M H;  3TU4 D;  5DNN B;  4EO5 B;  3MGR C;  3VH5 T;  3UTA C;  1M1A A;  4R8P A;  4UUZ A;  3C1C C;  3AZF C;  5B0Y B;  2ZY3 A;  5F99 B;  5DNM B;  4WV4 B;  3REI C;  1BH9 B;  5B1M B;  1M19 D;  3W99 B;  4J8U D;  3AZL C;  4H9Q A;  3MVD B;  2FJ7 C;  1F66 D;  3REH B;  3P5J B;  5GT0 A;  3AZI C;  1PZR A;  2NZD C;  5AV8 D;  3B6G B;  5CPK B;  3EG5 B;  3TU4 C;  1S32 B;  4LD9 D;  3AN2 B;  5B24 D;  1N1J B;  5CPJ D;  3LZ0 C;  1KX4 B;  3REK D;  1P3I A;  2NQB A;  3LJA B;  1BH8 A;  3WAA B;  1Q9C A;  1EQZ A;  3MGP B;  5CP6 D;  1P3F D;  4J8U C;  2Y2M A;  4QLC B;  3KUY A;  1F66 C;  1ID3 B;  3AZK D;  5AV8 C;  4H9R B;  3X1U D;  2G5I C;  1P3M D;  3B0D C;  3UT9 D;  1P3O A;  5B2J D;  5BT1 D;  3REL A;  4J8V A;  4AWL C;  4LD9 C;  5B24 C;  5CPJ C;  3REK C;  3AZM D;  5B2I D;  3NQU A;  1P3A A;  4H9S A;  4X23 D;  1P3F C;  5CP6 C;  5CPI D;  5E5A B;  4Z5T A;  5B32 D;  3W96 B;  5B31 B;  2FFF B;  3MNN A;  3KSY A;  3MGR B;  4WU9 D;  3A1I A;  3AZK C;  3AZH A;  1P3G D;  3WA9 D;  1U35 A;  3A6N D;  4YM6 D;  3C1C B;  3AZF B;  1P3M C;  2RIQ A;  3UT9 C;  1B6W A;  2XD5 A;  3REI B;  5B32 G;  5B2J C;  5BT1 C;  3KWQ A;  3AZM C;  3B6F D;  5GXQ D;  3NQJ B;  3AZN A;  5B2I C;  2FJ7 B;  1M18 A;  3AZI B;  4WNN A;  1TZY A;  4X23 C;  2NZD B;  5B0Z A;  5B32 C;  4KGC A;  5GSU A;  3TU4 B;  1P3B A;  4WU9 C;  3AZG A;  3WA9 C;  1H3O A;  1P3G C;  4EO5 C;  5AV5 A;  5GT3 A;  3A6N C;  4YM6 C;  3B0B A;  1M1A D;  4R8P D;  5F99 C;  1M19 B;  1AOI D;  4J8U B;  5B1M C;  3B6F C;  5GXQ C;  1P3L A;  3EPL A;  5BNV B;  1F66 B;  5AV6 A;  4NE6 A;  5AV8 B;  3X1T D;  1F1E A;  5GT0 D;  3W97 A;  3B0D B;  3H0M C;  2PYO A;  4LD9 B;  3AZE A;  5B24 B;  3LEL A;  5CPJ B;  2HIO A;  3REK B;  3W98 A;  1M1A C;  4R8P C;  1P3I D;  2NQB D;  2YFW A;  4JJN A;  1P3F B;  5CP6 B;  2YFV A;  1AOI C;  1BFM A;  3C1B A;  3V9R A;  3AZK B;  3AV2 D;  3KUY D;  3X1T C;  5B40 C;  1P3M B;  3EPK A;  3UT9 B;  2G5H C;  5B2J B;  3MGS A;  2ARO A;  3KXB A;  3REL D;  3AZM B;  4J8V D;  5B2I B;  1TAF A;  3WTP A;  2NQB C;  4X23 B;  5JRG A;  4ZUX A;  5CPI B;  1KX3 A;  4KUD A;  5B32 B;  1ZLA A;  2HUE C;  4WU9 B;  3WA9 B;  3MNN D;  3UTB A;  1P3G B;  4DRB A;  3AV2 C;  4H9P B;  5DNN A;  5BS7 C;  5AVB A;  4XZQ A;  3A6N B;  5KDM B;  3AZH D;  4YM6 B;  3LZ1 D;  2F8N A;  4KHA A;  3A1K A;  3VH6 A;  4H9O B;  5B0Y A;  5DNM A;  1BH9 A;  3REL C;  4J8V C;  3KWQ D;  5GXQ B;  3B6F B;  3W99 A;  3O62 A;  3REJ D;  3AV1 A;  1WWS A;  1JFI B;  3MVD A;  1M18 D;  1TZY D;  3VH6 W;  4DQY B;  5B0Z D;  5GSU D;  3MNN C;  1P3B D;  3AZG D;  4CSR A;  3LZ1 C;  1S32 A;  5AV5 D;  3R45 B;  5GT3 D;  4R8P B;  1M1A B;  1KX4 A;  3EPH A;  1P3G A;  2Y2H A;  3LJA A;  1AOI B;  1M19 C;  5BNX B;  2F8N K;  3REJ C;  3WKJ D;  4H9Q B;  4Z66 D;  3X1T B;  1P34 D;  5AV6 D;  5GT0 B;  1ID3 A;  5AY8 A;  5B40 B;  5B0Z C;  3X1V A;  3W97 D;  5GSU C;  2PYO D;  3AZE D;  5AV5 C;  5GT3 C;  2HIO D;  1P3I B;  2NQB B;  3W98 D;  1HQ3 D;  2ZY5 A;  1BH8 B;  4E44 A;  5BO0 B;  4JJN D;  2HUE B;  5E5A A;  3WKJ C;  3W96 A;  5B31 A;  4Z66 C;  3C1B D;  3AV2 B;  2BYK A;  1P34 C;  5AV6 C;  5AVC A;  3AZJ D;  3X1S A;  3UTA A;  4WU8 D;  1P3K A;  3AYW A;  3KFU G;  3W97 C;  3X1U C;  3C1C A;  5G49 A;  3REI A;  3MGS D;  2JCH A;  3REL B;  4J8V B;  3AZE C;  2BYM B;  3KXB D;  2HIO C;  3AZL A;  3W98 C;  1HQ3 C;  2FJ7 A;  2CV5 D;  3WTP D;  5JRG D;  3IP4 C;  3AZI A;  5CPI C;  4ZUX D;  1W2E A;  3EPJ A;  1KX3 D;  4KUD D;  1ZLA D;  4XUJ A;  4J8W A;  3MNN B;  3TU4 A;  3AZH B;  3AZJ C;  3UTB D;  3LZ1 B;  4WU8 C;  5AVB D;  4XZQ D;  2F8N D;  3LZ0 A;  3MGS C;  2Y2N A;  2ZM5 A;  2RVQ D;  1KX5 A;  3KWQ B;  3REJ B;  3KXB C;  4J8U A;  4DRA A;  3B0C W;  3O62 D;  4H9N B;  3AV1 D;  2F8N G;  2CV5 C;  3WTP C;  4WNN B;  2Y2K A;  5JRG C;  5B0Z B;  1KX3 C;  3AL0 C;  4KUD C;  3FDD A;  1ZLA C;  5GSU B;  5AV9 A;  3AFA A;  2IO5 C;  1H3O B;  3UTB C;  1HTA A;  2XD1 A;  5AV5 B;  5AVB C;  5GT3 B;  4XZQ C;  3H0L C;  5B1L A;  3H0R C;  1WWI A;  5CP6 A;  3WKJ B;  1EQZ D;  4Z66 B;  4CAY B;  4Z2M G;  3O62 C;  3AV1 C;  1P34 B;  5AV6 B;  1KU5 A;  5B33 A;  1P3P A;  5GT0 C;  3W97 B;  5AY8 D;  5JA4 A;  3X1U B;  1ULY A;  3X1V D;  4YS3 A;  3MGQ A;  4J8X A;  3AZE B;  1P3O D;  2Y2G A;  2HIO B;  3W98 B;  1HQ3 B;  4UPK A;  4M6B A;  4NFT A;  5FUG A;  1P3I C;  2YFW B;  1P3A D;  4X23 A;  1EQZ C;  4Z5T D;  3AZJ B;  5B31 D;  3KUY C; 
#chains in the Genus database with same CATH homology
 3VH5 A;  4WU8 B;  5AVC D;  5AY8 C;  3X1S D;  3A6N A;  5KDM A;  3UTA D;  2DQN C;  1U35 D;  3X1V C;  1P3K D;  3AYW D;  3MGS B;  5F99 A;  1P3O C;  3REI D;  3KXB B;  5B31 G;  5B1M A;  3B6F A;  2Y2I A;  3VH5 W;  3AZL D;  2CV5 B;  1TAF B;  3WTP B;  3AZN D;  1JFI A;  5JRG B;  1P3A C;  4ZUX B;  1KX3 B;  3REH A;  4KUD B;  4H9S C;  1ZLA B;  4HGA C;  4Z5T C;  2JSS A;  2Y2P A;  1R4V A;  3B6G A;  4KGC D;  4XUJ D;  5CPK A;  4J8W D;  2IO5 B;  3UTB B;  5CHL B;  5AVB B;  4XZQ B;  3AZH C;  5AVC C;  2F8N B;  3X1S C;  3AN2 A;  1U35 C;  1P3K C;  3AYW C;  4UUZ B;  1N1J A;  3R45 A;  4KHA B;  3LZ0 D;  3VH6 T;  1AOI A;  2LY8 A;  1T3U A;  1KX5 D;  3KWQ C;  3WAA A;  3MGP A;  5BNX A;  3O62 B;  3AV1 B;  1P3L D;  3AZN C;  4G91 C;  1M18 C;  4QLC A;  2VQR A;  3X1T A;  1TZY C;  5B40 A;  4H9R A;  4KGC C;  2Y2L A;  4XUJ C;  4J8W C;  2F2A C;  1P3B C;  5AV9 D;  3AFA D;  3AZG C;  4CSR B;  3LEL D;  1Z2C B;  5B1L D;  1EQZ B;  5BO0 A;  1KX5 C;  2ZY4 A;  1P3L C;  3KUY B;  3MGR A;  3AV2 A;  2W8S A;  5BS7 A;  5AY8 B;  5B33 D;  1P3P D;  3X1V B;  4NE3 A;  3AZF A;  4YS3 D;  2PYO C;  4G92 C;  5AV9 C;  1P3O B;  3AFA C;  3MGQ D;  4J8X D;  2ARO D;  3LEL C;  2UWX A;  2BYM A;  5C3I C;  5B1L C;  3NQJ A;  3NQU B;  1P3A B;  4JJN C;  4HGA B;  2NZD A;  4ZBJ C;  4Z5T B;  3C1B C;  2BYK B;  5AVC B;  3X1S B;  5B33 C;  5DNN D;  3UTA B;  3LZ1 A;  1U35 B;  1P3K B;  1P3P C;  3AYW B;  4WZS B;  2DF4 C;  4YS3 C;  5G49 B;  3MGQ C;  5B0Y D;  4J8X C;  5DNM D;  5F99 D;  4WJ3 C;  2ARO C;  1M19 A;  2JE5 A;  3AZL B;  3REJ A;  3W99 D;  5B1M D;  4G91 B;  3AZN B;  1M18 B;  5BNV A;  4H9N A;  1F66 A;  3MVD D;  2J8P A;  1TZY B;  4NE5 A;  4ZUX C;  5AV8 A;  3REH D;  4KGC B;  4XUJ B;  4J8W B;  1P3B B;  3B6G D;  3AZG B;  2Y2Q A;  5CPK D;  3B0C T;  5DNN C;  4LD9 A;  5B24 A;  5CPJ A;  3LZ0 B;  3REK A;  1S32 D;  3AN2 D;  1KX4 D;  2CWE A;  5B0Y C;  2RVQ C;  5DNM C;  3LJA D;  1KX5 B;  1P3F A;  3WKJ A;  3WAA D;  1P3L B;  3W99 C;  3MGP D;  4Z66 A;  4CAY A;  1P34 A;  3MVD C;  3F6T A;  3AZK A;  4QLC D;  1ID3 D;  3REH C;  5B40 D;  3X1U A;  1P3M A;  2ZY2 A;  3UT9 A;  2PYO B;  4G92 B;  5AV9 B;  3AFA B;  3B6G C;  5B2J A;  5CPK C;  1A7W A;  3LEL B;  4AWL B;  5C3I B;  1S32 C;  3AZM A;  5B1L B;  3AN2 C;  2BG1 A;  5B2I A;  1HQ3 A;  1KX4 C;  4JJN B;  3LJA C;  2YFV B;  4ZBJ B;  5CPI A;  5B32 A;  3WAA C;  3MGP C;  3C1B B;  2L5A A;  5E5A D;  4WU9 A;  3V9R B;  3W96 D;  3WA9 A;  5B33 B;  3AZJ A;  1P3P B;  3MGR D;  2F8N H;  4H9P A;  4QLC C;  4WU8 A;  1ID3 C;  5JA4 B;  4YM6 A;  4YS3 B;  3C1C D;  3MGQ B;  3AZF D;  2Y2O A;  4H9O A;  4J8X B;  2ARO B;  2Y2J A;  5GXQ A;  1B67 A;  5FUG B;  2CV5 A;  2FJ7 D;  4E45 A;  3AZI D;  2NZD D;  5E5A C;  3WTP E;  3W96 C;  5B31 C;  4Z2M H;  3TU4 D;  5DNN B;  4EO5 B;  3MGR C;  3VH5 T;  3UTA C;  1M1A A;  4R8P A;  4UUZ A;  3C1C C;  3AZF C;  5B0Y B;  2ZY3 A;  5F99 B;  5DNM B;  4WV4 B;  3REI C;  1BH9 B;  5B1M B;  1M19 D;  3W99 B;  4J8U D;  3AZL C;  4H9Q A;  3MVD B;  2FJ7 C;  1F66 D;  3REH B;  3P5J B;  5GT0 A;  3AZI C;  1PZR A;  2NZD C;  5AV8 D;  3B6G B;  5CPK B;  3EG5 B;  3TU4 C;  1S32 B;  4LD9 D;  3AN2 B;  5B24 D;  1N1J B;  5CPJ D;  3LZ0 C;  1KX4 B;  3REK D;  1P3I A;  2NQB A;  3LJA B;  1BH8 A;  3WAA B;  1Q9C A;  1EQZ A;  3MGP B;  5CP6 D;  1P3F D;  4J8U C;  2Y2M A;  4QLC B;  3KUY A;  1F66 C;  1ID3 B;  3AZK D;  5AV8 C;  4H9R B;  3X1U D;  2G5I C;  1P3M D;  3B0D C;  3UT9 D;  1P3O A;  5B2J D;  5BT1 D;  3REL A;  4J8V A;  4AWL C;  4LD9 C;  5B24 C;  5CPJ C;  3REK C;  3AZM D;  5B2I D;  3NQU A;  1P3A A;  4H9S A;  4X23 D;  1P3F C;  5CP6 C;  5CPI D;  5E5A B;  4Z5T A;  5B32 D;  3W96 B;  5B31 B;  2FFF B;  3MNN A;  3KSY A;  3MGR B;  4WU9 D;  3A1I A;  3AZK C;  3AZH A;  1P3G D;  3WA9 D;  1U35 A;  3A6N D;  4YM6 D;  3C1C B;  3AZF B;  1P3M C;  2RIQ A;  3UT9 C;  1B6W A;  2XD5 A;  3REI B;  5B32 G;  5B2J C;  5BT1 C;  3KWQ A;  3AZM C;  3B6F D;  5GXQ D;  3NQJ B;  3AZN A;  5B2I C;  2FJ7 B;  1M18 A;  3AZI B;  4WNN A;  1TZY A;  4X23 C;  2NZD B;  5B0Z A;  5B32 C;  4KGC A;  5GSU A;  3TU4 B;  1P3B A;  4WU9 C;  3AZG A;  3WA9 C;  1H3O A;  1P3G C;  4EO5 C;  5AV5 A;  5GT3 A;  3A6N C;  4YM6 C;  3B0B A;  1M1A D;  4R8P D;  5F99 C;  1M19 B;  1AOI D;  4J8U B;  5B1M C;  3B6F C;  5GXQ C;  1P3L A;  3EPL A;  5BNV B;  1F66 B;  5AV6 A;  4NE6 A;  5AV8 B;  3X1T D;  1F1E A;  5GT0 D;  3W97 A;  3B0D B;  3H0M C;  2PYO A;  4LD9 B;  3AZE A;  5B24 B;  3LEL A;  5CPJ B;  2HIO A;  3REK B;  3W98 A;  1M1A C;  4R8P C;  1P3I D;  2NQB D;  2YFW A;  4JJN A;  1P3F B;  5CP6 B;  2YFV A;  1AOI C;  1BFM A;  3C1B A;  3V9R A;  3AZK B;  3AV2 D;  3KUY D;  3X1T C;  5B40 C;  1P3M B;  3EPK A;  3UT9 B;  2G5H C;  5B2J B;  3MGS A;  2ARO A;  3KXB A;  3REL D;  3AZM B;  4J8V D;  5B2I B;  1TAF A;  3WTP A;  2NQB C;  4X23 B;  5JRG A;  4ZUX A;  5CPI B;  1KX3 A;  4KUD A;  5B32 B;  1ZLA A;  2HUE C;  4WU9 B;  3WA9 B;  3MNN D;  3UTB A;  1P3G B;  4DRB A;  3AV2 C;  4H9P B;  5DNN A;  5BS7 C;  5AVB A;  4XZQ A;  3A6N B;  5KDM B;  3AZH D;  4YM6 B;  3LZ1 D;  2F8N A;  4KHA A;  3A1K A;  3VH6 A;  4H9O B;  5B0Y A;  5DNM A;  1BH9 A;  3REL C;  4J8V C;  3KWQ D;  5GXQ B;  3B6F B;  3W99 A;  3O62 A;  3REJ D;  3AV1 A;  1WWS A;  1JFI B;  3MVD A;  1M18 D;  1TZY D;  3VH6 W;  4DQY B;  5B0Z D;  5GSU D;  3MNN C;  1P3B D;  3AZG D;  4CSR A;  3LZ1 C;  1S32 A;  5AV5 D;  3R45 B;  5GT3 D;  4R8P B;  1M1A B;  1KX4 A;  3EPH A;  1P3G A;  2Y2H A;  3LJA A;  1AOI B;  1M19 C;  5BNX B;  2F8N K;  3REJ C;  3WKJ D;  4H9Q B;  4Z66 D;  3X1T B;  1P34 D;  5AV6 D;  5GT0 B;  1ID3 A;  5AY8 A;  5B40 B;  5B0Z C;  3X1V A;  3W97 D;  5GSU C;  2PYO D;  3AZE D;  5AV5 C;  5GT3 C;  2HIO D;  1P3I B;  2NQB B;  3W98 D;  1HQ3 D;  2ZY5 A;  1BH8 B;  4E44 A;  5BO0 B;  4JJN D;  2HUE B;  5E5A A;  3WKJ C;  3W96 A;  5B31 A;  4Z66 C;  3C1B D;  3AV2 B;  2BYK A;  1P34 C;  5AV6 C;  5AVC A;  3AZJ D;  3X1S A;  3UTA A;  4WU8 D;  1P3K A;  3AYW A;  3KFU G;  3W97 C;  3X1U C;  3C1C A;  5G49 A;  3REI A;  3MGS D;  2JCH A;  3REL B;  4J8V B;  3AZE C;  2BYM B;  3KXB D;  2HIO C;  3AZL A;  3W98 C;  1HQ3 C;  2FJ7 A;  2CV5 D;  3WTP D;  5JRG D;  3IP4 C;  3AZI A;  5CPI C;  4ZUX D;  1W2E A;  3EPJ A;  1KX3 D;  4KUD D;  1ZLA D;  4XUJ A;  4J8W A;  3MNN B;  3TU4 A;  3AZH B;  3AZJ C;  3UTB D;  3LZ1 B;  4WU8 C;  5AVB D;  4XZQ D;  2F8N D;  3LZ0 A;  3MGS C;  2Y2N A;  2ZM5 A;  2RVQ D;  1KX5 A;  3KWQ B;  3REJ B;  3KXB C;  4J8U A;  4DRA A;  3B0C W;  3O62 D;  4H9N B;  3AV1 D;  2F8N G;  2CV5 C;  3WTP C;  4WNN B;  2Y2K A;  5JRG C;  5B0Z B;  1KX3 C;  3AL0 C;  4KUD C;  3FDD A;  1ZLA C;  5GSU B;  5AV9 A;  3AFA A;  2IO5 C;  1H3O B;  3UTB C;  1HTA A;  2XD1 A;  5AV5 B;  5AVB C;  5GT3 B;  4XZQ C;  3H0L C;  5B1L A;  3H0R C;  1WWI A;  5CP6 A;  3WKJ B;  1EQZ D;  4Z66 B;  4CAY B;  4Z2M G;  3O62 C;  3AV1 C;  1P34 B;  5AV6 B;  1KU5 A;  5B33 A;  1P3P A;  5GT0 C;  3W97 B;  5AY8 D;  5JA4 A;  3X1U B;  1ULY A;  3X1V D;  4YS3 A;  3MGQ A;  4J8X A;  3AZE B;  1P3O D;  2Y2G A;  2HIO B;  3W98 B;  1HQ3 B;  4UPK A;  4M6B A;  4NFT A;  5FUG A;  1P3I C;  2YFW B;  1P3A D;  4X23 A;  1EQZ C;  4Z5T D;  3AZJ B;  5B31 D;  3KUY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...