1P4AA

Crystal structure of the purr complexed with cprpp
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
269
Chain Sequence
KFRRSGRLVDLTNYLLTHPHELIPLTFFSERYESAKSSISEDLTIIKQTFEQQGIGTLLTVPGAAGGVKYIPKMKQAEAEEFVQTLGQSLANPERILPGGYVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPLAYAAASYLNVPVVIVRKDSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLVEAEGVDERLVDEYMSLLTLSTINMKEKSIEIQNGNFLRFFKDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pur operon repressor
publication title Functional dissection of the Bacillus subtilis pur operator site.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 77
structure length 269
sequence length 275
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
A PF09182 PuR_N Bacterial purine repressor, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p4aA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p4aA02
4JLSA 3CUQA 3GGCA 2O03A 1OPCA 5FLXZ 2M8EA 3ECHA 1KQ8A 1DQNA 1KU3A 1C0WA 1H9GA 2DFIA 2VBWA 5FLXK 4P84A 3GFJA 4P5OA 1LNWA 3KP4A 2C6YA 3OV8A 4LZNA 3KLNA 2RDPA 5KVRA 1YS6A 4BHPA 2W85A 3HTSB 1ULYA 2OU2A 3IRQA 4HZFA 4A5NA 5K1YA 3CLOA 1ZREA 1I6XA 5D6FA 4RGUA 4ENJA 1ZRFA 5CYVA 5F1RA 4U0YA 3VODA 2FXVA 1ZYRF 1UPUA 4I0AA 3F23A 2EV5A 3BZ6A 3TDUC 4LLLA 5D5VB 2DY0A 1QCDA 1J7KA 3O7MA 3GLXA 1ZG3A 3RPQA 3HRSA 2XHKA 5LGTA 2DW4A 4M73A 2XAFA 3QU6A 4RANA 3KZZA 2RNJA 2TDXA 1XGOA 2HYGD 3RKYA 1TW3A 4MTDA 2O6GE 4HF2A 2QQ9A 4RQAA 4QLCU 5BQTA 2PRYA 4IPAA 3EUHA 5JR3A 2ETHA 2STWA 3ABTA 1W5TA 2F5EA 3L2CA 4RACA 4P80A 1BOAA 2PI0A 2M1BA 2IA2A 3FWEA 1L1QA 1XZNA 4HLYA 2VBZA 2H06A 1G4DA 1R5HA 3MZYA 4HBLA 3MCZA 4WF2A 5BQOA 2IGBA 4L0YB 5FFZA 2H27A 1HKSA 2DLLA 3RJPA 3FX3A 3H92A 1WQ2A 4KN6A 2HOEA 4IXAA 2MH2A 3GVAA 4U88A 3IRRA 2OA4A 5H6QA 3HRUA 2XAHA 4FX0A 4Y13A 1U5TC 5LRRA 3ZMZA 2F2EA 1B1BA 1TW2A 2GIVA 4IJAA 2H94A 3WGIA 3JSOA 2L01A 3QRFF 3HTUA 4L9JA 1BC7C 3EFHA 2G9WA 3BROA 4L0ZB 3Q9VA 3F3XA 4MB6A 3R60A 4G7ZF 2K27A 2XROA 4EJUA 4EVIA 5HLIA 5CVJA 2XASA 1T98A 4HAMA 1RUOA 1QNTA 3JW4A 4ZYEA 3DFGA 5L3EA 3DF8A 2RVCA 5H6RA 2STTA 2CSOA 4OHCA 2GQQA 4YFNF 1RUNA 2LKPA 1QK3A 3KETA 2IPQX 2XKOA 3CO6C 1CF7A 3IC7A 5LRSA 2HCRA 4PCQA 3BJ6A 1CJBA 5ILUA 2KRFA 2BYVE 2GZWA 1P6RA 4G6DA 4M0KA 1FSHA 4PZJA 3MZHA 2HR3A 4N0BA 4P9UA 4LZAA 3K1MA 4MQ9F 3DEUA 1FZPB 1QK5A 1FBSA 5AIQA 1I27A 5LGNA 2KIFA 3T8TA 4P86A 2WWYA 2OD5A 1LVAA 1FX7A 3WTUC 3VOEA 4CZZA 1W7PA 2HGCA 3DPTA 4G9YA 1Z6RA 3C7JA 2EHJA 2DU9A 5E17F 1U5TB 2VOOA 1ZN8A 1GVJA 2P1ZA 3R61A 1XTUA 3SXYA 4A0XA 1P18A 3FMRA 1MDMB 4OIPF 4H0EA 2L54A 2JPCA 3NEUA 1ZH5A 4UVBA 4M72A 2ESHA 1MGTA 2CO5A 2BBYA 3K1NA 1BIBA 1STOA 4IVNA 5CVVA 5K51A 2C4KA 2A6HF 2FF4A 4LK0F 2Z33A 3P9CA 3FHZA 3GUDA 1J2XA 4XBFA 4LB6B 3K69A 2A6EF 2E7XA 4HV5A 1O57A 4JBAA 2JKZA 1MZVA 1JGSA 4ZZDA 1ZHFA 1A4XA 1XCVA 3VFZA 5LLQA 1Y0BA 1A97A 2VN2A 2WTEA 1F5TA 2FMLA 4OMYA 1WKMA 3H3UA 1T2KA 1XN7A 2H6BA 3RYRA 4RAQA 1QO0D 1K7AA 1BI2A 2ACJA 1I0IA 2MH9A 1BD4A 2D2WA 2PMHA 3J81Z 3GZ6A 2M5WA 2DPUA 3OZFA 3J81K 2E55A 2XGXA 3IWFA 3E97A 2VODA 1XMKA 3JTHA 4RGRA 3JAMK 4P81A 3HVUA 1XSDA 1G6NA 2FU4A 2WC2A 4QRIA 1PUEE 4OU0A 4OIOF 3L00A 2H07A 2ZJ2A 1RI7A 1ZN7A 4ENKA 1OMIA 3PFIA 4HX4A 1YIOA 3N4MA 4Q47A 1LEAA 4GYIA 1TNTA 4CO8A 4M0PA 4BH9A 4MQVA 1AO0A 1P4WA 5FGMA 1JXSA 3I59B 4I0BA 1IXCA 3GWZA 5BSKA 4CDGA 4HX7A 2L4AA 2X0LA 1DP7P 3P7NA 4WK8F 4ENMA 1K78A 5E18F 2V1DA 1A04A 1R36A 3MBIA 1SFUA 4Q48A 5H20A 1LH0A 1Z91A 4Z2YA 4XLNF 1G9SA 1EH8A 1MD0A 2VT2A 3MFKA 4G7OF 3R6SA 1XB4A 3NQOA 2YZKA 5LHGA 4ESBA 3MAJA 4EJVA 1U2WA 5BQPA 2ESNA 3I53A 1MJAA 5KK1A 4ZZLA 5BRNA 1UFRA 3SFZA 3GFIA 3RPUA 4M9XA 3RKXA 2QWWA 2HYFA 1P2FA 2E1CA 1OROA 4RABA 2O61A 1YS7A 4KICA 2OQGA 4EM1A 2QBYB 5LEJA 2JRTA 1QZZA 1TQPA 2EK5A 1YTYA 4YIFA 1KU9A 5A2QZ 4U7BA 2MD5A 5L3FA 1VTNC 5A2QK 1L3LA 2PFBA 2KJBA 5DD4A 1G3WA 3GEZA 1HW5A 3ZMVA 1IUYA 3G6WA 2IJLA 2ZBKA 2H6CA 3Q5FA 2YX4A 5F64A 3LSTA 1S3JA 2EFQA 2JZYA 2PBIA 4LG0B 3R4KA 1G3YA 1U8RA 1FSGA 3CTAA 3GFMA 1YFHA 4M0UA 1PP7U 1QZYA 5L3CA 2FBKA 4G7HF 3ZMUA 3MJDA 2MLGA 5JVTA 2B0LA 3FMSA 2HFHA 2QM3A 5HDKA 2FBHA 4IHTA 3F8CA 2ELHA 3LWFA 4KMFA 4MTEA 2A07F 3DAHA 1FT9A 1FOKA 1WSUA 4WN3A 3CUOA 1TTYA 5ESXA 1B4AA 5IT3A 4UVAA 1V9SA 4KT5C 3O2PE 2WNSA 2OZUA 1G2PA 4ETSA 5CVRA 3V8KA 4AIJA 2VC1A 1WI9A 2VE9A 2Q0OA 2GWRA 3SQNA 1W30A 2FXAA 5K5QA 1OR7A 1IN8A 2DQLA 2XKPA 5CLSA 4G8XA 5CJ9A 3J80Z 4AIHA 1EH6A 3I4PA 4HF0A 3WTWC 5DDGA 4HQEA 3J80K 1H9TA 1WRJA 4KFCA 1Z7UA 5ILSA 2NRAC 1B9NA 3B73A 5AONA 2CGPA 1H0MA 5ICEA 3E3VA 5ED4A 3TO9A 1ZGJA 3G3ZA 1D8JA 5DCMB 5ICFA 4PGGA 2ISZA 3DKWA 2XAQA 1XCBA 5HLGA 1FWZA 5K5RA 1FBQA 3KLOA 3LAJA 1SAXA 1LEBA 3CUQC 3ROUA 2LDUA 5HDNA 3GYHX 5AIPA 1CGPA 5HLHA 4Z1OA 4P9FA 2EFWA 4UV9A 3HOSA 2VONA 4CICA 2QLZA 5E1WA 1LQ1A 3BDDA 4BHCA 1G3SA 1T39A 1SD4A 3HSFA 5J8FA 4LYYA 1ZRDA 4LD5A 2QYOA 5D4RA 3F21A 4KDPA 3HIFA 4NQWA 3FXRA 5ESWA 5JI6A 4M71A 4PFQA 1U5TA 3HYIA 4PAWA 3HSRA 3DQVC 1FYLA 2QENA 3Q9SA 4M9ZA 5LHHA 4ESFA 1VSTA 1U6GA 2MLKA 3B02A 2M30A 3I64A 5BOXA 1I5ZA 3N2LA 2A5YB 2O8XA 2HZTA 3QW4B 3LRTA 1KU7A 1XMAA 3MQ0A 2OQRA 2P7CB 2DQRA 1I1SA 4KYWA 4BHBA 3GGJA 4A5MA 4EJWA 1FYMA 4RV4A 3KE2A 4KIFA 4L9TA 3WTXC 1I0LA 4P83A 1WWXA 4N9HA 2PG4A 3E6BA 3BJAA 2VXZA 4Q4ZF 3WGHA 2O3FA 4ZFNA 3TGNA 3O6BB 1XDUA 1XSVA 4GO1A 1R3UA 3JSPA 3CUQB 1YW8A 1O3RA 4RHTA 2M87A 2ZMEA 1FPQA 2PEXA 4GGGA 3I58A 4M9SA 2VC0A 2UXXA 4LFUA 3TQNA 4E70A 3M8FA 2V6CA 3L9FA 4B8XA 4WXDA 4ASNA 2KKOA 4I7HA 3KP7A 3WU1B 3VEPA 2P5KA 3M8EA 5CVUA 5DD8A 1O3QA 2IA0A 4I2OA 3GF2A 5J8CA 2FSWA 1GRVA 4U0WA 3T0YA 3QP5A 4LMYA 1HMPA 2V9VA 2W57A 3OHPA 1BZYA 3C1DA 3BY6A 3FXUA 4D0PA 4IJQA 3ZMTA 4ESJA 3I59A 2LF7A 1ZGAA 3V7CA 3M3HA 1E17A 1DBRA 1XSXA 5D4SA 1BI0A 2GXGA 4CYDA 3LAPA 1JHFA 3PQJA 1OYYA 2D1HA 1V4RA 1P17A 2ZO4A 1R23A 3AAFA 1ZRCA 4JITA 2OZ6A 1FY7A 1O7FA 4HW0A 5BMZA 4M6YA 3SZPA 2M45A 1BN5A 4WXHA 2CQKA 2RQPA 3EDPA 3EYIA 3FM3A 1SMYF 1ZLKA 1Z05A 1HQCA 1QCCA 4HYEA 4B09A 3GW2A 2AS5F 2JT1A 1S7OA 2HEOA 3NAGA 1YYVA 2P5VA 4KNYA 4O6JA 4XSXF 3OZGA 1LJ9A 2NS0A 4U0VA 2A69F 1YG2A 4G6QA 3T5XA 2NNNA 4XRFA 1USTA 1MKMA 3F8BA 3K9TA 2XIGA 4QYIA 3ABUA 3MWMA 3ECOA 1D5VA 4A12A 2K7LA 1B6AA 2Z5UA 1JLSA 1XZ8A 4RHXA 2OBPA 2H08A 3N97A 3V7SA 5IT9Z 4ZYDA 2HQNA 1DDNA 2H09A 5IT9K 1P4AA 2QUFA 4HA8A 1QGPA 4XSZF 5HDGA 3FZVA 3JAMZ 2V79A 2DBBA 4YIIA 1ZARA 5E8IA 4EM0B 2JBHA 5ERIA 5EEHA 1P92A 5K5OA 1E2XA 1GXPA 6PAXA 4LG0A 4O3MA 3RKWA 1R00A 3M7GA 1RNLA 3LQRA 5JSQA 5E38A 1CF7B 2ADUA 4ON0A 3WTYC 5LGUA 4HV6A 1VCHA 2ISYA 1B9MA 4HDVA 1HW2A 4RAOA 2NNYA 2JSCA 1TC1A 3WG9A 1PZMA 3GX4X 4L9VA 4IRHA 1F4KA 5DV5A 1QB7A 2K4JA 2EA4A 1A95A 1KYZA 4FHTA 1DPRA 2W84A 1A3CA 4KIBA 3BOQA 5E1ZB 4YFKF 4KIGA 4WX9A 1QK4A 4RB3C 5BPDA 4WCGA 1BJAA 4P82A 1O3TA 4I02A 1BD3A 5J6XA 3OOPA 3F6VA 2RV8A 4LJZF 1W7PB 4FX4A 4UHTA 3IWZA 2XAJA 2IRFG 4KN4X 4RQBA 4U7DA 4RHYA 4ZYHA 1XGNA 1HXDA 2FEZA 2O0YA 5JHUA 4RAZA 4KMUX 4MEXF 4I01A 3KZYA 2BEOA 3EETA 3M9AA 1OYIA 1VDMA 2DO7A 1ECBA 4UXNA 2R7FA 4X44A 1OREA 4S05A 4R1HA 2FA5A 4RAYA 4PGHA 2YR2A 1XGMA 3KP6A 3D5LA 3O3KA 3ZMDA 4XLPF 5CVIA 3ZMSA 1NONA 2ZFWA 2FNPA 1TQIA 1D8KA 4IRIA 4LLNA 5D5WB 1FC3A 5F6FA 3F22A 2VBYA 1P4XA 4OMZA 1YFZA 1LDDA 2E7WA 1R58A 1R1VA 2EB7A 1BI1A 1Z9CA 1IXRC 2FOKA 3WTSC 2WV0A 1ZG1A 3DMPA 1OKRA 3V8LA 3KB8A 1FP1D 3RI4A 1HBXG 1S29A 1IW7F 2GXBA 4YG2F 2VBXA 5D6EA 5ICGA 3HSEA 2QQAA 1R1UA 3ZPLA 1UHWA 5DUKA 2HS5A 1I13A 1YQAA 3ACBA 2PN6A 3DPLC 4X45A 3WTVC 3E6MA 4P55A 4UNOA 2FE3A 2YX7A 1UCRA 3M1EA 1TQMA 1J59A 3ERED 3S5JA 2IW5A 3QU3A 1OYWA 2HQRA 4EV0A 1UB9A 4HF1A 1DUXC 5FD5A 3K1PA 3F72A 4WMLA 3SZTA 4A0ZA 1G3TA 2RN7A 3T8RA 2UWMA 1QQIA 3DV8A 2AEEA 4MEYF 3U2RA 4YFXF 2CFXA 4Y15A 2FQ3A 4FYMA 1JE8A 5HOOA 1SD5A 1FSEA 1IXSB 4TV7A 1AWCA 3BPXA 2Y0MA 3H3ZA 1GHCA 5TRDA 2P6SA 3HRMA 2ZXJA 2DI3A 3RYPA 3S2WA 3E5UA 3ZN1A 3V7RA 3TOBA 2UZKA 2CW0F 4LGWA 4K2EA 2IT0A 3BWGA 5BS6A 1QPMA 1K78B 2PRZA 1J5YA 1QBJA 1DPUA 3V4GA 4WXCA 2BGCA 2P4WA 4GYGA 2VT3A 3ZQ7A 3BP8A 4A6DA 1AOYA 3U9GA 5HS7A 3HRTA 1HSJA 4Q5SF 1FLIA 3LA7A 2K4BA 2QQBA 1HGXA 4IHSA 4A0YA 3QAHA 3FM5A 3P9IA 3HHGA 5E8GA 1R1TA 2GAUA 2X4HA 1G9TA 3C3WA 4I98B 5LBQA 1Z7GA 1V3FA 1F1ZA 2FRHA 4R8HA 5FFXA 4GCVA 5D5UB 1D3YA 4MNUA 1JHHA 1HW1A 3PQKA 2HDCA 4HDUA 3EQLF 1W5SA 4G94A 2F5CA 2QVOA 2E1NA 1GXQA 3ULQB 2P5LC 3HUGA 1I5EA 2FMYA 1ZN9A 4DQ2A 4EMSA 3GZ5A 1T6SA 1ECCA 4UVCA 5DUIA 5TJJA 3LPNA 2FNAA 4JQFA 3DP7A 4L5JA 4MGRA 1D6NA 3ACCA 1TC2A 4M74A 4S04A 4R79A 1USSA 1B59A 1IAWA 1TBXA 1LDKB 5D5XB 3P9KA 1IN7A 5FB2A 1U9ZA 1MDMA 2L4MA 1NHAA 4BYYA 2RC4A 5FD6A 4ZH4F 2EWNA 1T38A 4AIKA 1O3SA 1XTVA 2NAZA 4OINF 3KP3A 4EGZA 3ZP5A 4RB2C 1YW7A 1YLFA 2HTJA 2XV4S 3IKVA 4HOBA 1FYKA 2ZNZA 3E5XA 1U3EM 4Y17A 1FP2A 3ELKA 3F8NA 2G7HA 3TO7A 4WWCA 1BC8C 2HTSA 4NB5A 2CYYA 2EFPA 4LZOA 3LA3A 4KUMA 3R0AA 4NHJA 5HKLA 5ILVA 1ZAOA 3KEQA 3ISPA 5JV5A 1ECGA 1HKQA 3L7WA 4EJOA 1ECFA 2Z9OA 1YW9A 2F5FA 3VB2A 1GPH1 3TOAA 1REPC 4IRGA 2PQ8A 2EV6A 5HS9A 3REOA 5E20A 3EYYA 2Q2EA 2VE8A 4RS8A 2PLYA 2GA2A 4CXFA 1JLRA 1PP8F 4BQAA 3SHFA 4A2UA 1XDSA 1ZLJA 3TKYA 2DK5A 4L18B 1P19A 2EFNA 2L02A 3JTGA 2RGVA 4I09A 2A61A 1KYWA 2G7UA 2COMA 4EM2A 2CG4A 1J7JA 2GA1A 4LYGA 2A68F 5HVQC 1J9IA 3G73A 3NRVA 2F5DA 1XD7A 1XGSA 1K6OA 1DKRA 3GEPA 1IZ1A 4HQMA 1ON2A 1FNNA 1ODDA 2DK8A 1L1RA 1T0FA 2KIUA 1KQ0A 3I5UA 1DKUA 2UXNA 3BPVA 4FT8A 4F8EA 2PJPA 1Y0UA 1OPRA 5FO5A 2J5PA 2ZNYA 1EV7A 5HIAA 4N9IA 1R7JA 4KA4A 1O5OA 4OOIA 1Z1DA 3WTZA 1DQPA 4QWQA 3WTTC 3WE2A 1IRGA 4TWBA 4PDKA 2IVMA 2XAGA 3R0JA 3TDZC 2IP2A 4ENNA 5L3GA 4OIRF 1UFMA 4LB5A 2OAZA 1WD5A 4BNCA 2YU3A 2XUBA 2XRNA 3V8JA 2W24A 5L3DA 2DPDA 1IN6A 5DEQA 3RIRA 1KA8A 3QPTA 4GXOA 2W25A 2MBFA 3FMQA 4MHGA 3IHUA 1IN4A 2D45A 2YSRA 2QBYA 2P6TA 2EJRA 5IAOA 3L09A 2A3SA 2AXLA 3J7AO 4S2UA 1BI3A 1LDJA 1TNSA 4RB0A 4P96A 3ML6A 3FXQA 1TLHB 2MC3A 1G2QA 3CJNA 1ON1A 1XTTA 4LK1F 1I14A 1W4MA 1STZA 3HOTA 2JI4A 2PS1A 1IF1A 3W6JB 3U1DA 2FBIA 4P3KA 3KFWX 3LQQA 4EQQA 3ZN0A 2KIMA 2ZMEB 4OIQF 2K86A 3E5QA 1IBSA 5DCFA 2R7DA 4AD9A 3IKTA 2Y48A 1SFXA 2HKXA 3WODF 1ZN2A 3C18A 1QB8A 1S7AA 2Y75A 3E6DA 1I1GA 3I0TA 2Q8KA 3COAC 1PDNC 1U9YA 3GO5A 3RDIA 1L0OC 3CDHA 5LEKA 1ZG5A 4RGXA 5D8KB 2VFAA 4RADA 2Z3YA 4HX8A 1J75A 4KN7X 3KEOA 3MEXA 2EFOA 2LF8A 2V1XA 1J0RA 2BV6A 3I54A 2L3DA 2NYXA 4M6XA 5LHIA 2IA1A 2P7VB 4EGYA 3WE3A 1SD6A 3F8FA 5E1XA 3H83A 1SFEA 3IL2A 2GEBA 1EH7A 4RGSA 4ZYGA 3F6OA 1RZ4A 2XVCA 1IN5A 2DAOA 3QOPA 4O5VA 4RB1A 3WU0A 3TO6A 4RHUA 1R5GA 2EV0A 1ECJA 3DEZA 1IRFA 2QZ8A 5HS8A 3D0SA 4JK1X 3W6KB 5BPIA 2JPBA 5L3BA 1BIAA 2RKHA 4L9NA 3HHHA 5IPFA 3ACDA 1X3UA 3KCCA 1K79A 4A6EA 2YPRA 1A98A 5DCMA 2PMUA 1UPFA 5DYMA 4F7ZA 3BJOA 1MJBA 1U78A 2VOPA 2J5OA 4AWXB 5ICCA 3K2ZA 4IF4A 3DXJF 5D8LB 3E6CC 1MJ9A 2DTRA 3KP2A 4L5IA 1FBUA 4QYIB 2HWVA 1SD7A 3I71A 1F9NA 5KAPA 2MA3A 3QPHA 4HLXA 2JKYA 2LSOA 3KP5A 5EUCA 3QP6A 2ZCWA 4EJTA 4UUVA 1W7PD 1R22A 1A96A 1MZBA 1KQ9A 4UV8A 2Z99A 3GFLA 1NULA 3T1BA 3CO7C 1RIOH 3LFKA 2R3SA 1HSTA 2LNBA 4AVPA 1S8NA 1BBYA 4DNCA 2CWEA 2DT5A 1Q1HA 5EEGA 1Z6TA 4LLGF 2D1VA 2V1UA 4BAYA 4CHUA 1KU2A 2XBUA 1S6LA 1SMTA 3K0LA 3RTRA 3GXOA 1ONVA 4BXUA 5KAMA 2BE5F 2JTVA 1LB2A 1HKTA 1O7LA 1BM9A 1KGSA 3LA2A 2HKOA 2P8TA 3WGGA 3F8MA 5JFRA 2KJCA 1UHMA 2K02A 4CGZA 2EA2A 1YO5C 2ZKZA 3FF5A
chains in the Genus database with same CATH superfamily
5IX8A 1LZLA 2A9VA 5EJEA 4UKDA 3EPRA 1GNTA 1JVBA 3GFJA 2MR5A 1FOXA 4BB9A 2XZDA 3QXJA 3RF6A 3W6NA 1O6FA 3ZDBA 1L8AA 2PPLA 4BNXA 2ZJFA 4A5NA 4YMSA 1VMAA 1CCWA 1JIXA 4DL9A 4OMFG 4L9SA 1QQBA 3MWJA 1FF9A 4RZ2A 2PBZA 1YHZA 4CLEA 3I9V1 1T2EA 2WU1A 2H0RA 3EIFA 1SHUX 3U6BA 3TLZA 1OQAA 5JQGF 2XTMA 4Q15A 1UFVA 5EIOA 4IDDA 3PQ4A 4QO7A 1AK9A 2V54A 2CMKA 4HSRA 3AQIA 1I24A 3FKSA 4YIKA 3S70A 2B3DA 2JHGA 4FE3A 2O8DA 5FF9A 2AGVA 4O2AA 2VDLB 5E9JA 5HKOA 1RQNA 1A8SA 3I1IA 1V6SA 2VBZA 2FKNA 2MGQA 3B6CA 2HT6A 3GCMA 2FK8A 4MR9A 2M7AA 4CF6A 3CBGA 3HJGA 3NHJA 2ID4A 5AI4A 2I7VA 1U5AA 1U31A 3EXG2 1W76A 4XVQA 3GVAA 2FA9A 3PNLA 1LVUA 2XAHA 1FEZA 2XGJA 2IGKA 4AMYA 3L7BA 1IXZA 2OO5C 4B32A 1YRAA 1Z4QA 4ZMBA 2DP4E 2QJRA 4N4AA 3H16A 3KUUA 1ZIXA 4JLDA 1ZINA 4BPRA 1W88A 1GPUA 2C3OA 3BHJA 3MKWB 2FRVA 1AS3A 2ANCA 3Q7PA 3ZY6A 3IULA 1AQYA 2V0NA 4BNJA 10MHA 3OC0A 5A4FS 3ZCQA 2GQQA 2J3KA 4UU1A 3PTAA 5I5EA 1QK3A 1E4OA 1UDRA 3D1JA 1ST3A 4Y6OA 4GXTA 3CLTC 3GMSA 5LRSA 1YNSA 4GI1A 5H9VA 3P2KA 4XLCA 3TE7A 1Z3YA 1ZXBA 1LTHR 3BJ6A 3H2GA 1KFJB 4YALA 2GZWA 2YJ5A 3SDZA 3MZHA 2G1KA 4KWEA 4N0BA 4P9UA 3EGOA 3O8OB 4NARA 1SKUA 1TYAE 5I7RA 1DAKA 5T8KC 3LDFA 3BG6A 4WUVA 3UUWA 4KR7A 2IH5A 1I6MA 1J21A 1G17A 5E17F 5K4HA 3EAFA 1SCUB 1W52X 1C3OB 1P18A 3EH2A 2CXSA 1T3SA 2ZIXA 1VJ1A 1LPMA 2CO5A 4IHJA 4RD3A 2JFBA 2ZC2A 3NNSA 1M8FA 1E6EA 3EF3A 2W43A 3IAM6 3JYQA 5CB6A 4D41A 1XZMA 1UMBB 4F9GA 2PD3A 4P0PB 5BNFA 4EY7A 2P65A 4BGEA 2OXRA 1Y81A 4GXNA 4OJMX 1U2DA 2ONCA 3IELA 4TQGA 1WZEA 4LJ8A 3SYKA 1XN7A 4YAEA 4K2HA 4AJLA 2Q3HA 3SR3A 3DEIA 3GZ6A 2IXDA 5HG0A 3OZFA 3AEKB 3J81K 3LXXA 3SWWA 1UBRS 3FTPA 3C16C 2OFFA 3UJPA 1ZGCA 5E3MA 1G8KA 4E5SA 3JSAA 1EIZA 3IIKA 1H9BA 3K7AJ 3KLMX 4BFUA 4XNFA 2AMVA 2BFBB 3BRSA 4E4RA 1TVEA 3SE0A 1VG9B 3PQ3A 1Y1WJ 4UDYX 2ZG6A 3ZHXA 1X7XB 2BFAA 1P4WA 3OZUA 3KWMA 1IXCA 1AOXA 1DIGA 1DP7P 1Z6QA 4DB2A 3UJDA 2VO1A 4M2LA 2ES4A 5LKAA 1XR3A 1SCAA 2HPZA 2Z3ZA 1V96A 3ZE7A 3MBIA 1JSRA 5CT6A 3KD3A 3LCJA 4XDZA 1LH0A 1Z91A 3RC1A 4TSRA 3MG9A 3EFBA 2VF2A 3CJQB 3K0HA 3WHCA 2OLKA 3MAJA 1BOOA 1II0A 5BQPA 3ANYB 3EUKL 2A4KA 1MJAA 1GTVA 4Z99A 5AQ1A 5K0JA 2FF5A 5HR5A 1YQXA 3VSAA 4X94A 3BDAA 2E1CA 5LMUB 4J1NA 3L02A 7GPBA 1KR5A 5GV8A 1JXAA 1GT91 1V1JA 1OQYA 4J3NA 4REOA 5LQRA 1OFIA 1RJWA 2QORA 4X85A 2BMFA 2ODTX 4IF6A 1CRPA 1UANA 3F8WA 4Y9RA 2A9KA 2MYTA 1ZD4A 1FP6A 3U4DA 2K9QA 3CONA 4HDQB 1BA3A 3SEQA 2UZ3A 1QHHB 1DRJA 4OHRA 4DF3A 1TD1A 4LG0B 3PNYA 1EFPB 1UEXC 3LPCA 1G3YA 3USZA 8LDHA 4C01A 2AD5A 1F06A 1WUTA 1PP7U 4GX1A 1E1MA 1MO6A 3MJDA 3CNQS 3H35A 1ZNZA 5BW4A 1QG2A 2HFHA 5CW1A 2OCEA 1N6RA 4DLAA 4B7UA 5A4AA 1OZGA 3N70A 1P1HA 2CNWA 5JBQA 3HBJA 2CVOA 1FOKA 4FUTA 4EVSA 4OOEA 3H9JA 4DRZA 2CQNA 4EKNB 2ADFA 3CMYA 1TMOA 2WAEA 3OCCA 5M34A 3GVIA 3BMXA 4OTZA 3V8KA 3G6EI 1PX2A 2XADA 2VC1A 4MRVA 1TB4A 4UMVA 5K05A 2FWNA 3AR5A 3UR3C 1DZ3A 3SLGA 4KZPA 1Z4OA 2XB0X 2ATCA 2GFIA 1R9MA 2W0SA 2Q5LA 4M86A 2OKCA 1IBCA 1RR8C 3U4GA 4DADA 3R6LA 1HDEA 3UXYA 2AEMA 1W4ZA 1H4QA 1BFDA 3DDSA 2ZUWA 3EGWA 3D54D 5D1NA 1FOYA 3QLVC 4LGCA 3V8MA 5B1DA 1CBUA 4ZU3A 4YAFA 2FSVC 1XGKA 4OK6A 3KT6A 4MV7A 1Z22A 1IIBA 1L1FA 5JPCA 1LEBA 3EQ7A 3OCJA 2FR0A 3AZQA 1ZAYA 4HLUC 3RS3A 2ZQYA 3HOWJ 3MUEA 2P9JA 5AD1A 2JJ1D 1LI5A 2EH3A 3TW6A 2ZE7A 3V9AA 1IHDA 3DEKA 3E9ZA 4L5BA 4QOJA 3B2QA 1PF7E 2PKRA 1WPKA 1ULZA 5C7IO 4XJVA 2QW1A 3M4JA 4PR3A 1RHJA 2R97A 3OBBA 1NN1A 2PV0A 2A67A 4J7UA 3R3WA 3QH4A 4ZC8A 1RXEA 4QATA 2ADMA 4KK3A 2PQ2A 4UAGA 3BJRA 1W5FA 2AF4C 5KYWB 2YCBA 1LBTA 3B82A 2J85A 3U60B 1U6GA 2W7TA 3I64A 4UHKA 1TF5A 5IYZA 2Z04A 1E2BA 1Q21A 2P9EA 1Z29A 4BHBA 2VYND 2P8JA 4RV4A 1CY8A 3H7IA 2K5CA 5LNK6 5K0FA 1PNQA 4A3IJ 5K03A 1GQOA 4Q4ZF 3HV2A 1TA0A 1U3DA 4PU0A 3C3AA 4PG5A 1ADCA 3GGGA 5EQTA 3V8EA 4LWQA 2OBMA 3AEZA 4UUAA 4YT2A 1NRJB 2VC0A 3ROFA 4EO9A 2FPXA 2JCSA 2P6MA 1PYDA 2A1UB 4ASNA 2WYVA 1PQYA 1YMQA 4YAIA 4XM2A 5KX5F 1MEOA 2W2XA 1PK9A 2IA0A 3QU5A 4NXMB 1LFUP 2LFBA 2WJPA 1L8LA 1KDTA 1CB7A 2XKBA 1FNSA 3K5WA 3QPAA 1E0AA 3AV0B 4MW5A 1YAHA 1N34B 1W96A 1P3DA 4IJQA 5BO5A 1WW3A 3RZOJ 5EWLA 4XGQA 4IUCS 3FPSA 3R4VA 4NBKA 5ITZB 4BRSA 2CRGA 4YCAA 3RU7A 3UH0A 3TJMA 3T1NA 4E3WA 2OUIA 3KXPA 1DT5A 1MJHA 3I1JA 3T95A 1K4TA 4HW0A 3PL8A 2VKTA 1BN5A 3RFUA 4J4HA 1U65A 4HUJA 5G41A 4UB6C 3JVVA 4H1TA 4Q7LA 3I9LA 3KQKA 3M1YA 4J94A 4I4LA 4IRXA 2EDCA 2R5YA 1L9KA 2RGAA 5K09A 2RFLA 1Q0ZA 3FB4A 1E3WA 1FYEA 3FIUA 3O8NA 1W19A 5F2NA 1GQYA 3K1JA 2PT7A 1AZLA 2FW9A 3U4IA 2NPIA 2WB1N 5LQSA 3LKDA 1EVIA 3MWMA 4YN3A 4XJTA 2OBPA 2RG1A 2R8XA 3PFFA 5EZGA 3DVAA 1T5DX 2Q2EB 1G20B 5CB4A 5HRAA 1YXMA 3HGYA 1OYOA 1G3UA 4E7HA 1P4AA 4TYMA 3K70D 3K6KA 4JZKA 2RGRA 3FZVA 4KGXA 3CZPA 1QQTA 2DBBA 5K3SA 1IB6A 2XTNA 4MWBA 3RUDA 1QIJA 3P2MA 2VJAA 2Q6OA 5KAIC 1ZJ5A 2VP2A 4KQMA 1J2RA 2QU7A 1G8GA 4BXOA 2B6HA 3ODGA 5C34B 1SB9A 1XZKA 4DYHA 1FXWF 2OSVA 2H6EA 3WB2A 1VJRA 1EBBA 3LLVA 3P4UA 2JK3A 1OB5A 3N74A 4C6RA 1RYDA 5SYNA 3W5AA 1YU6A 3P20A 4PSVA 1WXDA 4X65B 4FHTA 3L9XA 4RA6A 3FE2A 2HSDA 1ZFNA 3AEXA 4KNWA 3VJLA 2G0TA 1TFUA 2W6ZA 2XZOA 4IIXA 3UXHA 4E6PA 5JCOC 13PKA 4RNDB 4JEUA 3JAMA 1EBFA 4NK4A 1RJ9A 2CCJA 1MC8A 3CCSI 4XR4A 4ND3A 5CFRA 1NU6A 3ZS8A 4HATA 2FQ1A 4B3IA 2AQHA 2F9MA 3V4LA 5BYKA 2R65A 3W7AA 1PGQA 5K1ZA 3QOXA 5BMVF 2B0CA 3JARA 2V98A 1KO4A 4Q12A 5BQ5A 4V2FA 5AOCA 7MHTA 3ID6C 4V0QA 1JFVA 1QQ6A 4FDMA 1R1UA 2FWAA 3MZ8A 4I3FA 5EZSA 1V45E 4HDMB 1JQAA 3HBFA 3SX2A 3AVOA 4UNOA 2FE3A 3ZWQA 2B37A 1HE2A 4IJKA 2BEKA 3QEMB 3TLYA 4ZVPA 3PM1A 3AM1A 3F4KA 1FBTA 3KQQA 4YQFA 4FHCA 4RFSB 1G3TA 1PV4A 3HB9A 4PW0A 2IGMA 4FHGA 1T4CA 4JL5A 3U2RA 1SBZA 1F9EA 2CFXA 4L9WA 5CDFA 3CBQA 4CKXA 4R8KA 2GB4A 1G8HA 3NXKA 1FFWA 1USVA 2PRJA 2IDKA 4LIPD 4MWTA 1U2TA 3QVSA 3T61A 1K8YB 4HXYA 2A6PA 3BWGA 3QFFA 2D6FA 1ISMA 4QUKA 1HA3A 1YQDA 2VJNA 1X7ZB 2DFNA 3T3DA 1GZ5A 3TTSA 2I62A 4FKZA 5LIRA 1B6RA 4NNOA 1XU7A 3LA7A 4OHZA 4IHSA 2C1XA 2WSMA 2O14A 4PRYA 2CZCA 4BB0A 5LBQA 3GAAA 3LQ1A 2EJUA 1ZCBA 4EM6A 2UXCB 1FQOA 3D3WB 3ANMA 1W35A 3KFLA 1ZM7A 1RCUA 3TLGB 2CXPA 3C2HA 4A73A 3LT2A 2ZAOA 2B1GA 4L85A 4Z9YA 4G0MA 2G9VA 2OPBA 3UICA 3HZOA 5EHGA 2IEKA 5HBRA 1NJ5A 1SKQA 5SY6A 5KNDA 5ISMA 1M72A 5J9FA 3LBHA 3CRMA 4ZYWA 3B9RA 3WNZA 4S1NA 1VBFA 3LBYA 2DJIA 3LPNA 2M3AA 4AZ3B 4L5JA 3N2YA 4WIAA 3PPIA 3F71A 1EGVB 2YTZA 4FJ0A 4F6LA 1BJZA 2BFCB 1FIUA 1T9GS 4HG2A 3JU3A 4KJXA 1AMOA 1KQOA 5D5XB 3P9KA 1UEIA 3R8CA 4AYXA 3RREA 4JJFA 3NJ8A 4EFKA 2Y1DA 2AZ4A 3U3KA 5CFPA 1SIOA 3I04M 5K0SA 5HJ7A 4IQ0A 4AN4A 3ZP5A 3R8FA 1YW7A 3NEAA 5I7UA 1S3SA 5HZMA 1N77A 1IOZA 2G7HA 3TO7A 1NVKA 4WFKA 3UHPA 1FB5A 4CCOA 1FZTA 3X1ZA 2FSGA 3GJ3A 2QXUA 4Z7QB 5GY7A 3NATA 1ZAOA 3ISPA 4WT7A 3LDHA 2UZ1A 2ZK7A 1TKBA 4D56A 2HSGA 2F5FA 2PS9A 1VQOI 4DMGA 1QYIA 5D7BA 3S1NJ 3ZOZA 1CSEE 2WFZA 2A94A 4CZ2A 1ZOOA 4GYJA 4DC9A 1PP8F 4D9BA 3NHFA 3TKYA 1C4WA 3KVNA 3CX7A 2Z09A 2POCA 5ALHA 3I0MA 2WHXA 3GFTA 1XMVA 2IYUA 3G73A 3I3SR 1RFGE 3CLUC 1EWVA 1JKRC 1OMOA 1CRZA 1ZAKA 2Q5HA 4PFJA 4HLCA 3H05A 1VQ7I 5HFJA 2AFIA 3GEHA 2HFJA 2I91A 2FDXA 4NU8X 4N5HX 1PBTA 4I4TB 1P2UA 4KK4A 4KWHA 2AVDA 1CS0B 4Y9DA 1ZC3A 1NVMB 2QX6A 2J59A 3D4LA 1OLXB 1NLMA 5H7XA 4GVXA 2OZLA 4EUNA 1IZ0A 4DV7B 1V9LA 5DIFA 5JQGB 3EFOA 3V8JA 4DDMA 2PH7A 2BW3B 3M82A 1Q2XA 1IN6A 1KA8A 4GMKA 3F3SA 4BJHB 1HYEA 3BL6A 3QF4B 2WQ7A 1E77A 3COJA 2HA4A 2AX3A 1KK1A 5D5PA 1YB4A 4KLNA 1R6VA 3L09A 3LMKA 3DO5A 2R92J 1BI3A 5A05A 1G9XA 3TW7A 1SRRA 1THZA 1P0IA 3BN3A 3HOTA 2HPHA 5LR6A 1SBNE 3T3HA 3FCCA 3LOCA 3LQQA 4GX5A 3KZMA 5GONF 1N2BA 3D5TA 3HHPA 4FOOA 4N1AA 4RDCA 2AYZA 1V41E 1A9XA 3C18A 2Z4RA 3FUVA 2CZQA 3EEQA 1HH4A 5JTUA 5AP9A 3ZCXA 3ZWOA 1WJBA 2F4NA 3LW8A 2Y4OA 1J75A 2BSQA 1TEHA 5FR2A 3ITKA 1QAMA 5B55A 3UWPA 2FFQA 3KEOA 3CE6A 3WHBA 4CLHA 3EQ8A 1G5HA 4EGYA 1LZKA 3JQAA 3RLIA 2P6UA 1N78A 1D2RA 1OIXA 1YS9A 3PFKA 3JWIA 3N0TA 4G1MB 4ZIRB 4WINA 4LOIA 3IL2A 3R0QA 3IKLA 1EFVB 4RGSA 3IODA 2D5IA 3GEEA 5CX4A 2DAOA 3L5KA 4RHUA 2EV0A 1KYIA 5C5IA 3NBAA 2IW1A 5KB3A 3OYMA 3BWMA 4C0WA 3KOXA 2Z5LA 2REXB 3HSYA 2GDZA 4KU4A 4IKOA 2E60A 4QOSA 2YS6A 1KZGB 1YJ8A 3UNGC 4QOIA 1HLDA 3V7YA 3CZ5A 1AHIA 3KHUA 4CNQA 3A4CA 2E9SA 1JMYA 4PLPA 3HADA 2YX1A 2IYVA 3I61A 3CC4I 5A3RA 4JOQA 4WOKA 3THXB 2XUFA 3KKZA 3BORA 1Z6YA 4QLAA 5LQAA 4HLXA 3UK6A 3O2JA 1BW5A 5BV8A 1U9IA 4X92A 3ADCA 4V0ME 2J0VA 3HKCB 1ZH6A 4C5AA 1KQ9A 1TRHA 2Q8NA 3BGVA 5BOSB 2IUYA 4M9UA 1NULA 3ZDZB 4QOEA 2RGGA 4NCNA 3EK2A 1JGGA 5FBZA 4Q9DA 2CQQA 1X1BA 3DEJA 3OQJA 5JDCC 2B61A 3PWZA 4KFUA 5I9TA 1RWMA 1JNXX 1F2UA 5FPSA 4G8CA 3UB4A 2JGIA 4BP9A 4LVUA 1ONVA 4BXUA 1CFZA 3WL3A 2PX9A 2G9QA 2QMZA 3VNVA 1IAQA 1LFAA 4CKBA 5GAJA 2Q7OE 3KR1A 2BE7A 1EFLA 5DGIA 3WGGA 2PT6A 1EG7A 2PZKA 1C1XA 2JKVA 3HCAA 4DQUA 2ELJA 2ZKZA 1ENZA 1JHMA 4Q1EA 3ECHA 2OVBA 4AJNA 1DQNA 1EXNA 2DFIA 3AH8A 2X85A 2NZVG 2RHJA 1NG9A 4M60A 2J3EA 2W85A 1U0GA 3G8DA 3NHLA 1NUPA 1ZREA 1K89A 3ZLBA 5D6FA 2H2DA 3AJEA 3WTBA 1GRQA 5CIQA 5BR7A 3K16A 5F1RA 2WYHA 1CUFA 3MS7A 2DE0X 2CCKA 2FXVA 3VR0A 5BN4B 1UZNA 3Q4GA 2WHEA 1DC7A 3NBFA 5GVSA 2HRDA 4C4TA 5TQ2A 3ABLH 2M32A 5EP2A 3TZKA 4BE1A 3AEYA 4P7JA 2ZUVA 2B82A 2KZGA 3RVQA 3P9SA 3FI9A 1OXVA 3IHTA 1PFVA 3WS7A 2GQ0A 3HK2A 2WAQA 1JIVA 4X63A 1Y3CE 1YJCA 3I5YA 1PHRA 2EU8A 5EE0A 1M6VA 4PSDA 3TLAA 4Z4CA 1P73A 2YY7A 2FX5A 4ZOAA 5B3JC 3H0DA 1U0EA 4I1YA 3SJZA 2NVXJ 3UT6A 5CLJA 2IGBA 2DBRA 3BXEA 1ZMOA 4UXIA 7ABPA 3RJPA 5ELXA 3GJRA 1BC5A 4IEFB 4DNQA 1MDFA 4PN7A 4U88A 4Y6QA 2PT5A 2HA5A 1YJAA 3DZIA 4HH4A 4Y13A 3CCCA 4Q4JB 2WFLA 1JYSA 2PLFA 4J0FA 3PT5A 3NANA 3T1YB 4E2WA 3FNFA 4C2TA 1BC7C 3BROA 4YGYA 5A03A 3VDQA 4MO7A 4DXHA 4LKRA 1U7PA 1T98A 1DAPA 2TYSB 4F2GA 4G4JA 4MB0A 1YASA 3G2NA 1F2TA 2OHXA 1EVJA 1JQEA 1R6UA 4RESA 4N7JA 2D0DA 3MCTA 2HCFA 3WX0A 5FUVA 1VYTA 4LMRA 2L7FP 1DO0A 1VYUA 3PFCA 2KDZA 3QTLA 1V48A 1KVSA 3BEDA 3TG2A 2L2OA 2CK3D 1CKEA 4RYDA 2FP4A 4YP7A 4GPIB 4E5PA 4AY5A 2OBFA 4N9QA 1X80B 3OT1A 5BN5A 1PT9A 1ACJA 5F4BA 5CLLA 5AIQA 3BD7A 4W4TA 3U13A 4FFBB 3PJDA 4N5LA 4ZYZA 5IC4A 1A8HA 3VOEA 4MJXA 1Z18A 4PYRA 1TIKA 3UMBA 3Q5EA 3WGZA 4NQWB 3LH5A 3WIVA 3OJEA 2P1ZA 4NSNA 3FMRA 4GOOD 3I1YA 1NF9A 4B4DA 3DNMA 4J0IA 2JSPA 1J6UA 4EFDA 1VCOA 1SZPA 4BO5A 3CLRD 3P9YA 5B1IA 3VTAA 1NR5A 5I7VA 3AILA 2ZXFA 4U0JA 5JCJD 4XBFA 4XB6B 3HSSA 1E2NA 3EA0A 3RWOA 4ILKA 3MAAC 4HV5A 4JBAA 2G25A 4C2AA 4BUZA 1AQ6A 4JQZA 2EX1A 1P60A 3K5HA 1BDJA 3GOHA 1HNWB 3MVPA 1IEXA 2Y1WA 5CVDA 5BWOA 1ZK8A 4GS5A 4UULA 5CA0F 4XOPA 1LCIA 3ROTA 2ACJA 1YS4A 1XTRA 2FPIA 2C7PA 3FAZA 5T6BA 3IVMA 4XGIA 3B2EA 3UGTA 3DZBA 3L1VA 4RIEA 2A0WA 3RVJA 4N3CA 4L8VA 1XX5A 3F0CA 3OMWA 1EUCB 2ECQA 3NBZC 3THWB 5D00A 4DUZB 2C96A 3AWIA 4RMIA 3RTAA 4F46A 4EB3A 4NYJR 4OGGA 3KVRA 5I45A 3VHXA 2X6RA 3DFUA 1EFCA 2QRZA 1JNYA 1DARA 4JENA 3ZBPA 5JSUA 2ZI6A 1NFFA 4CDGA 2NVTJ 4WLEA 1LFPA 4L22A 1H4SA 5KX5B 1LEHA 5HNFA 3IQGX 2Q3CA 4Z2YA 2QPTA 4BHTA 1H42A 3TCNA 1DRKA 3TL6A 4F60A 3PXCX 3BHIA 1T0IA 3AEUB 3FPAA 1NJ8A 1O4WA 1RXWA 2GYWA 4MYTA 4LSZA 4HDRA 3BA1A 2HRZA 2BY3A 2J3HA 1KH1A 2B8EA 3L5OA 5FO0A 1GSIA 1G63A 1N0VC 2DLDA 1FMTA 5DW3A 4FFPA 3HU2A 1P3JA 5FTLA 1ZU4A 1PEYA 3GLUA 1S3GA 1QE3A 2HZBA 3MBOA 1QRAA 1L7VC 2QP9X 5IDYA 1N2ZA 3RROA 1QM5A 1OZFA 3E7FA 2CSXA 2VRBA 2YYYA 3EIUA 4HUQA 1DC8A 4KL8S 3KIPA 5CBPB 1ZJ6A 4XRGA 3G0DA 1UPXA 5AHOA 3QY9A 5IT0A 4IHVA 4UM5A 1JECA 1E6KA 3SIRA 2JQ7A 4TMKA 3JZAA 4CCSA 3ZMVA 3ULKA 5DI3B 4JYBA 2OBYA 3BAFA 4B33A 2QVZX 4M38A 3R4KA 5AKKA 1M6NA 5AJTA 5L6LB 2O52A 3A1SA 5L3CA 2H57A 2YV4A 3JRHA 3ESDA 2W2LD 4K3UA 2RGUA 1EM8B 2GTHA 3CUOA 4G0WA 3C3MA 5L3ZA 1W49A 1J99A 1KTIA 1TZKA 2NV2B 2FFHA 1WHSB 4RTNA 1DJNA 3DAOA 1G2PA 1GRRA 3F5SA 2WE8A 1M2OA 1M7BA 4Q21A 3WWPA 3UY4A 2HSJA 1Y63A 3O9VA 4CR7A 3FFWA 3A04A 2ZCUA 3FGOA 2Y31A 2DQLA 5I7SA 1Q1EA 1Q1BA 4C08A 4G8XA 1OXKB 2EGGA 1A5AB 2WG0A 3S2SA 1AZTA 5DDGA 3DMNA 3H0CA 1UJNA 5ILSA 3V1LA 1PNRA 3MKLA 3T7RA 4MVJH 4G0XA 4GWKA 3QEKA 3OPQA 2OXEA 3WMRA 1XX6A 4X1IA 5L3SB 5F27A 4NJMA 2ZWPA 1PFUA 3WKCA 4UNPA 1JQLB 3CRVA 5AT1A 2QUKA 3KDAA 4JLBA 4Q1CA 1A69A 1P9OA 4HXGA 2YRXA 3BQ9A 4ABZA 5JJBA 3UJ8A 3LMMA 3LAJA 4B9EA 1RCTE 3TPFA 3EA4A 4WCDA 5HYVA 2N1BA 1V2GA 5DK4A 3I45A 3WA7A 3HCCA 1JWAB 3WGYA 1QTQA 4OUDB 4CU5A 3Q12A 1Y1LA 3LSMA 3OFND 3V46A 4CICA 4HX2A 4IX9A 1A35A 1SWVA 1LQ1A 3LECA 3H86A 3MGAA 5J8FA 1ZRDA 1G4AE 4KAFA 3L4BA 4UD6A 3UK7A 1NF3A 5BMVB 3T99A 3X2FA 1JMKC 1Q1VA 3ITDA 2X9QA 1LF5A 2AG0A 3BERA 2DTXA 1OGYA 1NVEA 5KWIA 2JFVA 4DSTA 3KTAB 4M71A 3EA5A 4PFQA 4JEIA 4YMIA 3HSRA 2Z56A 1P6XA 4DG5A 3AERB 4EPRA 4FNMA 1KOJA 2QUAA 4LIVA 3KVYA 1ZWKA 3WYEA 4FFNA 3FMPB 5EI5A 1L8QA 5BOXA 3OTHA 3CCJI 3VOAA 1CVIA 2PUTA 1VCMA 2BM8A 2WYOA 3QW4B 4MDHA 1MTZA 3MJCA 2PMZA 1BIFA 5LL6P 2XGEA 1T3GA 3LPAA 1FFAA 2VRCA 1GCOA 1LSSA 2OCDA 1I4TD 3I01M 3WTXC 4G4SP 1Q5PA 2R6R1 3UEOA 3E7PA 5FCDA 2Q5CA 1Y48E 8ADHA 1E3JA 2V55B 2IPNA 3N5KA 3MTAA 4TVSA 3VR4A 3D4NA 1IL0A 2KYRA 3R0XA 1RRMA 5J2UA 1QIGA 4M9SA 2XGCA 2ZJQF 3H1BA 3C8MA 3VZCA 5GTHC 2UVPB 3BB4A 2X5KO 4KODA 4KR0A 4Y67A 5KSYA 1TGVA 3G0HA 2EZLA 1YQ9A 3GPIA 1O3QA 3M6UA 4DR2B 3ZE6A 1E62A 4ZI7A 2I1VB 1QWOA 5EA2A 2QUJA 2DA7A 1TECE 3U81A 5DYNA 1QS0B 4OBWA 5A3JA 4D0PA 3H17A 3FH0A 3MCWA 2C2KA 5AI6A 5EMLA 2YZNA 4EA9A 1GRNA 4DYDA 4Q1FA 2PRIA 1PFKA 6REQA 2VSFA 3UMCA 5LXTF 2RB5A 3DDHA 5JEDA 2DU8A 2CHVA 3THOA 5BR4A 2WMYA 1R0YA 3INGA 4NBTA 3T7SA 5DEIA 3RU3A 3FM3A 3VPAA 4LBWA 4QKQA 4Y2YA 1X7YB 1XCMA 4P32A 4IV0A 3U5TA 2HEOA 5E95A 4ZCQA 3T34A 3VZRA 5JD5A 2AQ8A 1CB0A 4GM1A 4PZAA 3I62A 1RWWA 3SVZA 4XRFA 2TCTA 2NUAA 3HE3A 4DREA 1IGNA 5MFPA 3OE7D 4K9SA 4UEJA 3L2WA 4QGAA 2K6GA 3ELDA 5EHQA 1GFIA 4OAYA 3L01A 3NFYA 2HLHA 3PHBE 2AC4A 4MPTA 3R20A 3C8DA 1JLLA 3LQFA 4GC9A 5ALMA 4LDRA 5TY0A 2F43A 4IIBA 3KZIC 5BRJA 1JJIA 5JG7A 3ASNH 3UMMA 5IOYA 1HDGO 1RQLA 2E35A 4JJEA 2A2ZA 2G9RA 2H2AA 2HQSA 3PSIA 3GTJJ 3DKPA 4DDVA 2QVLA 1XD2A 4FDLA 4IVRA 2E49A 5FLMJ 2IEGA 3R75A 2K4JA 4P53A 1HC7A 1JKIA 2B1RA 2H18A 4YLYA 5E1ZB 5IXJA 2I65A 3M7IA 4LXQA 3ROXA 1DHTA 1K6IA 4N4NB 1UKYA 3HB0A 3O73A 4RVFA 2QLJA 2KS6A 4D81A 4ZYHA 3WLMA 3MBKA 2XXBA 1HEYA 2ZYGA 1RBYA 5HMLA 4D4GA 3WC4A 3OPYA 2DUJA 4D6XA 3MIIA 3LHKA 5K3BA 1LUAA 4P08A 2FEXA 1X4OA 3AUFA 2CH0A 4BLOA 3D5LA 4JMLA 1PDOA 1SC9A 1NONA 1C30B 4KI0A 4X24A 1XXHE 4FDVA 2R1TB 3LSIA 1PT5A 4YXFA 2QA5A 5IMBA 5ENDA 1L7BA 4BN0A 1HM5A 2P2YA 5JJCA 3CCRI 5FTWA 3KB8A 3REQB 1AKHA 4JOCA 4ER5A 3N05A 4C7OA 1YZLA 4OHYA 2CE2X 4G1FA 4UBMA 4J3FA 3ZPLA 3S2GA 3OETA 1GL7A 1WCIA 4X45A 2UYQA 2NMVA 1UBHS 2YIMA 3QU3A 4Z0HO 4OV6B 2WUEA 1QP8A 2R8EA 3A1VA 4HF1A 4BYMA 1JDJA 1G64A 3WJAA 2Z43A 1P44A 2PS3A 4HDSB 5K7HA 4AJIA 3E61A 5GONB 3EVTA 1VCIA 5AM2A 1Y42X 4K1LA 3HRMA 1E7MA 4M0EA 1H85A 1BAPA 1MXHA 3VO8A 1V1MB 3AHFA 3IDFA 2XNJA 4GI7A 3IUOA 1JHPA 3T54A 3A36A 4D9GA 2GO1A 2AN5A 3AKZA 2ID7A 1N6IA 3RVKA 3WIOA 3NHWA 5JI3E 1QLJA 5E8GA 5BNTA 2QVBA 2X4HA 3UYKA 2ANBA 3IFSA 4HPQA 1L4LA 2NO6A 1E89A 1N2CE 2WPDD 2QYTA 3BZUA 4NY1A 1T36A 3UHFA 4I4TF 1ABFA 3E3MA 4DNOA 9ANTA 1POXA 3DC7A 4C9BA 1Z7BA 1X19A 1RI4A 4F1JA 1Y9AA 4G94A 2RI0A 2ZATA 3G1WA 3FOFC 2JUCA 2R6JA 3GLIE 2Q3LA 1WJCA 3HJCA 5C8YF 1TMGE 4EIWA 2ZI4A 4RULA 3NEJA 5E8JA 2NT3A 4RK5A 3FLMA 2G9UA 3NUGA 5B6JA 2K2WA 1HG1A 3G0BA 5DDIP 3FW1A 2RH5A 4IJWA 3S1RJ 4BFLA 4CYMA 1IAWA 4O4LB 5AXDA 4N18A 8GPBA 3HN2A 1HE8B 4QUAA 3V8RA 2EARA 1S2IA 2W1OA 2PGNA 2ZUDA 4PN3A 2W4MA 4YO8A 2W4SA 5EIBD 4GVPA 3RYIB 3CB4A 2C3PA 5J4VA 2XHEA 4N7BA 1C9DB 1QIFA 1UQTA 2H31A 4E22A 2GZMA 4CCJA 1S2DA 1YLFA 1XJ0A 5JMOA 2GLTA 3MRSA 4CETA 1CUDA 2EFEB 2IWRA 2N8GA 2YOHA 1OCRH 1GOTA 4KUMA 2C3YA 3CUWA 3VVBA 1G16A 1KYQA 2GHQA 4KUGA 2QU8A 2ISCA 1QOZA 4HLQB 4D1QA 1F3OA 4C0HA 3ZCVA 1CHDA 1SBTA 4O0LA 4L73A 4PO3X 2EP8A 1T0JB 3G85A 3NRBA 3DZHA 1DTEA 3F4BA 1XMQB 3B85A 2DK5A 2HOAA 3ADPA 3SD7A 4HSEA 2Y9YA 1SC3A 5DGCA 1KYWA 3AF2A 2COMA 4GLBA 3KTFA 3I0ZA 1JXMA 3S2HJ 3MRXA 4ZV9A 1ZOSA 4LYGA 4U8HA 1J9IA 3B6IA 3RS9A 1ZVJA 3P9QA 4MV6A 3C1UA 5A06A 3R8XA 4GSKA 3GPDG 4PAGA 4HQMA 1IIRA 1MIOA 2RI6A 2WP0A 5EJ9A 3OJLA 2LVSA 1ZZGA 1CUHA 2PTGA 4N8SA 4LE1A 3FI0A 4K6HA 2EILH 2O1EA 4HBZA 2PH3A 1XI2A 1HEIA 1ZICA 4JDPA 1ZMRA 2QE6A 3T1TA 1D6SA 2Q21A 4EJSA 2DF8A 3QX7A 5G1NA 3R0JA 4B87A 3I2FA 2G0AA 1Z5GA 3TEDA 3Q9LA 1ZM3A 2FJPA 3WHLA 3EISA 3ZH9B 4QC2A 3CLSC 3HDJA 2RAVA 1UDWA 3BIFA 2AFVA 3TSCA 5AI8A 4ACBA 1G2HA 3H1CA 4X1YA 3S8MA 3RFXA 2Q4EA 2QD1A 1BDHA 1YBAA 4MP3A 3SC6A 1BJTA 1UIMA 4S2UA 1O5IA 4HNAB 3VZPA 4LF6B 3O91A 1KWKA 1P7CA 4MUIA 2QAIA 3RI3A 4ZGBA 4RVHA 2YFYA 1VI2A 2O9LA 2YDYA 4PYOA 1U11A 3CE9A 1ZRSA 5L3QA 1G8JA 1QGAA 3W6JB 4XQ9A 2ZOSA 2LRHA 2I0FA 2QRPA 3BXHA 1IY2A 1D5YA 4OIQF 4K46A 4XYLA 2K86A 1GGVA 1KZ4A 3MK31 2OCYC 1WJDA 2ZJRF 4ZKDA 2NT4A 1ZJWA 1GVHA 1DG1G 5JARA 1QB8A 3SF8A 3RS4A 1NAIA 1CRLA 4QYSA 3GTKJ 3L8MA 3RDIA 4URVR 3DTEA 2D0OB 1PEDA 5BP7A 5D8KB 3KB2A 1VKOA 2X48A 1MT3A 2Z3WA 4D4HA 1ZNYA 3E4DA 5IH3A 1UJ8A 4EJ2A 2LF8A 1G55A 1MOZA 1XZPA 3O92A 3CC8A 2O2IA 3RHSA 2P7VB 3RFTA 3TD9A 2O6HA 4ENUA 4Q1DA 4D0RA 1C0KA 1XF1A 4G5HA 2L19A 3CT4A 1G2OA 3H83A 3ZHOA 5CT9A 3RK4A 2ID6A 3LSJA 2VC2B 3RSSA 3I4FA 1Q1QA 2QWXA 4QSHA 4LUCA 4D4KA 3HTXA 2P9GA 4EJFA 4BASA 2NM0A 4JSYA 3MWYW 1X1DA 4R51A 1V35A 2JCVA 5L3RA 1O8BA 4KRXA 1SUWA 1G19A 4L2IB 4CG0A 1QRDA 1QTNA 1UFQA 2RHTA 4RORA 3BKWA 3NYRA 3R5KA 4C3OB 3KKPA 4ZGGA 4QYIB 1SXJD 1H05A 1C7EA 2IP1A 3QPHA 2RCNA 3KP5A 3TI9A 4MGKR 1FUEA 3TD6A 4GYYA 3O26A 4MRMB 3SMVA 2XDQA 3R74A 5EVJA 1RYHA 4I0WB 2IHNA 1L7EA 4RPCA 2VSQA 2HV9A 5FTMA 3S4YA 4MJLA 4DA6A 4HTFA 1RZRD 1P81A 1FSPA 4LWPA 2O0KA 1LI4A 4WNAB 1XA0A 1QP0A 5BW6B 4INPA 1TIBA 2DXIA 4CCAA 2QMEA 2H52A 3K0CA 5CA0B 2XNDD 1BRTA 3RAEC 4RVSA 3G7UA 3PIOF 4UM9B 3HJAA 1E5LA 4AJPA 1A82A 2VCYA 3CH4B 5KAMA 3PCTA 2JTVA 4Y2XA 4XOIA 4HWRA 4G63A 3VRHA 3GY0A 4MLZA 4DC0A 1Q6YA 1B0PA 3GA0A 2KJCA 3PQ5A 1QRUA 1JV2B 3EXEB 3KUDA 4B6SA 3ZIDA 2C9CA 1RXSA 1MAHA 4D97A 4TQAA 5KTOA 3ABZA 1FNMA 3CKLA 1WVIA 3UMSA 4Z7OB 5HQ3A 1ZGGA 1WBJB 4DUPA 1BOBA 5JXHA 5BYAA 1ULYA 1G5QA 2OBBA 4TL7A 4HZFA 4WKNA 1C7IA 4KUHA 1EJ2A 5G1OA 3EUWA 4FFRA 3R6WA 5JD4A 5THKA 2QLFA 1ZRFA 4CMHA 1OBFO 4R6XA 2JFUA 4MUGA 4L0DA 1NC3A 1VQ5I 4RVUA 1YR3A 3FBGA 3HDTA 3NHBA 4CYCB 3DOIA 3FHLA 1P9WA 3RM3A 3GLXA 3S68A 4QXPA 4YV1A 4CDMA 4MQMA 4BVKA 3VTFA 3HYCA 4RQAA 5EUBA 5FYQA 2XAUA 1MPTA 3QWHA 2OFOA 4EFMA 2WJWA 1QG0A 2ERCA 4R3UC 4HRYA 4A3BJ 4IUYA 1TAGA 3FNQA 2W2PA 4I9NA 2CLFB 3ZHCA 1YA6A 3ODPA 4ZTZB 2XZTA 1NW3A 5JY6A 3PDCA 1NYTA 2C2BA 1Z06A 4NDZA 4ALJA 4X7MA 2VPIA 3L40A 5HCUA 3ABRB 4D5FA 1NLZA 1HKSA 2DLLA 1U4SA 1SXIA 3OUTA 4EFLA 2QZZA 3FX3A 1UJ2A 3AR7A 1FX0A 2ORVA 3QYJA 3TE6A 3BG3A 2OA4A 4IZIA 4ZOLF 1PKEA 2OBXA 1ADFA 3KKKA 4QNMA 3R9XA 1U5TC 2O8EA 2F2EA 5IP5A 3EPJA 1OHHD 4PAOA 3UAZA 2A5JA 2RK3A 4PHFA 5AM1A 3KG2A 1P1FA 2FSPA 3D0RA 3U17A 2WD7A 3KDSE 2BJVA 3C3XA 5B5SA 3DZDA 1OLSB 1A9PA 3W7BA 5EE9A 4O4JA 2HCRA 2A9OA 3WK4A 2KRFA 4IOCF 3KLBA 1VSQA 3KAKA 5M7EA 3DMTC 4QEDA 4JUIA 2OHFA 1R4NA 3G79A 2XXAB 3DEUA 2A9PA 4KMMA 2JGFA 2WW8A 2RAEA 2O2CA 2VP3A 3F2IA 1LPOA 1Y33E 2JAXA 1RZUA 3SF0A 4G9YA 5AVTA 1MPXA 3QX3A 1U5TB 4XOUA 4IIDA 1XZEA 2GD0A 5I47A 2H2IA 2IU3A 2BTQB 2HK8A 2O8NA 4CG3A 3NEUA 4P7FA 4UVBA 3FDFA 2FUG6 3VPDA 4WDRA 5D3KA 1C80A 4Q66C 2XDWA 2Y9ZA 4KXYA 4A2WA 1SXPA 5E79C 1UAGA 4LXTA 5COBA 3MS2A 3NHRA 1O7JA 3ZLVA 2X76A 4IXDA 4LZPA 2P4SA 2H4XA 3FD8A 1JGSA 5AVOA 3TLMA 4D4LA 4Z7NB 4ZQCB 2ZSJA 4QPCA 3A03A 3OFJA 5LLQA 4NCAA 1XO1A 1Z5OA 4B6GA 3ASUA 4I99C 2IYZA 3IUNA 5K3AA 3MSXA 5E3OA 5ALQA 2H6BA 4AO6A 5HDBB 4A8PA 4Q4LA 3AU8A 4JVMA 2FWPA 1CQPA 3QGMA 3J81Z 1GCGA 2DPUA 4ZJPA 3U31A 2JJ8A 4TOIA 4U3JB 3O74A 5LP6F 5J1RA 4MW1A 2WC2A 2IIVA 2WTMA 2CVZA 1XDWA 2HA6A 4I1IA 2COEA 4DPLA 4G84A 1OMIA 4MS3B 4UFNA 3N4MA 2BFDA 1GO2A 4L76A 4V19K 1ULBA 4M0PA 3FPEA 1GV0A 5JAQA 1KP2A 2F1JA 1H9CA 4JUCA 1F8XA 5DISB 1K78A 3A2KA 2XUIA 4PZYA 3D8TA 1A04A 1TNDA 1KP9A 3I2GA 4UUSB 4PYNA 3LXRA 2I6TA 4QBHA 4G7OF 3EVFA 2B30A 1LTQA 1V37A 3S8PA 4LNUA 2Y6VA 2IDMA 3W2EA 1SC7A 1DGWY 5KYUB 4ZVMA 5P8WA 1MBHA 3DTNA 4P5EA 1KL7A 1NP3A 5LXTB 1CULC 3HLYA 2B2CA 4CEHB 2C0CA 2C29D 3MLEA 1YS7A 1NU8A 4UHCA 3WSWA 4A3FJ 2ZJ3A 1ZHHA 5LEJA 2JRTA 1PWZA 2WNIA 5K8JB 5CPRB 1JT6A 1TQPA 3L92A 2H8WA 5AOAA 1PEKE 4YYEA 2GT1A 4IUDS 4N41A 2PFBA 1TL8A 3TF5A 2I6GA 5HPYB 3L0OA 3M6MD 3CJTA 1U2RA 4IKEA 4ZT5A 3PK0A 2R44A 2HLPA 2VDVE 2QKLB 3HLTA 1HFKA 2L9NA 1WDLA 1EWYA 2OV6A 2Q6KA 2R84A 3AR2A 1RBMA 2HWKA 5FEUA 1L6IA 3C3DA 3QLEA 2ELHA 4DB4A 5JFGA 4MTEA 1THMA 4FYKA 4G5RA 3DBHA 3HCWA 1YB2A 4JGGA 1JZSA 4YUAA 2D8MA 1FDSA 1JHYA 4IFBA 1PV1A 3AR8A 5J5VA 3PHLA 4AIJA 1T5HX 3VNRA 3A27A 2DERA 4LV6A 1X38A 4KTVE 1A36A 1W30A 2OCAA 3FZNA 5KQSA 2NS8A 1DIHA 2XKPA 3HJBA 3R7WA 2J46A 4Z53A 5BSTA 2PUBA 5JSKA 5HHTA 2EKZA 4EB6B 4BMDA 3GLSA 2VHYA 3HR4A 1JJ8C 3D81A 2OY0A 2IV3A 4O2LA 3C70A 2AKYA 3L6CA 4WGGA 4WLVA 1W1WA 5DCMB 1B74A 2X5NA 1W36D 4HX5A 2R8OA 4OHVA 1BG6A 2X41A 2NX2A 4MV4A 4O2RA 3EEBA 3K05A 2WA0A 3CUQC 3SJBA 1CC1S 2X2PA 1NX9A 5AIPA 2D5CA 3PYMA 3V1YA 1WXWA 2ZM6B 2V7XA 2HSWA 4X97A 2O7VA 5E1WA 4NC9A 4IWYA 4BHCA 3H5WA 3E3AA 1KJ9A 4KREA 1YMUA 4ZXPA 4F7DA 3HIFA 1KYXA 3GN2A 1UM9A 3KYJB 3FXJA 2Q4BA 4JWTA 3AJ9A 2ZXIA 1ZQ3P 3A6GA 2Z6QA 1T15A 5BV0A 4YMTA 3MB5A 3DPIA 4BTEA 3WQRA 3DV0B 2ZPTX 4IDCA 3GFGA 2HW8A 2O8XA 1C7RA 4JEHA 4I4IA 2WZDA 1E1LA 3MLBA 2MMCA 2ECCA 4DMMA 4PNEA 1UWLA 5T4FA 2BL4A 5C35A 4CQLA 5HMMA 4W1RA 2HVSA 4GX2A 5CXQA 4P83A 3O38A 5HM8A 4ZVQA 1SVIA 3WGHA 1YZVA 4OFZA 2C07A 3HUEA 4KDCA 1KFEB 4GO1A 2PXAA 1ML3A 4QGFA 1F0YA 3CUQB 4B6PA 2AN3A 5AVRA 4TM8A 2D7JA 4G56A 2XCRB 1JPVA 4F45A 1QJ4A 2BFMA 2E3JA 4UXHA 4QHSA 2V6CA 4FHZA 2EBFX 3F3KA 2BT4A 1B2LA 4ZPJA 3HXMA 4DM7A 1TDJA 4JLJA 1SUCA 5E7MA 3MF4A 5DOZA 3K0FA 2YOGA 3FCAA 3GVPA 2WU8A 1P1RA 3T3GA 5C8ZA 4K9QA 2VDQB 2QRHA 1IOLA 4TMTA 2HDDA 1QGYA 2KX7A 3NS7A 5CUQA 1LQUA 2EP5A 1Z0KA 1GG5A 4QQNA 1LPBB 3KE8A 2LF7A 3EDCA 3TSYA 2VJIA 3OLYA 3J7TA 4D92A 2Q4TA 1HDRA 1CYDA 5BSEA 4G6TB 3TCXB 1M6WA 3KPWA 2A86A 4ESVA 2AWNA 2DR3A 2DODA 2ZE8A 1SVLA 2HQBA 4R1OA 5J63A 4JX9A 2DTZA 3T4UA 5C8YB 1C29B 1WJGA 2AQFA 1M76A 4NS1A 5CFQA 3GW2A 2GK4A 1YACA 4KSBA 5KTSA 3F7OA 4LYAA 2NS0A 2HRBA 2A69F 1KFBB 3I37X 4FKMA 2LE0A 3NTRA 1PNTA 2OD7A 3EGXA 5EHNA 1WRBA 3U7HB 4GM0A 3QF7A 1JEYA 3QQ5A 2G71A 2FMFA 3QU9A 2GVDC 2J48A 2DWPA 1ACLA 1TVMA 2YH2A 1AF4A 1AKWA 3IUSA 4KQJA 4F4FA 1VJGA 2JAWA 1N0WA 5BN3A 4M9CA 1NXTA 3BXFA 1Z0AA 2ZE5A 3PFYA 3IE2A 3BULA 1TLTA 4OJKA 1VIMA 4QXQA 1ZEJA 1JA0A 3IESA 3HM2A 1KAEA 3X44A 1X7HA 3HS3A 2DHDA 1NNSA 5B1AH 3AL2A 5E38A 3EQZA 4D3ZA 3R9IA 3ZWPA 4LJ5A 3A37A 1I6WA 1OWPA 5HIKA 2NNYA 1N1EA 4PBTA 3KPJA 4AS3A 3BCRA 1PZMA 4HMOA 3FOBA 4HRVA 4IHQA 3L2RA 2B7CA 4W7IA 2Y4NA 1YAJA 4IRHA 5LA6F 4NBLA 2HU5A 1LPQA 2FFJA 1E9CA 4ZCTA 4X60A 1DKNA 4DSUA 7REQA 1FJHA 3HMKA 4BJ6C 3JQ8A 4E2ZA 3A6FA 4I6GA 2LZ0A 1W7PB 3J81A 1VGVA 4WADA 5DWQA 5PGMA 1KF0A 2IRFG 3KXLA 4J76A 5SZKB 2WB1A 2P9QA 4UXJA 3EETA 4ZCPA 5GAGJ 4K8RB 3ETCA 3U6KA 1CJMA 1T3TA 5FBWB 2ORIA 3K0KA 4CCWA 4CN9A 3N76A 4AC9A 3RAPR 1TQIA 1JEDA 3F6PA 4KGZA 4XZ3A 3ABSB 3KSBC 2CXRA 2C97A 3COYA 4UQLA 1ODIA 1IXRC 5JZSA 2XUJA 1V8ZA 4JC0A 3DMPA 4O4LF 1FP1D 3EDRA 1AIPA 2H1CA 4G4IA 3PC7A 4M76B 4GE0A 1YQAA 1COWA 2FOLA 3AFIA 3BWBA 2L69A 3QG1A 3KB6A 3WGTA 4B2LA 3D59A 1KJ8A 1ZISA 2GBGA 3R7SA 3C48A 4DBLE 1H94A 5AW9A 4PFKA 4EV0A 1XQXA 4Y1EA 1MB3A 4TROA 3F72A 4OOFA 2E71A 3MGBA 1VSUA 5DBFA 4D9IA 2QTWB 3O7WA 3ME5A 1BA5A 4OGKA 3JRIA 5L3VA 2K3PA 4LYDA 4BFXA 4FUQA 3K4NA 1KJWA 1DADA 2QK4A 3WWEA 1J25A 3FROA 2ZXJA 5JVDA 4JU9A 5IAJA 3MNFA 2OFPA 4Z4GA 2LXNA 2C0PA 4FWTA 1YIDA 4K2EA 5BS6A 4OXIA 1YJQA 2KMUA 4GQBA 1K8ZB 4PVDA 3L7OA 5T6MA 3LVBA 1XXHB 2X3FA 4KBGA 3D2BA 3S2YA 1PFQA 2GASA 5KHLB 5ARBA 3FM5A 3FNRA 1N4DA 3DHEA 1QF6A 6GPBA 2G0EA 4BAUA 2ZXEA 3LOQA 4I5EA 4MV8A 5HSGA 5D5UB 1G7RA 2JJQA 2Q3BA 1AHPA 1JDBC 5IJWA 1X42A 3BZBA 3JS5A 2GA9A 2R8BA 3RVNA 3LRXA 4BATA 2ENUA 3EQLF 4KOAA 4BLVA 4IO9F 4JJ4A 1JFFB 4EA8A 3C6YA 4R2WA 3T8YA 2OMKA 2XMBA 5K0GA 4AUNA 4U00A 3IPCA 1FFEA 4LNHA 4GF5A 3BTUA 4EZIA 2ATVA 5GP9A 5HZGA 4LC0A 3U5ZB 3QBDA 1XZJA 3JQ7A 1SG9A 1EVQA 2DKFA 2P4UA 4B2YA 1UP7A 3EUHC 1VPDA 3KAJA 3ZD6A 1VHWA 3F8NA 4YRAA 2HTSA 1A5JA 4PFPA 3P2OA 3STYA 3H36A 1OCEA 1LK0A 3AF1A 4WERA 5L7YA 5HKLA 4FFSA 3KEQA 2WSSA 4CH7A 4PZ0A 1JDBB 4A0QA 4EJOA 1EVKA 1N2CB 4ABYA 3I09A 1T5IA 1DWUA 4LNAA 2YC4C 1T5SA 5EKUA 3OP1A 4B2PA 2FMHA 3EFEA 2MSWA 4G86A 5C5DA 3N7AA 4M89A 4CXFA 3U7IA 1EXWA 1N2XA 5JLJA 1N1MA 4TM7A 3WKEA 4RVGA 3GLIB 2G28A 4BZXA 2F62A 3CNLA 2AZXA 1U2QA 4V03A 3GBSA 2K9MA 4EBBA 2XWJI 4LSMA 1T8TA 3P0FA 4NTZA 2O2HA 1J7JA 1WUIS 1H93A 2Y77A 4QYTA 1LSJA 1PTJC 1Q0UA 3OLZA 4MSUA 4UY8I 1NTOA 4BQSA 1R0RE 1XCOA 1M5UA 2GRAA 4J0EA 1J9EA 1T0FA 2Y8EA 3ZYZA 4FT8A 1RCFA 2ADOA 2QVXX 3QKTA 1YRLA 4U6NA 4CNBA 4O2BF 3C3JA 4RTKA 3F67A 4QWQA 1YR2A 2ZR0A 4JL6A 4TT3A 3ICPA 3SXUA 3PX3A 3N2GA 4LRWA 4A2PA 3GTOJ 4UAVA 3K92A 4GX0A 2QMQA 3OM1A 3UT5A 2C5GA 4NBUA 2QLMA 1UWVA 3I6IA 1YZYA 4BVEA 2X7XA 4UVHA 3AHHA 4G0VA 3X3HA 3AETB 4OYRA 4OIMA 1VL2A 3E22A 4XGNA 3V2IA 1M83A 2QBYA 4RPIA 4WUTA 2EJRA 2JGLA 1F6WA 5DU2A 1LDMA 1SVMA 3EOAI 3HZJA 2HYIC 3ITEA 1T6BY 5FLEX 2OOSA 2ZS7A 4H4DA 4ZTBA 4RIGA 4DJAA 3W5BA 3ECCA 1KK3A 3WGKA 3PXDA 4CEIA 1IF1A 1YVRA 2B1QA 4F84A 3TTTA 4AG6A 4OXXA 3U1DA 5ALTA 2BHRA 1EQUA 4E0BA 1IBSA 4JT2A 1L7QA 4ZOLB 2W58A 3HABA 1NXPA 2VHZA 3CR3C 4K0KB 1B8NA 5ALDA 3DMDA 1AKMA 4MCHA 4ZOEA 1TTTA 4ARCA 3S27A 2Y75A 4HEA2 4MVWA 3ANLA 1AMUA 4MWDA 3AEQA 3GI1A 1JAIA 2J87A 3OURA 3G13A 2E87A 4QSMA 4B3TB 4JJZA 2VFAA 1DKQA 2ZQZA 5AHRA 2JGDA 4AP6A 3SHWA 1YQWA 3FWHA 4WOBA 2CNLA 3OKAA 1GFSA 4EF4A 4PYLA 1JF8A 1N3BA 2YHBA 3DD1A 5JDIA 2VOEA 5K7ZA 1QOPB 1UZAA 2IYLD 2R68A 4ZYGA 3QTBA 2M9HA 1RZ4A 2PZMA 5K2OA 1CR0A 4DA4A 2M0CA 3JVEA 1GARA 4YDQA 3IAHA 5DYGA 3B2NA 1L1EA 2JGRA 3W6UA 3DEZA 3E8SA 1L5QA 1MP0A 4P4LA 2IXFA 2GUWA 2P77A 2RKHA 1EESA 3KXDA 5J5AA 5LP6C 3OD5A 4JP3A 1G38A 2RHGB 2CNDA 3LD9A 2XE8A 3WOVA 2PMUA 4LQLA 1I80A 3CCUI 1JL3A 1T9HA 1T9ZA 1B7GO 4A0FA 4PX5A 3COSA 2JN6A 3KQUA 3NDPA 3V00A 4NQZA 3A32A 4EGFA 4V0LA 4AD8A 1AE1A 3LBIA 1Z0UA 5EVCA 2I3DA 2DFHA 3EC2A 4TUYF 3B6AA 3RNOA 2O5RA 3INTA 1XFAA 5B64A 3WL6A 4DMHA 2VHCA 1PO7A 1RHMA 1R22A 1SB8A 1I4WA 3CUVA 4ZO9A 3I01A 4BRWA 1SULA 1Q57A 1TYBE 5IAEA 1ATIA 3LCRA 4EO7A 4DGQA 5F35A 1DQYA 4IVPA 3CW9A 3N53A 1DIAA 1V5IA 1LC3A 3M6IA 1Q1HA 1ODKA 1IJWC 3VR6A 3DKYA 3H1EA 4UD2A 1Z75A 3QFRA 4FINA 2XBUA 4UUOA 2NUTB 4BO3A 3DAYA 4IILA 3A9RA 4FP9A 4KAXA 5K6AA 1XAGA 1T8SA 3WISA 5LP6B 5JHHB 3KQYA 3R4CA 3WHIA 2DT6A 2UUBB 1UHMA 3SQMA 4I1VA 3K9QO 1NE2A 3B20A 1FS4A 5SZHB 1HNXB 5EN4A 3EEFA 1YIAA 3ECSA 5KYYA 5F52A 4AB1A 4OQPA 1Q1NA 1MGPA 2NO1A 2GAOA 2RMKA 3LBFA 2ZSHA 1T35A 3EXIB 1DO8A 2OU2A 4AS2A 3IRQA 1Y5LA 3RRNA 2PZ8A 1ML4A 1WLYA 3M6AA 4FR5A 2QTGA 3T9CA 3VU8A 2E2WA 3VYTB 4ANJA 1JEJA 3VU3A 4ENJA 4RMJA 1QLHA 1K6EA 1AVTA 3AG4H 4LRUA 1PP4A 3AM5A 5K9ZA 4NWIA 1I3OA 1SO8A 4K28A 3O8QB 3E9YA 5F77A 1B8OA 2VNSA 5J3JA 5DXFA 1BXZA 2QQ9A 2PRYA 1FU8A 5FLYA 4MYSA 2LCIA 5JSFA 1IM8A 3HWSA 4OMCA 2AOXA 1CD5A 3OSZA 2EIXA 2EW1A 4IIUA 5D1HA 4KXLA 4RACA 2IKSA 4H6VA 2HNAA 3HPRA 1U6JA 3IAM1 1W5EA 1X2NA 3E9QA 5A7HA 2Q1YA 2XITA 3MCZA 3HVJA 3LSPA 2VPRA 1MABA 5K8LA 3LOUA 4L0YB 3PNMA 5JO9A 2ZKLA 2OO7A 2XXJA 3ND5A 5K7FA 1MSFC 1EDEA 3I4NJ 1LQ2A 1LV8A 4B7ZA 1WKBA 3HVHA 3K70C 1CDZA 5CJPA 4FX0A 1KYTA 2ZI7A 4YAWA 1W29A 1J0DA 5LRRA 4BKQA 3UMFA 1E92A 1GZ4A 3WGIA 2QN7A 1M2EA 4RY9A 5KTKA 4X00A 4OHKA 4C4ZA 1DV1A 1JMVA 1FMFA 3DXZA 3V1UA 3VYWA 3OZBA 2EBWA 4RPHA 2FW0A 2CFTA 2UV8A 3TZCA 1XWWA 2DHRA 4O33A 1RZVA 4L9AA 3IP1A 3IPAA 3NRCA 4ZANA 1A9OA 4CKEA 5KNBD 3V5NA 2VZ0A 3DEYX 2WYUA 1T1IA 2G4LA 4G6DA 4GXQA 1RKXA 3HLKA 2WD9A 4YEDA 3QZUA 3FOZA 1PQ4A 1KVRA 2WF5A 1FC0A 1GTJ1 1BHJA 5C5CA 5LGNA 3L6OO 2KIFA 3F97A 1LKXA 2UV1A 4HYTA 2HK9A 2CLLB 3K70B 5CH3A 3FHJA 2X58A 3C7JA 1M75A 4YRMA 3W5CA 4R41A 1S7CA 4EH1A 1AK1A 4I2NA 3KUKA 4L27A 2JVGA 3AGQA 1PGJA 4Y4RA 3NU1A 1GEEA 5LC1A 2ASVA 4JNKA 1ZH5A 3BIJA 3A06A 4HZUB 3EW9A 1Z6AA 4IVNA 4UCQA 3M8JA 3OWOA 1E1YA 4BNHA 1XVIA 3PEVA 1L5OA 5IFKA 1E1DA 1W6RA 4BNKA 4MQFA 1HT2E 1U28C 2G1JA 2D2FA 3EBLA 4DRXB 2B20A 2Q5JA 1XL1A 5HBGA 2IEYA 2KWIA 4NAUA 2ZUUA 2RAFA 3IB6A 1P0QA 4HEHA 1YDGA 3VZBA 3RSFA 3FKSD 3EZ7A 5F2OA 1N8KA 1V7PC 4YJFA 3ZV6A 3DLIA 3PZRA 4P7BA 4XTCS 1K7AA 2MH9A 4GWGA 2PMHA 3NZEA 4ZI3A 3B9PA 3E97A 3DKXA 4ODIA 2R8PA 4PQFA 4P81A 3WBJA 1R9GA 2OJED 4PZPA 4RVCA 3ZZNA 1PUEE 4QASA 4ZALA 2H1HA 2FEMA 2WJJA 3DG9A 1S3FA 3L00A 1K6JA 4HX4A 3CG4A 1J5XA 4O1MA 1P62B 5EIXA 3GRFA 2GF2A 1SCNE 2AG6A 4GXRA 4FGLA 1LRJA 3VBCA 5EE3A 1V43A 4EY8A 4JBIA 4A9AA 3B12A 2AG1A 4ENMA 1X39A 5KYNA 3D6UA 4RD2A 3DCNA 3JZMA 1CXZA 1HYQA 1FXUA 3GRPA 3OESA 1W47A 4FYWA 2QN1A 1NFQA 1ZCFA 5A6SA 1WY5A 4ON9A 2R7MA 3F6CA 3HDYA 1AU7A 2J3QA 1YTUA 3WGUA 2QRVA 4ZZLA 1WSAA 3QYPA 1ONSA 1KK2A 2FUNB 3JRNA 2HWXA 3A14A 3K32A 2VSOA 1GN9A 3HG7A 2L0KA 4KXXA 4NDAA 4G0UA 5GM2A 3B89A 4JI2B 1X4PA 1PD0A 4L95C 2QX9A 1YTYA 3NBMA 4Y33A 1K63A 3G9XA 4BEJA 1GCUA 2PL1A 3HACA 5IAKA 2IIPA 4I1SA 1DFGA 3RG8A 2NU8B 1ZUD1 5HRUA 2YX4A 3RADC 1C0LA 2PZEA 3T4XA 1UMKA 3PU6A 1A31A 3LUDA 1YBFA 3LDUA 1ZITA 4UVDA 3UJ9A 2XRFA 1W2WB 3RABA 5H5JA 1JE0A 3K9BA 2NQ2C 3ZMUA 2MLGA 1KJQA 2P41A 1SANA 1O95A 3QK7A 4MGIR 3D7SA 4WKOA 2A07F 4NFLA 4XCVA 5LNK1 4XN0A 4WN3A 3UAOA 4BU2A 1DP3A 2PANA 5DP1A 5EZHA 1ZK3A 1KSHA 2BDUA 3P2JA 5ESXA 1ADBA 3WP1B 2PX0A 1WI3A 1QGDA 4EPXA 3EGDB 1EDOA 4PZDA 3JQGA 2E4YA 3WGVA 2ZT7A 1TLLA 2DFVA 3EXHC 2MYSA 5KVQA 4JBYA 1VL5A 4DQXA 5C31A 2ZUSA 3FYUA 5LA6B 3J80K 2NSDA 1NFRA 1Z2CA 2X7HA 4O25A 2C78A 3KYCA 2ZYDA 4FGJA 1X74A 2K87A 2XUOA 4EYKA 5ICEA 3E3VA 4XR9A 1MRSA 1VPVA 1YR6A 1JJ7A 1X1PA 1FDTA 1TUBB 5JASA 2A6TA 4EYGA 4R8VA 4QYXA 4QGBA 1XCBA 2G8LA 3OTOB 3LHSA 3BCSA 5I9MA 3WLFA 1ODTC 1E79A 3GYHX 3AU9A 4Z1OA 4WOCA 4YQYA 3PVZA 1Y8ZA 1T39A 4Y52J 4MWOA 4KR9A 2R4UA 5TQ0B 2LY9A 1I10A 3NG1A 1XEXB 1H8EA 3ZQUA 3L04A 1LK7A 4KXNA 3THRA 2EQRA 4CEJB 3FXRA 2HF9A 3IKMB 1KBOA 4E03A 3BMQA 2EIJH 3EXHB 4II3A 3NGMA 5CX1A 1XMAA 1GSOA 1XU4A 4LWOA 2JD2A 3DEFA 1P9RA 5JE8A 1CE8A 2QG4A 1QYRA 4IM7A 4YRTA 2W6MA 2BONA 3HOYJ 4UE6A 3ECAA 1GZDA 1KQPA 3CVJA 5KZMB 4HFRA 1CNFA 3GT4A 2CJXA 2BSXA 2Q5EA 3C74A 3HH8A 1I4EB 4IJVA 3P0JA 2COUA 4GP6A 4AW9A 2O3FA 3O6BB 1S2GA 2BF7A 4HWSA 4D9FA 2HJVA 1WVRA 3QOFA 4YJ2A 4BO0A 4RHTA 1OTXA 2JA6J 5BPFA 1JUDA 4NFSA 2UXXA 5CA1A 1JWLA 2C5AA 1X3ZB 1XRMA 1SU8A 2XAAA 3PNSA 1HETA 1CX9B 3PIPF 2CNWD