1P4AA

Crystal structure of the purr complexed with cprpp
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
269
Chain Sequence
b'KFRRSGRLVDLTNYLLTHPHELIPLTFFSERYESAKSSISEDLTIIKQTFEQQGIGTLLTVPGAAGGVKYIPKMKQAEAEEFVQTLGQSLANPERILPGGYVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPLAYAAASYLNVPVVIVRKDSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLVEAEGVDERLVDEYMSLLTLSTINMKEKSIEIQNGNFLRFFKDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pur operon repressor
publication title Functional dissection of the Bacillus subtilis pur operator site.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 77
structure length 269
sequence length 275
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
A PF09182 PuR_N Bacterial purine repressor, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p4aA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p4aA02
1XD7A 3BJAA 4EJWA 2PRYA 1RZ4A 1EV7A 1HKTA 4BYYA 3KLOA 3HRMA 3F3XA 3L09A 1QQIA 1ECCA 1P4AA 3ZN1A 3KP2A 1ZH5A 2UXNA 5E1XA 5IT9Z 3K1MA 4LK0F 2HTSA 4WXCA 2CWEA 2D2WA 4L0ZB 2DY0A 2BE5F 2PI0A 4GXOA 2IVMA 1TC1A 2Q2EA 1OYYA 3K2ZA 1VSTA 2O61A 2WTEA 2Z33A 2AEEA 4OINF 3DF8A 4WMLA 3FM5A 3QPTA 3RPUA 1LJ9A 1ZLKA 1I0LA 1SFEA 4KDPA 1TLHB 3SZTA 1K78B 2VXZA 3CLOA 1F5TA 2X0LA 1XGMA 2PQ8A 1ZREA 2W24A 2O3FA 2ESHA 2STWA 1A04A 2H06A 5LHIA 4A5MA 5D5XB 4RANA 3F8BA 4PZJA 3DXJF 2KIMA 2E7XA 3VB2A 2JTVA 1GPH1 1XB4A 4ZH4F 2MC3A 4XSZF 2M1BA 4XLNF 5IT3A 1UFRA 4P83A 2EV6A 1D3YA 4OIRF 5D5UB 3GFLA 2K7LA 1QO0D 1O3RA 4DNCA 3FXUA 4KUMA 4ZYEA 2D1VA 3QP6A 3RKYA 5FB2A 1Z7GA 3K1PA 3LQQA 4EVIA 1R1TA 1IZ1A 1BC8C 4HDVA 3I54A 1SMYF 3RTRA 1XZNA 4P82A 2GA2A 4OHCA 1JHFA 5LLQA 4Z2YA 1QK5A 3KP7A 4HLYA 4X45A 3RKXA 3WU1B 1FYLA 4MTDA 1G2PA 1DPRA 5AIPA 2RGVA 3LPNA 4BH9A 1YS7A 3HHHA 3ZN0A 2J5PA 4ZZDA 3N2LA 1BBYA 3IC7A 4Q5SF 3ACBA 5E38A 2XASA 2P6SA 3K9TA 3FF5A 2OBPA 3F8FA 3IHUA 2RN7A 4RQBA 4KN4X 2HZTA 1ZGJA 4L9VA 3GEZA 3E5QA 2D45A 2UXXA 3KEOA 3BY6A 1WKMA 4U0VA 1K7AA 2ZBKA 1XGOA 5L3BA 3ULQB 1CF7B 2XROA 1O3QA 2JBHA 1FSEA 3NAGA 4YFKF 3G6WA 1J9IA 4RHYA 4GO1A 4CYDA 1JE8A 5EEGA 4U7BA 4ZYHA 2BBYA 3ZMDA 4EQQA 4F7ZA 4F8EA 1RI7A 2BYVE 1STZA 1R7JA 2RV8A 4HV6A 4ZZLA 5D5VB 1UPFA 2E7WA 5D5WB 3V7RA 1I1GA 1R3UA 3HYIA 3ZMTA 3ZMSA 3EDPA 1G4DA 1TBXA 4YIFA 3B02A 4TV7A 2EFOA 1MJ9A 1FSHA 1FPQA 5HLIA 2L4AA 1RNLA 1T0FA 4NQWA 5BQTA 2A6HF 1L1QA 3F6VA 1S7AA 1UHMA 2R7FA 1USTA 4M6XA 1DKRA 1BI2A 1MKMA 4P9FA 2V9VA 4LK1F 3TQNA 1IRFA 3WGIA 3QOPA 1D8KA 5E8IA 1IW7F 3H3ZA 3C1DA 3MQ0A 1BD3A 3HIFA 3GO5A 2VE9A 4I01A 3F6OA 3IRQA 2OZ6A 3M8FA 5BPDA 3I58A 5DYMA 1HBXG 2IRFG 2PJPA 4LD5A 4EMSA 1U6GA 1QCCA 5ESWA 3DP7A 2XAHA 5CVVA 4OIQF 2EV5A 2V79A 1YFHA 4RGRA 1Q1HA 2STTA 5F64A 2EA4A 1ECFA 4PDKA 1TQMA 4E70A 1FBQA 4P81A 5HDGA 3ISPA 5DDGA 3PQJA 4BNCA 1HW5A 1LDKB 4I02A 5KAMA 1XMAA 4YIIA 3TOBA 3P9CA 1IAWA 4UUVA 2YZKA 4ESBA 1IN8A 4U0YA 3W6JB 4ESJA 3ZMVA 3RI4A 3WTSC 3HTSB 5ESXA 4I98B 5FO5A 4RB1A 3GZ5A 1B9MA 2MD5A 3ZPLA 4KA4A 2FBKA 5JSQA 4RHUA 3BROA 3IRRA 2PRZA 3RYPA 4B8XA 1NULA 2FE3A 1I5EA 3C7JA 5HS9A 1B59A 5HLGA 4PGHA 3NEUA 1G3SA 2FXVA 5F1RA 3CUQA 5JVTA 2OZUA 4WCGA 3GFJA 3LRTA 1SD6A 4YG2F 1I27A 2FF4A 1YQAA 2FXAA 1W7PA 2ZJ2A 4JLSA 1STOA 2RVCA 1UCRA 4HDUA 1ZRDA 2EV0A 4AIHA 1G3WA 5HOOA 1Y0UA 2EK5A 3LQRA 1ZN8A 1HKQA 3SHFA 1XCBA 4IVNA 1DUXC 1HW2A 1I1SA 2ZNZA 3R0AA 3WGGA 1K6OA 2M30A 2JI4A 4O5VA 3OZFA 2V1DA 1AOYA 4HF2A 2JSCA 2JKYA 2QBYB 4LGWA 1RIOH 3EYYA 5LRSA 4EM1A 2R3SA 3BZ6A 4PCQA 1KA8A 4MEYF 3S5JA 1XGNA 3CUOA 1KQ8A 3MBIA 2O6GE 2GA1A 1LH0A 3VEPA 1IBSA 1TW2A 4RABA 3WTTC 1O7LA 2XBUA 1BD4A 3QU3A 4A0YA 2HQNA 2EA2A 4IJQA 1XTUA 4HV5A 4FYMA 4EJVA 1DBRA 1DKUA 4CDGA 2DBBA 3CUQC 1KU3A 5TRDA 4M0KA 4RB3C 5BS6A 3VODA 1SD7A 2DTRA 4MQ9F 4WF2A 4ASNA 4O3MA 1R5HA 3LA2A 1KU2A 3JAMK 3ZP5A 4WN3A 4RB2C 1R22A 3KETA 3HSFA 2OU2A 2HDCA 1I13A 3DFGA 1ZN9A 4HYEA 3R6SA 2LF7A 2FQ3A 1O3TA 3JTGA 2PEXA 4MB6A 4I09A 4KFCA 3Q5FA 3WTUC 3F8CA 4P9UA 4M9XA 1P6RA 4RGXA 3GYHX 2MBFA 1G9SA 1WI9A 4LMYA 3HUGA 5LHGA 1IN6A 2AS5F 3BJOA 5H6QA 4HA8A 3EFHA 1XCVA 2DAOA 1JHHA 4G7ZF 1ZARA 2K02A 5CVRA 3MEXA 4AVPA 2CGPA 1OPRA 2A3SA 3RDIA 2KRFA 5JFRA 1W5SA 2GXBA 1T6SA 4Q48A 3OV8A 1WRJA 2IT0A 3HSRA 2QWWA 1YTYA 3J80K 1A4XA 2KKOA 5FLXK 4IHSA 5DUKA 2EB7A 5E1WA 3G73A 1G6NA 4KIFA 1P17A 1PP7U 1FWZA 4JK1X 4AIJA 1T98A 3LFKA 1UHWA 1OYWA 3D5LA 4WX9A 4HOBA 2V1XA 2HWVA 2HCRA 2COMA 3M8EA 3U9GA 4KIGA 2ETHA 4A6DA 1IF1A 4O6JA 3HSEA 4G94A 1DQNA 1ECGA 3DEUA 4ETSA 4M0UA 3T5XA 3LSTA 1Z9CA 2Q8KA 4AIKA 2G9WA 4BHPA 3KP4A 4IRHA 1Z05A 1B6AA 1LDJA 1TTYA 3M9AA 1ODDA 1ZLJA 1S6LA 1P19A 1USSA 1QB7A 2IGBA 3NQOA 1TQIA 4ZYGA 1ECJA 4KMUX 2PS1A 2EJRA 1ZG1A 4U88A 1R5GA 5CLSA 5HDNA 3BP8A 3T8TA 5D6FA 2FBIA 3E5XA 3GLXA 4BHCA 4N0BA 3V8KA 5LGUA 5ILVA 3G3ZA 4L18B 4H0EA 3LAPA 4IRIA 3EYIA 3DPLC 1J5YA 3ECHA 3I64A 3COAC 1ON1A 5D4SA 2H08A 5IAOA 4P3KA 3I71A 2K27A 2GQQA 4HW0A 1S7OA 2QQAA 2L02A 1AO0A 4Z1OA 1SD4A 1BI0A 3GW2A 5E18F 2M5WA 2GEBA 3GWZA 2H6CA 2ZFWA 3M3HA 1MJBA 4UHTA 2L3DA 5TJJA 3T1BA 2OQGA 5BQOA 4OIPF 3GFIA 4OIOF 1BJAA 4IPAA 3BJ6A 2DFIA 2KIFA 2WV0A 2JRTA 1A3CA 2P5KA 1W7PD 4IRGA 2NS0A 1U9YA 2XIGA 4B09A 5JI6A 2RKHA 3H83A 2PMHA 3DEZA 3T0YA 5FFZA 1MZVA 2LF8A 1J7JA 4HLXA 2F5EA 4JBAA 1FZPB 5LGTA 2MA3A 2X4HA 1V3FA 5DD4A 1V9SA 3BOQA 3I4PA 1ULYA 4L9JA 1U2WA 1U5TA 1IN5A 4LB5A 2QUFA 5D4RA 2XV4S 1MJAA 4ON0A 5HDKA 1T39A 1UB9A 2VC0A 4GCVA 5E17F 1O3SA 2OAZA 1WWXA 4Q47A 1I5ZA 2BV6A 4EM2A 4LFUA 2DPDA 3JAMZ 2EWNA 2A61A 3KZZA 3KCCA 1V4RA 2P6TA 2CG4A 3DKWA 3M7GA 3TKYA 2RDPA 2MH2A 3GX4X 3MJDA 3N4MA 3ZQ7A 2A68F 2F5CA 3CUQB 1PDNC 3HVUA 2CFXA 3DPTA 5CVUA 1XGSA 2QENA 4G7OF 2G7HA 2XKOA 1W7PB 1J0RA 4CGZA 1LVAA 4R79A 4UV9A 2VT3A 3SFZA 2CQKA 2H6BA 5J8CA 2NRAC 1IXRC 2P5VA 1OKRA 1J75A 4MGRA 4LLNA 5L3CA 4N9HA 1FLIA 2MH9A 3RJPA 2VODA 4EM0B 1U5TC 4BHBA 3J7AO 3FMRA 2O03A 1C0WA 3E6BA 4P96A 3CJNA 3J80Z 1QCDA 2J5OA 4LYYA 4TWBA 2UZKA 5FLXZ 4OU0A 4ENNA 3R4KA 1OREA 2FOKA 2Z3YA 2ZXJA 1FYKA 3NRVA 1A98A 3V4GA 4M74A 1QZZA 3QPHA 1YLFA 5HVQC 3K69A 3RIRA 4RB0A 3E97A 2P5LC 3WODF 3LA7A 3MFKA 2DK5A 2QYOA 4RADA 1FY7A 1FP1D 3WTWC 3JW4A 4QYIA 5BPIA 1LQ1A 1MGTA 3MZHA 1J2XA 1SD5A 3QW4B 2VFAA 1KYZA 4LB6B 1DQPA 2O8XA 2PLYA 5DV5A 3O3KA 4N9IA 1P4XA 4XBFA 3KP3A 4M72A 3WE2A 2IJLA 1XTTA 2HEOA 2DO7A 1RUOA 3BPVA 3GFMA 4I0AA 2QQBA 5K51A 1BIAA 2WC2A 3U1DA 4UVCA 2FBHA 1IRGA 1P4WA 5KK1A 3F72A 1SFXA 2LNBA 2VOOA 3KFWX 4CZZA 2ZMEA 2RQPA 2HKOA 4FX4A 1WSUA 2DPUA 2JPBA 2FSWA 4CXFA 2FNPA 5DCMA 3IKTA 4LG0A 1YW9A 3FX3A 1GXQA 2E1NA 3ABTA 2VT2A 3E6MA 1YYVA 4OOIA 1JLRA 4FHTA 3T8RA 3K1NA 5HIAA 2XAGA 4CHUA 1QB8A 3WU0A 3VOEA 4EGYA 1ONVA 2YU3A 1A96A 1FC3A 4HZFA 1A95A 1BM9A 1VDMA 3HRTA 3RPQA 4BQAA 3HOTA 4RACA 3PFIA 2ZCWA 3ZMUA 3R0JA 4MEXF 2L4MA 4S04A 3Q9SA 3R61A 5BMZA 3ROUA 4ZFNA 2VE8A 5BQPA 3CO7C 2A6EF 3SZPA 3FM3A 2F5DA 3QAHA 4K2EA 4NB5A 4A0ZA 1B1BA 4ENJA 3I59A 5JV5A 3WTXC 1YO5C 4RAYA 5HS7A 1PZMA 1FBSA 1DDNA 4P86A 5D8KB 4GYGA 3CTAA 1XDSA 4L9NA 5D6EA 3KEQA 3F8MA 2DLLA 2XAJA 2G7UA 4M73A 1H0MA 1UPUA 1R23A 1TNTA 2QVOA 2ZO4A 3EETA 5E8GA 2NNYA 1I6XA 2QLZA 2ZNYA 4UXNA 4S05A 3SQNA 4KMFA 1KQ9A 3FMSA 2HYGD 3V7SA 5K1YA 1S8NA 4WXHA 1YIOA 4IJAA 1L3LA 1F4KA 3GZ6A 2FU4A 1GXPA 2OD5A 3S2WA 1L0OC 2VN2A 1WD5A 5ILSA 1TC2A 1BI1A 5LBQA 1LEAA 3GGJA 1B9NA 1ON2A 1O5OA 3V7CA 2W57A 2EFPA 2YSRA 2L54A 3BWGA 1KYWA 1BIBA 1P2FA 4HQEA 4RAZA 2KIUA 2Y48A 2FRHA 2M8EA 5ICCA 1ZN7A 1HMPA 2A5YB 1BC7C 5ILUA 1ZGAA 2F5FA 1U3EM 5EEHA 2IA2A 2NAZA 3VFZA 5H20A 2VBXA 5LEJA 3I53A 3LA3A 4RHXA 3HRSA 1BI3A 3IWFA 5L3GA 2PG4A 1MD0A 2IA1A 3QU6A 1ECBA 3P9KA 4A0XA 4G6DA 2DK8A 2W25A 4QWQA 4M9SA 5FD5A 1RUNA 5A2QK 4OMZA 1PP8F 4G9YA 1SAXA 2EFNA 3O7MA 5LHHA 4A5NA 1O57A 3GXOA 2BGCA 5CVIA 2V1UA 4HX8A 3WTZA 2XGXA 3P9IA 2P8TA 1LEBA 3L2CA 4EV0A 3WG9A 1H9TA 3FXQA 1OYIA 2HS5A 1XSVA 2YX4A 3L7WA 1U5TB 5EUCA 4KN6A 1XDUA 2D1HA 1ZG5A 3K0LA 1YW8A 3OZGA 1JXSA 1B4AA 3F23A 2DU9A 1ZG3A 1TW3A 1E17A 2ISYA 3J81K 3JTHA 5JR3A 2XAQA 5ICEA 3HHGA 2HQRA 4XSXF 3TGNA 3TDZC 2VOPA 2EHJA 2A07F 5LGNA 1G3YA 1AWCA 4P84A 4G8XA 3W6KB 2ESNA 4KN7X 4Y17A 2M45A 4L5JA 2GIVA 2DI3A 2K4JA 2VBZA 1R36A 1Z6TA 3ZMZA 2GAUA 3E5UA 2MLGA 3ML6A 3CO6C 2CSOA 2FEZA 1X3UA 2Y75A 5AIQA 1FT9A 2DQLA 6PAXA 1YG2A 2VBWA 2LDUA 2Q0OA 4HX7A 1JLSA 4IHTA 1HGXA 3KB8A 4RAQA 5FFXA 4L5IA 3FHZA 1SMTA 1MDMB 1QK4A 3GGCA 4LLGF 4Q4ZF 4I7HA 4IXAA 3TO9A 2PFBA 4HF0A 4EGZA 1Z91A 1HQCA 4UNOA 1O7FA 4ESFA 4PAWA 3WGHA 4QRIA 1FOKA 3MWMA 4IF4A 3P7NA 4MHGA 2ELHA 3KZYA 5ERIA 3FMQA 5D8LB 3KE2A 1ZN2A 1FX7A 4LJZF 3V8LA 3O6BB 2C6YA 4JITA 1EH8A 2LSOA 1LDDA 2WWYA 4RGSA 4PGGA 2QZ8A 1SFUA 1TQPA 3CDHA 4L9TA 4AWXB 1HSTA 5ICGA 4LLLA 4RHTA 1LNWA 1GVJA 2GZWA 1XTVA 3FWEA 4I2OA 2H07A 5CYVA 5J8FA 3DAHA 1EH6A 2GXGA 1ZRFA 5BRNA 2AXLA 2TDXA 2JKZA 1G3TA 4ZYDA 1U9ZA 1A97A 2NYXA 4QYIB 1BN5A 3OOPA 1BZYA 2P1ZA 4XRFA 4G7HF 5E20A 2IP2A 3BPXA 3RKWA 3GF2A 1WQ2A 3TO6A 2HGCA 1MZBA 1OR7A 1DP7P 2YPRA 4KICA 3MAJA 2HR3A 1GHCA 4KT5C 4EJOA 3DQVC 2VC1A 3V8JA 1K78A 2A69F 3IWZA 4CO8A 1L1RA 3GEPA 3ERED 3AAFA 3ECOA 2ACJA 4EJTA 1Z1DA 2IW5A 1IN7A 3F21A 1D5VA 1XMKA 4WWCA 2XHKA 4WXDA 1EH7A 4HQMA 4CICA 2ZMEB 5FGMA 1U8RA 2YX7A 3D0SA 3MZYA 5DCMB 1W30A 3M1EA 4LG0B 2VBYA 3LAJA 2PN6A 3TOAA 1MDMA 1P92A 1J59A 4OMYA 3LWFA 3TO7A 1IXCA 2MLKA 1HXDA 5K5OA 2FMYA 2E55A 1F1ZA 2QQ9A 2JT1A 4LYGA 1DPUA 2FNAA 1YFZA 2OA4A 4LZNA 3SXYA 4RS8A 2EFWA 5KAPA 3IL2A 2FMLA 4RAOA 2RC4A 4LZOA 5FD6A 4RGUA 4UVBA 4HAMA 2B0LA 3HOSA 1E2XA 1FYMA 5K5QA 1NHAA 4XLPF 2XRNA 2NNNA 2XAFA 5A2QZ 5KVRA 4MQVA 5HLHA 4WK8F 1YW7A 2CO5A 3WTVC 3KP6A 4DQ2A 3ELKA 3GUDA 4I0BA 1OMIA 2JPCA 2ISZA 3I59B 5IT9K 1FBUA 2K4BA 2KJCA 1XSDA 3E6DA 2CW0F 5DEQA 5AONA 3DV8A 1NONA 4A2UA 3HTUA 5HKLA 3Q9VA 3TDUC 5K5RA 1QZYA 1HKSA 4R1HA 4HX4A 5L3DA 5ED4A 1U78A 1G2QA 4UV8A 4MNUA 3IKVA 2Z9OA 3ABUA 1PUEE 1CF7A 1FP2A 4FT8A 3KLNA 2R7DA 1T38A 2HFHA 5DD8A 4P55A 1R1VA 2HYFA 1IXSB 3J81Z 1CGPA 3ACDA 1QNTA 4P5OA 3GVAA 5LRRA 3WTYC 5LEKA 2RNJA 2K86A 3HRUA 3I5UA 1IN4A 1D8JA 1R58A 2ADUA 4HF1A 4X44A 4U7DA 5JHUA 2IA0A 5F6FA 1H9GA 2PMUA 3C18A 1ZYRF 4NHJA 4BXUA 1KU9A 3I0TA 2F2EA 3E3VA 4Y15A 1KU7A 4L0YB 3B73A 2JZYA 4G6QA 3JSPA 2M87A 1JGSA 3RYRA 2UWMA 1FNNA 2GWRA 1S3JA 5DUIA 2XUBA 1QPMA 2Z5UA 1KQ0A 2H09A 1OROA 1UFMA 2XVCA 3DMPA 1I0IA 2P7VB 4ENMA 2H27A 2QM3A 4QLCU 5BSKA 1FSGA 2FA5A 1HW1A 3FZVA 4GGGA 5BOXA 1W5TA 1GRVA 1XN7A 4S2UA 2Z99A 4M9ZA 1VTNC 1ZHFA 3H3UA 2C4KA 3C3WA 1CJBA 5L3FA 2H94A 3EUHA 4EJUA 1P18A 2CYYA 1I14A 4U0WA 1HSJA 1QBJA 2E1CA 1IUYA 4HBLA 1TNSA 2OQRA 1K79A 2EFQA 1Z6RA 4PFQA 2IPQX 5DCFA 3JSOA 1F9NA 3KP5A 5E1ZB 2V6CA 2DQRA 1OPCA 1G9TA 1T2KA 4GYIA 1R1UA 3N97A 5L3EA 2WNSA 5ICFA 3ACCA 4RV4A 3F22A 1ZAOA 1XSXA 2LKPA 5IPFA 3PQKA 3REOA 2O0YA 2P7CB 2DW4A 4M6YA 2XKPA 4FX0A 4YFNF 4RQAA 3L9FA 4A6EA 2PBIA 2BEOA 4BAYA 2HTJA 1W4MA 2VONA 3OHPA 1VCHA 2DT5A 1REPC 3QP5A 3BDDA 4P80A 4UVAA 4Y13A 3L00A 1YS6A 4KNYA 4AD9A 3QRFF 1J7KA 5CVJA 4KIBA 4ENKA 4D0PA 2KJBA 3WE3A 2HOEA 4M0PA 4KYWA 4A12A 2ZKZA 2W85A 4R8HA 2YR2A 3FXRA 2W84A 1QGPA 4MTEA 1Z7UA 3E6CC 1Y0BA 4JQFA 5CJ9A 2L01A 4LZAA 5H6RA 1ZRCA 1QK3A 1S29A 1D6NA 2HKXA 2QBYA 4YFXF 2P4WA 3EQLF 3F8NA 1R00A 1BOAA 2Y0MA 3U2RA 1KGSA 5HS8A 1XZ8A 4M71A 3H92A 3R60A 3MCZA 3O2PE 1LB2A 5J6XA
chains in the Genus database with same CATH superfamily
4D5GA 5B55A 2VRCA 3AEUA 4PG7A 2CEKA 1GJRA 4ZI3A 3RODA 3HRKA 4YIHA 3ONEA 4WXCA 1VBNA 2PI0A 4ALIA 1J1IA 3VU9B 4PYRA 2BGRA 4ZCQA 3BTUA 4E32A 3F9RA 1TM3E 3CH5A 2P62A 2K9NA 1MMDA 2X2EA 1JQKA 1HLFA 4OINF 4MVJA 3EHDA 3GFGA 3TLBA 4F1JA 4JOBA 4BAGA 3N9IA 2QZZA 1TLHB 4KL8S 4V24A 2O3QA 4RA2A 3TZHA 3ZGVA 3OPYA 2GCPA 1X1SA 4WOPA 3UH1A 3IH3A 2IYNA 3FW1A 5JDIC 1A04A 3CHYA 1E8MA 1ILEA 4PSAA 3A10A 4J1SA 5KAFC 4PTZA 3B53X 3RYIA 2BGKA 5ESDA 4N7RA 4KV7A 3I8SA 1JH8A 1X7ZB 4FMBB 3MAGA 4FHDA 1UFRA 3AYXB 1PV1A 1QYDA 4CF4A 1OSNA 221PA 1N5DA 2J9GA 1A7AA 1YB1A 2PS3A 3JR9A 1ZJ4A 2Q1SA 2BJWA 4RPLA 3QKUA 1OC4A 1Q1GA 2Y0DA 2QSZA 3ZI7A 4LQCA 1EJ0A 1QHGA 3B13B 4IJ6A 4ZRMA 4Z2YA 3MELA 3QBVA 4QUGA 1LFDB 1C1HA 3KP7A 1XQ1A 3RKXA 1XWFA 3FJOA 3E70C 3NFYA 4OJMX 4FE3A 3K8QA 2VQHA 3LBFA 4LIUA 4EYEA 1DRKA 2NZVG 3OTGA 3VSEA 2VHWA 3RVDA 1MN6A 1T6XA 4DV1B 3N2LA 1VL1A 2Q0SA 4LC0A 3I2YX 1XLWA 2XKJE 3ZGOA 5IAKA 2GBLA 4WA8A 3OA0A 1CZLA 5DULA 3RKUA 1KORA 2W2MA 3N2KB 4QNMA 2ZBKA 2BMAA 5AQEA 4K0KB 3CZMA 2R6CA 2OQVA 1SRRA 1PS8A 3ZMDA 2DYKA 4XVHA 4YAFA 4F7ZA 4F8EA 1IEXA 5HQJA 4B71A 3TXXA 3EIWA 4UUTA 2X9QA 4ZJZA 5E9QA 3I9NA 2QLBA 3S70A 2YWCA 4HEQA 5LQKA 1AV7A 2QSUA 4YY3B 1BXKA 4OBWA 3TJMA 4YVFA 3FB4A 4EM6A 5CYPA 1WVGA 1NYQA 3G5TA 5KNBD 6PFKA 5LQUA 1G20A 3D3JA 3N74A 4RJIA 4PG5A 3U60B 4CL8A 5ALMA 2GN0A 1E58A 1I3MA 3E4CA 4Q4HA 1HG0A 2Y1LA 3TQNA 3EOAI 5D6NA 2PANA 3DKVA 1D8KA 1E1RA 2FLKA 5K6RA 1RBMA 1BD3A 5BWLA 1SXIA 5T5QA 3VR6H 1YKGA 3IUPA 4DIEA 1Y3FE 2A33A 3BE8A 2GKGA 3K5HA 4EMSA 4COOA 3DLHA 1G59A 4FYJA 4ALNA 1K8ZB 1Q0ZA 5IPAA 2PVCA 3CZAA 3QPAA 3N7TA 4UNNA 1NF9A 3RHSA 4ZHQA 4YIIA 3H75A 2HSDA 2I67A 4UAVA 2YZKA 4NKRA 4UKDA 3WMRA 3N76A 1KS2A 4ACBA 4E2WA 5TMDA 5DTEA 1HO3A 1BOBA 2XTMA 1K7YA 1OWLA 2C2OA 1EZ1A 2P4EA 4L4YA 4W5WA 4EDHA 5BR7A 3HA7A 1KAHA 3WDSA 1TQ4A 3VR2D 3LL4A 2OXCA 4I46A 5FEUA 1NULA 1BX0A 2VDOB 1UWLA 3DH0A 4DRZA 1KI6A 4ENSA 4EY7A 3U7HB 1T3TA 3SQDA 3JRGA 1EX6A 4XAQA 1YQAA 4Y1GA 3R3WA 3WGMA 1VBMA 3GFQA 1PV2A 2CHFA 4OHVA 1NYTA 5FO1A 3OM1A 1Q57A 3DFIA 4UU1A 2WUGA 4WDQA 1DDIA 3S1MJ 1KZ6A 4TS3A 3RPUD 3ZZMA 2XMZA 5I9NA 4CCWA 3LHDA 3S93A 2AJCA 2DDBA 1WTAA 3ZCUA 3LT1A 1QZXA 3HXLA 1V4BA 3DHVA 1UKCA 1M1XB 4R2HA 4TM8A 1JDBB 1YB7A 3DMYA 4I9HA 4LF8B 2OBNA 1YCHA 3WTTC 4OP3A 2XJ9A 1IIBA 3IV9A 3O1JC 4CDRA 3TL4X 1H9BA 4EJVA 3N1UA 3JZFA 3PUYA 5KYUA 4CDGA 4BVJA 2HBZA 2IOYA 5ALPA 4CVNA 4XYMA 1S2GA 4IXMA 4RTPA 3VODA 5LQAA 2JJ2A 4HH1A 2GBIA 4XONA 3OYFA 2GEUA 4MYUA 2FVXA 1CPYA 3ZXUB 2HMUA 4CWAA 3K4HA 3RU9A 1X1EA 2ODQA 3RSCA 3UH0A 1DIAA 4IVPA 1E5XA 1MTOA 1FX1A 3AERA 4JI0B 1D09A 4JBLA 4GWGA 2Q9AA 3DDUA 4WCDA 4FWTA 3EG5A 3I72A 2J45A 3IYLW 3WAGA 3UXMA 2FG5A 1U9IC 2QYHA 3ZXXA 1EP1B 2MSLA 5JSKA 5BWBA 3FSGA 4LMYA 4RF4A 2KDZA 3BJOA 1Z4PX 2JAOA 1XCVA 1NG7A 2Z56A 1NVTA 2JSPA 3C8HA 4U6NA 2PX2A 1JI8A 1VE1A 3D1LA 3HGGA 2PKXA 1TFRA 3MZ0A 1P2GA 5EG0B 1DBIA 5EUBA 1CJCA 3FHOA 4HWTA 3M1YA 2EU8A 3H2HA 1VG1A 2GKOA 3WFIA 3J80K 2V7BA 1E7YA 5G1PA 1ZESA 1CC1S 3G73A 1MIJA 2CJPA 1L7AA 1OE0A 2FWRA 1SIOA 4LF7B 1VG8A 1A2BA 4JROA 4ALLA 2OXEA 2EG9A 3D59A 1K7FB 2GJ9A 4WASA 4JVOA 2JEYA 3UJHA 2V6BA 3LXRA 3JD1A 4G94A 2O2JA 4D4GA 4KXFB 3BQ9A 3L0PA 2V4JC 3ZH9B 4JI1B 2NV0A 4KBFA 3J7AC 1X0VA 3IUBA 4M0UA 3WTCA 1ACLA 3A36A 4PINA 2Y1GA 5FLXA 3OFJA 3GP3A 4Y98A 2MSNA 2VQ3A 4R4JA 3FZYA 2AVDA 4YDRA 1USSA 4LWZA 1L3BA 2GPAA 1R5GA 1QQ7A 4AVZA 2FV8A 3OKCA 2ZVPX 3QWFA 1NW5A 1Y4AE 4WTOA 2K9SA 1GXSB 4JYCA 5FXMA 2XTNA 2IP4A 1S1CA 1T2DA 3IX7A 3FPFA 5KWEA 4B3FX 2DWCA 4C3HJ 1GYRA 3WYCA 2YVLA 2LCIA 4GU5A 2PX8A 2OWDA 4LHYA 4Z1OA 1KSGA 1LPPA 3PSIA 4TQ9A 2QHXA 1KXZA 1E3EA 4V0SA 5CX4A 3WHIA 2G70A 2L17A 4LOIA 1ZLYA 1K9VF 2VHXA 2H63A 5AHWA 3CMEI 5H16A 3LPAA 2NTNA 2IYUA 1GZUA 3UYLA 2QU7A 1CJSA 4KOAA 2NS0A 5JJKA 1PS9A 2PAAA 2D5LA 1U80A 3DEZA 2Z43A 4LRWA 5CCXA 3OF5A 2X4HA 2M98A 3BHJA 4YMLA 2M9HA 2ECOA 2C3UA 2RGXA 1Y4UA 1SCQA 2R48A 5AM5A 3BMOA 4DZTA 2XRMA 4UNRA 5HFJA 1Z4MA 1I4EB 1SXQA 1E0SA 4JVMA 3F73A 5FPQA 1S4QA 2FPRA 3H5OA 1CIPA 1ZK0A 3SZMA 1W75A 3COYA 4RD3A 3IPYA 2ZRNA 3EGDA 4LGMA 3MJDA 2C1XA 1QVZA 1AXEA 1GTJ1 2F67A 3VPGA 3OQBA 4OI1A 3A1NA 4Z4GA 3K0BA 1G21A 4MX8A 1LVAA 5F9MA 5D5QA 4R2MA 2WTUA 4GBED 1JUDA 4CKCA 1NFQA 3AF6A 4J6EA 3OYCA 3T4EA 1C1XB 4G8JA 1PZEA 4XNFA 4FCYA 1PR9A 4JOMA 1WUYA 2C3PA 3MS7A 3ZTYA 2XUIA 1XRNA 1XMOB 1QYIA 2C7RA 3J7AO 1W25A 1CFZA 3SQXA 4RMHA 2P2LA 2CXOA 2X5KO 4Q7QA 4I2NA 4M1ZA 5B2EA 1EUDB 1B93A 2Z3YA 4CEHB 4LITA 3IUSA 4XJSA 2RBKA 2XW6A 1A76A 1AN9A 3F6RA 1K6IA 4MRSA 5IW8A 3A4VA 2GESA 1EGVB 5JHHB 3HNRA 2QE6A 4K6CA 3W0LB 2VAWA 1SUIA 2WP0A 3OT1A 1K3FA 3TRIA 3S2YA 3IAHA 1TU4A 3WLFA 1XA4A 2X0KA 4MVJE 1IVYA 1JUMA 4TMKA 3GYBA 3WAKA 5FR2A 4NNOA 3OSUA 3AHGA 3WGNA 5BPIA 4HP8A 5JQGA 4O1IA 1XRRA 2GT1A 4CIXA 2ZUTA 1CVRA 4KXYA 4Q3CA 3KKEA 2IYVA 4EA7A 1T56A 3O26A 3DNPA 4XBFA 5M3BA 3TOVA 1UXHA 2FKNA 1SIUA 3O8NA 3A9CA 2CLOB 4LHVA 2Y9ZA 2M32A 1T08B 4QPDA 1O6ZA 2VOOA 2R5FA 3AEKA 2ZMEA 2RQPA 4FX4A 3RYHB 4G6TB 1VPWA 3F5MA 4UCXA 1YD7A 1VYUA 4LBVA 2NO0A 3KTDA 4L08A 1U98A 1QH1A 4H60A 4CL2A 7GPBA 1XX5A 3K1NA 2GPSA 4ASUD 4GGMX 4QEZA 1GPBA 4ER5A 2CQXA 2I2AA 2V74B 5IMBA 4I19A 1EHIA 3WB9A 1A2KC 4G5FA 1RQPA 3RPQA 4V1CB 3G8YA 2LOOA 1XQXA 2VE8A 2F4VB 3PX7A 1N2XA 4GLJA 5JAIA 1BHO1 1QTRA 4W5JA 4MUXA 4ENJA 3EPHA 2ZBEA 4HADA 3DBIA 1L6IA 4KIWA 2NTYC 4CQLA 4OJNA 3KEQA 2ZTLA 2V9KA 4M73A 2QMZA 1H0MA 3TECE 4DMKA 2QVOA 4PZPA 1FSZA 2WILA 3X1MA 1XIVA 4Q3BA 3KKOA 1FMCA 3H3VK 1IY0A 3B7WA 2H7XA 3AXTA 3RV4A 2W90A 2A78A 1GRNA 3GJYA 2IWRA 1JV2B 3Q0WA 2RMKA 1QZUA 3L8YA 3PNKA 1L1EA 1B9NA 5FEMA 1G20E 3EQ2A 1F38A 3N7UA 3E9ZA 1XAJA 3RVQA 1T5LA 2UYCA 5TPZA 4RAZA 3PTAA 4Q1BA 2HWWA 2FWJA 5JROA 5DSXA 1ABEA 4K9SA 1RR8C 4BFZA 3K4CA 4I5EA 4ZU3A 2ETVA 2A05A 4BVHA 1Y9DA 5L3SB 4A2WA 5AKYA 5EZHA 1Y9JA 3QKWA 1XJQA 1FQKA 4K6GA 1TVKA 3ENZA 5DHPA 4Q21A 2GN6A 1IFXA 1DIGA 4HN4B 4HY3A 4GMKA 4ER6A 1RUNA 4YR9A 1N2BA 2YIJA 2KSQA 3MN1A 3R44A 3AP1A 3O82A 3D1NI 1R71A 3UIEA 3QGMA 4HX8A 4GP9A 1WF3A 3WLOA 1EFVA 2FQWA 4FNOA 4JVSB 2PYZA 2QVGA 3WG9A 1YZLA 3JQRA 1TKCA 1Z07A 3WLNA 1J20A 5EUCA 2DR3A 1M7GA 3IBGA 1VYHA 2FP4B 4ARZA 1CLUA 3STWA 2I5PO 1I3AA 1G64A 4XIFA 3FSJX 1Y5LA 1BCSA 3Q3JB 3TL6A 4NAUA 1U8CB 3ILYA 4EW2A 5HJ5A 3K70D 1N1MA 1DU0A 3B1KA 4TMTA 3I4CA 3ADBA 3HM2A 1B15A 1TYEB 2DI3A 1QFXA 3O9ZA 4OOFA 3COJA 2E1MB 3VR6A 1X3UA 1R74A 2FWNA 1YBHA 1XZKA 2JJYA 5F1PA 6PAXA 1T4GA 3RS8A 3AHDA 4GYJA 2JBAB 2LDUA 4MPPA 4YAUA 5J43A 2L9RA 3C6YA 2LIPA 4H27A 2D4AA 1WVRA 4BMOB 1MDMB 2WRZA 2YRWA 4DMMA 3NAQA 2EIMH 1E32A 4WJKB 4RDHA 4QRIA 3WGHA 1ZICA 4D4KA 1UJ5A 2EOAA 3TLAA 1MJGM 4MRNA 4WZBA 4C01A 3P2OA 3D7LA 3T7JA 4I6ZA 4QXOA 3IAXA 3OPMA 4DLKA 3CDHA 4L9TA 3DZDA 4RJJA 4MIEA 5TQ2B 3FWEA 2YN2A 3SSOA 2H07A 2V3VA 4DMUB 2ODEA 4D9CA 3HKDA 1ZRFA 3IURA 4YIRX 1L3IA 4TLLB 3L9WA 1I01A 3HY6A 3FWKA 1VBFA 1BN5A 4ZOAA 4DR4B 3ZI4A 2OCYC 4G7HF 5C7OO 4V2IA 3PUXA 3NHRA 2DFKB 3UQZA 1EDZA 3URKA 4AJEA 1WQ2A 2QPAA 2CRGA 1ZHHA 1VXOA 5K2OA 1OXBB 2VC1A 3VR0A 5AK5A 4YCJA 2QVYX 3NANA 4EJTA 1AKRA 1G3RA 3F21A 3B8EA 2Q1XA 1Z5PA 2QDKA 3HLYA 1E6MA 2LNDA 3A2NA 1XNJA 2MOKA 2R68A 1TO1E 4OMYA 3R23A 1UH5A 3U17A 1JRLA 5K5OA 3QEJA 5C3UA 2ID8A 3DCJA 3I01A 3G68A 5FNVA 2QOEA 3UJDA 1E0KA 4MV3A 4D3XA 2XRNA 1DOZA 3M8JA 4B3AA 1OIVA 2GNAA 4DYCA 3C7AA 3RTAA 2VRWA 1ZJ5A 1QR6A 2CHQA 5LQNA 2W2KA 2OORA 3ZHZA 5E1DA 2WBMA 2CU7A 5H5JA 3NT5A 4LK2A 2X9DA 3TDUC 4QYXA 2BFDA 1NE7A 5ED4A 3JWGA 4ESEA 3HN6A 3TLEA 1CQPA 1PUEE 3FR7A 3QBTA 2CT8A 2A94A 4MJ7A 4PLZA 4TTIA 5DT9A 4G07A 3UBMA 2I2DA 1ZIYA 5B1BH 1QNTA 1GT0C 5LEKA 5ALTA 1B2RA 4CV2A 2XE4A 3OPQA 4ZPJA 3GLUA 2Q4BA 3GT0A 1Z5UA 3CBGA 4BBAA 3GJ8A 3QPBA 1TL8A 5F6FA 3DA8A 1OD6A 3OM0A 2LTAA 3DXZA 2NP7A 2KM1A 4Y6PA 1Q84A 4ZO9A 1SN7A 3BUSA 2GO7A 4L0YB 4RFVA 2G28A 1XCPA 2NG1A 1YOBA 3SK0A 2CN1A 2O4UX 1VRCA 1NW3A 1NVBA 2AI1A 4JEHA 4I6EA 3LUHA 1XEWX 3UCEA 2XUBA 4C6TB 2L18A 4FX5A 1YZHA 4CLDA 5IDQA 5E6SB 5IJ9B 5KYXB 3JRFA 1YHQI 3M8KA 3KOWA 2LY9A 2GZ1A 3OCCA 4JR1A 1GRVA 3LSJA 3VNRA 2FJUA 2AOXA 5FI3A 3C3WA 2O2YA 1TD1A 1YS2X 1AKYA 1X58A 1WQ4A 4CSWA 4RIHA 2CYYA 1XI2A 4R05A 2ESRA 4AUNA 1CE8B 1X7HA 1BW9B 1JHDA 3Q85A 1JIUA 1KONA 4G8CA 3LH5A 4MO9A 4M87A 2GYYA 3MVEA 3FBTA 2ZZMA 1E3WB 1WL8A 2IQ5A 1RZUA 2FRDA 1Y7TA 3H5WA 1B76A 3GLQA 4Z4IA 2Q4RA 2XD9A 3FGOA 3ACCA 4AUEA 4RDUA 2HO5A 2R96A 2HDOA 2VJDA 2FEXA 2CDAA 4P92A 2Y9YA 1G21E 5CJJA 2VP0A 3SSAA 3ZOBA 421PA 1ADGA 2NVWA 4ZQBA 1D5YA 2VONA 4G41A 4EJSB 4FGJA 2OPHA 2DEUA 1IY8A 3CZ4A 4D57A 2FEKA 4U0KA 1BTOA 3SLKA 1RI5A 4UJ3A 2QRLA 2C4WA 4L4SA 3D4IA 3N7AA 2YZMA 2BHYA 3V6MA 2C9MA 2G0TA 4B7XA 5M04A 3LY5A 1K4YA 2A9RA 1M34A 3P9YA 1T4BA 3MVPA 1EE9A 4KPUB 3O3CA 3OAAA 3CZQA 3D5EA 4DRXB 4C7OB 1DAFA 4I4NA 3T99A 4K9LA 1JR2A 4DR3B 2RC5A 3F8NA 2MR5A 3G9ZA 3TR6A 2R86A 4PZ9A 5ADHA 4R3UC 1XVVA 2ZYGA 3L8CA 2FDXA 1GV5A 1HKTA 4KODA 3ZDEA 5CFQA 3F3XA 1LVUA 1H3FA 1KPIA 4MYCA 3CEHA 1II8A 5I4IA 3DXYA 3HNOA 3MTJA 4QECA 4GX5A 4GVLA 3P94A 4F97A 1VLZA 1HQDA 1BS9A 4Y6GB 3RS3A 3WA6A 4MQFA 3QVGA 1P7PA 4N8EA 3E48A 3K9WA 2WTEA 4M8LA 5FTWA 3K0CA 2VJOA 1IVSA 3GJTA 4MITA 2GA9A 8LDHA 1F5TA 1REQB 2BCGY 1G98A 1YMVA 2CL0X 3Q8XB 4IQGA 3QVKA 4CF7A 1NU8A 3VDQA 5LHIA 4IDGA 4L6CA 1CDZA 2QEQA 4M1KA 1O94D 3T1YB 3O8HA 3EE6A 2ET6A 4YFYA 3EQZA 1B16A 3EXG2 4ZOLB 1P74A 3R40A 1A2QA 1TD9A 2Q27A 4ZCIA 3B6ZA 1O3RA 2XE8A 3E7XA 2DFVA 2H5JA 4QFMA 4KUMA 1SUFA 4GE0A 2BFEB 2OCAA 4CTJA 3LP6A 3FPGA 5BO5A 4HDVA 4L07A 3OTQA 1PWZA 4RTQA 3LWNA 5CFZA 1MW9X 2IZ0A 2PH5A 2RK3A 1CUBA 3R7SA 4RPJA 3MJRA 3K7AJ 4KH0A 3AZQA 3ZHBA 2ZT8A 4KXXA 3DTVA 1XK6A 1AV6A 3L6CA 2CBGA 4FKZA 2OBPA 1TWAJ 2OE2A 2RN7A 4YXWA 2FEOA 4N6GA 5M3MJ 2XMRA 4N5NA 2D0OB 4GVXA 4IDFA 4U3JB 1TWGJ 2PHZA 4C5CA 3A1CA 4JWTA 2XROA 1VE5A 5J4KA 4BFYA 3PNMA 2YOHA 5EEGA 1R6XA 4EQQA 3NWJA 4P54A 3EIQA 2Y9MB 2YR0A 1RI7A 3BE6A 4NONA 5TRTA 2KQRA 3GQBB 5LU9A 4Y6SA 4KZPA 1Q15A 4TWRA 4GI1A 2BTOA 2JLUA 2ZB8A 3HYIA 1TU0A 5BVHA 2X9LA 1ZUWA 1MJHA 1R9NA 4KR9A 4PJMA 3JARB 2W1OA 4AFNA 3K9HA 5I7RA 3A4NA 3WZMA 2L4AA 2YBDA 1DC4A 5D5HA 3HO8A 3KOMA 1KS9A 2YU9J 1J25A 4DF3A 4B35A 4FMDB 2DOFA 2YMQA 1V48A 2GBLC 4HGYA 5AW8A 2QG6A 1TUBB 2Z4RA 2Y99A 1PK7A 1K86A 3B1JA 3MS2A 4ZO8A 4PBTA 4YQEA 4E0BA 3IRQA 2HRBA 2V0CA 2WZDA 4C4XA 5JNWA 2PJPA 4DWVA 4A3FJ 2FSFA 1N6RA 1X4PA 3BG3A 3UOGA 1TA0A 3B51X 3T1VA 3GJZA 2X8JA 1QH0A 3JSXA 1T6YA 3IP1A 3UHAA 2G88A 3MXOA 3TCXB 2C42A 3K73O 1YBVA 3CLRD 3LI2A 3R7FA 1HFKA 3LVQE 3QM1A 2I71A 5JWHA 3P9CA 5KQSA 3V8NA 3DO8A 3SHOA 1O4XA 2EERA 3BWVA 2X4IA 2PK3A 1WB9A 1E61A 4I98B 4LJ4A 1G8JA 2PZEA 2PL3A 5JSQA 3EDQA 4G6ZA 3GN2A 3L7JA 2LW7A 4IV5A 4YPFA 2FE3A 1SUBA 3MBOA 1I5EA 3TDKA 5HWSA 2XKAA 4Q39A 4F55A 4JX8A 2DR2A 4W5NA 4AWBA 4JUFA 2OZUA 2IYAA 4UVGA 3KFXA 1YMUA 1YS9A 3T9BA 3DQQA 4K28A 1GOTA 5KBYA 1STOA 3D5RC 3GVCA 3FMGA 1NUAA 4DKJA 1ZRDA 1QG6A 4Y0AA 1KK1A 5EZ6B 1C3OA 4HQNA 3U7EB 3P0JA 3TQFA 2KRHA 3FTDA 1CWUA 1VJ0A 4WZBE 2V3CC 3HUEA 3WGGA 4JU8A 3PUFA 3E03A 1FFXB 2GAAA 4BVKA 5CDSA 4YRVA 1OOEA 1UIMA 3QY0A 5KVVA 4GX0A 2EBWA 4HG2A 2QTWB 4RGBA 4U6SA 1LH0A 1QJCA 4HDNA 5HUQA 5I45A 2FETA 1XMJA 8ADHA 1WF6A 1YMQA 2DQ4A 3WXMA 2PL9A 4RM2A 2VLBA 5EP3A 3AG6A 5AJYA 4M8SA 3OX3A 1Z3XA 5BS6A 4BRUA 1V1JA 4TXLA 3OU7A 1C1DA 4XL9A 1XRQA 3JQPA 1K61A 3ZVKA 3UPUA 2JAPA 1W1IA 2ZUEA 1N78A 1P4HA 4NY1A 1DGRM 1QQTA 4LN1A 3DULA 2DHRA 2SICE 1CDEA 4B44A 4F91B 1GAJA 4Q4JB 3L0ZA 3GJ0A 4HYEA 3SS9X 4YECA 4D6YA 1G2HA 1DHTA 2P5SA 1RE0A 1OA0A 2C94A 4HMPA 2XUOA 3I76A 2ROQA 3GHHA 2X13A 4HAOA 1NMEA 1USVA 5CFLA 1P75A 2CH0A 5U4QA 5FLXK 2DA3A 2J48A 1EUZA 4C4SA 3IESA 3LSIA 2JFZA 4JJZA 3MSXA 2ZSDA 5K4HA 3EZ2A 3ZW7A 4RF5A 1UHWA 1N6IA 1T4MA 3DVLA 3L8ZA 3SDZA 1T9KA 3LCUA 4QOIA 1R8QA 1T2UA 5EC8A 4WX9A 2KLHA 4JLUA 2V1XA 3FNBA 3WIVA 3FK7A 1C50A 2RDMA 4CKWB 1LV8A 4LQLA 1IF1A 5I4KA 1K75A 4DJFC 2HPVA 3BTLA 3OBBA 3R8XA 1MO6A 2Q3FA 5KVCA 4ZOLF 4UREA 2LCQA 3BR1A 4R1NA 2Q8KA 3VPBA 5JCOA 1Z05A 3GU3A 4HGNA 4CM1A 2YFYA 1ZLJA 4F60A 3SE0A 4QM7A 3TD2A 1SK8A 4P38A 4HDRA 3EPKA 3T8TA 2GIZA 3WYDA 5HLTA 1GG8A 3BMCA 5HR5A 4XKJA 1ZW1A 2P8JA 4HMQA 4OA8A 2R5YB 2DUMA 2GVDC 2Y0SA 1M0TA 1QZTA 2FGKA 3SEAA 1KMCA 2HNBA 1ON1A 1ZONA 4HW0A 2JFOA 2JL1A 3TFWA 1DMSA 1W1UA 4A3SA 2FN8A 1J2UA 4H4DA 3HXPA 3TW8A 2VQ6A 3I1IA 3GWZA 5D86A 4QJBA 3BE4A 2C5BA 3E15A 2LVSA 3CS3A 3NW9A 4K1LA 1L5OA 3DCIA 2GBPA 4KXMA 1BJAA 1IATA 3G9UA 4MB0A 1ZM4A 1RC8A 4O02B 1EA5A 1GN9A 3VNUA 4IRGA 4IWYA 1DJOA 3KUXA 2JN6A 2UUZA 2FW8A 4HLXA 1KJ9A 3QNMA 3RS4A 2AR7A 2RARA 3I9MA 2ATCA 2ADFA 5D3QA 3AB8A 2R8XA 4I3HA 2Q0XA 3BFJA 1CP3A 3T5BA 3LZCA 4AMUA 1BSVA 2FMHA 4FMDF 4D82A 2C4HA 4YAEA 3GLKA 4J9UE 3N2NA 3KCCA 4ED9A 4JBHA 3NCTA 1DO8A 3V8BA 2RNGA 2HPAA 2W4QA 2PX4A 3BBPA 2V3WA 4LF9B 2FF7A 3GX4X 1IE3A 2Q45A 2ZAGA 4M3GA 5ALRA 3V4ZA 1SELA 1E8NA 3EEOA 4ZDKA 2B9VA 1XAHA 1EFAA 3QWBA 2CQKA 1WHSB 4I4TA 1M34E 5C5CA 4V39A 3I28A 3RFTA 5AUNB 2NWQA 1DGWY 3C6XA 4RK0A 2FR0A 3CISA 3RVKA 1M1YB 4Q4AB 3ZWCA 2C3YA 3SHVA 2MH9A 1IPEA 5CLHA 4BWVA 4X95A 4DR5B 3WQRA 1DL5A 4PYOA 3KE9A 2OT3B 1T3LA 1CW2B 1XF1A 2IEGA 5DXJA 1JUPA 4PQFA 2X8AA 1MW8X 4ENNA 2E2JJ 2G9VA 4C4YA 5BV8A 4DMRA 4FINA 1OZGA 2REQB 2QN1A 2J5XA 1Y7HA 1E5LA 5FYDA 5EJ8A 3EEBA 4L1KA 1MB0A 4CCJA 1C14A 4X1YB 1X8LA 1C8LA 1P8AA 5EE9A 3BRWD 4BFTA 4MV7A 2JIQA 1PT7A 4X1IA 5ICMA 2M7AA 2VPTA 2VDLB 5ALDA 4IDNA 1WPQA 4H6VA 1HZJA 1NUQA 1NQOA 4HQ0A 1LQ1A 1H8HD 1NU6A 3CLSD 3K7EA 5HQ3A 1UQUA 5JH7F 2PLYA 1LDGA 1MBGA 2I2WA 2IYFA 2QJTA 1RETA 2RHOA 2O0HA 1I39A 1AE1A 2HXOA 5F12A 4FJ2A 2X0FA 1VPVA 4DZZA 1QV6A 2QSYA 2XCRB 1CQIA 4YGYA 1ZGZA 3A0UA 1LLUA 3THXA 1N5LA 2W7TA 1JPNA 3PEUA 2R6AA 4JSRA 3JQGA 1I51A 5JD5A 2WAQA 3WR5A 1GXQA 1XB2A 3KAPA 3NWTA 1BQEA 2R7UA 3P4UA 3LC2O 1KH1A 5E4YA 3B8HA 1YCFA 2QKYA 3PUHA 1GQRA 4S35A 4WKOA 4ZEMA 3ZQQA 4LF6B 4S04A 3OJLA 2DJIA 1K4TA 3NJRA 3PQDA 1AHIA 1Z0DA 3AM5A 3RREA 4N03A 1SVLA 3QA3E 4MI1A 5DH9A 2FOWA 4A0ZA 3EW9A 2FWAA 4DJDC 1NFFA 5LDDC 3ERMA 3WRXA 4C6SA 2P40A 1F06A 3FLBA 4A03A 2ZMEC 4YJKA 4G12A 5LC1A 4EYQA 1Z6AA 4PNHA 1MQ8B 4FASD 4MGIR 5IASA 3ND5A 1YULA 3H2GA 3KFVA 1E2EA 3C98A 1XKXA 3R7WB 2E4UA 4GLLA 4PYIA 1M1NA 1EWVA 3GZ6A 2G9QA 1Q17A 1JNYA 2FU4A 1W44A 2XVZA 3WMFA 4BFSA 1K9SA 3CEPB 1DAOA 1HE3A 5CP8A 3WGQA 2ODWA 3KQWA 4REQA 4J1TA 4CF3A 5ICCA 5A9RA 4AM3A 2A5YB 3I4NJ 4RKQA 5C5IA 1N5OX 3KWLA 5CT5A 1VDZA 2A5WA 2C8JA 3FM9A 2AFHA 4EGCB 3HRSA 4PANA 1JR6A 1HYBA 1MD0A 1JTXA 1TQ6A 2GCIA 1JYSA 4WLUA 5ALLA 5J1YA 3AR5A 4RZ3A 3HXTA 4EKNB 5FD5A 1P45A 4UDYX 1DTWA 5ARCA 1SULA 1NSYA 3UJBA 3E61A 2JLQA 1ZIOA 4JELA 5IT5A 1G7CA 4J0KA 1O57A 1KAQA 3EF0A 4RZHA 4GG1A 2BMEA 4MDEA 3C5CA 4V19K 1AHDP 2AEFA 2Q3LA 2LTPA 5IANA 5A1TA 2R79A 4I55B 4UC0A 2P8TA 3NHAA 1QFMA 5E3HA 1HZZA 5JASA 4EV0A 3HSSA 3MPOA 4MUFA 1VL5A 2E4AA 3OE5A 2B5WA 2Z5FA 2C7GA 1A9YA 2FQ1A 5FL3A 3ZLUA 4C76A 4EI7A 2QSGX 2PFGA 1FZQA 1VI6A 2AHRA 2ZFUA 3FPLA 2BOLA 4TV9B 4MKHA 1V35A 4ZYXA 4P35A 3OKPA 1U8ZA 2G0NA 4YAKA 4MAFA 1LPSA 4G26A 1O97C 2LK2A 2ESNA 4KN7X 3WSWA 3LRPA 3ZCRA 1U7WA 4EO4A 1HT3A 3LFTA 2BSQA 1PNRA 1ZGBA 1RLTA 1YZQA 1ZCAA 5JI2E 3EUEA 1R5NA 4H77A 4K46A 1MDFA 1TTHA 1ZD4A 4JBNA 1EP2B 2YS7A 1M76A 4RAQA 4YRAA 2GJ8A 1RYZA 8ATCA 4BTVA 2HPMA 1AA6A 1SR8A 2EFDB 1E89A 4BO7A 1D0SA 3F1KA 4C30A 1P0CA 3FMQA 1N77A 4YHHB 2HA2A 4JZYA 3O6BB 3FUWA 1ACMA 4D0SA 2DU8A 1OKKA 4N40A 1SFUA 1DXOA 5E7QA 4DCPA 1AMOA 4QYTA 1C80A 5FWAA 3HVKA 1LNWA 1MXFA 3IODA 5CYVA 3OHSX 3HJCA 1HDIA 5BRNA 4J90A 4EBFA 2HOTA 3EVAA 1XTBA 4MO7A 1U9ZA 2A9VA 4O2RA 4Q1FA 3PB3A 1GARA 5BW4A 4CM8B 5D84A 1E4VA 1ZM7A 5AW3A 3HPHA 1ZNXA 4PONA 4QODA 4XYLA 1TF7A 1RPAA 2M3AA 3F49S 3U39A 4KT5C 3G89A 1IBCA 3VO2A 1GV1A 2X3FA 4YAWA 3SGLA 1EFKA 4J0QA 2BTQB 4B6EA 3P0HA 1GU0A 5AKZA 1B72A 2HF9A 2ZJ6A 4D99A 4PX2A 1SWWA 4AVYA 2NX2A 4Y2SA 1POGA 1JAHA 1VIVA 5DEIA 1SUPA 3O4JA 3D1JA 1ZRHA 2H1FA 4K6FA 1F1ZA 1TLLA 3TH5A 3L01A 3ZV6A 1NNLA 3EZ6A 2C98A 2RFLA 1VZ2A 5HNKA 3FZGA 3FNGA 1Y8RA 1N8SA 4II3A 2N3ZA 3MRXA 1XYYA 2C4UA 1CKEA 3WLAA 5C8YB 3L2WA 3D2BA 5KVRA 1X8KA 1LV7A 4FEEA 2TCTA 1YZNA 4IL5A 2H7VA 4BQFA 4I8XA 4EJ0A 3AGQA 1OT5A 3QJYA 2HPHA 3BH7A 1QU3A 4PE5B 1U0BB 3C1AA 4GOND 5KOYA 4X8MA 2WMYA 4M4SA 5JCZA 5JNVA 3FKIJ 4WJLA 3PRJA 2BFAA 1X13A 1Y6QA 3QUCA 4RMJA 1LZLA 1LTKA 1RJFA 2FSUA 2R7DA 3JTMA 2P6UA 3SC4A 3VUEA 3D7NA 4LSZA 4NPAA 1CNEA 1F6DA 3GVAA 4LTDA 4N0DA 1LRKA 4J0EA 4WDRA 3T15A 1D8JA 2ADUA 3NVMB 5E0KB 1H9GA 1R9JA 1ZYRF 3K4NA 4BXUA 4B3IA 2DJNA 1T3SA 2W4SA 4YUYA 5A9SB 1W0CA 4RFSB 1FS4A 2YHIA 4NQRA 1WBBA 3CA8A 2OORC 5ICSA 2UDPA 1X87A 5FV7A 4L8LA 3A6FA 4B8ZA 3K1TA 1SBIA 3CX8A 4UOEA 3VPDA 4YLGA 2NYAA 1ZM3A 2H3EA 2H4HA 4KOEC 4ENUA 4GGGA 5DI9A 5BOXA 3P9XA 4CPDA 4AB1A 1XN7A 3DLIA 3HFRA 4PLCA 4M9ZA 2UUBB 5LMZA 4FQGA 2WJ3A 5K0ZA 1OWPA 1FFDA 4NJOA 2MC4A 1W59A 4LIPD 4DCMA 1KE2A 2HK8A 3SSMA 4W99A 2CNWD 1Z6RA 3V33A 5DI3B 1AA9A 2VZ9A 4OQEA 2V6CA 4NJMB 5KSWB 1U2ZA 1T2KA 3RPEA 3QVTA 4EI9A 1YB2A 1NAIA 2F43B 2NUAB 4ZYTA 5KHLB 4IQ0A 5IPFA 2AQHA 3T94A 3UAYA 4MICA 3CN7A 4UBJA 1BMFA 3QVVA 3HCPA 5C2JB 4CL3A 3HCFA 3OHPA 1ISMA 1RCTE 3ERCA 3JYLA 2EYUA 4NIMA 4BIMA 1D3AA 2X76A 4WI1A 3WGJA 4B3SB 4I55F 4FHEA 1J7KA 4QPCA 1EJ9A 1C8BA 1SBZA 2N1BA 2LR0A 4XGNA 4UNSA 4YC7A 2FHPA 1WX1A 4H7JA 2XGJA 4LZAA 2FW0A 2YZ7A 3YASA 3D0QA 2WTXA 3QFSA 3CUWA 2FRDC 2NNLD 3MWYW 2P4WA 4R81A 2CLIB 5F2EA 4TV9F 1TEZA 1KGSA 5HS8A 2C4NA 2YV2A 1BMTA 1CIVA 4IZHA 4NCAA 1NQUA 3AETB 2W37A 2WJ6A 2F9MA 4NBVA 1OLSA 1RYYA 3A0BC 1H9CA 4FYYA 4IH9A 1QQIA 3KP2A 4EEFG 3HBLA 3PGJA 1J0BA 4W7HA 3VHXA 4ZMBA 2IL1A 3ZWPA 2IDZA 3QEMA 3QPUA 2L2OA 3W5SA 2HU5A 3UJ9A 4TKZA 4AJLA 3QPTA 1J5PA 4PR3A 2I34A 3CLQA 4DHWA 3MJCA 2G7ZA 3Q3GE 1LJ9A 4AF7A 2ZXHA 4OFXA 1HKUA 4A2CA 4MQEA 1YR3A 3L9XA 2ZG6A 1T8SA 3JQAD 4WWHA 3CLOA 3CC2I 3AKZA 3RJ5A 3IO5A 1YCGA 2VF8A 4MVJI 1NR1A 3VR4H 2YWRA 2STWA 1V7CA 3RJ9A 5D5XB 4IIUA 5BSGA 3UWMA 4NYMQ 1OXUA 3I1JA 3OPYI 4AYWA 2MC3A 1DBQA 2E37A 1THZA 3DMFA 1XTKA 4XCVA 3PA8A 1WZ2A 3QP6A 2NO4A 1IZ1A 1TP4A 3I54A 4OBXA 2V45A 5A5EA 3OZCA 2OC4A 2PZBA 1JHZA 1UC4B 2O8EB 1OCRH 3WU1B 4YS6A 4G1MB 2QRHA 3K0CC 5DBEX 3SXPA 1FFEA 1UODA 3AF2A 1U7PA 5CLGA 1WP9A 4MVJM 1YBAA 2VCHA 4F5EA 4QXRA 3K9TA 5BPFA 4WLNA 5IWAB 3L4JA 1GFSA 1GVHA 4CG0A 4L0DA 3BAFA 3ELWA 1FTNA 3EEIA 3E5QA 4A26A 2D45A 3C3PA 1W85A 1YRWA 2GYWA 4IKEA 3QU4A 4B3DA 3O8CA 1P2TA 1R0KA 4MWCA 4BFXA 1E3QA 1K7AA 2H5IA 1GAQA 3ZR8X 3ZWBA 3ZLVA 3VZBA 4G63A 1Y4SA 1G6OA 3TSZA 2X51A 4QDKA 2FZKA 5E8RA 4PO1A 4ZZIA 5H4GA 4BACA 1MBZA 2MWMA 5EGSA 4CIBA 2LKXA 1ULUA 4R41A 3PC8A 2WWHA 4PSUA 3MMXA 5C8YF 4UFPA 1VHLA 3C70A 4P0TA 2D3TA 1FFYA 4PU0A 2QTCA 4OYHA 3BLYA 2OECA 4LZWA 3QU2A 3I56I 3R5HA 5LP6A 2YFKA 4XOPA 2UZAA 5JY6A 2ZRJA 3AM4A 3O2QB 1E6UA 3NUZA 2OCCH 4NHOA 5K0BA 3IUYA 2I4RA 2F7SA 4PHFA 2W2VA 3RQIA 1ORWA 3WGIA 4LMAA 5C8ZA 4Q1DA 2G77B 3AV0B 3HCDA 4DCUA 4I01A 3U61B 1H3NA 5TB5A 1LUAA 4BKQA 2VATA 3HUTA 1C3XA 3O31A 1RADA 1YRBA 1YFHA 2STTA 3WB1A 4PPYA 4OATA 4E7HA 4PDKA 5JTTA 2OYCA 4EHKA 4LXTA 3PQJA 2I4MA 3TOBA 2F1HA 3EVTA 3HCNA 4OB8A 5HG0A 3ER8A 2YYAA 3W5CA 1IAWA 4H7PA 1U8BA 4U7JA 3C45A 4GC9A 4IINA 1JXQA 5GPCA 1EEHA 5A3SA 3CX7A 4KR0A 1XRJA 2MD5A 4WHMA 1GZ4A 4R01A 1JQEA 2OUKA 4HCJA 3HCWA 2K7ZA 1YX5A 1JI0A 2XYGA 1EDBA 3U4AA 2YMMA 3JWEA 1QRSA 1T1GA 5DN9A 1EKEA 3BWXA 5IFKA 2NUTB 3AFIA 3D3WB 2W42A 3UV6A 5I8WA 1DIHA 1KVUA 3GFJA 3AG1H 4IEJA 4GPD1 1B7GO 2PRJA 2ME0A 2JLCA 5CW2A 2K6GA 4BWYA 2WT4A 3KWJA 2L7FP 3E5NA 1XELA 3I6ZA 1UWVA 2B21A 3C6KA 3UXEA 2HU9A 1WKVA 4EWLA 5CVDA 3NHWA 3EWIA 1L4KA 2AI2A 4KN8A 2ZDHA 4HJRA 4EM1A 2HA4A 3CZCA 4RLSA 3I0ZA 4OH1A 3F9KA 3VYRB 4Y2UA 5DNVA 1LB1B 3GT4A 2VIXA 2EA2A 2FMTA 1P9RA 4U5QA 4G65A 4PHHA 4I1SA 4ZXFA 4LFCB 3OJXA 2IEYA 2OGTA 3CMMA 1GPKA 1QSGA 1TNDA 1T1IA 5F2NA 2QT9A 4RAFA 3EIXA 3UT0A 4PBSA 3Q8KA 4WF2A 3D2CA 2R66A 3WP1B 3VNAA 2ZJRF 4PX5A 3M1LA 2BXZA 3OECA 2Q1WA 4QJ4A 5J3JA 4KUGA 4YMIA 3RIHA 3DM5A 2E7ZA 2XADA 4NU6A 1RXWA 4FUQA 3KETA 1A4IA 2IT1A 2KYRA 2QR2A 2H1HA 1ZN9A 1RLOA 2BZSA 2JHGA 1GTRA 3OQMA 5BUSA 2B78A 1SXJB 1VLMA 4G9BA 4PQEA 4HATA 1YXMA 3ZWAA 4B7UA 1BH2A 2J7PA 2QJOA 4U6QA 5ELMA 3QG5A 3LM8A 1I32A 1IJBA 1KK0A 4DY4A 2Q5FA 2YUIA 2EW8A 1KERA 3X3HA 4MW6A 3HYLA 2I6GA 2RG1A 1D2CA 3QX7A 2DFLA 4PZLA 5CBPB 1ID1A 1XQVA 3I9V1 1GIAA 1HE8B 2ZJZA 1RBQA 2V0NA 1COWD 4ZVOA 2WF7A 2JB9A 1WRJA 1U31A 2BKLA 2WHQA 3DS8A 4XK4A 3PITA 2G7MC 2H2IA 1DV1A 1JXMA 2I6FA 3HL4A 4GKAA 3OOEA 4W8GA 5JSFA 3TS1A 4OHXA 4GL4A 2FSGA 5E2AA 4NE9A 4C0JA 1ZWLA 1R27A 1ONNA 4XYGA 2BC9A 3OMYA 2BMDA 4B17A 2XCOA 1MMFB 1UM8A 4J76A 1UDBA 4ZIRB 1AKTA 5EWJA 1FA9A 1GKUB 2FPMA 3NR2A 1KHHA 1DS6A 5F04A 1PJRA 2LFBA 5ADUS 2Q6VA 4AJIA 2OA0A 2P2YA 4I3GA 1NMXA 2NUPA 2YKGA 4QTTB 3RCBA 2ZSBA 3W3AD 1B6TA 3C2QA 1ZL2A 1OAOA 3PEVA 3BPSA 2ZB2A 3FZNA 3DEHA 4BHCA 2DSTA 4PLVA 4HI0E 2RGCA 1J1ZA 2ZUDA 4XFKA 3FTNA 4NCJA 5IARA 1UBLS 1J00A 3QFHA 3I23A 5CLJA 4GM1A 1IEQA 3ECHA 4MRPA 1RAEA 1UKBA 4ZOBA 1PSWA 2OBFA 4C7VA 3IAM2 1AU7A 2VH5R 1ZCZA 3S81A 5C80A 5LQJA 3PCTA 3AUUA 3BSFA 2HLHA 4FFBA 2Z6VA 1RXCA 5F1KA 5JCOC 2ZSKA 4DYVA 5AVVA 4IQFA 2UVPA 4F3NA 4X60A 3VGPA 5DNYB 5K01A 2PBLA 5IK2D 2LV8A 4M6WA 4B4VA 2W43A 1K08A 2HT6A 2DGDA 4B09A 3UT5B 4N54A 4UXHA 2ZUVA 1Z56C 1T5BA 3SDGA 4IIJA 1QHSA 3C7KA 2DTEA 4FJ0A 3AIMA 4AP9A 3PXCX 2QUFA 4WKPA 5EXPA 4BE0A 3HPRA 1SCDA 4B46A 1ZVJA 1SHTX 3BQNB 2OKCA 3EDOA 2JJ1D 2OAZA 4RKWA 1YRQA 3ESDA 4E3WA 2OHJA 2EWNA 5FJIA 4PLHA 4PWZA 1AKHB 1LSJA 4QXMA 2G5TA 1P5ZB 2VYNA 2HAEA 3E22A 4NS4A 1W4BA 3RS7A 4BLSA 4C3OB 4IOKA 3HKEA 4HEA2 3SLRA 1ST3A 2HCTA 2GKSA 2WHPB 3GPBA 2HA7A 1NSTA 2P9ZA 3CPHA 1ZISA 1YC5A 5UKDA 5I47A 5THKA 4NI5A 5A3QA 2G83A 2RGUA 4K6HA 3AEZA 4DA7A 1VFCA 1KJYA 4A0FA 3U7GA 1H2HA 1MAVA 3R7DA 3FXKA 1PI3A 2V7FA 3KKLA 4F4UA 3T9EA 3OYNA 5DK6A 4JSYA 4BNKA 2VXOA 3CO0S 1KVRA 3SWWA 2B8WA 1Y5NA 3C74A 3PFFA 2WWWA 3I8OA 4UMEA 2EP5A 1SC3A 3E97A 5B1IA 2JGDA 5AIBA 2A5DA 1E2NA 1TJPB 3RI3A 3ZCPA 1IXYA 4ADSG 1PDVA 4YUZA 3R3YA 1PHPA 4Q7KA 1B26A 2G80A 2C20A 3H3FA 1X7YA 1VTKA 2IV7A 3NM4A 4LB6B 4MRAA 1T5DX 1ZOSA 5G53C 1YCDA 4XWOA 5AW9A 2E5LB 3Q8WA 2HA6A 4X9XA 2L7ZA 1G5FA 1QWOA 5U9CA 1PGOA 2FWIA 4MPTA 3KP3A 1ZR4A 3E9QA 1NV9A 4B33A 1BCRA 2IUUA 4C05A 3O8OB 1J8MF 1AQIA 2WLSA 1NUSA 1UAGA 3BKXA 1JG6A 4D3ZA 3TIFA 2XPWA 3LC1O 3GJ6A 1EFRD 2E18A 3ULKA 2IEDA 3Q5GA 2YW9A 3SR4A 1UADA 3MJSA 4YO7A 3BR6A 2OCDA 1XZGA 3VOEA 2C1EA 5F1OA 5AI9A 2E6UX 1Z0AA 3AL2A 1Z2NX 4AS1A 4PLWA 1G42A 3ESCA 4HO1X 2O8BB 4B3XA 2XB9A 2F00A 1RWVA 3IRVA 4IJ5A 5DXFA 5JDCA 3ZU6A 3CO7C 3W5IA 1U7UA 4R9UC 3KWMA 5LA6B 2PKEA 4TRRA 3Q15C 1E2DA 2H11A 3VR4A 2P67A 2I87A 3AUAA 1EHCA 2AIRA 1T6BY 4G4JA 4H7HA 2K4MA 4XYBA 4Q3AA 4CEJA 1KWKA 1T2AA 2V6IA 3WIEA 2D00A 9GPBA 4LVOA 4RLQA 5GQSA 3WK8A 2K40A 3COPA 3FTPA 4KFUA 1JYFA 3DL7A 2L2QA 2E2IJ 4QQNA 1YIDA 3UUWA 1YIOA 2IZ6A 1BDHA 3I37X 3X44A 1I4WA 1H0SA 2OD5A 1F8GA 1G7TA 2GARA 3KVVA 5T67A 3GEHA 3PXAA 1KI3A 5K8VA 1E6CA 3NHSA 2M6LA 1XZMA 4CKYA 5KTYA 4U2BA 4JJKA 4QYWA 4WXYB 4JVNA 4DDHA 3GH1A 4KE7A 4OXRA 3PL8A 3HYRA 1VJDA 1USUA 1ADBA 2HK9A 2ZI3A 1COZA 4JXKA 3DBHB 2I1WA 3WRXC 4MINA 4R6XA 4IV8A 1PSZA 3UWOA 1PEDA 4HXFB 5BR8B 5TEVA 3LNQA 5CUQA 1JPUA 2MTBA 1QE0A 2LUOA 4OAOA 5BYKA 4FETA 1FNBA 2WYWA 4G67A 2E9SA 4UNIA 2Q4DA 1A9QA 4B75A 1FVXA 3RVRA 2BGCA 3UMGA 2WY2D 3SVTA 4JI6B 4OXNA 2WR8A 3B1FA 5EJIA 4YAIA 4KBYA 1NASA 1F0KA 1YBFA 5LXTB 2YX4A 1EUYA 3ICQB 1NNEA 1TE2A 1HBJA 1VI5A 5JAOA 1N9ZA 2VL8A 2QA5A 1BXRA 4J1TC 5L95A 1KSHA 2BGLA 3OZGA 4YEJA 2AFIA 2CW5A 4YAGA 1CLEA 1N2JA 2D13A 2GZSA 3UHFA 2IU4A 3OJWA 1F6BA 4ZVQA 4UBKA 2VB6A 4XFJA 2VOPA 1QFYA 2H59A 2PO7A 2EZLA 2J9XB 3WNVA 3IQHX 4EGJA 1KEUA 3G2HA 2GAUA 3N6VA 3RE1A 3I2FA 4F4FA 4Q18A 1A9XB 1N2CA 1VLHA 3JTEA 4CEIB 2PXAA 2DQLA 1PGPA 4TXNA 3ZD7A 3PHIA 3A0RB 4AULA 4PC6A 3KB8A 2QX7A 3W6PA 3MKLA 5FFXA 3VAZA 3FHZA 5HIMA 3AF4A 1HZZC 1QK4A 4EVQA 2A35A 2R00A 4ISBA 1AKNA 4Z86A 1ESNA 1J9EA 4OFZA 1YJQA 1KETA 3JAKB 2BFCA 2R6GA 1A8IA 2QTRA 4Z7JA 2V7PA 3B5EA 3JU3A 3KZYA 1C4XA 4EH1A 1WH7A 4YXFA 1X7XA 2CXQA 3RT9A 3RDPA 2YL2A 4AWXB 4A5SA 5CA0B 3PKZA 1U6IA 2Q2QA 5M34A 4ZQFA 3KBBA 4ZVNA 1L5MA 6CHYA 2JKZA 1W36C 4X6UA 4A92A 2D2IA 2YS6A 4EJ2A 4ENRA 2BKEA 9ABPA 3OOPA 1KQNA 3VKGA 4DCTA 3IXLA 2Z6AA 3BPXA 1ZQ1A 3HBNA 2QR5A 4JASB 5K3SA 1OR7A 2D2VA 4KICA 3AB3A 4YCDA 1GCOA 5EESA 1HFJA 2B7BA 5ALEA 3RSSA 1UKVY 4X00A 4DNOA 4UULA 2WD7B 1P9NA 1HFWA 4OB6A 1OB5A 1J07A 1XTSA 5AK6A 4PFJA 1ZR2A 1WXDA 1EH7A 2VUIB 3PFGA 2FMFA 4JLOA 3WI7A 3LT2A 3K8ZA 4BV8A 5JI3E 3IAS6 4L2IB 3VJLA 4KHZA 4NC9A 2OV4A 4HN2A 4J43A 1D1CA 2AE1A 4V02A 1A8SA 3OU2A 1N5RA 3BMNA 1RFGE 5BWNA 4PFPA 2ISSD 2I78A 1IQPA 4TXJA 1H1DA 5AJHA 1PJBA 3CGWA 3HE3A 3L0SA 3HEBA 3O91A 1Z17A 5KAPA 2NU9B 4CM9D 2JFYA 2MSWA 5CDUA 5EE0A 2B0LA 3WL3A 3S16J 2HADA 3HB0A 1A8QA 5KSPA 2PU7A 1CUZA 3G7UA 4UM9D 3RIXA 3KP6A 3EJWA 1P77A 1ZBDA 3ZG6A 4HV4A 4B9EA 2KJCA 1D0ZA 2DG2A 2B7LA 5DEQA 1QDEA 3DV8A 2J07A 1PJCA 2VPPA 2B5OA 3BSSA 1VJ1A 1U1GA 3U13A 3TZKA 4XN0A 2QUIA 3R8CA 1LQUA 2UYGA 4L51A 2XVYA 4CCYA 3KQYA 4R8MA 2NVUA 1FP7A 4W6QA 1SVSA 4TMWA 4PZ0A 2HJGA 3LPMA 2DWUA 2WU8A 2K86A 3HRUA 4UVHA 1B8IA 4LTNA 5C1PA 2XTJA 2GK7A 2I8CA 3I01M 3WL4A 3RRFA 2DXIA 1YJXA 5JHUA 1GL9B 1ZIDA 4FT2A 2PMUA 3H0EA 3S1AA 5EGNA 1KU9A 2XF7A 3GMEA 5L3QB 1Y89A 5LA6F 4TUYA 5F52A 2O7RA 1D6SA 4N9WA 3DW1X 2M87A 2EZKA 2Y27A 1RWQA 1NQTA 3KLMX 5FYQA 2GUWA 3OURA 2BGGA 2D1TA 1RYFA 4G5GA 3KJGA 2OLJA 4HOYA 2WJZB 3NOVA 5JH7B 1P1KA 1NT4A 2XQVA 3HJRA 5H59A 4ZOCA 4BTLA 4F04A 2EH3A 4LJ9A 4I1IA 5G0TA 1E6KA 5GIPE 1Y6JA 4GYYA 2FA5A 1OUMA 2QE7A 2DPHA 4V2UA 2AYXA 1QIGA 4S2UA 2FUKA 3A6PC 2E89A 2XYHA 2R4UA 3S4YA 2JIDA 4OXYA 3EUHA 1Q21A 3A4TA 1JIXA 1I4LD 4JLPA 1ZJWA 2E71A 1UKZA 1O6CA 1Q2XA 4N0MA 4EECA 3CKYA 3OFNA 4B6FA 1VA4A 4EZBA 1F9NA 1S7EA 2HO4A 4PVDA 3R0QA 4NXNB 4MVJP 3M4YA 3N97A 3M9LA 3A31A 1UAAA 3MLEA 4FISA 2K87A 2OBYA 5L4NA 4KTTE 4E6KG 3MPUA 4JQCA 4RDCA 4YFNF 1YUMA 4JI3B 4OUDA 3HSKA 3I5XA 3FXAA 5JMWA 3QITA 1NF3A 5F35A 5LPNA 1XMPA 1CJUC 5FCDA 2OCGA 4OHMA 4D74A 4INPA 3CCUI 1NJ2A 3BB1A 5LXTF 1G1AA 3HP1A 4D26A 2DUNA 2GD1O 5HODA 2R6R1 2H29A 3FNHA 4DS3A 1Y0BA 4TMVA 1J2RA 3QE2A 1UQRA 1CFJA 2AJDA 4GH5A 5D3MB 3EAFA 4Y6RA 2C1ZA 1M0SA 1L4GA 1SQGA 3GZJA 1Y1SA 3B3GA 3ED1A 3GCWA 4C6RA 1LLCA 4KYUA 4HZGA 2GXAA 4XE5A 3S3NA 5C81A 4BYYA 3KLOA 1GPAA 1O96B 1WS6A 3TSCA 1N0HA 2GS9A 3ANLA 3C3AA 4L0ZB 3Q0VA 1E1KA 4GXOA 2XSZA 1SEUA 1IMJA 2WF5A 3DLBA 5HUJA 1W5FA 4R51A 3THYB 4HFJA 5FBZA 1FB5A 3FGNA 3VPXA 3CBQA 3FM5A 1DP4A 3L7DA 4OU5A 2YXNA 4KDPA 1HCRA 3HVHA 3D5SC 3CR7A 1WPXA 2NZWA 3F2VA 3FPKA 5AHOA 4JWKA 3LRXA 4AROA 1USGA 1JHVA 1TWHJ 1Q6ZA 5DM2A 1J4AA 1VI0A 1FYDA 2CK3A 4CV1A 2E7XA 3VSKA 2R6DA 4FE4A 1BMQA 1YJ8A 2OFPA 2AO9A 2X1VA 4OHUA 5M7EA 4XSZF 5CA0F 2GOMA 3HXQA 3NBYC 5GONB 3K2IA 2WVJA 1WI3A 4AKGA 3F0CA 4DNCA 2HYJA 1UOQA 1SHJA 4ZYEA 4D97A 1YRLA 1HA3A 3K1PA 2N47A 4W9MC 5SZJA 4BRSA 5SZIA 5A4FS 2PNJA 6REQA 4G8DA 5FPSA 5BSUA 1A9SA 1JHFA 3JQCA 4KMRA 2HHHB 3ZDBA 2UZ4A 3G59A 2IYLD 4MTDA 4EG1A 3ICCA 4PHTA 2RGVA 3LPNA 1YS7A 5I51A 3QG1A 2ILTA 3VFDA 1Y4DE 5CYOA 1GTVA 2X9NA 3VBCA 4XPIB 2DLDA 2JFXA 3I9FA 1DXYA 2UUCB 3LIPA 4BNGA 2XMCA 4TT3D 1V8DA 2PGJA 2I7CA 2JIMA 5A71A 4GRDA 1JPVA 4BV9A 1RI2A 2L7KA 4DXAA 1ZQ3P 5B4VA 2WAAA 2EZIA 3K4LA 1O4VA 3NAGA 4RHYA 1JE8A 4BNUA 2VYQA 1IONA 2GCEA 4DZJA 2GZAA 2OENG 4GM0A 1FU8A 5E3NA 1V3UA 3DZFA 1VPDA 4QARA 5IJZA 4XEUA 1A9TA 3HM5A 1QCYA 1E7SA 2B61A 3W5BA 3SFIA 1AQ6A 3IPCA 3N2EA 3I2GA 1V11A 2ZI4A 4CLHA 2PLNA 2BGUA 3DPUA 4D6PA 3ELDA 1FPQA 2ZBPA 1RNLA 3IO3A 4F06A 1NN0A 2AJLI 3W8FA 1G7RA 2JFQA 4P32A 3WBFA 1USTA 1Y1VJ 3T7SA 3ZE9A 3H1CA 1MKMA 2HBYA 2V9VA 2WG2A 4LK1F 3LXXA 4MW5A 4YREA 1ZLXA 5FUBA 5AM3A 1IW7F 1V8OA 4PS1A 3MQ0A 4CQMA 2F4NA 5EXXA 1RKBA 1OI4A 2HPIA 4B0OA 3OJFA 2E5NA 1UDCA 3M9WA 4NAHA 2WKWA 5CFNA 3ZCVA 1UMCB 1N0UA 3ZEAA 3VV3A 4TYPA 3T7KA 3VNSA 2WYOA 2ZZKA 1D0VA 1UPAA 4JL8A 1QHHB 2Y1EA 3PC8C 1GTMA 4RVGA 2AFIE 3UWKA 2A4MA 1CX9B 1P4SA 1XMAA 4JY7A 3LQKA 3AJ9A 4D9EA 3K8OE 2AZDA 1N5KA 1V6AA 3VPRA 3WGKA 4C88A 3H11B 5LP6C 2VF2A 3FJYA 4DR2B 5C46F 3INTA 3KQMA 3K9QO 4MUBA 4OQXA 4P7BA 1E79A 3NBXX 5A7GA 1OCZH 2RQQA 1S2IA 1N2CE 2GZRA 2O50A 3SIRA 1BE1A 1E3DA 5FF9A 4FYKA 1NMYA 5HLGA 1B00A 4PGHA 1SD1A 3DONA 1JT6A 3ISTA 5BYAA 4IX1A 3RLIA 2H0AA 4JVLA 3LRTA 4MUIA 2IE0A 1SKYB 4MR8A 4DBVO 3IDZA 3O3NB 3OCZA 4A9AA 3EFOA 1DC3A 3MTIA 4UUBA 1Z6ZA 3LQRA 5IH7A 1I36A 3OYEA 3QW2A 2Q3JA 4C2UA 3RFXA 4K7JA 5JJ5A 1G6KA 3A6DA 2PL5A 3L84A 5TV2A 2EWWA 2GF0A 1ECPA 2JSCA 1XLUA 4ZI7A 4FTWA 4WOBA 2VJPA 4MTLA 1KA8A 1XAGA 4GPBA 1PJTA 3DOHA 2XBUA 4C0LA 4Q9KA 5B37A 4Y6OA 2JS7A 3D2LA 4OWRB 3EASA 2ACEA 1VJCA 2PBZA 1VQ5I 4XR6A 3OY2A 4WE3A 3HXMA 1DZ3A 5F7XA 3ZWMA 1PR4A 2PL1A 1HORA 3ZZ0A 2I65A 4WOCA 1WDKA 3H19A 4Z9FA 1UBCA 3TOSA 3FXOA 3ND6A 1WJ5A 2DCUA 5TY0A 1HDXA 2J3MA 5JJBA 1ND6A 2JI9A 2RHJA 1TOAA 4N41A 3AINA 1E6EA 4TN1A 5BMVB 1ORVA 2BHNA 2Z5VA 2OZLA 3TBHA 2QY6A 4TL9A 3A05A 4NULA 4HSTA 1Q14A 4PGMA 3KV3O 2PTGA 1M6NA 3BJZA 4J0DA 3AUSA 3RSHA 2FUCA 4DMLA 3UA4A 5FT9A 2OCKA 5CVRA 1SC6A 5AW6A 3MGKA 1KJWA 1X2NA 5L6LB 1CULC 3OFVA 4X71A 1VCMA 1KMIY 2I6TA 3KJNA 2NZ2A 4G5RA 2WKQA 4UHCA 4WFKA 1D7OA 5DWVA 1G55A 2WJAA 4LAFA 1ZSYA 1MO2A 2DFNA 4FEYA 4GYWA 5DUKA 3L1IA 5CEFA 4UXIA 2ZCJA 4RA9B 3UT6A 2ZJFA 3G2IA 2AKAB 2RBGA 3D7KA 4TT8A 2DOAA 2AJTA 1OYVA 1QS0A 3KYCA 3TJRA 2GQ0A 2WDZA 1UC9A 2A3RA 2DBRA 5CW1A 1LPQA 3IEUA 4H16A 3HK2A 1PVEA 3S29A 1V45E 1E9FA 2YYZA 3K16A 4A3DJ 2CVZA 1LE8B 3EA0A 3TTYA 3T4XA 1X19A 2JRLA 2FUEA 4DA4A 1YVPA 2CZGA 3NT2A 1ECGA 4CCSA 4A8JB 1JZQA 5KCMA 1GT91 3ONQA 5JZSA 3TL3A 5GONF 5REQA 2F1JA 2BJVA 2M6RA 4R1QA 1J2YA 3DFZA 3I3SR 4TX1A 2R5WA 3OLWA 1AUXA 1I80A 1UXGA 1UP4A 2BAGA 4UU0A 2GAFA 5KSZA 4AJ4A 1TQIA 4ZYGA 3DBVO 2TMGA 4KMUX 2PS1A 1G8PA 1JG7A 1KDPA 2YJTD 5D6FA 1F2TB 3OL3A 4A0QA 3VMMA 2O8CA 1TZ2A 5BT9A 1SHLA 2HDNB 2B20A 4QVIA 5BORA 4MWDA 3DOEA 1GFZA 3EYIA 4JS0A 5I6DA 4NBWA 3STUA 5CB8A 1AO0A 1LDEA 1G8YA 1IUPA 2AZ4A 4EI8A 1I1NA 3CT4A 2GEBA 1JKXA 3BT9A 1WZEA 4NZNA 1YE9A 4DRYA 2G82A 4RVUA 1DFGA 3K96A 3GFIA 4OIOF 3W1WA 2XMDA 1ZU4A 3CWQA 5DHAA 3ELUA 4J3JA 4MYRA 5K3FA 1NH3A 2WV0A 5HKOA 2ZBFA 1MXHA 5K3DA 1Z6YA 5JI6A 1OAOC 3NHPA 2OJED 4HBZA 4JBAA 1FFGA 1H5QA 4RMIA 4EENA 2JEZA 2VTBB 3ZQ4A 2B2CA 3VSBA 2B34A 4BUZA 5JD6A 1AHNA 1XS9A 2GFQA 4Y9SA 5COAA 4QBKA 2VLIA 4Y1FA 4EM2A 3TLGB 5HS4A 3SIWA 1WMDA 2OVBA 3MWGA 3K9FC 4WZZA 1RZRA 1HLPA 4MV8A 3HVUA 3BZKA 3ZWNA 2BMWA 3IB6A