1P3LC

Crystallographic studies of nucleosome core particles containing histone 'sin' mutants
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of histone Sin mutant nucleosomes reveal altered protein-DNA interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
molecule keywords Palindromic 146bp Human Alpha-Satellite DNA fragment
total genus 31
structure length 106
sequence length 106
chains with identical sequence G
ec nomenclature
pdb deposition date 2003-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00125 Histone Core histone H2A/H2B/H3/H4
C PF16211 Histone_H2A_C C-terminus of histone H2A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 1p3lC00
4J8UC 1P34C 1P3GC 4XZQA 4X23D 1M19D 3AN2D 4Z66A 5CPJA 3VH5T 3X1VC 2HUEC 1P3FB 3RELA 5CPJB 3RELB 5AV9A 2YFWA 3C1BD 1S32C 5AY8C 5E5AA 1P3MD 5BNVB 5B0ZD 4KGCD 5B2JC 3AZJB 3REKC 3LJAC 4H9PB 1P3LC 3X1UB 3AZNB 1TAFB 3B0CW 5B40A 1AOID 4DRBA 5B0YC 5B32D 3REKA 1P3GD 5G49A 3AV1A 5G49B 3X1SA 3UTAC 4XUJA 3AZFB 5B24D 4WU9C 3REHA 2PYOD 3KUYC 4J8UD 3REHB 1P34D 2AROD 1B67A 1TZYC 1F1EA 4H9OA 1S32D 3LZ1C 2NZDB 3AZLB 5BO0A 3UT9B 4LD9A 5DNMD 2BYMB 3V9RB 4JJNC 3MGSA 5AV5B 3LELB 4J8WB 5GT3A 3MGSB 4J8WA 2HIOC 4H9NA 3WA9D 1P3LA 1P3KB 3LZ0D 3AZKB 1ZLAB 1AOIA 1HQ3B 1ID3B 5JA4A 4AWLB 1ID3A 5B24C 3VH6W 1P3KD 1ZLAD 3WA9B 3RELC 1BH9A 5CHLB 5AVCD 4YM6D 3KUYA 4JJND 4WNNA 3O62C 2F8NH 3MVDB 2AROC 1KX4B 1P3OB 5GT0B 4J8VD 3KXBA 4WU8A 5AVCB 5B0YB 3REIB 3W97A 3C1CB 4CSRA 5B0YA 3AV2A 4ZBJB 3W97B 1EQZD 2NQBD 3LJAA 1HQ3D 3WTPC 3B0DC 1P3BC 4DRAA 1ID3C 5B32G 1KX3A 5B0ZB 4KGCB 1KU5A 5E5AC 5B0ZC 4KGCC 3KSYA 5B2IB 1S32A 3MGSD 1N1JB 2NQBB 1S32B 2NZDD 5AV5C 3AZHA 3O62D 3AZHB 5F99A 3AN2B 3LZ1A 5AV8A 4WU9D 3W98A 3MGQD 4ZUXD 3REJA 1P3AA 1P3ID 5BT1D 3AFAD 5B31D 1KX3C 5B24B 1JFIB 3X1TC 3UTAB 2NQBC 3AV1C 3B6FC 1HTAA 5B1LC 3W99D 3AZND 3AFAA 3WA9C 3AZJA 1F66D 4H9QA 3AZMC 3AZLC 4WV4B 4WZSB 3LZ0B 5AY8A 3R45B 4R8PD 3RELD 3AZID 3AZKD 2PYOA 4NE6A 3LZ0A 3REIC 3C1CC 1P3KC 1ZLAC 4EO5C 1M19C 2PYOC 4X23C 3MVDC 2HUEB 5DNMA 3WKJC 4EO5B 4Z66D 4AWLC 3AFAC 5B1MC 5B31C 1KX3D 4HGAC 3TU4D 3AZLA 5BO0B 3UT9A 4LD9B 5BNVA 3B0CT 2HIOB 3WTPB 4H9PA 1KX5A 2HIOA 3W99C 5B2JD 3MNNA 2L5AA 2F8NK 5B1LD 1KX5C 4H9SC 4KUDC 5AVCC 3UTBB 4H9SA 3W98C 5B31B 3WTPD 3TU4A 5JRGD 2IO5C 5B31A 5DNNA 3UTAD 3TU4B 3MGQB 4WU9B 3X1TB 1P3FD 5B32C 4XUJC 1M19B 3WKJA 3MVDD 4X23B 3KXBD 5GXQA 3O62A 4H9RB 4M6BA 3VH5A 5DNND 2YFVB 1M18A 5GT3B 5B40C 2YFVA 5CP6C 3MGPD 3TU4C 5GT0A 1M1AB 1P3KA 3AZKA 1KX5D 1ZLAA 5GSUB 3REIA 3W96C 1F66B 5B1LB 5KDMA 3AZGC 1P3BD 1P3FC 3A6NA 1U35B 3B6FD 3UT9C 3B6GD 1Q9CA 3X1VA 3AV2C 1KX3B 2BYKB 3MGRA 3AZED 3C1CD 1P3OD 4Z66B 3AZLD 4HGAB 3AZKC 2AROA 1TZYA 3AZMD 4YS3C 2AROB 1KX4C 2YFWB 4NFTA 1WWSA 1M18C 4JJNB 3B6GA 5AY8D 4R8PA 3C1CA 3AZIA 3B6GB 1WWIA 1P3PA 5B40D 3MGPC 3UTBC 3W98B 3AZMA 3AZNA 2JSSA 2CWEA 3A6ND 5B0ZA 4KGCA 1ID3D 3AZGD 2F8NG 5BS7C 3X1SB 3W97D 4Z5TC 3AZFA 1N1JA 5JRGC 2NQBA 4ZUXA 3REJD 1P3IA 1P3AD 3MGSC 2FJ7A 4J8XD 4XZQD 5AV5D 2FJ7B 5AV6C 5GT0D 4J8VB 5GT3D 5CPKA 1M1AC 4KHAA 5AV8C 4XZQC 1KX4D 5AV9D 1JFIA 2FJ7D 4YM6C 4XZQB 4Z5TB 3X1UC 3KWQD 3UTAA 1BH8A 4Z5TA 3AZFC 5B1MD 1P3FA 1BH8B 4QLCC 4UUZA 3AZEB 3X1VD 2FJ7C 1HQ3A 4UUZB 3X1UD 3MGRD 3MGQC 3AZEA 2CV5B 4KUDD 3AZGB 5BS7A 1P3LD 3WTPA 4H9QB 5GT0C 5AV6D 1KX5B 3W96D 1M1AD 3WAAD 5CP6B 3X1UA 4G92C 4R8PC 3AZIC 1TAFA 5B40B 4QLCB 4WU8D 4QLCA 3UTBA 5GXQD 5B33B 5AVBB 1KX4A 4E45A 3AV1B 2RVQC 3AV2D 5DNMB 3KXBB 3UT9D 4YM6A 3KUYD 4XUJB 4CSRB 1P3OC 3MGRC 4NE3A 5B33D 1R4VA 5GXQB 2IO5B 4H9RA 5CPKC 3AZFD 4QLCD 5JRGB 3NQJB 4ZUXC 1P3IC 3MNNC 5JRGA 5AV5A 3WAAC 1P3BB 3W96A 3AZJD 4H9NB 2HIOD 5B2JA 2NZDC 1F66A 1B6WA 4ZBJC 1P3MB 3MGQA 5JA4B 3B6GC 5BNXB 5GSUC 1TZYD 5F99B 5BNXA 4G91B 4Z5TD 5AV8B 4X23A 1H3OB 4XUJD 5BT1C 3O62B 3AZHD 2BYKA 5CPJD 4J8UB 1P34B 5AV9C 4J8UA 4YS3B 1P34A 3KUYB 3REHC 5B31G 4WNNB 1TZYB 5F99D 4YS3A 1P3MC 3KWQC 3X1SC 1M1AA 5AV8D 5CP6D 5AV6A 1ULYA 4CAYB 4WU8B 5AV6B 3C1BC 4J8VC 4G92B 4R8PB 3AZIB 3X1SD 3WAAB 3AYWA 4KUDA 3AZNC 4KUDB 4J8XC 5CPIC 3LJAB 3WTPE 3X1VB 5FUGA 1EQZA 3LELC 2CV5D 3MGRB 1EQZB 3AZEC 3NQUB 3WKJD 3REID 4G91C 3NQUA 5B2IA 4ZUXB 1P3IB 5AV9B 4JJNA 1M18D 3LZ0C 1P3PB 5GXQC 3AN2A 3LZ1B 2NZDA 1U35C 5E5AB 5AVBD 4Z2MG 2BYMA 3REJB 3LELA 1P3AB 3MNNB 5B2ID 5DNNC 3AYWD 3VH6A 3W99A 3REKB 5B33C 1P3LB 2CV5C 3A6NC 3W99B 2CV5A 5CPID 3AZGA 3LELD 3X1TA 2RVQD 1BFMA 3KWQB 2F8NA 3AFAB 3MGPB 5CPKB 3KWQA 2F8NB 5B1MB 3MGPA 5B0YD 5CP6A 4H9OB 5B1MA 5AY8B 2PYOB 1M18B 3V9RA 3REHD 4E44A 2F8ND 3MVDA 4J8XB 5CPJC 4YM6B 5GSUA 5B32A 4J8XA 5AVCA 4NE5A 5B32B 1P3GA 5C3IC 5CPKD 1AOIB 1EQZC 1P3GB 3B0DB 5C3IB 1AOIC 1HQ3C 5CPIA 3A6NB 3WA9A 5CPIB 3REKD 2LY8A 5GSUD 1BH9B 1P3BA 3W98D 3C1BA 4LD9D 5E5AD 3C1BB 4WU8C 5B33A 5AVBA 1P3PD 1P3MA 4J8WD 3W97C 5DNMC 5F99C 1P3OA 3LZ1D 5DNNB 3KXBC 4YS3D 4WU9A 3AZHC 3AN2C 1H3OA 3AV2B 3AV1D 1M19A 4Z2MH 3AZMB 3WKJB 1A7WA 3X1TD 3UTBD 3NQJA 5B24A 5B2IC 3B0BA 1F66C 3W96B 5AVBC 3B6FB 5B2JB 3VH6T 4CAYA 3AZJC 1U35D 3B6FA 3AYWC 3LJAD 1P3PC 3WAAA 5B1LA 5KDMB 4J8WC 3MNND 5GT3C 3AYWB 4J8VA 4KHAB 3REJC 1P3AC 4LD9C 1U35A 3R45A 4Z66C 5FUGB 3VH5W
chains in the Genus database with same CATH superfamily
4J8UC 1P34C 1P3GC 3EPHA 4XZQA 4X23D 1M19D 3AN2D 4Z66A 5CPJA 3VH5T 3X1VC 2HUEC 1P3FB 3RELA 5CPJB 3RELB 5AV9A 2YFWA 3C1BD 2VQRA 1S32C 5AY8C 5E5AA 1P3MD 5BNVB 5B0ZD 4KGCD 5B2JC 3AZJB 2JCHA 3REKC 3LJAC 4H9PB 1P3LC 2XD1A 3X1UB 3AZNB 1TAFB 3B0CW 5B40A 1AOID 4DRBA 5B0YC 5B32D 3REKA 1P3GD 5G49A 3AV1A 2ZY4A 5G49B 3X1SA 2Y2GA 3UTAC 4XUJA 3AZFB 5B24D 3H0MC 4WU9C 3REHA 2PYOD 2ZY5A 3KUYC 4J8UD 3REHB 1P34D 2AROD 1B67A 1TZYC 1F1EA 4H9OA 1S32D 3LZ1C 2NZDB 3AZLB 5BO0A 3UT9B 4LD9A 5DNMD 2BYMB 4DQYB 3V9RB 4JJNC 2JE5A 5AV5B 3LELB 3MGSA 5GT3A 4J8WB 3MGSB 4J8WA 2HIOC 4H9NA 3WA9D 1P3LA 1P3KB 3LZ0D 3AZKB 1ZLAB 1AOIA 1HQ3B 1ID3B 5JA4A 4AWLB 1ID3A 5B24C 3VH6W 1P3KD 1ZLAD 3WA9B 2Y2KA 3P5JB 3RELC 1BH9A 5CHLB 5AVCD 4YM6D 3KUYA 4JJND 4WNNA 3O62C 2F8NH 3MVDB 2AROC 1KX4B 1P3OB 5GT0B 4J8VD 3KXBA 4WU8A 5AVCB 5B0YB 3REIB 3W97A 3C1CB 4CSRA 5B0YA 3AV2A 4ZBJB 3W97B 1EQZD 2NQBD 2G5IC 3LJAA 1HQ3D 3WTPC 3B0DC 1P3BC 4DRAA 1ID3C 5B32G 1KX3A 5B0ZB 4KGCB 1KU5A 5E5AC 5B0ZC 4KGCC 3KSYA 5B2IB 1S32A 3MGSD 1N1JB 3H0RC 1S32B 2NQBB 5AV5C 2NZDD 3AZHA 3O62D 3AZHB 5F99A 3AN2B 3LZ1A 5AV8A 2Y2MA 4WU9D 3W98A 3MGQD 4ZUXD 3REJA 1P3AA 1P3ID 5BT1D 3AFAD 5B31D 1KX3C 5B24B 1JFIB 3X1TC 2J8PA 3UTAB 2NQBC 3AV1C 3B6FC 1HTAA 5B1LC 3W99D 3AZND 3AFAA 3WA9C 3AZJA 2W8SA 1F66D 4H9QA 3AZMC 3EG5B 3AZLC 3A1KA 4WV4B 4WZSB 3LZ0B 5AY8A 3R45B 4R8PD 3RELD 3AZID 3AZKD 2PYOA 4NE6A 3LZ0A 3REIC 3C1CC 1P3KC 1ZLAC 4EO5C 1M19C 2PYOC 4X23C 3MVDC 2HUEB 5DNMA 3WKJC 4EO5B 4Z66D 4AWLC 3AFAC 5B1MC 5B31C 1KX3D 4HGAC 3TU4D 3AZLA 5BO0B 3UT9A 4LD9B 5BNVA 3B0CT 2HIOB 3WTPB 2ZM5A 4H9PA 1KX5A 2HIOA 3W99C 5B2JD 3MNNA 2L5AA 2F8NK 5B1LD 1KX5C 4H9SC 2ZY3A 4KUDC 5AVCC 3UTBB 4H9SA 3W98C 5B31B 3WTPD 3EPJA 3TU4A 5JRGD 2IO5C 5B31A 5DNNA 3UTAD 3TU4B 3MGQB 4WU9B 3X1TB 1P3FD 5B32C 2Y2PA 4XUJC 1M19B 3WKJA 3MVDD 4X23B 3KXBD 5GXQA 3O62A 4H9RB 4M6BA 3VH5A 5DNND 2YFVB 1M18A 5GT3B 5B40C 2YFVA 5CP6C 3MGPD 2Y2QA 3TU4C 5GT0A 1M1AB 1P3KA 3AZKA 1KX5D 1ZLAA 5GSUB 3REIA 3W96C 1F66B 5B1LB 5KDMA 3AZGC 1P3BD 1P3FC 3A6NA 1U35B 3B6FD 3UT9C 3B6GD 1Q9CA 3X1VA 3AV2C 1KX3B 2BYKB 3MGRA 3AZED 3C1CD 1P3OD 4Z66B 3AZLD 4HGAB 3AZKC 2AROA 1TZYA 3AZMD 4YS3C 2AROB 1KX4C 2YFWB 4NFTA 1WWSA 1M18C 4JJNB 3B6GA 5AY8D 4R8PA 3C1CA 3AZIA 3B6GB 1WWIA 1P3PA 5B40D 3MGPC 3UTBC 3W98B 3AZMA 3AZNA 2JSSA 2CWEA 3A6ND 5B0ZA 4KGCA 1ID3D 3AZGD 2F8NG 5BS7C 3X1SB 3W97D 4Z5TC 3AZFA 1N1JA 5JRGC 2NQBA 4ZUXA 3REJD 1P3IA 1P3AD 3MGSC 2FJ7A 4J8XD 4XZQD 5AV5D 2FJ7B 2XD5A 5AV6C 5GT0D 4J8VB 5GT3D 5CPKA 1M1AC 4KHAA 5AV8C 2UWXA 4XZQC 1KX4D 5AV9D 1JFIA 2FJ7D 4YM6C 4XZQB 4Z5TB 3X1UC 3KWQD 3UTAA 1BH8A 4Z5TA 3AZFC 3FDDA 5B1MD 1P3FA 1BH8B 4QLCC 4UUZA 3AZEB 3X1VD 2FJ7C 1HQ3A 4UUZB 3X1UD 3MGRD 3MGQC 3AZEA 2CV5B 4KUDD 3AZGB 5BS7A 1P3LD 3WTPA 4H9QB 5GT0C 5AV6D 1KX5B 3W96D 1M1AD 3WAAD 5CP6B 3X1UA 2Y2IA 4G92C 4R8PC 3AZIC 1TAFA 5B40B 4QLCB 4WU8D 4QLCA 3UTBA 5GXQD 5B33B 5AVBB 1KX4A 4E45A 3AV1B 2RVQC 3AV2D 5DNMB 3KXBB 3UT9D 1T3UA 4YM6A 3KUYD 4XUJB 1Z2CB 4CSRB 1P3OC 3MGRC 3EPKA 4NE3A 5B33D 1R4VA 5GXQB 2IO5B 4H9RA 5CPKC 3AZFD 4QLCD 1PZRA 5JRGB 3NQJB 4ZUXC 1P3IC 3MNNC 5JRGA 5AV5A 3WAAC 2Y2JA 1P3BB 3W96A 3AZJD 4H9NB 2HIOD 5B2JA 2NZDC 1F66A 2Y2HA 1B6WA 4ZBJC 1P3MB 3MGQA 4UPKA 5JA4B 3B6GC 5BNXB 5GSUC 1TZYD 5F99B 5BNXA 4G91B 4Z5TD 5AV8B 4X23A 1H3OB 4XUJD 5BT1C 3O62B 3AZHD 2BYKA 5CPJD 4J8UB 1P34B 5AV9C 4J8UA 4YS3B 1P34A 3KUYB 3REHC 5B31G 4WNNB 1TZYB 2Y2OA 5F99D 4YS3A 3KWQC 1P3MC 3X1SC 1M1AA 5AV8D 5CP6D 5AV6A 1ULYA 4CAYB 4WU8B 5AV6B 3C1BC 4J8VC 4G92B 4R8PB 3AZIB 3X1SD 3WAAB 3AYWA 4KUDA 3AZNC 4KUDB 3AL0C 4J8XC 5CPIC 3LJAB 3WTPE 3X1VB 5FUGA 1EQZA 3LELC 2CV5D 3MGRB 1EQZB 2F2AC 2RIQA 3AZEC 3NQUB 3WKJD 3REID 4G91C 3NQUA 3H0LC 5B2IA 4ZUXB 1P3IB 2FFFB 5AV9B 4JJNA 1M18D 3LZ0C 1P3PB 5GXQC 2G5HC 3AN2A 3LZ1B 2NZDA 1U35C 5E5AB 5AVBD 4Z2MG 2BYMA 3REJB 3LELA 1P3AB 3MNNB 5B2ID 5DNNC 3AYWD 4WJ3C 3VH6A 3W99A 3REKB 5B33C 1P3LB 2CV5C 3A6NC 3W99B 1W2EA 2CV5A 2DQNC 5CPID 3AZGA 3LELD 3X1TA 2RVQD 1BFMA 3KWQB 2F8NA 3AFAB 3MGPB 5CPKB 3KWQA 2F8NB 5B1MB 3MGPA 5B0YD 5CP6A 4H9OB 5B1MA 5AY8B 2DF4C 2PYOB 1M18B 3V9RA 2Y2NA 3REHD 4E44A 2F8ND 3MVDA 4J8XB 5CPJC 4YM6B 5GSUA 5B32A 4J8XA 5AVCA 4NE5A 5B32B 1P3GA 5C3IC 5CPKD 1AOIB 3A1IA 1EQZC 1P3GB 3B0DB 5C3IB 1AOIC 1HQ3C 5CPIA 3A6NB 3WA9A 2ZY2A 5CPIB 3IP4C 3REKD 2LY8A 5GSUD 1BH9B 1P3BA 3W98D 3C1BA 4LD9D 5E5AD 3F6TA 2Y2LA 3C1BB 4WU8C 5B33A 5AVBA 1P3PD 1P3MA 4J8WD 3W97C 5DNMC 5F99C 1P3OA 3KFUG 3LZ1D 5DNNB 3KXBC 4YS3D 4WU9A 3AZHC 3EPLA 3AN2C 1H3OA 3AV2B 3AV1D 1M19A 4Z2MH 3AZMB 3WKJB 1A7WA 3X1TD 3UTBD 3NQJA 5B24A 5B2IC 3B0BA 1F66C 3W96B 5AVBC 3B6FB 5B2JB 3VH6T 4CAYA 3AZJC 1U35D 3B6FA 3AYWC 3LJAD 1P3PC 3WAAA 5B1LA 5KDMB 4J8WC 3MNND 5GT3C 3AYWB 4J8VA 4KHAB 3REJC 1P3AC 4LD9C 1U35A 3R45A 4Z66C 5FUGB 3VH5W 2BG1A
chains in the Genus database with same CATH topology
4J8UC 1P34C 1P3GC 3EPHA 4XZQA 4X23D 1M19D 3AN2D 4Z66A 5CPJA 3VH5T 3X1VC 2HUEC 1P3FB 3RELA 5CPJB 3RELB 5AV9A 2YFWA 3C1BD 2VQRA 1S32C 5AY8C 5E5AA 1P3MD 5BNVB 5B0ZD 4KGCD 5B2JC 3AZJB 2JCHA 3REKC 3LJAC 4H9PB 1P3LC 2XD1A 3X1UB 3AZNB 1TAFB 3B0CW 5B40A 1AOID 4DRBA 5B0YC 5B32D 3REKA 1P3GD 5G49A 3AV1A 2ZY4A 5G49B 3X1SA 2Y2GA 3UTAC 4XUJA 3AZFB 5B24D 3H0MC 4WU9C 3REHA 2PYOD 2ZY5A 3KUYC 4J8UD 3REHB 1P34D 2AROD 1B67A 1TZYC 1F1EA 4H9OA 1S32D 3LZ1C 2NZDB 3AZLB 5BO0A 3UT9B 4LD9A 5DNMD 2BYMB 4DQYB 3V9RB 4JJNC 2JE5A 5AV5B 3LELB 3MGSA 5GT3A 4J8WB 3MGSB 4J8WA 2HIOC 4H9NA 3WA9D 1P3LA 1P3KB 3LZ0D 3AZKB 1ZLAB 1AOIA 1HQ3B 1ID3B 5JA4A 4AWLB 1ID3A 5B24C 3VH6W 1P3KD 1ZLAD 3WA9B 2Y2KA 3P5JB 3RELC 1BH9A 5CHLB 5AVCD 4YM6D 3KUYA 4JJND 4WNNA 3O62C 2F8NH 3MVDB 2AROC 1KX4B 1P3OB 5GT0B 4J8VD 3KXBA 4WU8A 5AVCB 5B0YB 3REIB 3W97A 3C1CB 4CSRA 5B0YA 3AV2A 4ZBJB 3W97B 1EQZD 2NQBD 2G5IC 3LJAA 1HQ3D 3WTPC 3B0DC 1P3BC 4DRAA 1ID3C 5B32G 1KX3A 5B0ZB 4KGCB 1KU5A 5E5AC 5B0ZC 4KGCC 3KSYA 5B2IB 1S32A 3MGSD 1N1JB 3H0RC 1S32B 2NQBB 5AV5C 2NZDD 3AZHA 3O62D 3AZHB 5F99A 3AN2B 3LZ1A 5AV8A 2Y2MA 4WU9D 3W98A 3MGQD 4ZUXD 3REJA 1P3AA 1P3ID 5BT1D 3AFAD 5B31D 1KX3C 5B24B 1JFIB 3X1TC 2J8PA 3UTAB 2NQBC 3AV1C 3B6FC 1HTAA 5B1LC 3W99D 3AZND 3AFAA 3WA9C 3AZJA 2W8SA 1F66D 4H9QA 3AZMC 3EG5B 3AZLC 3A1KA 4WV4B 4WZSB 3LZ0B 5AY8A 3R45B 4R8PD 3RELD 3AZID 3AZKD 2PYOA 4NE6A 3LZ0A 3REIC 3C1CC 1P3KC 1ZLAC 4EO5C 1M19C 2PYOC 4X23C 3MVDC 2HUEB 5DNMA 3WKJC 4EO5B 4Z66D 4AWLC 3AFAC 5B1MC 5B31C 1KX3D 4HGAC 3TU4D 3AZLA 5BO0B 3UT9A 4LD9B 5BNVA 3B0CT 2HIOB 3WTPB 2ZM5A 4H9PA 1KX5A 2HIOA 3W99C 5B2JD 3MNNA 2L5AA 2F8NK 5B1LD 1KX5C 4H9SC 2ZY3A 4KUDC 5AVCC 3UTBB 4H9SA 3W98C 5B31B 3WTPD 3EPJA 3TU4A 5JRGD 2IO5C 5B31A 5DNNA 3UTAD 3TU4B 3MGQB 4WU9B 3X1TB 1P3FD 5B32C 2Y2PA 4XUJC 1M19B 3WKJA 3MVDD 4X23B 3KXBD 5GXQA 3O62A 4H9RB 4M6BA 3VH5A 5DNND 2YFVB 1M18A 5GT3B 5B40C 2YFVA 5CP6C 3MGPD 2Y2QA 3TU4C 5GT0A 1M1AB 1P3KA 3AZKA 1KX5D 1ZLAA 5GSUB 3REIA 3W96C 1F66B 5B1LB 5KDMA 3AZGC 1P3BD 1P3FC 3A6NA 1U35B 3B6FD 3UT9C 3B6GD 1Q9CA 3X1VA 3AV2C 1KX3B 2BYKB 3MGRA 3AZED 3C1CD 1P3OD 4Z66B 3AZLD 4HGAB 3AZKC 2AROA 1TZYA 3AZMD 4YS3C 2AROB 1KX4C 2YFWB 4NFTA 1WWSA 1M18C 4JJNB 3B6GA 5AY8D 4R8PA 3C1CA 3AZIA 3B6GB 1WWIA 1P3PA 5B40D 3MGPC 3UTBC 3W98B 3AZMA 3AZNA 2JSSA 2CWEA 3A6ND 5B0ZA 4KGCA 1ID3D 3AZGD 2F8NG 5BS7C 3X1SB 3W97D 4Z5TC 3AZFA 1N1JA 5JRGC 2NQBA 4ZUXA 3REJD 1P3IA 1P3AD 3MGSC 2FJ7A 4J8XD 4XZQD 5AV5D 2FJ7B 2XD5A 5AV6C 5GT0D 4J8VB 5GT3D 5CPKA 1M1AC 4KHAA 5AV8C 2UWXA 4XZQC 1KX4D 5AV9D 1JFIA 2FJ7D 4YM6C 4XZQB 4Z5TB 3X1UC 3KWQD 3UTAA 1BH8A 4Z5TA 3AZFC 3FDDA 5B1MD 1P3FA 1BH8B 4QLCC 4UUZA 3AZEB 3X1VD 2FJ7C 1HQ3A 4UUZB 3X1UD 3MGRD 3MGQC 3AZEA 2CV5B 4KUDD 3AZGB 5BS7A 1P3LD 3WTPA 4H9QB 5GT0C 5AV6D 1KX5B 3W96D 1M1AD 3WAAD 5CP6B 3X1UA 2Y2IA 4G92C 4R8PC 3AZIC 1TAFA 5B40B 4QLCB 4WU8D 4QLCA 3UTBA 5GXQD 5B33B 5AVBB 1KX4A 4E45A 3AV1B 2RVQC 3AV2D 5DNMB 3KXBB 3UT9D 1T3UA 4YM6A 3KUYD 4XUJB 1Z2CB 4CSRB 1P3OC 3MGRC 3EPKA 4NE3A 5B33D 1R4VA 5GXQB 2IO5B 4H9RA 5CPKC 3AZFD 4QLCD 1PZRA 5JRGB 3NQJB 4ZUXC 1P3IC 3MNNC 5JRGA 5AV5A 3WAAC 2Y2JA 1P3BB 3W96A 3AZJD 4H9NB 2HIOD 5B2JA 2NZDC 1F66A 2Y2HA 1B6WA 4ZBJC 1P3MB 3MGQA 4UPKA 5JA4B 3B6GC 5BNXB 5GSUC 1TZYD 5F99B 5BNXA 4G91B 4Z5TD 5AV8B 4X23A 1H3OB 4XUJD 5BT1C 3O62B 3AZHD 2BYKA 5CPJD 4J8UB 1P34B 5AV9C 4J8UA 4YS3B 1P34A 3KUYB 3REHC 5B31G 4WNNB 1TZYB 2Y2OA 5F99D 4YS3A 3KWQC 1P3MC 3X1SC 1M1AA 5AV8D 5CP6D 5AV6A 1ULYA 4CAYB 4WU8B 5AV6B 3C1BC 4J8VC 4G92B 4R8PB 3AZIB 3X1SD 3WAAB 3AYWA 4KUDA 3AZNC 4KUDB 3AL0C 4J8XC 5CPIC 3LJAB 3WTPE 3X1VB 5FUGA 1EQZA 3LELC 2CV5D 3MGRB 1EQZB 2F2AC 2RIQA 3AZEC 3NQUB 3WKJD 3REID 4G91C 3NQUA 3H0LC 5B2IA 4ZUXB 1P3IB 2FFFB 5AV9B 4JJNA 1M18D 3LZ0C 1P3PB 5GXQC 2G5HC 3AN2A 3LZ1B 2NZDA 1U35C 5E5AB 5AVBD 4Z2MG 2BYMA 3REJB 3LELA 1P3AB 3MNNB 5B2ID 5DNNC 3AYWD 4WJ3C 3VH6A 3W99A 3REKB 5B33C 1P3LB 2CV5C 3A6NC 3W99B 1W2EA 2CV5A 2DQNC 5CPID 3AZGA 3LELD 3X1TA 2RVQD 1BFMA 3KWQB 2F8NA 3AFAB 3MGPB 5CPKB 3KWQA 2F8NB 5B1MB 3MGPA 5B0YD 5CP6A 4H9OB 5B1MA 5AY8B 2DF4C 2PYOB 1M18B 3V9RA 2Y2NA 3REHD 4E44A 2F8ND 3MVDA 4J8XB 5CPJC 4YM6B 5GSUA 5B32A 4J8XA 5AVCA 4NE5A 5B32B 1P3GA 5C3IC 5CPKD 1AOIB 3A1IA 1EQZC 1P3GB 3B0DB 5C3IB 1AOIC 1HQ3C 5CPIA 3A6NB 3WA9A 2ZY2A 5CPIB 3IP4C 3REKD 2LY8A 5GSUD 1BH9B 1P3BA 3W98D 3C1BA 4LD9D 5E5AD 3F6TA 2Y2LA 3C1BB 4WU8C 5B33A 5AVBA 1P3PD 1P3MA 4J8WD 3W97C 5DNMC 5F99C 1P3OA 3KFUG 3LZ1D 5DNNB 3KXBC 4YS3D 4WU9A 3AZHC 3EPLA 3AN2C 1H3OA 3AV2B 3AV1D 1M19A 4Z2MH 3AZMB 3WKJB 1A7WA 3X1TD 3UTBD 3NQJA 5B24A 5B2IC 3B0BA 1F66C 3W96B 5AVBC 3B6FB 5B2JB 3VH6T 4CAYA 3AZJC 1U35D 3B6FA 3AYWC 3LJAD 1P3PC 3WAAA 5B1LA 5KDMB 4J8WC 3MNND 5GT3C 3AYWB 4J8VA 4KHAB 3REJC 1P3AC 4LD9C 1U35A 3R45A 4Z66C 5FUGB 3VH5W 2BG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J8U C;  1P34 C;  1P3G C;  4XZQ A;  4X23 D;  1M19 D;  3AN2 D;  4Z66 A;  5CPJ A;  3VH5 T;  3X1V C;  2HUE C;  1P3F B;  3REL A;  5CPJ B;  3REL B;  5AV9 A;  2YFW A;  3C1B D;  1S32 C;  5AY8 C;  5E5A A;  1P3M D;  5BNV B;  5B0Z D;  4KGC D;  5B2J C;  3AZJ B;  3REK C;  3LJA C;  4H9P B;  1P3L C;  3X1U B;  3AZN B;  1TAF B;  3B0C W;  5B40 A;  1AOI D;  4DRB A;  5B0Y C;  5B32 D;  3REK A;  1P3G D;  5G49 A;  3AV1 A;  5G49 B;  3X1S A;  3UTA C;  4XUJ A;  3AZF B;  5B24 D;  4WU9 C;  3REH A;  2PYO D;  3KUY C;  4J8U D;  3REH B;  1P34 D;  2ARO D;  1B67 A;  1TZY C;  1F1E A;  4H9O A;  1S32 D;  3LZ1 C;  2NZD B;  3AZL B;  5BO0 A;  3UT9 B;  4LD9 A;  5DNM D;  2BYM B;  3V9R B;  4JJN C;  3MGS A;  5AV5 B;  3LEL B;  4J8W B;  5GT3 A;  3MGS B;  4J8W A;  2HIO C;  4H9N A;  3WA9 D;  1P3L A;  1P3K B;  3LZ0 D;  3AZK B;  1ZLA B;  1AOI A;  1HQ3 B;  1ID3 B;  5JA4 A;  4AWL B;  1ID3 A;  5B24 C;  3VH6 W;  1P3K D;  1ZLA D;  3WA9 B;  3REL C;  1BH9 A;  5CHL B;  5AVC D;  4YM6 D;  3KUY A;  4JJN D;  4WNN A;  3O62 C;  2F8N H;  3MVD B;  2ARO C;  1KX4 B;  1P3O B;  5GT0 B;  4J8V D;  3KXB A;  4WU8 A;  5AVC B;  5B0Y B;  3REI B;  3W97 A;  3C1C B;  4CSR A;  5B0Y A;  3AV2 A;  4ZBJ B;  3W97 B;  1EQZ D;  2NQB D;  3LJA A;  1HQ3 D;  3WTP C;  3B0D C;  1P3B C;  4DRA A;  1ID3 C;  5B32 G;  1KX3 A;  5B0Z B;  4KGC B;  1KU5 A;  5E5A C;  5B0Z C;  4KGC C;  3KSY A;  5B2I B;  1S32 A;  3MGS D;  1N1J B;  2NQB B;  1S32 B;  2NZD D;  5AV5 C;  3AZH A;  3O62 D;  3AZH B;  5F99 A;  3AN2 B;  3LZ1 A;  5AV8 A;  4WU9 D;  3W98 A;  3MGQ D;  4ZUX D;  3REJ A;  1P3A A;  1P3I D;  5BT1 D;  3AFA D;  5B31 D;  1KX3 C;  5B24 B;  1JFI B;  3X1T C;  3UTA B;  2NQB C;  3AV1 C;  3B6F C;  1HTA A;  5B1L C;  3W99 D;  3AZN D;  3AFA A;  3WA9 C;  3AZJ A;  1F66 D;  4H9Q A;  3AZM C;  3AZL C;  4WV4 B;  4WZS B;  3LZ0 B;  5AY8 A;  3R45 B;  4R8P D;  3REL D;  3AZI D;  3AZK D;  2PYO A;  4NE6 A;  3LZ0 A;  3REI C;  3C1C C;  1P3K C;  1ZLA C;  4EO5 C;  1M19 C;  2PYO C;  4X23 C;  3MVD C;  2HUE B;  5DNM A;  3WKJ C;  4EO5 B;  4Z66 D;  4AWL C;  3AFA C;  5B1M C;  5B31 C;  1KX3 D;  4HGA C;  3TU4 D;  3AZL A;  5BO0 B;  3UT9 A;  4LD9 B;  5BNV A;  3B0C T;  2HIO B;  3WTP B;  4H9P A;  1KX5 A;  2HIO A;  3W99 C;  5B2J D;  3MNN A;  2L5A A;  2F8N K;  5B1L D;  1KX5 C;  4H9S C;  4KUD C;  5AVC C;  3UTB B;  4H9S A;  3W98 C;  5B31 B;  3WTP D;  3TU4 A;  5JRG D;  2IO5 C;  5B31 A;  5DNN A;  3UTA D;  3TU4 B;  3MGQ B;  4WU9 B;  3X1T B;  1P3F D;  5B32 C;  4XUJ C;  1M19 B;  3WKJ A;  3MVD D;  4X23 B;  3KXB D;  5GXQ A;  3O62 A;  4H9R B;  4M6B A;  3VH5 A;  5DNN D;  2YFV B;  1M18 A;  5GT3 B;  5B40 C;  2YFV A;  5CP6 C;  3MGP D;  3TU4 C;  5GT0 A;  1M1A B;  1P3K A;  3AZK A;  1KX5 D;  1ZLA A;  5GSU B;  3REI A;  3W96 C;  1F66 B;  5B1L B;  5KDM A;  3AZG C;  1P3B D;  1P3F C;  3A6N A;  1U35 B;  3B6F D;  3UT9 C;  3B6G D;  1Q9C A;  3X1V A;  3AV2 C;  1KX3 B;  2BYK B;  3MGR A;  3AZE D;  3C1C D;  1P3O D;  4Z66 B;  3AZL D;  4HGA B;  3AZK C;  2ARO A;  1TZY A;  3AZM D;  4YS3 C;  2ARO B;  1KX4 C;  2YFW B;  4NFT A;  1WWS A;  1M18 C;  4JJN B;  3B6G A;  5AY8 D;  4R8P A;  3C1C A;  3AZI A;  3B6G B;  1WWI A;  1P3P A;  5B40 D;  3MGP C;  3UTB C;  3W98 B;  3AZM A;  3AZN A;  2JSS A;  2CWE A;  3A6N D;  5B0Z A;  4KGC A;  1ID3 D;  3AZG D;  2F8N G;  5BS7 C;  3X1S B;  3W97 D;  4Z5T C;  3AZF A;  1N1J A;  5JRG C;  2NQB A;  4ZUX A;  3REJ D;  1P3I A;  1P3A D;  3MGS C;  2FJ7 A;  4J8X D;  4XZQ D;  5AV5 D;  2FJ7 B;  5AV6 C;  5GT0 D;  4J8V B;  5GT3 D;  5CPK A;  1M1A C;  4KHA A;  5AV8 C;  4XZQ C;  1KX4 D;  5AV9 D;  1JFI A;  2FJ7 D;  4YM6 C;  4XZQ B;  4Z5T B;  3X1U C;  3KWQ D;  3UTA A;  1BH8 A;  4Z5T A;  3AZF C;  5B1M D;  1P3F A;  1BH8 B;  4QLC C;  4UUZ A;  3AZE B;  3X1V D;  2FJ7 C;  1HQ3 A;  4UUZ B;  3X1U D;  3MGR D;  3MGQ C;  3AZE A;  2CV5 B;  4KUD D;  3AZG B;  5BS7 A;  1P3L D;  3WTP A;  4H9Q B;  5GT0 C;  5AV6 D;  1KX5 B;  3W96 D;  1M1A D;  3WAA D;  5CP6 B;  3X1U A;  4G92 C;  4R8P C;  3AZI C;  1TAF A;  5B40 B;  4QLC B;  4WU8 D;  4QLC A;  3UTB A;  5GXQ D;  5B33 B;  5AVB B;  1KX4 A;  4E45 A;  3AV1 B;  2RVQ C;  3AV2 D;  5DNM B;  3KXB B;  3UT9 D;  4YM6 A;  3KUY D;  4XUJ B;  4CSR B;  1P3O C;  3MGR C;  4NE3 A;  5B33 D;  1R4V A;  5GXQ B;  2IO5 B;  4H9R A;  5CPK C;  3AZF D;  4QLC D;  5JRG B;  3NQJ B;  4ZUX C;  1P3I C;  3MNN C;  5JRG A;  5AV5 A;  3WAA C;  1P3B B;  3W96 A;  3AZJ D;  4H9N B;  2HIO D;  5B2J A;  2NZD C;  1F66 A;  1B6W A;  4ZBJ C;  1P3M B;  3MGQ A;  5JA4 B;  3B6G C;  5BNX B;  5GSU C;  1TZY D;  5F99 B;  5BNX A;  4G91 B;  4Z5T D;  5AV8 B;  4X23 A;  1H3O B;  4XUJ D;  5BT1 C;  3O62 B;  3AZH D;  2BYK A;  5CPJ D;  4J8U B;  1P34 B;  5AV9 C;  4J8U A;  4YS3 B;  1P34 A;  3KUY B;  3REH C;  5B31 G;  4WNN B;  1TZY B;  5F99 D;  4YS3 A;  1P3M C;  3KWQ C;  3X1S C;  1M1A A;  5AV8 D;  5CP6 D;  5AV6 A;  1ULY A;  4CAY B;  4WU8 B;  5AV6 B;  3C1B C;  4J8V C;  4G92 B;  4R8P B;  3AZI B;  3X1S D;  3WAA B;  3AYW A;  4KUD A;  3AZN C;  4KUD B;  4J8X C;  5CPI C;  3LJA B;  3WTP E;  3X1V B;  5FUG A;  1EQZ A;  3LEL C;  2CV5 D;  3MGR B;  1EQZ B;  3AZE C;  3NQU B;  3WKJ D;  3REI D;  4G91 C;  3NQU A;  5B2I A;  4ZUX B;  1P3I B;  5AV9 B;  4JJN A;  1M18 D;  3LZ0 C;  1P3P B;  5GXQ C;  3AN2 A;  3LZ1 B;  2NZD A;  1U35 C;  5E5A B;  5AVB D;  4Z2M G;  2BYM A;  3REJ B;  3LEL A;  1P3A B;  3MNN B;  5B2I D;  5DNN C;  3AYW D;  3VH6 A;  3W99 A;  3REK B;  5B33 C;  1P3L B;  2CV5 C;  3A6N C;  3W99 B;  2CV5 A;  5CPI D;  3AZG A;  3LEL D;  3X1T A;  2RVQ D;  1BFM A;  3KWQ B;  2F8N A;  3AFA B;  3MGP B;  5CPK B;  3KWQ A;  2F8N B;  5B1M B;  3MGP A;  5B0Y D;  5CP6 A;  4H9O B;  5B1M A;  5AY8 B;  2PYO B;  1M18 B;  3V9R A;  3REH D;  4E44 A;  2F8N D;  3MVD A;  4J8X B;  5CPJ C;  4YM6 B;  5GSU A;  5B32 A;  4J8X A;  5AVC A;  4NE5 A;  5B32 B;  1P3G A;  5C3I C;  5CPK D;  1AOI B;  1EQZ C;  1P3G B;  3B0D B;  5C3I B;  1AOI C;  1HQ3 C;  5CPI A;  3A6N B;  3WA9 A;  5CPI B;  3REK D;  2LY8 A;  5GSU D;  1BH9 B;  1P3B A;  3W98 D;  3C1B A;  4LD9 D;  5E5A D;  3C1B B;  4WU8 C;  5B33 A;  5AVB A;  1P3P D;  1P3M A;  4J8W D;  3W97 C;  5DNM C;  5F99 C;  1P3O A;  3LZ1 D;  5DNN B;  3KXB C;  4YS3 D;  4WU9 A;  3AZH C;  3AN2 C;  1H3O A;  3AV2 B;  3AV1 D;  1M19 A;  4Z2M H;  3AZM B;  3WKJ B;  1A7W A;  3X1T D;  3UTB D;  3NQJ A;  5B24 A;  5B2I C;  3B0B A;  1F66 C;  3W96 B;  5AVB C;  3B6F B;  5B2J B;  3VH6 T;  4CAY A;  3AZJ C;  1U35 D;  3B6F A;  3AYW C;  3LJA D;  1P3P C;  3WAA A;  5B1L A;  5KDM B;  4J8W C;  3MNN D;  5GT3 C;  3AYW B;  4J8V A;  4KHA B;  3REJ C;  1P3A C;  4LD9 C;  1U35 A;  3R45 A;  4Z66 C;  5FUG B;  3VH5 W; 
#chains in the Genus database with same CATH topology
 4J8U C;  1P34 C;  1P3G C;  3EPH A;  4XZQ A;  4X23 D;  1M19 D;  3AN2 D;  4Z66 A;  5CPJ A;  3VH5 T;  3X1V C;  2HUE C;  1P3F B;  3REL A;  5CPJ B;  3REL B;  5AV9 A;  2YFW A;  3C1B D;  2VQR A;  1S32 C;  5AY8 C;  5E5A A;  1P3M D;  5BNV B;  5B0Z D;  4KGC D;  5B2J C;  3AZJ B;  2JCH A;  3REK C;  3LJA C;  4H9P B;  1P3L C;  2XD1 A;  3X1U B;  3AZN B;  1TAF B;  3B0C W;  5B40 A;  1AOI D;  4DRB A;  5B0Y C;  5B32 D;  3REK A;  1P3G D;  5G49 A;  3AV1 A;  2ZY4 A;  5G49 B;  3X1S A;  2Y2G A;  3UTA C;  4XUJ A;  3AZF B;  5B24 D;  3H0M C;  4WU9 C;  3REH A;  2PYO D;  2ZY5 A;  3KUY C;  4J8U D;  3REH B;  1P34 D;  2ARO D;  1B67 A;  1TZY C;  1F1E A;  4H9O A;  1S32 D;  3LZ1 C;  2NZD B;  3AZL B;  5BO0 A;  3UT9 B;  4LD9 A;  5DNM D;  2BYM B;  4DQY B;  3V9R B;  4JJN C;  2JE5 A;  5AV5 B;  3LEL B;  3MGS A;  5GT3 A;  4J8W B;  3MGS B;  4J8W A;  2HIO C;  4H9N A;  3WA9 D;  1P3L A;  1P3K B;  3LZ0 D;  3AZK B;  1ZLA B;  1AOI A;  1HQ3 B;  1ID3 B;  5JA4 A;  4AWL B;  1ID3 A;  5B24 C;  3VH6 W;  1P3K D;  1ZLA D;  3WA9 B;  2Y2K A;  3P5J B;  3REL C;  1BH9 A;  5CHL B;  5AVC D;  4YM6 D;  3KUY A;  4JJN D;  4WNN A;  3O62 C;  2F8N H;  3MVD B;  2ARO C;  1KX4 B;  1P3O B;  5GT0 B;  4J8V D;  3KXB A;  4WU8 A;  5AVC B;  5B0Y B;  3REI B;  3W97 A;  3C1C B;  4CSR A;  5B0Y A;  3AV2 A;  4ZBJ B;  3W97 B;  1EQZ D;  2NQB D;  2G5I C;  3LJA A;  1HQ3 D;  3WTP C;  3B0D C;  1P3B C;  4DRA A;  1ID3 C;  5B32 G;  1KX3 A;  5B0Z B;  4KGC B;  1KU5 A;  5E5A C;  5B0Z C;  4KGC C;  3KSY A;  5B2I B;  1S32 A;  3MGS D;  1N1J B;  3H0R C;  1S32 B;  2NQB B;  5AV5 C;  2NZD D;  3AZH A;  3O62 D;  3AZH B;  5F99 A;  3AN2 B;  3LZ1 A;  5AV8 A;  2Y2M A;  4WU9 D;  3W98 A;  3MGQ D;  4ZUX D;  3REJ A;  1P3A A;  1P3I D;  5BT1 D;  3AFA D;  5B31 D;  1KX3 C;  5B24 B;  1JFI B;  3X1T C;  2J8P A;  3UTA B;  2NQB C;  3AV1 C;  3B6F C;  1HTA A;  5B1L C;  3W99 D;  3AZN D;  3AFA A;  3WA9 C;  3AZJ A;  2W8S A;  1F66 D;  4H9Q A;  3AZM C;  3EG5 B;  3AZL C;  3A1K A;  4WV4 B;  4WZS B;  3LZ0 B;  5AY8 A;  3R45 B;  4R8P D;  3REL D;  3AZI D;  3AZK D;  2PYO A;  4NE6 A;  3LZ0 A;  3REI C;  3C1C C;  1P3K C;  1ZLA C;  4EO5 C;  1M19 C;  2PYO C;  4X23 C;  3MVD C;  2HUE B;  5DNM A;  3WKJ C;  4EO5 B;  4Z66 D;  4AWL C;  3AFA C;  5B1M C;  5B31 C;  1KX3 D;  4HGA C;  3TU4 D;  3AZL A;  5BO0 B;  3UT9 A;  4LD9 B;  5BNV A;  3B0C T;  2HIO B;  3WTP B;  2ZM5 A;  4H9P A;  1KX5 A;  2HIO A;  3W99 C;  5B2J D;  3MNN A;  2L5A A;  2F8N K;  5B1L D;  1KX5 C;  4H9S C;  2ZY3 A;  4KUD C;  5AVC C;  3UTB B;  4H9S A;  3W98 C;  5B31 B;  3WTP D;  3EPJ A;  3TU4 A;  5JRG D;  2IO5 C;  5B31 A;  5DNN A;  3UTA D;  3TU4 B;  3MGQ B;  4WU9 B;  3X1T B;  1P3F D;  5B32 C;  2Y2P A;  4XUJ C;  1M19 B;  3WKJ A;  3MVD D;  4X23 B;  3KXB D;  5GXQ A;  3O62 A;  4H9R B;  4M6B A;  3VH5 A;  5DNN D;  2YFV B;  1M18 A;  5GT3 B;  5B40 C;  2YFV A;  5CP6 C;  3MGP D;  2Y2Q A;  3TU4 C;  5GT0 A;  1M1A B;  1P3K A;  3AZK A;  1KX5 D;  1ZLA A;  5GSU B;  3REI A;  3W96 C;  1F66 B;  5B1L B;  5KDM A;  3AZG C;  1P3B D;  1P3F C;  3A6N A;  1U35 B;  3B6F D;  3UT9 C;  3B6G D;  1Q9C A;  3X1V A;  3AV2 C;  1KX3 B;  2BYK B;  3MGR A;  3AZE D;  3C1C D;  1P3O D;  4Z66 B;  3AZL D;  4HGA B;  3AZK C;  2ARO A;  1TZY A;  3AZM D;  4YS3 C;  2ARO B;  1KX4 C;  2YFW B;  4NFT A;  1WWS A;  1M18 C;  4JJN B;  3B6G A;  5AY8 D;  4R8P A;  3C1C A;  3AZI A;  3B6G B;  1WWI A;  1P3P A;  5B40 D;  3MGP C;  3UTB C;  3W98 B;  3AZM A;  3AZN A;  2JSS A;  2CWE A;  3A6N D;  5B0Z A;  4KGC A;  1ID3 D;  3AZG D;  2F8N G;  5BS7 C;  3X1S B;  3W97 D;  4Z5T C;  3AZF A;  1N1J A;  5JRG C;  2NQB A;  4ZUX A;  3REJ D;  1P3I A;  1P3A D;  3MGS C;  2FJ7 A;  4J8X D;  4XZQ D;  5AV5 D;  2FJ7 B;  2XD5 A;  5AV6 C;  5GT0 D;  4J8V B;  5GT3 D;  5CPK A;  1M1A C;  4KHA A;  5AV8 C;  2UWX A;  4XZQ C;  1KX4 D;  5AV9 D;  1JFI A;  2FJ7 D;  4YM6 C;  4XZQ B;  4Z5T B;  3X1U C;  3KWQ D;  3UTA A;  1BH8 A;  4Z5T A;  3AZF C;  3FDD A;  5B1M D;  1P3F A;  1BH8 B;  4QLC C;  4UUZ A;  3AZE B;  3X1V D;  2FJ7 C;  1HQ3 A;  4UUZ B;  3X1U D;  3MGR D;  3MGQ C;  3AZE A;  2CV5 B;  4KUD D;  3AZG B;  5BS7 A;  1P3L D;  3WTP A;  4H9Q B;  5GT0 C;  5AV6 D;  1KX5 B;  3W96 D;  1M1A D;  3WAA D;  5CP6 B;  3X1U A;  2Y2I A;  4G92 C;  4R8P C;  3AZI C;  1TAF A;  5B40 B;  4QLC B;  4WU8 D;  4QLC A;  3UTB A;  5GXQ D;  5B33 B;  5AVB B;  1KX4 A;  4E45 A;  3AV1 B;  2RVQ C;  3AV2 D;  5DNM B;  3KXB B;  3UT9 D;  1T3U A;  4YM6 A;  3KUY D;  4XUJ B;  1Z2C B;  4CSR B;  1P3O C;  3MGR C;  3EPK A;  4NE3 A;  5B33 D;  1R4V A;  5GXQ B;  2IO5 B;  4H9R A;  5CPK C;  3AZF D;  4QLC D;  1PZR A;  5JRG B;  3NQJ B;  4ZUX C;  1P3I C;  3MNN C;  5JRG A;  5AV5 A;  3WAA C;  2Y2J A;  1P3B B;  3W96 A;  3AZJ D;  4H9N B;  2HIO D;  5B2J A;  2NZD C;  1F66 A;  2Y2H A;  1B6W A;  4ZBJ C;  1P3M B;  3MGQ A;  4UPK A;  5JA4 B;  3B6G C;  5BNX B;  5GSU C;  1TZY D;  5F99 B;  5BNX A;  4G91 B;  4Z5T D;  5AV8 B;  4X23 A;  1H3O B;  4XUJ D;  5BT1 C;  3O62 B;  3AZH D;  2BYK A;  5CPJ D;  4J8U B;  1P34 B;  5AV9 C;  4J8U A;  4YS3 B;  1P34 A;  3KUY B;  3REH C;  5B31 G;  4WNN B;  1TZY B;  2Y2O A;  5F99 D;  4YS3 A;  3KWQ C;  1P3M C;  3X1S C;  1M1A A;  5AV8 D;  5CP6 D;  5AV6 A;  1ULY A;  4CAY B;  4WU8 B;  5AV6 B;  3C1B C;  4J8V C;  4G92 B;  4R8P B;  3AZI B;  3X1S D;  3WAA B;  3AYW A;  4KUD A;  3AZN C;  4KUD B;  3AL0 C;  4J8X C;  5CPI C;  3LJA B;  3WTP E;  3X1V B;  5FUG A;  1EQZ A;  3LEL C;  2CV5 D;  3MGR B;  1EQZ B;  2F2A C;  2RIQ A;  3AZE C;  3NQU B;  3WKJ D;  3REI D;  4G91 C;  3NQU A;  3H0L C;  5B2I A;  4ZUX B;  1P3I B;  2FFF B;  5AV9 B;  4JJN A;  1M18 D;  3LZ0 C;  1P3P B;  5GXQ C;  2G5H C;  3AN2 A;  3LZ1 B;  2NZD A;  1U35 C;  5E5A B;  5AVB D;  4Z2M G;  2BYM A;  3REJ B;  3LEL A;  1P3A B;  3MNN B;  5B2I D;  5DNN C;  3AYW D;  4WJ3 C;  3VH6 A;  3W99 A;  3REK B;  5B33 C;  1P3L B;  2CV5 C;  3A6N C;  3W99 B;  1W2E A;  2CV5 A;  2DQN C;  5CPI D;  3AZG A;  3LEL D;  3X1T A;  2RVQ D;  1BFM A;  3KWQ B;  2F8N A;  3AFA B;  3MGP B;  5CPK B;  3KWQ A;  2F8N B;  5B1M B;  3MGP A;  5B0Y D;  5CP6 A;  4H9O B;  5B1M A;  5AY8 B;  2DF4 C;  2PYO B;  1M18 B;  3V9R A;  2Y2N A;  3REH D;  4E44 A;  2F8N D;  3MVD A;  4J8X B;  5CPJ C;  4YM6 B;  5GSU A;  5B32 A;  4J8X A;  5AVC A;  4NE5 A;  5B32 B;  1P3G A;  5C3I C;  5CPK D;  1AOI B;  3A1I A;  1EQZ C;  1P3G B;  3B0D B;  5C3I B;  1AOI C;  1HQ3 C;  5CPI A;  3A6N B;  3WA9 A;  2ZY2 A;  5CPI B;  3IP4 C;  3REK D;  2LY8 A;  5GSU D;  1BH9 B;  1P3B A;  3W98 D;  3C1B A;  4LD9 D;  5E5A D;  3F6T A;  2Y2L A;  3C1B B;  4WU8 C;  5B33 A;  5AVB A;  1P3P D;  1P3M A;  4J8W D;  3W97 C;  5DNM C;  5F99 C;  1P3O A;  3KFU G;  3LZ1 D;  5DNN B;  3KXB C;  4YS3 D;  4WU9 A;  3AZH C;  3EPL A;  3AN2 C;  1H3O A;  3AV2 B;  3AV1 D;  1M19 A;  4Z2M H;  3AZM B;  3WKJ B;  1A7W A;  3X1T D;  3UTB D;  3NQJ A;  5B24 A;  5B2I C;  3B0B A;  1F66 C;  3W96 B;  5AVB C;  3B6F B;  5B2J B;  3VH6 T;  4CAY A;  3AZJ C;  1U35 D;  3B6F A;  3AYW C;  3LJA D;  1P3P C;  3WAA A;  5B1L A;  5KDM B;  4J8W C;  3MNN D;  5GT3 C;  3AYW B;  4J8V A;  4KHA B;  3REJ C;  1P3A C;  4LD9 C;  1U35 A;  3R45 A;  4Z66 C;  5FUG B;  3VH5 W;  2BG1 A; 
#chains in the Genus database with same CATH homology
 4J8U C;  1P34 C;  1P3G C;  3EPH A;  4XZQ A;  4X23 D;  1M19 D;  3AN2 D;  4Z66 A;  5CPJ A;  3VH5 T;  3X1V C;  2HUE C;  1P3F B;  3REL A;  5CPJ B;  3REL B;  5AV9 A;  2YFW A;  3C1B D;  2VQR A;  1S32 C;  5AY8 C;  5E5A A;  1P3M D;  5BNV B;  5B0Z D;  4KGC D;  5B2J C;  3AZJ B;  2JCH A;  3REK C;  3LJA C;  4H9P B;  1P3L C;  2XD1 A;  3X1U B;  3AZN B;  1TAF B;  3B0C W;  5B40 A;  1AOI D;  4DRB A;  5B0Y C;  5B32 D;  3REK A;  1P3G D;  5G49 A;  3AV1 A;  2ZY4 A;  5G49 B;  3X1S A;  2Y2G A;  3UTA C;  4XUJ A;  3AZF B;  5B24 D;  3H0M C;  4WU9 C;  3REH A;  2PYO D;  2ZY5 A;  3KUY C;  4J8U D;  3REH B;  1P34 D;  2ARO D;  1B67 A;  1TZY C;  1F1E A;  4H9O A;  1S32 D;  3LZ1 C;  2NZD B;  3AZL B;  5BO0 A;  3UT9 B;  4LD9 A;  5DNM D;  2BYM B;  4DQY B;  3V9R B;  4JJN C;  2JE5 A;  5AV5 B;  3LEL B;  3MGS A;  5GT3 A;  4J8W B;  3MGS B;  4J8W A;  2HIO C;  4H9N A;  3WA9 D;  1P3L A;  1P3K B;  3LZ0 D;  3AZK B;  1ZLA B;  1AOI A;  1HQ3 B;  1ID3 B;  5JA4 A;  4AWL B;  1ID3 A;  5B24 C;  3VH6 W;  1P3K D;  1ZLA D;  3WA9 B;  2Y2K A;  3P5J B;  3REL C;  1BH9 A;  5CHL B;  5AVC D;  4YM6 D;  3KUY A;  4JJN D;  4WNN A;  3O62 C;  2F8N H;  3MVD B;  2ARO C;  1KX4 B;  1P3O B;  5GT0 B;  4J8V D;  3KXB A;  4WU8 A;  5AVC B;  5B0Y B;  3REI B;  3W97 A;  3C1C B;  4CSR A;  5B0Y A;  3AV2 A;  4ZBJ B;  3W97 B;  1EQZ D;  2NQB D;  2G5I C;  3LJA A;  1HQ3 D;  3WTP C;  3B0D C;  1P3B C;  4DRA A;  1ID3 C;  5B32 G;  1KX3 A;  5B0Z B;  4KGC B;  1KU5 A;  5E5A C;  5B0Z C;  4KGC C;  3KSY A;  5B2I B;  1S32 A;  3MGS D;  1N1J B;  3H0R C;  1S32 B;  2NQB B;  5AV5 C;  2NZD D;  3AZH A;  3O62 D;  3AZH B;  5F99 A;  3AN2 B;  3LZ1 A;  5AV8 A;  2Y2M A;  4WU9 D;  3W98 A;  3MGQ D;  4ZUX D;  3REJ A;  1P3A A;  1P3I D;  5BT1 D;  3AFA D;  5B31 D;  1KX3 C;  5B24 B;  1JFI B;  3X1T C;  2J8P A;  3UTA B;  2NQB C;  3AV1 C;  3B6F C;  1HTA A;  5B1L C;  3W99 D;  3AZN D;  3AFA A;  3WA9 C;  3AZJ A;  2W8S A;  1F66 D;  4H9Q A;  3AZM C;  3EG5 B;  3AZL C;  3A1K A;  4WV4 B;  4WZS B;  3LZ0 B;  5AY8 A;  3R45 B;  4R8P D;  3REL D;  3AZI D;  3AZK D;  2PYO A;  4NE6 A;  3LZ0 A;  3REI C;  3C1C C;  1P3K C;  1ZLA C;  4EO5 C;  1M19 C;  2PYO C;  4X23 C;  3MVD C;  2HUE B;  5DNM A;  3WKJ C;  4EO5 B;  4Z66 D;  4AWL C;  3AFA C;  5B1M C;  5B31 C;  1KX3 D;  4HGA C;  3TU4 D;  3AZL A;  5BO0 B;  3UT9 A;  4LD9 B;  5BNV A;  3B0C T;  2HIO B;  3WTP B;  2ZM5 A;  4H9P A;  1KX5 A;  2HIO A;  3W99 C;  5B2J D;  3MNN A;  2L5A A;  2F8N K;  5B1L D;  1KX5 C;  4H9S C;  2ZY3 A;  4KUD C;  5AVC C;  3UTB B;  4H9S A;  3W98 C;  5B31 B;  3WTP D;  3EPJ A;  3TU4 A;  5JRG D;  2IO5 C;  5B31 A;  5DNN A;  3UTA D;  3TU4 B;  3MGQ B;  4WU9 B;  3X1T B;  1P3F D;  5B32 C;  2Y2P A;  4XUJ C;  1M19 B;  3WKJ A;  3MVD D;  4X23 B;  3KXB D;  5GXQ A;  3O62 A;  4H9R B;  4M6B A;  3VH5 A;  5DNN D;  2YFV B;  1M18 A;  5GT3 B;  5B40 C;  2YFV A;  5CP6 C;  3MGP D;  2Y2Q A;  3TU4 C;  5GT0 A;  1M1A B;  1P3K A;  3AZK A;  1KX5 D;  1ZLA A;  5GSU B;  3REI A;  3W96 C;  1F66 B;  5B1L B;  5KDM A;  3AZG C;  1P3B D;  1P3F C;  3A6N A;  1U35 B;  3B6F D;  3UT9 C;  3B6G D;  1Q9C A;  3X1V A;  3AV2 C;  1KX3 B;  2BYK B;  3MGR A;  3AZE D;  3C1C D;  1P3O D;  4Z66 B;  3AZL D;  4HGA B;  3AZK C;  2ARO A;  1TZY A;  3AZM D;  4YS3 C;  2ARO B;  1KX4 C;  2YFW B;  4NFT A;  1WWS A;  1M18 C;  4JJN B;  3B6G A;  5AY8 D;  4R8P A;  3C1C A;  3AZI A;  3B6G B;  1WWI A;  1P3P A;  5B40 D;  3MGP C;  3UTB C;  3W98 B;  3AZM A;  3AZN A;  2JSS A;  2CWE A;  3A6N D;  5B0Z A;  4KGC A;  1ID3 D;  3AZG D;  2F8N G;  5BS7 C;  3X1S B;  3W97 D;  4Z5T C;  3AZF A;  1N1J A;  5JRG C;  2NQB A;  4ZUX A;  3REJ D;  1P3I A;  1P3A D;  3MGS C;  2FJ7 A;  4J8X D;  4XZQ D;  5AV5 D;  2FJ7 B;  2XD5 A;  5AV6 C;  5GT0 D;  4J8V B;  5GT3 D;  5CPK A;  1M1A C;  4KHA A;  5AV8 C;  2UWX A;  4XZQ C;  1KX4 D;  5AV9 D;  1JFI A;  2FJ7 D;  4YM6 C;  4XZQ B;  4Z5T B;  3X1U C;  3KWQ D;  3UTA A;  1BH8 A;  4Z5T A;  3AZF C;  3FDD A;  5B1M D;  1P3F A;  1BH8 B;  4QLC C;  4UUZ A;  3AZE B;  3X1V D;  2FJ7 C;  1HQ3 A;  4UUZ B;  3X1U D;  3MGR D;  3MGQ C;  3AZE A;  2CV5 B;  4KUD D;  3AZG B;  5BS7 A;  1P3L D;  3WTP A;  4H9Q B;  5GT0 C;  5AV6 D;  1KX5 B;  3W96 D;  1M1A D;  3WAA D;  5CP6 B;  3X1U A;  2Y2I A;  4G92 C;  4R8P C;  3AZI C;  1TAF A;  5B40 B;  4QLC B;  4WU8 D;  4QLC A;  3UTB A;  5GXQ D;  5B33 B;  5AVB B;  1KX4 A;  4E45 A;  3AV1 B;  2RVQ C;  3AV2 D;  5DNM B;  3KXB B;  3UT9 D;  1T3U A;  4YM6 A;  3KUY D;  4XUJ B;  1Z2C B;  4CSR B;  1P3O C;  3MGR C;  3EPK A;  4NE3 A;  5B33 D;  1R4V A;  5GXQ B;  2IO5 B;  4H9R A;  5CPK C;  3AZF D;  4QLC D;  1PZR A;  5JRG B;  3NQJ B;  4ZUX C;  1P3I C;  3MNN C;  5JRG A;  5AV5 A;  3WAA C;  2Y2J A;  1P3B B;  3W96 A;  3AZJ D;  4H9N B;  2HIO D;  5B2J A;  2NZD C;  1F66 A;  2Y2H A;  1B6W A;  4ZBJ C;  1P3M B;  3MGQ A;  4UPK A;  5JA4 B;  3B6G C;  5BNX B;  5GSU C;  1TZY D;  5F99 B;  5BNX A;  4G91 B;  4Z5T D;  5AV8 B;  4X23 A;  1H3O B;  4XUJ D;  5BT1 C;  3O62 B;  3AZH D;  2BYK A;  5CPJ D;  4J8U B;  1P34 B;  5AV9 C;  4J8U A;  4YS3 B;  1P34 A;  3KUY B;  3REH C;  5B31 G;  4WNN B;  1TZY B;  2Y2O A;  5F99 D;  4YS3 A;  3KWQ C;  1P3M C;  3X1S C;  1M1A A;  5AV8 D;  5CP6 D;  5AV6 A;  1ULY A;  4CAY B;  4WU8 B;  5AV6 B;  3C1B C;  4J8V C;  4G92 B;  4R8P B;  3AZI B;  3X1S D;  3WAA B;  3AYW A;  4KUD A;  3AZN C;  4KUD B;  3AL0 C;  4J8X C;  5CPI C;  3LJA B;  3WTP E;  3X1V B;  5FUG A;  1EQZ A;  3LEL C;  2CV5 D;  3MGR B;  1EQZ B;  2F2A C;  2RIQ A;  3AZE C;  3NQU B;  3WKJ D;  3REI D;  4G91 C;  3NQU A;  3H0L C;  5B2I A;  4ZUX B;  1P3I B;  2FFF B;  5AV9 B;  4JJN A;  1M18 D;  3LZ0 C;  1P3P B;  5GXQ C;  2G5H C;  3AN2 A;  3LZ1 B;  2NZD A;  1U35 C;  5E5A B;  5AVB D;  4Z2M G;  2BYM A;  3REJ B;  3LEL A;  1P3A B;  3MNN B;  5B2I D;  5DNN C;  3AYW D;  4WJ3 C;  3VH6 A;  3W99 A;  3REK B;  5B33 C;  1P3L B;  2CV5 C;  3A6N C;  3W99 B;  1W2E A;  2CV5 A;  2DQN C;  5CPI D;  3AZG A;  3LEL D;  3X1T A;  2RVQ D;  1BFM A;  3KWQ B;  2F8N A;  3AFA B;  3MGP B;  5CPK B;  3KWQ A;  2F8N B;  5B1M B;  3MGP A;  5B0Y D;  5CP6 A;  4H9O B;  5B1M A;  5AY8 B;  2DF4 C;  2PYO B;  1M18 B;  3V9R A;  2Y2N A;  3REH D;  4E44 A;  2F8N D;  3MVD A;  4J8X B;  5CPJ C;  4YM6 B;  5GSU A;  5B32 A;  4J8X A;  5AVC A;  4NE5 A;  5B32 B;  1P3G A;  5C3I C;  5CPK D;  1AOI B;  3A1I A;  1EQZ C;  1P3G B;  3B0D B;  5C3I B;  1AOI C;  1HQ3 C;  5CPI A;  3A6N B;  3WA9 A;  2ZY2 A;  5CPI B;  3IP4 C;  3REK D;  2LY8 A;  5GSU D;  1BH9 B;  1P3B A;  3W98 D;  3C1B A;  4LD9 D;  5E5A D;  3F6T A;  2Y2L A;  3C1B B;  4WU8 C;  5B33 A;  5AVB A;  1P3P D;  1P3M A;  4J8W D;  3W97 C;  5DNM C;  5F99 C;  1P3O A;  3KFU G;  3LZ1 D;  5DNN B;  3KXB C;  4YS3 D;  4WU9 A;  3AZH C;  3EPL A;  3AN2 C;  1H3O A;  3AV2 B;  3AV1 D;  1M19 A;  4Z2M H;  3AZM B;  3WKJ B;  1A7W A;  3X1T D;  3UTB D;  3NQJ A;  5B24 A;  5B2I C;  3B0B A;  1F66 C;  3W96 B;  5AVB C;  3B6F B;  5B2J B;  3VH6 T;  4CAY A;  3AZJ C;  1U35 D;  3B6F A;  3AYW C;  3LJA D;  1P3P C;  3WAA A;  5B1L A;  5KDM B;  4J8W C;  3MNN D;  5GT3 C;  3AYW B;  4J8V A;  4KHA B;  3REJ C;  1P3A C;  4LD9 C;  1U35 A;  3R45 A;  4Z66 C;  5FUG B;  3VH5 W;  2BG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...