1P4AA

Crystal structure of the purr complexed with cprpp
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
269
Chain Sequence
KFRRSGRLVDLTNYLLTHPHELIPLTFFSERYESAKSSISEDLTIIKQTFEQQGIGTLLTVPGAAGGVKYIPKMKQAEAEEFVQTLGQSLANPERILPGGYVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPLAYAAASYLNVPVVIVRKDSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLVEAEGVDERLVDEYMSLLTLSTINMKEKSIEIQNGNFLRFFKDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional dissection of the Bacillus subtilis pur operator site.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Pur operon repressor
total genus 77
structure length 269
sequence length 275
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
A PF09182 PuR_N Bacterial purine repressor, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p4aA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p4aA02
2W25A 1XN7A 1Z7GA 4KIFA 1BI0A 2STTA 4OHCA 3WTWC 3BJAA 3ML6A 4HF0A 4BAYA 3U1DA 1R00A 2X4HA 4CHUA 3R4KA 3DQVC 4RV4A 1BM9A 4EGYA 4XSZF 1HKSA 1IN5A 2ZKZA 1XTVA 3ZMSA 2O0YA 2A61A 4G9YA 1ZG3A 3PQJA 1GHCA 1ZGAA 1CGPA 5FO5A 3C18A 3BWGA 3VEPA 4A6EA 3EFHA 5JSQA 5CVUA 1PZMA 1XSVA 1J75A 2VBYA 4LZNA 5DEQA 1JE8A 3ZMVA 3E5UA 1UPUA 3J80Z 2VN2A 4IRHA 3NQOA 2KIFA 4RAYA 3JW4A 3ACDA 3IWZA 1FNNA 3LAJA 1T6SA 3NRVA 1FSGA 3T5XA 1GRVA 1BC8C 3V8KA 1O5OA 2VC1A 2MLKA 2L01A 4UXNA 1RUNA 4RHTA 4BNCA 5F64A 5ICGA 2Q8KA 4L9JA 2DY0A 2CSOA 2B0LA 1PDNC 3JAMK 4KFCA 2IA1A 4HZFA 3HYIA 4E70A 1OREA 3QP5A 1F1ZA 5D5XB 3IKVA 3M8EA 2E1CA 3CLOA 3SFZA 1UFMA 1U9YA 3ZMUA 4AIJA 4EJVA 3TO9A 1G2QA 2HWVA 2O6GE 1G3TA 2WWYA 3DMPA 1Z6RA 1STOA 2VBZA 2EFNA 4RQBA 5LLQA 1P2FA 2HYFA 1IF1A 2JZYA 3DAHA 1IZ1A 2TDXA 1JLSA 5D6EA 4LK0F 4O6JA 1YIOA 3GF2A 4OMYA 3GGCA 2KKOA 3MCZA 1ECCA 2DK8A 2P6SA 2H08A 4PCQA 1AOYA 1MJAA 5E17F 1STZA 4G8XA 1J0RA 3BDDA 2D1VA 2X0LA 3MFKA 2V6CA 4A2UA 3HSRA 3F22A 3E3VA 1HW2A 4KMFA 2FMYA 3HIFA 4P83A 1ECJA 1NONA 4R8HA 4L9VA 1QBJA 4RGSA 1O57A 4KIBA 3IRRA 4UVAA 1I5ZA 3VODA 5FD5A 1T2KA 2OQGA 1QO0D 2M5WA 4G7ZF 3I54A 2XV4S 3LRTA 3ZQ7A 3O6BB 2O61A 5DD4A 1MZBA 2HKXA 3TKYA 1XSXA 2GIVA 2VC0A 2QWWA 1IUYA 1WWXA 4PFQA 3IHUA 2HKOA 1L1QA 1YQAA 3P9CA 1FYMA 1O3QA 4LMYA 3DKWA 1DKRA 3JAMZ 4YFNF 1W4MA 4P80A 1TNTA 4RQAA 1PP8F 1YTYA 4WMLA 2P5KA 3K1NA 2PLYA 1FOKA 3BJOA 1ODDA 3ZMZA 3I0TA 2ELHA 4KT5C 2VE9A 2P5LC 3FZVA 2P6TA 1ZG1A 1SFUA 1S7AA 2F5EA 5H6RA 1U5TB 1LH0A 3WTTC 2FF4A 3GVAA 1R1VA 1O7FA 2QBYB 2FBKA 1TQPA 4IJAA 5HDKA 1LEAA 1Z6TA 2DPUA 4LLGF 1QPMA 2ADUA 4RS8A 5TJJA 5L3BA 5L3CA 1CF7A 1F9NA 4LZOA 1ZN7A 5LHGA 2FE3A 4G7OF 1H9TA 4L18B 1XB4A 2Y75A 1ZLKA 4ZYEA 1I13A 2J5OA 2OA4A 2L3DA 1D8KA 1RUOA 4P55A 2J5PA 2CO5A 3P9KA 4CICA 1KYZA 3KP2A 2HQRA 3ISPA 4XRFA 2RKHA 1I27A 3KEOA 1TTYA 1USSA 2ZNZA 4M9XA 2A07F 1LDDA 1FSHA 2Y48A 3L9FA 2VXZA 1KQ8A 5FB2A 3ELKA 1LJ9A 5LRRA 4LZAA 1C0WA 1EH7A 4AIHA 2Y0MA 1J7JA 1MD0A 1BI1A 2EFPA 5L3FA 2O03A 4I0AA 4Q4ZF 2RNJA 3LA2A 4HDVA 1FSEA 1ZHFA 4OIRF 3C3WA 4CO8A 3GWZA 2V1DA 2V9VA 1XCBA 2RDPA 1W7PD 3QAHA 3T1BA 1ZRDA 4ASNA 2PEXA 1FYKA 4N0BA 2EHJA 1HKTA 2IGBA 4JITA 1IN7A 1TBXA 2H6CA 1HKQA 4RHYA 3O7MA 1UPFA 2G7HA 2F2EA 2HFHA 4XLPF 5KVRA 3HRTA 3T0YA 2RC4A 5BS6A 2ZFWA 4ESJA 1YS6A 5EEGA 2JI4A 5LGUA 3EYIA 4NHJA 4UVCA 1HSTA 1BI2A 2DTRA 5DUIA 1TNSA 1HGXA 2JTVA 2DI3A 1I5EA 4KIGA 1RI7A 3M1EA 1U6GA 3OZGA 4EM1A 3JSOA 2COMA 2DPDA 2GXGA 5DCFA 3TOBA 3NEUA 5E38A 1BD4A 1G9SA 4I0BA 4KN6A 2E1NA 1SD6A 1KU7A 1V4RA 1LQ1A 4QYIA 4KUMA 1AWCA 2M1BA 1WI9A 2V1UA 2H6BA 1A04A 2WTEA 3MBIA 2XAHA 1RIOH 4EJOA 1GPH1 3MWMA 3RDIA 3QW4B 1IRFA 4LJZF 3COAC 1UHWA 2Z3YA 3WTUC 4ZYGA 3G6WA 4IHSA 1HMPA 1G6NA 1OYYA 2BYVE 3V7CA 4L5JA 2QENA 1XDUA 3HOSA 1LB2A 4QLCU 1OROA 2WNSA 5A2QK 1DUXC 5DCMB 4UHTA 2CW0F 1HSJA 3I71A 4MTEA 4MNUA 3VFZA 3P9IA 2MBFA 4A0YA 1WSUA 1MJBA 3QU3A 3LQRA 3E6BA 2JRTA 3E6DA 5F6FA 5IT3A 2NS0A 3SZPA 5HS7A 3R60A 1I14A 4QRIA 1ZN8A 1R1UA 2IP2A 1FLIA 4KN7X 4UNOA 5K5OA 3QOPA 3RKXA 1SFXA 2EFWA 2H09A 1P17A 3RI4A 5E18F 1G9TA 4Q47A 4MHGA 1FBSA 2VE8A 1YW7A 2L4MA 2PFBA 4ZYDA 4S2UA 2KJBA 4WF2A 3KP7A 5K5RA 2RVCA 5LEKA 2DO7A 4MEXF 1FP2A 4L9TA 1LEBA 3HRUA 2EA4A 2YZKA 2P5VA 3DV8A 3I5UA 3KLOA 1BIBA 2ETHA 3F8CA 5BPDA 4U88A 5HS9A 4RABA 5ED4A 5K51A 1R7JA 3M7GA 2PN6A 2YX4A 2EA2A 2L4AA 5J6XA 4EM2A 5TRDA 4WXCA 1UFRA 3OOPA 1T39A 1ZRCA 3DEZA 1IXCA 3U2RA 4RB2C 1P4AA 1MJ9A 2K4JA 5ILSA 3P7NA 2O8XA 3H92A 3RIRA 4N9HA 2HR3A 4KDPA 2PS1A 4L0YB 1YG2A 1O7LA 4EGZA 1EV7A 4LK1F 2CG4A 2QM3A 4OIQF 2PBIA 4AWXB 3E6CC 3FMSA 3WGGA 4LLNA 3GFIA 5D5UB 1P4WA 1K78B 2P1ZA 4B8XA 3HSFA 2IRFG 2G7UA 3IWFA 2L54A 3H83A 1JHHA 4OIOF 1MDMA 3FXQA 2MLGA 2K4BA 4P9UA 3QP6A 5D4RA 5HKLA 2RQPA 4HYEA 3KB8A 3ABUA 5DDGA 3TDZC 4KMUX 5E1ZB 1ON1A 3GFMA 1F4KA 1PP7U 1JXSA 4DQ2A 2QQBA 2W84A 4MB6A 5BOXA 1K78A 3FF5A 2CGPA 1V9SA 4XBFA 1RZ4A 1SD7A 3KCCA 4M72A 3WTXC 3HSEA 2CYYA 4A5MA 2EV5A 2NYXA 4EJTA 4RGXA 4UUVA 4QYIB 2CQKA 2ZXJA 3N4MA 4GO1A 1XTTA 2GAUA 5CVVA 4ZFNA 1DQNA 3GLXA 5F1RA 3HTUA 1YLFA 1Q1HA 3E97A 1U5TA 2QZ8A 3ZPLA 2IVMA 2CWEA 1U2WA 1P19A 5J8FA 2Z33A 4A6DA 2FRHA 4G6QA 3GO5A 1QCDA 3WE3A 4P81A 4I09A 1R5GA 1Z7UA 3M3HA 4KNYA 1KYWA 5ILVA 1L1RA 1FBQA 1ZLJA 4RAQA 3ACCA 3KP6A 2D45A 2JPBA 5JHUA 3C7JA 3FM5A 2OU2A 4BHCA 3SHFA 2PG4A 2MH2A 4LB6B 2HDCA 3GEZA 4WN3A 2JSCA 5LGTA 1ECBA 2HGCA 3T8RA 3WTVC 5BQPA 1D3YA 1K79A 1W5SA 1S29A 2XGXA 1FZPB 1BIAA 3QPTA 5CJ9A 3TDUC 3SXYA 1FBUA 2FNAA 5ILUA 2AEEA 1S6LA 1EH6A 2Q0OA 1XCVA 3RKYA 2P8TA 2UZKA 1BC7C 1TC1A 5ESWA 1R36A 4X45A 1G2PA 2JKYA 3HHHA 3K1PA 3BPVA 4X44A 3WTZA 1KU3A 1JGSA 1SD5A 4Z2YA 2H27A 1ECFA 1YW8A 2JT1A 4M71A 4YIIA 3B73A 2F5DA 2OAZA 5CYVA 2LNBA 4GGGA 3VB2A 4NQWA 3DXJF 4H0EA 3U9GA 4JLSA 3GX4X 2FBHA 5IPFA 1RNLA 3BP8A 4EJWA 3K9TA 1A4XA 3GGJA 4HBLA 3ZMDA 2KJCA 2A69F 4Z1OA 1XMKA 2DFIA 3F3XA 2K86A 1J2XA 1AO0A 5LRSA 3ZMTA 4HV6A 2YPRA 1OR7A 5IT9Z 2ZO4A 1ZGJA 3FX3A 2LSOA 2MC3A 3WTYC 2L02A 2FBIA 2UXXA 1OYIA 4RGUA 4R1HA 1D5VA 5BQOA 4ESBA 1V3FA 3ABTA 2W57A 4M73A 1MGTA 3N97A 3KZYA 2ZMEB 1S3JA 3LA3A 1REPC 2HCRA 3HUGA 3H3UA 1F5TA 3OHPA 4YIFA 3L2CA 5KK1A 1O3RA 5HLHA 4RHUA 5KAPA 1VDMA 2NNYA 1T38A 3CUQA 3BOQA 2VONA 4OMZA 3IKTA 2PRZA 5A2QZ 2PJPA 3LQQA 3WE2A 2MD5A 4F8EA 1SAXA 3PFIA 2DQLA 3LSTA 1MZVA 1J59A 4KICA 3S5JA 3RKWA 3EDPA 4PDKA 1XZ8A 2VBWA 5DCMA 1XZNA 2H06A 4ZYHA 2E7XA 4A0ZA 2OBPA 3LPNA 1SD4A 2LKPA 2EJRA 4A0XA 4CXFA 2K02A 2R7FA 3RPUA 2VFAA 1ZAOA 1B9NA 1MKMA 2H94A 3F8NA 4P9FA 4UV9A 2ZNYA 4CGZA 2ISZA 4GXOA 5HLGA 1BBYA 5EEHA 4ENMA 1OMIA 2GWRA 4LG0A 4U7DA 2H07A 2DAOA 4RANA 3CO6C 4LYGA 3E5QA 3ZP5A 2E7WA 4YG2F 1KGSA 2C4KA 3OZFA 1YS7A 3F8FA 2XKOA 4I7HA 2EV6A 4RAOA 3EQLF 2Q2EA 4L5IA 4U0YA 2XBUA 1WKMA 4Q5SF 3DPLC 4R79A 1X3UA 5LHHA 2DQRA 3QRFF 5E1WA 2CFXA 1YO5C 3JTGA 5E1XA 3CUQB 1DKUA 2R7DA 4RADA 3KFWX 3IC7A 1QK4A 5ESXA 1H9GA 1YYVA 4P96A 4P84A 4CYDA 4Y17A 4EV0A 4HA8A 1A97A 3GEPA 1FWZA 4Q48A 4S04A 1G3WA 1B4AA 1XGSA 4RB1A 2V79A 1IN6A 1D8JA 3CDHA 5BQTA 1UB9A 2RGVA 1U3EM 4CDGA 1TW3A 4HDUA 1QGPA 3SQNA 3W6KB 2XVCA 4HOBA 3V7SA 1P4XA 1Y0UA 2XAQA 1O3SA 3H3ZA 5HVQC 2BGCA 4U0VA 3NAGA 1P92A 2P7CB 5E8GA 1D6NA 5JV5A 1VCHA 2FA5A 1FT9A 1Z9CA 2QBYA 1R23A 2QQ9A 2Z99A 2WV0A 1KQ9A 5HOOA 1Z05A 1UCRA 2BV6A 5JR3A 3HTSB 1TQMA 5HDGA 1S7OA 2IW5A 2M8EA 3FM3A 2VT3A 4RB3C 1I6XA 6PAXA 4WX9A 1Y0BA 1IBSA 4LG0B 4I02A 2FU4A 2D1HA 4A5NA 1J7KA 5EUCA 2IA2A 2GA1A 1U9ZA 3CUQC 1I1SA 2OZUA 2V1XA 1L3LA 2Z5UA 3G73A 3K2ZA 5E8IA 4JK1X 2KRFA 4YFKF 3BY6A 5D8KB 3KP3A 3RYPA 4IVNA 2XRNA 3B02A 3I58A 4I2OA 1QZYA 3O3KA 1WQ2A 3JSPA 3D0SA 4AVPA 1FPQA 3ZN0A 4N9IA 3VOEA 3KLNA 3LAPA 4P86A 2EB7A 2ZCWA 4EVIA 5CVJA 5H6QA 3FXUA 1QZZA 1CF7B 1G4DA 4PZJA 3GUDA 3REOA 5KAMA 3ERED 2LF8A 2IPQX 2UWMA 4UV8A 1ZYRF 3L7WA 4F7ZA 2ZJ2A 3F21A 1GXPA 1DBRA 1LDKB 2XKPA 1HW1A 2QLZA 3KP4A 5DV5A 4Y13A 1A98A 4P82A 2YX7A 1OPRA 1XMAA 4LD5A 2IT0A 3I53A 3S2WA 2M30A 4FHTA 4Y15A 1QCCA 1A95A 2JKZA 5D8LB 4K2EA 3BPXA 3AAFA 4OOIA 2PMHA 1IN8A 3HHGA 4AD9A 4BH9A 1TLHB 3JTHA 4M6XA 3V8LA 2K7LA 4ENJA 2OZ6A 2PI0A 1TW2A 1QNTA 2ESHA 1I0LA 5JFRA 4PGHA 3QU6A 1USTA 4WK8F 2YSRA 4ZZDA 2HZTA 1I1GA 4L9NA 1FX7A 4OU0A 2AXLA 5H20A 5HLIA 3TO7A 2DLLA 2FEZA 2VOOA 4P3KA 1KU9A 1BN5A 3Q9VA 3MQ0A 3Q9SA 1MDMB 2QVOA 1U78A 3FMQA 2UXNA 4I01A 3R0JA 4YFXF 1BI3A 2GEBA 1NULA 3TQNA 3WGHA 1E2XA 1G3SA 3T8TA 2FOKA 4RB0A 4MQVA 4B09A 1IXRC 1B59A 1BOAA 2DU9A 1ZARA 1LVAA 3CTAA 3M8FA 5E20A 4WXDA 4M6YA 3GZ5A 4LLLA 4HAMA 3V8JA 1U8RA 3I4PA 2RN7A 3G3ZA 3ECOA 4HLYA 2EV0A 1DPUA 4FYMA 3FMRA 5K1YA 3ULQB 4I98B 5LHIA 1HW5A 4WCGA 1FYLA 5HS8A 2PQ8A 2XAJA 4HF2A 2EFOA 2K27A 2E55A 2P7VB 1JHFA 2YU3A 5L3EA 1ZN2A 4S05A 4ZH4F 2FXAA 4KYWA 4FX0A 3I59A 5HDNA 3N2LA 5ICEA 1YFHA 4UVBA 5AIPA 4HLXA 5DUKA 3RPQA 2Z9OA 5L3DA 1Z91A 1XSDA 3QPHA 1IN4A 1VTNC 3WU1B 4BHBA 2BE5F 2F5FA 1KU2A 2QUFA 3CO7C 4LB5A 1XGMA 3E6MA 1WD5A 2DBBA 2MA3A 3WTSC 3K69A 5CLSA 3RTRA 2KIUA 4A12A 1OYWA 5FFXA 2FSWA 4OIPF 1HBXG 3GFJA 4M0PA 2KIMA 3FWEA 4HF1A 1ONVA 3DPTA 4RAZA 2P4WA 1FY7A 5AONA 2VT2A 4L0ZB 2DW4A 2PRYA 2FXVA 1S8NA 3GW2A 3I64A 2ZBKA 3C1DA 4U0WA 4TV7A 2MH9A 1B9MA 4IXAA 2NAZA 1GVJA 3RYRA 3KZZA 3KP5A 3DF8A 3FXRA 4IF4A 3BROA 4M0KA 1H0MA 4O3MA 2GZWA 5IAOA 5CVRA 1K6OA 1R22A 2OQRA 5IT9K 2NRAC 2HTSA 1SMTA 2R3SA 2FNPA 3OV8A 4IHTA 1ULYA 4NB5A 4RGRA 2QYOA 1G3YA 5JI6A 5FFZA 1J5YA 2QQAA 2WC2A 5AIQA 1DP7P 5HIAA 2EFQA 1IAWA 5ICCA 3EETA 1NHAA 3ACBA 2XASA 3WG9A 3CJNA 5BMZA 3MEXA 2A3SA 1OPCA 1T0FA 2XHKA 1LNWA 1XTUA 1K7AA 4JQFA 3GFLA 2A5YB 1QK5A 3R61A 4ETSA 5BPIA 4IPAA 2HQNA 4M9ZA 1T98A 2G9WA 1PUEE 1E17A 3CUOA 4KA4A 3R6SA 3HOTA 2W85A 2OD5A 1QQIA 5L3GA 2HOEA 2JPCA 4EM0B 4XLNF 3HVUA 4CZZA 1LDJA 5ERIA 1O3TA 1P6RA 3DFGA 1Z1DA 1QB7A 3F8BA 3PQKA 1ZREA 3SZTA 5FLXZ 2ACJA 1W5TA 5CVIA 4HV5A 3L00A 1BZYA 2M45A 5D6FA 1FP1D 3F8MA 3HRMA 2BEOA 3MJDA 4KN4X 4FT8A 3I59B 3BZ6A 3F72A 2XUBA 1KQ0A 1HXDA 1XDSA 4BXUA 4BQAA 4RACA 5DYMA 4HX4A 4G94A 2DK5A 2VBXA 4OINF 3WODF 3F23A 1BD3A 2A6EF 2IJLA 1WRJA 5JVTA 3EYYA 1ZH5A 1R3UA 3KE2A 3ZN1A 1DDNA 5D5VB 4ON0A 2NNNA 3J81Z 2DT5A 1IW7F 2HS5A 3MZHA 1ZN9A 3D5LA 1QB8A 5D5WB 4GYIA 4HX7A 1QK3A 3ROUA 5DD8A 3RJPA 4EQQA 3GYHX 1ON2A 2IA0A 3HRSA 1DPRA 1XD7A 3DP7A 4P5OA 3GZ6A 2JBHA 1IRGA 2YR2A 1TC2A 3LA7A 3V4GA 2XAGA 5J8CA 2A6HF 4HW0A 1U5TC 2GA2A 3LFKA 4MEYF 4BHPA 3IRQA 2FMLA 2HTJA 4EMSA 1FC3A 1KA8A 4JBAA 4ENNA 1ECGA 3O2PE 2STWA 3DEUA 3WU0A 1XGOA 5BRNA 2A68F 3GXOA 4LYYA 3TGNA 1W30A 4M0UA 4O5VA 5LBQA 3IL2A 1R58A 3M9AA 1ZRFA 2ZMEA 1IXSB 1TQIA 4PAWA 1B1BA 3F6OA 3ECHA 2F5CA 1SFEA 1JLRA 4TWBA 1OKRA 4MGRA 4MTDA 2BBYA 2AS5F 5FLXK 2D2WA 2GXBA 1A96A 4IRGA 1W7PA 1R1TA 4HQMA 3L09A 3MZYA 2GQQA 4MQ9F 5ICFA 3K0LA 4LFUA 1GXQA 1L0OC 4D0PA 2ISYA 1UHMA 1SMYF 1YW9A 4HX8A 4GYGA 5LGNA 2VOPA 3K1MA 3WGIA 3MAJA 2W24A 2LF7A 2EWNA 3TOAA 1P18A 3LWFA 1W7PB 2XAFA 1R5HA 3V7RA 3FHZA 3J81K 1XGNA 4M74A 5D4SA 4IRIA 1YFZA 2PMUA 4HQEA 4WWCA 5LEJA 4FX4A 4WXHA 4EJUA 3J80K 2ESNA 2EK5A 3E5XA 1DQPA 4GCVA 3BJ6A 4G7HF 4ESFA 2XROA 4U7BA 4RHXA 1I0IA 1EH8A 4IJQA 3TO6A 2FQ3A 1J9IA 5K5QA 2HYGD 4PGGA 4G6DA 1BJAA 1A3CA 1HQCA 4ZZLA 3EUHA 3KETA 2M87A 3R0AA 4XSXF 5FGMA 2VODA 1ZG5A 5BSKA 2XIGA 4M9SA 3J7AO 2RV8A 2C6YA 3Q5FA 4AIKA 3W6JB 1B6AA 4BYYA 3KEQA 4QWQA 5FD6A 2O3FA 4ENKA 2LDUA 4LGWA 1VSTA 3F6VA 2HEOA 1CJBA 4DNCA
chains in the Genus database with same CATH superfamily
4DILA 4JHLA 2X85A 2DVMA 3A1VA 2FE4A 2NQ2C 3GUCA 2N47A 1G8JA 3PNBA 4UY8I 2GEKA 4YIRX 3WZMA 1R5NA 3OYAA 4R9UC 5F4BA 2CLHB 1WSAA 2E5FA 3AJ8A 2RIRA 2BMWA 4N5MA 3ZWOA 2EIKH 2W2KA 5L45A 2F00A 2IK8A 4RU1A 4PBRA 4A2CA 1U3TA 2ZTMA 3A1EA 3EXG2 3KR9A 2QLJA 4Q1VA 4F96A 2AOUB 2G9UA 1GPAA 1OCCH 4HF0A 1NVAA 5B1HA 1O9GA 4AZ3B 2VKEA 2WD9A 3LOQA 3RFVA 2PUEA 4FCWA 2G63A 3WGNA 1D09A 4MW7A 5K6AA 4HUJA 1C1XA 2H59A 3R4KA 3W2HA 4GHWA 5LMUB 2QSYA 2I22A 2OSVA 3IDOA 4KJXA 4RV4A 2XT9A 1ISPA 1MEOA 5DYGA 2PWPA 4CT0A 1H69A 3M7IA 4N3AA 5EJAA 1XVIA 3QSYA 2V7BA 4W8GA 1XTVA 2KSQA 3QK7A 4FLFA 2QG4A 5D5HA 3ZMSA 3DBOB 2Q2VA 4IW3B 4E32A 3N2KB 3MLAA 1T15A 3LD9A 2R4UA 3SEAA 1OQYA 3AEKA 3R74A 4EIWA 3W34A 3I42A 5JTUA 4G9YA 4E4HA 1IUFA 2APJA 2HMWA 2NX2A 4JB0A 3RYHA 2F9LA 1H0RA 2XCIA 3DE3X 1GHCA 1PCXA 1SPBS 4HQFA 5EP4A 3PX2A 5EMNA 2WC1A 4QJ3A 5K6AC 1EWVA 2GD6A 3FF1A 4CKBB 3X1KA 3C18A 3MGGA 1I2MA 3K53A 4EJ2A 1JIIA 1IIRA 1DTSA 1TF7A 2AJTA 1ANKA 1S9DA 1MLDA 3EFHA 5CURA 2PGDA 4OQQA 4J01A 3RUAA 1W46A 4FKBA 3R75A 2ZRKA 5IYZA 2R7WA 3CONA 1XSVA 3LSGA 4RK1A 1GCAA 4UMEA 2QD4A 1M54A 2E4YA 2NV6A 4R0NA 2G08A 2ZT5A 1BA5A 2XADA 1SWVA 2ZAYA 3D6UA 1MX1A 3E5UA 1UPUA 2VKQA 3CUVA 4IRHA 2ZJ8A 4UOEA 2YVKA 4ZHQF 4B5LA 1U28C 2VJAA 1JR3A 3ZBPA 1DX4A 3V1LA 4PXAA 4Y6PA 3R7WB 5BR4A 2JBAB 2L7MP 3PNMA 1RXCA 3Q9UA 1TM1E 2AMJA 3IUMA 3Q3JB 1XLVA 2W5UA 2WNHA 4TTPA 4F1WA 1AJEA 5FKOA 1E9CA 2F59A 3RYFB 4BAGA 3PXDA 1G21E 5IEBA 1UWKA 1WB9A 1O3YA 4QLOA 1F2VA 2MSEB 1PWZA 4UUAA 1NBME 1ZRNA 1GLGA 3V8KA 4Y30A 3M1CA 1NN5A 1Z26A 4P58A 2O59A 4NEHB 2JH9A 4RY0A 1BSVA 1RUNA 2RG7A 1I6KA 4RHTA 2AYZA 4W1UA 4FOSA 4URYR 4P7GA 1WUJS 2YWRA 5PGMA 2DY0A 1RETA 5AKKA 3MT9A 4IFTA 2QTVA 3IUQA 3SHQA 1PDNC 5E7QA 2IQ5A 5HA5A 3U13A 5IVPA 2KZVA 5BW8A 2I3ZA 2Z83A 5C5EA 2VDJA 2R7OA 1CERA 3IR6A 1RP1A 4C7VA 1C8KA 1FEZA 1JKMA 2NS7A 3A9RA 4RKFA 4TROA 4DJFC 1PJTA 4G9EA 5JNSA 1II0A 3ZHYA 1F1ZA 1JFLA 1UMKA 1J8DA 3GCWA 4GYWA 1FP4B 1R4MA 4QPJC 5BUQA 1TK2A 5KOHA 3BGVA 3LDAA 4XOIA 2BFEB 4F7WA 1SBCA 3UXMA 3CLOA 4RLQA 4TTQA 2IV3A 1IH8A 3AVOA 1UFMA 3AU9A 3TVTA 1C0EA 4NDLA 2WSYB 5EPUA 5GIPE 1LVKA 4WK2B 3OKAA 1OVGA 1TT5A 2GPAA 1IONA 3DYBA 3HSKA 4A3MJ 1WOMA 4AIJA 2HBQA 4EJVA 4DBZA 1T8TA 1Z6PA 1E6KA 4I2VA 2WAAA 3TO9A 3M70A 1KYYA 2UZ3A 5DN9A 1Y9EA 1G6HA 4M1YA 4M99A 3BTVA 2AXTC 4H3HB 4UEQA 4EFLA 721PA 3UAVA 2G8NA 1SCIA 1IHPA 2WFLB 2XVAA 3CRMA 1MRSA 3VR0A 2KPOA 2AC4A 3DUFA 4Y1RB 3SXJA 2C98A 2JGKA 4M0UA 3U81A 1STOA 2VBZA 1EX1A 4A3KJ 2JAQA 3RAGA 3NHJA 4UD6A 3WXMA 4RQBA 4ESOA 3GJ4A 2VG8A 1T9GR 3OYFA 2E71A 3DV2A 3HKZN 2VF5X 4GM4A 3WK7A 3GLGE 4B43A 1VJ0A 3EWSA 2QEQA 4HMPA 2VJLA 3LKDA 2TDXA 1K3TA 2IP1A 3OZTA 1JLSA 1JPNA 3R0VA 2VL7A 5CA1B 1ZUNB 4XDGA 5H8WA 3K6JA 4O6JA 3KJZA 1VJTA 4LJYA 3C8MA 1YIOA 3V1KA 4EI2A 3W8DA 4NCNA 1ECCA 2H08A 4Y6SA 4YRPA 3EGDA 7REQA 1JR6A 3IOEA 1MJAA 1ZK0A 2H65A 1L7OA 3LKZA 5KBYA 4YQZA 1IWPB 1RYHA 2WJVA 5TJHA 1J56A 3IB3A 3O75A 4DV7B 1H1LB 3QUSA 1G66A 5E17F 1WCXA 2G5GX 2GA9A 3E2MA 3LNCA 3VUFA 5B2EA 4OUDA 3O92A 3TQTA 4DLXA 5BN1A 1X9GA 3OEHD 4AS1A 3HDJA 3I05A 3MFKA 4C7JA 5C7OO 1NBAA 3AWIA 3D2CA 1ZOIA 2D74A 2ZIAA 3A1NA 1P77A 1PTJC 4MX8A 1QTQA 4A2UA 2QTFA 1OFCX 1RRFA 2P2DA 3MELA 3NM5A 3PRHA 3D8TA 5B3JC 1QG2A 1BFDA 1UJ6A 1YL5A 2V65A 5D87A 3NNNA 1CZHA 3F22A 1PQ4A 3S2EA 1HW2A 3THWA 1OXUA 4F4UA 2MMCA 3HIFA 1CFJA 1EK6A 2XNJA 4HQRA 4PZUA 5TB5A 3UWDA 1NONA 2O3UA 3KZCA 4RGQA 4RF2A 5AHOA 3NDJA 3ZOKA 4LOKA 3TX2A 4L9VA 1QBJA 2YVUA 1MJFA 4WLNA 5LU9A 3AZQA 2FQ1A 4RGSA 1Z0FA 2QJOA 4Q1CA 1TCAA 5BSMA 3L05A 1TYDE 2BFPA 4I8DA 3BZBA 3T1NA 5CDTA 1VCOA 4UVAA 3O84A 4LSGA 1OV6A 1TADA 2FW7A 3OZSA 1QTNA 4NCJA 1V8DA 1E3OC 1NWHA 3BWXA 5DW3A 4WY8A 4NTZA 2GCIA 1JWAB 1FJLA 2M32A 1CY6A 4K26A 4K6MA 3RC9A 2MSNA 3KHKA 3OLYA 4UNQA 4I99C 1AY0A 3H6HA 3LRTA 5CW1A 1ZIOA 3NEJA 3O6BB 2W7NA 3F6CA 2ZSFA 4ACAA 3OPYI 5JS8A 2WD8A 1KJWA 1L3BA 4LTDA 4NOKA 1U0NA 5FKJA 3HDYA 5A0FA 2V6FA 3WY9A 4XQGA 3FR7A 3NS7A 3MBKA 2WILA 3OF2A 5IT5A 4C7OA 2EKLA 1G9XA 1ODLA 2P2CA 1X6VA 4ND3A 3EZXA 3TW4A 4V0OA 5I7SA 1HEYA 2ERCA 4HNTA 3V8PA 3FTEA 1BVYF 2QWWA 4BUJA 3HACA 3IMEA 3VOTA 4V0LA 4PFQA 3C43A 1F0PA 3BB1A 4U6QA 3G2QA 4C0LA 2D7JA 1XYGA 4F45A 2DFNA 1G63A 1YQAA 3OEED 4JOBA 4QUEA 3WAJA 3K9FC 5IT0A 3ESZA 2CK3D 3R7AA 1Y7IA 2CNKA 1WHSB 3AF3A 4I1IA 1IBKB 3W7VA 2KRCA 1G6OA 3KP1A 3DEJA 1S8AA 1NV8A 4JLVA 5REQA 1GL3A 1OXKB 3GROA 1IWOA 3COYA 3ZLBA 2LDXA 1IJFA 1NZDA 1OHHD 3T3GA 2BSAA 2RKWA 2AD5A 5KNCH 3P2IA 3U17A 4TKVB 3LX8A 2VZ9A 3B6JA 3PD0A 1S7EA 2ZYUX 1TNTA 4LAFA 3FPBA 4AJPA 1XK6A 2GRAA 4E6PA 3H9UA 1XMSA 5A3JA 1SBNE 4H7DA 1PJBA 3TMKA 2A78A 3VO1A 1DTWB 1X9IA 1E2HA 2P5KA 4L2IB 1FVXA 4RVOA 2AQKA 2Q41A 3ILVA 3K6GA 3GRKA 3ZMZA 3I0TA 2ELHA 1OT5A 3BMCB 2ZJQF 2VDKB 2ZT7A 3BICA 2VP0A 3GLTA 5PNTA 4AQYB 5CX4A 3AVQA 4FYXA 2P6UA 4Q1BA 5BW5A 3WK8A 2QI9F 4M49A 5DV9A 5TPZD 1PJAA 1RKQA 2F5EA 1P9OA 2X8BA 4YALA 4AC9A 3VVCA 5A7FA 2G83A 3G8YA 4FFRA 1HORA 4P22A 2YXNA 5ULLA 1LPPA 2ID6A 3GVAA 2BFAA 1YITI 3BCUA 3GA7A 2BKVA 3DC2A 3GVHA 4NC6A 3R3VA 4FOOA 2IYUA 4HGOA 4OP3A 5ALDA 3HGMA 6PFKA 4EHHA 3IUYA 4D4LA 1HFJA 5TIIA 1Z7BA 1QHHB 1JPJA 5HDKA 1MNMC 1TYAE 5K3AA 4NC8A 3VR4H 5CLJA 5LQJA 4LLGF 3SFIA 2GS9A 2J0SA 3LF1A 1N8TA 3PRKE 4E1AA 4L08A 3DT6A 3GD7A 3KQMA 2YWHA 3VOBA 1A9YA 2FEWB 2EQRA 1K4YA 1IRZA 2WW8A 3AL2A 4LY0A 1T2NA 3WHLA 5TJJA 1JE1A 1TMYA 5L3CA 3V2GA 3PL1A 1OFVA 4NV1A 2GNPA 3DE2X 1RP7A 3SK0A 4MVJG 3TAUA 4IQ8A 4G5OA 4H77A 1N5LA 2ZWPA 3B60A 4OSEA 3G7NA 1U0BB 4AZVA 4XTCS 4HTFA 4EPVA 2DJ5A 2Y75A 2QT0A 2QPLA 1M8JA 2W2MA 5JDIA 2BY1A 5HP4A 2HJGA 4IEIA 4ESVA 4FM9A 1CK4A 3WR5A 2IUFA 2HWWA 4ZYEA 1I13A 3RBVA 1RXWA 4CM4B 2X76A 5DZSA 5LP1A 2J5OA 2OA4A 1FLAA 2DKFA 1G3UA 4IIJA 4RVHA 1KSJA 4LKRA 2ZUCA 4V03A 1B93A 1NW4A 2XMRA 1USVA 1X9HA 1JKOC 4OBBA 1ACMA 3M3DA 3GP8A 3LPAA 3BMQA 2CKDA 3MOIA 4WK0B 3ZXXA 3GFRA 1K27A 4XPIB 4YONB 4CICA 1VYVA 3A6JA 3AOGA 2MDTA 3K5WA 5I7WA 4RFSB 2ZVPX 3L4BC 4B6SA 1DU0A 3PLNA 4GECA 4WUTA 1BHJA 4YCCA 1BDHA 2HLDD 1KMNA 2O2CA 2RKHA 1NM5C 1QE0A 2HWKA 3KEOA 5DB4A 2YHAA 3EUWA 4JKOA 2VZEA 1I3MA 1USSA 2M7AA 2YCBA 4I1UA 4L9RA 5C0OE 3NASA 2Z58A 3X1MA 1FFCA 1EHIA 3RQIA 1XU7A 4M9XA 3GNQA 4KLZA 4CT4B 2JFWA 3OR1C 2X0KA 1NHGA 1V16B 1YS4A 1LDDA 4V3CA 3WWDA 1FSHA 3L9FA 1CKEA 2JCXA 3MLEA 1KQ8A 4O4LB 2DQKA 1E5LA 4QT4A 5FRMA 3DBVO 1W5CC 5TV2A 3QMMA 3RIXA 2DF8A 1EM8A 1JSXA 1YRAA 1YL6A 2C59A 2G9RA 3KJIA 3NOVA 4XVHA 5K3CA 5JZVA 1ZKDA 5LQNA 3N2KA 1KPHA 1QIGA 2A3NA 3HWX1 3ILSA 1PTJA 1NW8A 4Q4DA 4BOYA 2DSTA 3M4OJ 3CCJI 1RR7A 4GSKA 4R31A 4CM9D 1XCPA 3NWOA 3OICA 2E35A 3RK0A 4GG1A 5FF9A 3ZW7A 3L2QA 5C7IO 3PC8C 4UNNA 4G6TB 4BNZA 1RXUA 4F71A 3FOEC 2O03A 3K73O 4ZREA 2CJPA 1U0LA 1CE8A 2CVHA 1AKWA 1FDUA 3HCEA 1K86A 4LZWA 4B0PA 4D96A 4F5ZA 4F6CA 3LA2A 4PK4A 3EQZA 2PNFA 2VLIA 3QWHA 1IHOA 4QLBA 2JFPA 5DX0A 1UMQA 4F97A 1QO0A 3NWPA 3MJHA 3C3WA 1MP0A 1F5SA 3EEBA 4G8CA 3WL4A 2AFHA 2V1DA 4G8DA 2XCUA 1PLLA 3FFXA 1YVPA 1BR1A 2RDPA 3W5VA 3LIPA 1R3DA 3T1BA 4GLJA 4D3SA 4ASNA 4CN9A 5EZ5A 2K6GA 2FPRA 1FYKA 4LXQA 1Q44A 2GM9A 2IGBA 3ZBQA 1KORA 4PFSA 4WL0A 3SHOA 3WIBA 4KQ9A 4YP0A 2JFUA 3D0RA 4RHYA 3NP9A 1UPFA 4EEFG 2C3PA 2WJYA 4YDRA 4EP1A 3W2IA 1ZL0A 2Y0SA 1W44A 3E2IA 2Y71A 5KKNB 1L0BA 4IDAA 2HFHA 1E2IA 2AF4C 3SM3A 4C4YA 2HV9A 4JBXA 5EQFA 4Q93A 4DT1A 2FRVA 4XLPF 1CF2O 2ZKLA 3UHOA 3V8MA 4LG1A 3HRTA 3T0YA 4WGGA 4EJMA 1I01A 4DSOA 2ZUSA 1HI9A 2JAPA 2QL6A 3K9NA 1M2EA 3ND5A 4CYMA 1XWIA 2BOLA 3MVEA 2P8JA 5AK6A 1YS6A 4BMXA 4L02A 1QFSA 3LUGA 4ER0A 5M7EA 1AKRA 3CISA 3PJGA 3M4ZA 1S2DA 4OREX 4CQNA 3ASNH 3BORA 1N5JA 3IXMA 3MTIA 3GYBA 1TK9A 1ZCJA 5FA5A 5KYUA 3HPHA 4BQSA 1A27A 4GU5A 2VYCA 4NHJA 2I76A 4UVCA 3LPMA 2CH0A 2HUPA 4MKIA 4RL4A 1O2DA 2CEKA 4I3HA 2FLKA 3V55A 1H6CA 2CNDA 4LX8A 3VDXA 1MCZA 1XAJA 4HPJB 1XZGA 3FYHA 3OQ6A 4OI4A 1DOHA 4DEVA 3PXGA 1XELA 4EJ6A 3ADPA 4H4DA 5DUIA 1SOUA 4TWIA 3IBFA 4ZC1A 2BFEA 2JTVA 3OP4A 1KFBB 5GJCA 5B7PA 2FMUA 3M6XA 3OPQA 5IM5A 4BDZA 5IJ0B 3IVGA 1FX0B 4CTOA 4O4HA 1P31A 4EEKA 5HSGA 3MOGA 3EZLA 4HDMA 5KQMA 3T3OA 4EM1A 1N2CE 4FWBA 2CVFA 5JPIA 5DM2A 4CG0A 4EW1A 2VDRB 1GNVA 1U7OA 4XKCA 4M1ZA 5BURA 3IBYA 4R2MA 3AP3A 2VQGA 4HQLA 4GM1A 2H1HA 4PYOA 2J7PD 3KYBA 1PT8A 3OFNA 1U2DC 1NN0A 1E1MA 4Y6LA 4EWLA 1XD2A 2GTIA 1RBQA 4B33A 4ZMBA 1LQ1A 2CUEA 2L9NA 1CY0A 4QPQA 2Q9AA 4DIFA 5KJ6A 3EC7A 2HJWA 3DT9A 2X2FA 4OHFA 3WL6A 5JADA 1AWCA 1E6MA 1PR0A 3CLSD 2X8LA 4E2ZA 1QYDA 2NZJA 5E3NA 3C14C 3PR3A 3UJ7A 2CV0A 1F7VA 3O8DA 4B7AA 1QQ7A 3QVTA 5ECDA 4CPDA 2ZJ0A 1MRNA 5COQA 1G2HA 1EVJA 2W2LD 4QYXA 3FPLA 1PWYE 3CG4A 3Q0EA 2XAHA 3WAGA 1NXWA 1A5TA 1L7RA 2GERA 1F9EA 3CURA 1PP4A 1RI2A 4AUEA 5FDFA 2O7RA 3QG1A 2QA5A 3RDIA 4LNUB 3SLRA 5DLQC 4OHZA 1C0PA 3QW4B 3ZHOA 1NXQA 1WNTA 4RYLA 3RWBA 3VRHA 1EWQA 1ORWA 3T9BA 3U19A 4M87A 1XZHA 2DKNA 4I1SA 5LLSA 2NP6A 3P9ZA 5KTRA 3EK2A 4TQGA 5HF5A 5GP9A 1NLFA 4F5YA 1SQGA 1YHZA 2C99A 3D3QA 3NFYA 1RHMA 3OJCA 5CIQA 5HNKA 1B6TA 1XTBA 5CEJA 3IOBA 2P78A 3G6WA 2QT1A 2ZE6A 4IHSA 1HMPA 3OFVA 5DH9A 3SQDA 3ZXUB 1OYYA 1BDMA 4IFIA 1A8UA 4AU1A 4DV6B 1S5PA 4HJXA 1XDUA 1MH9A 2ZIEA 2OBXA 5F2KA 1NYLA 2I2CA 1Q0UA 2ZYHA 3FH0A 2X8JA 3D4IA 2VJMA 4GEGA 1DUXC 4NC7A 1NBMD 4Y1GA 3HY6A 4UHTA 1T8IA 2JGJA 3FN4A 3KO8A 4YVFA 2CW0F 1UDBA 4O5AA 3KWLA 3R6GA 4KC0A 3G2JA 3HY3A 1Y1LA 2W2XA 3VFZA 2GZAA 2P0AA 4RPCA 2MBFA 2C8JA 1CJSA 3RI3A 1EFTA 2GT1A 4FU0A 4RXUA 1IV8A 3R1IA 3NWSA 4QULA 3M6VA 3DFUA 3QVMA 1LFUP 2YCLA 3CLUC 4OCZA 4TMFA 4JYPA 3TLMA 5A62A 3E6BA 1UOOA 4IICA 4BUCA 3EUKL 5J2TA 3EVAA 3R7FA 4G0WA 4KWEA 5AXDA 1QRRA 2Z2JA 3K1AA 3SF8A 1H1DA 4YJ3F 4A9AA 4AXBA 4G0MA 4O6VA 1JUMA 1SQ5A 2IGKA 4CMHA 5DMXA 4PN7A 5K8JB 1ZRHA 1OBCA 2B9VA 1R0CA 3G2OA 2XRLA 3GARA 4C7OB 4OVKA 1NUQA 3AY7A 1TZMA 2P4UA 4EUFA 2ZUEA 2C78A 2D1SA 4DSUA 1FPMA 1HQDA 4RETA 2EU8A 1CRWG 5GM2A 1N4AA 3SSNA 3WMEA 5JHHB 3PSFA 5J2TB 2XZDA 1XPOA 4HSEA 4HVCA 1O95A 4QGAA 2FQWA 3AERA 4QVGA 5AVXA 3A70A 1JDNA 4UNOA 1LCIA 2EL7A 4N3NA 4YJGB 3TXYA 4BTLA 5L3QA 5K5OA 4S1NA 1PV4A 1KR5A 2YMPA 3UW1A 3H0KA 1QWOA 3CEJA 1FDRA 4QDTA 1NU6A 2H09A 3SPXA 4LOIA 4Q3DA 3W5DA 2I8DA 5E18F 2CUNA 2XYPA 2YMLA 3VSKA 3CD6I 3E1GA 1G9TA 2LK2A 1LA2A 2LBFB 5KYWA 2ENUA 4G6ZA 5TSDA 2XUHA 5LUBA 2LP4Y 3N2NA 1QM5A 1DEHA 1FBSA 3BDIA 4XYBA 2X6TA 1W93A 3IC5A 2QORA 1JDBC 4R2HA 2EKPA 2IW1A 1WRBA 1DTWA 3Q85A 2HDDA 3T7CA 2EKQA 3UXEA 1SG6A 3BF8A 5CPRB 1EVIA 3EWIA 1ORVA 3ZZNA 3HXMA 1PR6A 1RXEA 5J4VA 1YX3A 1KPIA 2ECFA 4PLFA 2PFBA 2FG5A 3T1VA 3BMCA 4NESA 1U3GA 1ETUA 2KJBA 3MXOA 3GLIE 4WF2A 2OO5A 3OJLA 3PQEA 2E5NA 4XGQA 1W1WE 2X22A 4MYSA 1MOSA 3R44A 3WMFA 1K4MA 2J9FB 3PXAA 4CCWA 1L5YA 4XWWA 1ZOLA 5LEKA 2CLSA 3MJVA 3MC1A 3UT5A 4MB0A 4S1TA 3VAZA 1AE1A 4LJ8A 2EDCA 2IS2A 1QIFA 5KTMA 3QLUC 1LEBA 1IUNA 1LBQA 2EA4A 3L2WA 1GXSA 1U2PA 2XF2A 3N8NA 3TR0A 4WOJA 1RTTA 4I3GA 3KLOA 1CQIA 4RV5A 3CRZA 2YXPX 3L49A 5GADl 3M6AA 2ZK7A 3GLQA 3FHCB 3F8CA 4B3MB 1G0NA 3ENWA 4L76A 5JRJA 1EP9A 5BPDA 3SYMA 4RJKA 3KOWA 4U88A 4WCVA 3G5TA 5HS9A 3EUFA 5K4AA 1QGED 3CR8A 3FJ1A 1IG7A 3ANYB 1R8YA 5HNFA 1SK9A 3AR7A 3N7TA 4M36A 4U2EA 3LVBA 4L9WA 4W6QA 5K51A 2D2XA 3FG9A 3DHNA 1GN8A 3PUVA 3KXLA 1L7BA 3IBSA 1YTLA 1ZLXA 4WOCA 2CDAA 3ADBA 3TIGA 2EA2A 1JKJA 3DTTA 2L4AA 1QGUA 3LY5A 3QFSA 3E3OA 4N5HX 2ZJ7A 3HKCB 1W0JD 4A3LJ 1IM5A 4WWHA 5B36A 3BMNA 1UFRA 4HTFB 1C50A 3SIXA 4MQFB 1S5LC 4LY3A 4YP6A 3DEZA 4DN6A 1T0PA 1XRRA 2BZTA 3JPYA 3FKSA 1I1QB 2FN9A 4FCYA 1SUDA 3JQRA 1EQAA 1XNJA 1F2UA 4M22A 1CQJB 1MO4A 2PO5A 5EJ6A 3CCYA 4EKYA 2OCCH 3A01A 5CFRA 4PFJA 2PS9A 3F1LA 2DG2A 3VSDA 1KP2A 1JAIA 3I09A 5GMOA 4RYDA 2QKMB 5KDLA 3NR2A 2IV2X 2M0MA 1R49A 1GKUB 4QQFA 1SZJG 1VZ0A 3QF4B 2DT7B 1DEOA 5JSYA 4LK1F 1GL6A 1XL0A 1V26A 2GKOA 5LB4A 4MDFA 1U63A 1PJRA 1JJ7A 2VKTA 3HADA 2QM3A 2FX2A 5ALYA 4XZ3A 4IHJB 2DUWA 4NG5A 5J2UF 1LX6A 1VE3A 4X24A 3H36A 4AWXB 1QVRA 2HJHA 1JYEA 2F48A 3RDPA 3FMSA 2CMKA 2ISCA 1NI5A 2XCTB 2WIBA 4X90A 4D9KA 3FNHA 2GEDA 3BD8A 2FEAA 4RCVA 3TINA 1AHIA 4D3ZA 4E31A 1UH5A 2ZWMA 3IHTA 4O0LA 3O9VA 2WYHA 1ZO8A 4RV9A 3EQ9A 3GFIA 1HOXA 4LWPA 3N5KA 5ER9A 5GIOE 5D5UB 4LJ7A 2PMZA 2IODA 3BXEA 3FPGA 4L72A 2VR1A 4AY6A 1DCTA 2DCUA 2VP5A 2WUVA 2IRFG 2G7UA 2WY7Q 1Z16A 4IVPA 2L54A 2CLDX 1JUSA 1A5ZA 3H83A 3HCCA 4XB2A 5D3MA 3OWXA 2R1UA 1D4AA 3AUFA 4PCVA 4B1RA 3RF7A 4C2BA 1MDMA 5AM2A 5BWLA 4C20A 5J23A 2MHCA 3PFWO 1KZ9A 5TVGA 2MLGA 3IDAA 1V55H 3FUXA 5D4RA 1A71A 1FDVA 3MSXA 4H31A 4QU9A 3VZPA 4HYEA 5L51A 3S3OA 1JAYA 3JRCA 1RYBA 3ABUA 1NP3A 1SR8A 1WE2A 1WZCA 1WUYA 2WUFA 4KMUX 4K5QA 4MRNA 4MVXA 5U4QA 3A4TA 1UBNA 4M2LA 3IRVA 4HDNB 3MSCA 1GTJ1 1PP7U 1SULA 1QVUA 2CB9A 4MRAA 3ANNA 4DQ2A 1Q2XA 2HEGA 3DMTA 5GINE 4AKGA 4BEBA 1QJ4A 3K8OE 4JDPA 1LPOA 4LOJA 4Y0VA 2PKYX 4LRXA 1PGQA 1ZCZA 5BOXA 1NVTA 3U9SA 1EK0A 3NHUA 2CFCA 5E1OA 3WGOA 2BI4A 1X4PA 1U2TA 1ZL2A 1IOWA 1THZA 2FUG6 5EINA 4B9EA 2G1UA 5TT0A 4L28A 4BNFA 1SD7A 1GA4A 1VI5A 2ZQZA 3KCCA 5GV8A 3W8EA 4M72A 4RULA 2CHQA 4DE5A 3HXQA 1QDLB 1H2FA 3E7LA 1AGRA 1FQWA 1L7DA 5FLYA 3DA8A 3H9JA 3PFHA 4ZICA 3HSEA 2IJGX 1J8FA 1JJ8C 1VQPI 3H5WA 4PLCA 2DR3A 3H2GA 4PX2A 2EV5A 2NYXA 1JLLA 2CMGA 3RUDA 2JA1A 2P6RA 2GOMA 3G0HA 1E89A 1USKA 2DPYA 2HXGA 1EEHA 2HKIA 3IH2A 4B47A 1QWSA 2SNIE 3H1PA 3FWHA 4K6KA 2BGTA 2L9SA 3CR7A 4M38A 2YHUA 4Q9DA 4V3BA 5EWJA 1FTTA 1RMQA 2N75A 2G07A 3VR5H 3R2JA 1RW4A 2WDPA 2JANA 1KL7A 4W7SA 1MBKA 5BSEA 4IXTA 2GAUA 2NYAA 5CVVA 1GLVA 1QJCA 2NO6A 3BQ9A 3VPXA 3WGZA 4ZFNA 2J4DA 4JNKA 1DDIA 3HN2A 4ZVSA 2Z2SB 2QTHA 3BHMA 4D1YA 4UTRA 5F1RA 1BQ3A 3E22A 1FYXA 2A0FA 3HTUA 3HCFA 3PXXA 4PS0A 4FYYA 4CHGA 4MROA 2ZUVA 4D0NA 5C44J 4XM1A 1YLFA 1V0JA 5ALGA 3RO7A 3L8MA 4BMOB 4RAGA 1W1UA 1G8XA 2XRMA 4RIIA 5CHYA 4ZOEA 5KWSA 4K87A 1I80A 2PLNA 3H1FA 2LV8A 1BG6A 3PCXA 5DISB 5FOTA 1U2WA 3QOEA 1RLTA 1YONA 3ICCA 3KQPA 1J0AA 5J8FA 4J0DA 4DV2B 3WHCA 3VU1A 4PWYA 3K4JA 3JQFC 4AJ9A 2WSBA 5KINB 1QCDA 3GO5A 3PFCA 5CMLA 4DA9A 3T1HB 3WE3A 1EX9A 3H0CA 4FW8A 4ITVA 4JIMA 3QUAA 4MCJA 4URUR 2II6A 3NTVA 4N48A 3M3HA 4KNYA 1KYWA 2QN3A 5CIWA 5DF1A 1L1RA 1CP3A 4ZAGA 2XRFA 3TB4A 5CK5A 2PX6A 3R7WA 5A2GA 1XTSA 4EY6A 3K8YA 1F1BA 3CPHA 5L40A 3UXHA 3Q5DA 3KPUA 1GFIA 2JPBA 3GMTA 1Z7WA 2VQ6A 1SXGA 1AUOA 3HJHA 2NVWA 4E08A 4F04A 4Q4CA 4PYRA 2MH2A 1JH8A 1I50J 3M9LA 1GAXA 1JI8A 1NDQA 2QVXX 2PXAA 1P5FA 1X3SA 2HDCA 4GGMX 4WN3A 4ZMSA 1RZRA 1Y3BE 3ISTA 2TRTA 2JAHA 4OATA 4XUDA 2W43A 5CT5A 1L5WA 3PQCA 2C29D 3LHSA 1FTWA 3ESYA 3HA2A 4MQBA 1XWFA 5BQPA 1E2KA 2HA7A 3DV0B 4J4BA 1K79A 4DJ5X 3OCUA 1ISGA 3CVUA 1E1QA 1QH1B 1TU4A 3SX0A 1E3PA 3GJXC 1C14A 4MFEA 1T3LA 3MJRA 4K9PA 1DC5A 1BIAA 4CT5A 1SXPA 1E7RA 4Y4RA 3MS7A 3VGPA 1AB5A 2J3LA 2BHLA 3SXYA 3GEGA 1U0GA 5AJYA 4JOCA 3QU7A 1QYVA 3GA5A 1FBUA 3RGWS 3YASA 1R2QA 5F52A 1J8YF 2CBXA 3CT4A 3RV4A 2GNAA 4Z9YA 3WLSA 2AEEA 3CNHA 1LE8B 1PF7E 1S6LA 3FCOA 1KK1A 3S1LA 4HXGA 2F1IA 4QM6A 4BBAA 5C2JB 3ZDZB 1H3EA 4HH1A 4BKXA 1FFBA 1TJPB 3VKFA 2W4MA 5IJ9B 2UYCA 4WV3A 1HYBA 5ITWA 1KETA 1GIAA 2G9ZA 4HWRA 4ND8A 2ZXUA 3L6EA 4EM6A 4YR7A 1MX5A 1BC7C 1OTYA 4J19A 1NQAO 1RD4A 1D5YA 1VMKA 1FP6A 1G2PA 1XEAA 3HHHA 2QD1A 2F4IA 2XUQA 3HS3A 1MD9A 2VOEA 3T35A 4CR6A 1LNZA 2A8YA 1QHSA 3FPHA 1KU3A 4X44A 4BTVA 2ZVJA 5DP2A 3L4EA 1SD5A 2H27A 4O02B 5ES3A 4LGYA 5K45A 5WRFA 1B4DA 1DV1A 4AX4A 3O90A 4IJWA 3BFXA 2OAZA 1XTKA 3QKSA 4JUDX 4MQ5A 3Q8XB 1W6RA 2ATVA 2HN9A 4UOQA 3VTKA 4B80A 1NVGA 4FHDA 3A6LA 1SRQA 3VDMA 3VB2A 2C5FA 1Z73A 1Q22A 4PNHA 4NQWA 3DXJF 4DMCA 4MR9B 1TPYA 1DBSA 4DQ0A 4JLSA 2NPIA 5M3MJ 2FBHA 5TEWA 3OU7A 3FUWA 1R0WA 1SBHA 1RNLA 2OOSA 1W4CA 2QQEA 3N0VA 3PQ2A 2V9ZA 3ZKWB 4P4LA 1O9BA 3OJXA 3FCUB 3FPEA 4ND5A 3L0IB 4K03A 4LNHA 1HURA 1Q15A 3K9TA 3E3NA 3W5SA 1CJKC 3GGJA 4CYCB 1XXHE 2X13A 1NN3A 3I1YA 3WLIA 3ZMDA 3P1JA 2XBLA 4B2IA 3QFHA 4O2LA 2CXUA 1EDZA 4EFMA 1OTHA 2OKCA 1B15A 1Q17A 4W82A 5AVTA 2XF5A 4H3SA 3IKMB 4EKEA 5JQGB 3SZ3A 3V6MA 3W05A 2G67A 3K7EA 1JILA 2V55B 2WSLA 3C7AA 3DL7A 1OIXA 3OCCA 3QPLA 2AOXA 3QJ5A 4FHZA 4C29A 3ZMTA 4HV6A 1RJFA 3D4LA 5L7TA 1MN6A 2ZO4A 1BOOA 3THXA 4H1WA 1DVRA 5CA0F 2R92J 3D5QA 3OLCX 5F7JA 2R4QA 3G59A 2VQDA 2L02A 3KSAC 2FPPA 3QODA 2XUGA 3KKLA 1X7DA 3EZ7A 3FYUA 4R01A 2L18A 2HW8A 3IV5A 4HS9A 4MYDA 4KGXA 4XD7D 3WYEA 2G82A 2MSYA 1VZ3A 5EJCA 3SE0A 3CB4A 3KC2A 2YVQA 1V3FA 3N05A 1PUXA 3ZLUA 3OQJA 1BXGB 4K2HA 3OS1A 3AL3A 4QEKA 5G0SA 5FOVA 2V3WA 4CMGA 1OXBB 1QYCA 3OT5A 5AI9A 2AZ4A 5HK8A 1XZDA 1V5FA 2WNIA 3KZYA 4N4AA 5FBWB 3AHGA 1S3JA 3LA3A 5JJKA 1REPC 4Q4HA 4EATA 2XMCA 1OI4A 5LMCA 3L2UA 4BNDA 2BGWA 1NLZA 4O2BB 3KU1A 4DJEC 1C4XA 3D5SC 3DJFA 2HCRA 3HUGA 2QTZA 1WABA 1PKEA 3H3UA 4TYWA 1XTAA 2C4NA 1D07A 4IJ5A 5CCBA 3WDLA 2EZUA 4XYMA 4Z1MD 4YIFA 4AP9A 5EZHA 2NZUG 5KNDH 3C5EA 2GJ9A 1DI0A 2QN6A 2OY0A 3ZEIA 2ZRQA 5HLHA 3MWGA 2OYRA 1ZAYA 2NS8A 3TR6A 1CR6A 2O05A 4IKFA 3FBNB 3L0BA 4X93A 3RK4A 2HA0A 3MWDB 3JW8A 3RNOA 5C18A 3DEWA 1POWA 3VR6A 3QWFA 1S2NA 3VJKA 3W9BA 1JJBA 1D0VA 4J1SA 5KO2A 3DVQX 1JDUA 3A4VA 1RYMA 1KQ3A 3BIOA 4CCYA 1QQTA 4XRSG 1OA1A 3UHJA 5IK2A 4TTRA 3BOQA 1PDVA 3A1SA 4ZYLA 3PSIA 5BUCA 4NZOA 4DOZA 2VONA 2KM1A 4OMZA 1XWWA 4KN9S 4Y7DA 3S2UA 2VN8A 3R5JA 4J9VA 4ZQHA 2P4HX 4DLYA 1MC1A 1B6RA 5J43A 3PTLA 4AC0A 1FTNA 3FFBA 3UHFA 3ZS8A 2KBFA 1AU9A 1RS0A 1X2EA 2XWJI 2REQA 1P2DA 2W2PA 3X3HA 4HWPA 3LQQA 4HX2A 5F78A 2R7KA 3BRSA 4AM3A 2YJZA 5KX5F 4ZDPA 3ELDA 3QKIA 4MWZA 4FTWA 2CYAA 2DA7A 1PBNA 2XUJA 4FCVA 5AOBA 2JA2A 1JAXA 4YRNA 1SAXA 3AKEA 3BA6A 4QXAA 4PNZA 3PFIA 3LSTA 2ZTVA 1V35A 3IAS2 4R1SA 4CIAA 2YZMA 3BMOB 1QH8A 3GRYA 2B92A 4RESA 1CEQA 1ETVA 1W581 3RKWA 2WSSD 3VU9A 4DW8A 1E2DA 5ES4B 3PUHA 4UPEA 4PSDA 2VBWA 5DU2A 1GP2A 4Z0PA 4YV1A 2HXOA 2HBZA 1XZNA 1DAKA 5CB8A 4Y2JA 4DVGA 3WFIA 5E8RA 3T1TA 3UJPA 5EHXA 4A0ZA 4HWTA 3DYVA 4O33A 5EKXA 2KYRA 2UUPA 2ZIVB 3M9WA 4F56A 2PFSA 4II2A 2M7BA 2CFTA 4A0XA 3H16A 4DLWA 2Q5JA 4JI1B 3SXPA 4EYKA 5A3QA 2R6HA 1HZJA 1ENPA 3UFXA 4FGLA 2VHCA 5KWEA 4ZOLF 5EGSA 3QQAA 4BV2A 4TZ6A 5IP9J 1D6JA 2AN4A 1HETA 1T2EA 4RJ2A 2A57A 4X92A 2GD2A 3E7FA 3L2VA 4HPWA 3DLCA 4DCMA 1IDYA 1T4BA 4UHJA 4UV9A 4UULA 2X15A 5JJ5A 4JBWA 1O03A 1Z5PA 1PR1A 2R7XA 2A59A 2TYSB 2VH2A 5LQAA 2BBTA 3K09C 3TSCA 4IRUB 1ZDMA 1KC3A 4WKCA 3U9TA 3GZTB 3TH5A 1BBYA 4WAUA 1XTZA 3WZ2A 3FWPA 1PD0A 3IP5A 4QASA 3VR6H 4EX7A 3WAKA 5BN4A 4D9EA 4L6IA 4ZAFA 3VSAA 1OMIA 2BKLA 2W8ZA 2GWRA 1ZGBA 3LRPA 4IH1A 4QJBA 4LG0A 2Q1ZB 4BE2A 5HW0A 4YJHB 1HNZB 1ZONA 3VNSA 4AWAA 2FPXA 4OKIA 4Z3OA 1HT2E 2BL4A 3JRIA 4JBIA 4GC5A 4RANA 3CO6C 1FP4A 2KT0A 3E5QA 3ZP5A 3CC4I 1UXGA 2QZSA 4LYGA 5KVQA 2GKSA 1VGQA 3CUSA 5SY4A 4ISBA 4C6SA 1JIXA 2C4KA 3OZFA 1X7XB 4TKMA 3WV4A 2XKOA 3E8MA 3EC1A 4C76A 2JLYA 2Q6VA 1SU8A 1I3NA 1JI0A 2WY8Q 1XDDA 3B7PA 5CDFA 2Q2EA 1IUOA 1KO7A 4D8UA 4Z6KA 2VHVA 1WKMA 4BJTA 5LOVF 4JLPA 4FEGA 1M33A 1X2BA 1YE3A 3CTPA 4MULA 3AIOA 2CWWA 1YZLA 2GARA 3I3SR 1V16A 3TCKA 1VCIA 3PGMA 4RD3A 2Z0MA 2NU9B 3BJMA 2BLLA 3BWBA 5ECWA 5HZGA 5E1WA 2V5VA 5BQ5A 5DW0A 3ZTTA 2CFXA 3WDKA 4O4LA 1FW8A 2ZQ5A 3VH2A 3PRJA 2Q5EA 1FX1A 3JYNA 2NO0A 1IWBB 1SQ6A 2W6PA 4FP9A 1DKUA 4RADA 3GZ4A 3KKMA 4ZT4A 4IY1A 5SY6A 2GK4A 4W1QA 2OXIA 1OW3B 3PIPF 3IOMA 4JUFA 1VCNA 3B5JA 5LP6A 3D0KA 2BW0A 3FUVA 4P84A 4W9NC 3CH5A 3ZU2A 1UBMS 2VNKA 4IBOA 4EF4A 5JZ9A 5JAZA 3BQMB 4XLFA 4Q48A 2VTVA 3CUUA 4U1RA 4CUJA 1X1CA 3SEQA 1G3WA 5IC4A 3N6RA 2A5LA 2QUIA 1IN6A 2BMDA 3K16A 1BL0A 4F12A 7REQB 1LVUA 3LC1O 3M8KA 5J2TF 3RT1A 1UUFA 2IEZA 4W6ZA 4B2YA 3U4HA 1VKHA 1DDGA 3IIJA 4LSZA 5AW1A 1RE0A 4HXFB 5F08A 4P3OA 5ITSA 5AI8A 1QKJA 3ZZUA 3THYB 1M1YB 2AD1A 4GI1A 4ENQA 3LP8A 5LL6P 1WVGA 2EJTA 5AP9A 4XIYA 3SVLA 3HYCA 2VRWA 2W93A 3FYSA 1Y1VJ 2AFHE 3MILA 3MQ4A 4IILA 5AHXA 3UJBA 5G40A 1C1DA 4XGNA 1TW3A 2AQIA 3EULA 4UBIA 5HQTA 2CUZA 3OIDA 4HDUA 1B2RA 3GJ3A 1QGPA 1L3CA 5K0FA 4R83A 1FSZA 2JI7A 1LNSA 1X7WA 3V7SA 2IHTA 1W25A 3EDMA 2GHTA 1L9XA 1E9EA 3PRYA 5E3JA 1U2ZA 2A9JA 1UANA 3DKVA 4HI0E 4RVDA 5SYAA 4KOEC 1Y56A 3CZPA 3WK9A 2GVNA 5HVQC 3O8QA 3U3DA 5LP6F 1SU6A 1R8SA 1FSSA 3KPHA 3SZRA 4BMZA 4CDNA 1EJ9A 2RHJA 1P75A 2EZTA 3HUFA 1N7HA 3MZ8A 1J2EA 2OFPA 1AA6A 2BLNA 1O0CA 2EBUA 3HXTA 2PAFA 2Z2ZA 3JATB 1UMBB 3NVAA 4GZ6A 5DYWA 1ZICA 4TSFD 1YE9A 2ZRPA 2P1RA 3AM5A 4U2GA 2WM8A 5K09A 1FT9A 1OASA 1Z9CA 3NTLA 1R23A 4X60A 4Y2HA 1B3RA 3CIFA 3ZYZA 5K0ZA 3RAFC 4RXTA 5AO9A 3V2UA 4IIEA 2V97A 5KKCA 4EAAA 1KQ9A 1U0RA 2ZBFA 2O48X 3BE5A 4ZVKA 4DLVA 5LIRA 4E2WA 1JQKA 4D97A 5TQ2A 2B6NA 3R3WA 2O6HA 1UBLS 3P2EA 2OE2A 4PYIA 5B3LA 2XB0X 3CG0A 2MSCB 4G8BA 4G07A 3CNOA 5F04A 1Q1AA 6ADHA 5JAUA 4PYNA 4G5YA 2R65A 1VP3A 1I6XA 3KKKA 4I55B 4BKOA 1CS4C 1AZTA 3RSQA 3E22B 1OWMA 4EW2A 6PAXA 4AG5A 4BCBA 1IBSA 4BATA 4RPGA 3JSAA 1FX0A 1MBEA 3WLPA 1QPBA 4Q05A 1VFCA 2FU4A 1GL7A 2JA8J 1P0IA 1XO1A 3PB3A 4BASA 1E8NA 1KNXA 5KDDA 1WVRA 3ZTYA 4A5NA 4B4UA 2XGJA 1BMDA 1KP9A 4OA5A 2CF5A 1KEZA 3K0CA 5CNJA 5JDCC 3HYTA 4LEIA 3FRIA 1N2IA 4WINA 4EUHA 3ZHCA 1U9ZA 3SC2B 3TB6A 3UOGA 2WM3A 1I1SA 1DB3A 3F6BX 1OMOA 4R81A 3C5CA 5HJEA 2UXDB 2BBWA 3GGSA 2CNBA 3T94A 4UE3S 1PG2A 1E59A 3FOAA 2HLPA 3NUGA 5JBQA 1Y33E 4DR1B 3IB6A 4WCFB 1HOTA 4PY2A 1ULZA 3EGXA 3ENKA 1L3LA 2Q6LA 4W5HA 1NY6A 4JEIA 5KNBD 1YVRA 3A26A 3PT9A 4YUZA 5L95A 4R1PA 5BV7A 2H4FA 3ITDA 1KDZA 3KFLA 4QQRA 2GPTA 3KP3A 4V0NA 5AMXA 4BCCA 4KXNA 4TVSA 4R2XA 3QENA 4BN5A 1G4HA 3B6MA 4LJAA 4HRYA 4IYRA 1VQ7I 1DEKA 4BO2A 2HT6A 4MARA 4QJ5A 2XAAA 2CSXA 1Z38A 3Q7RA 2BHRA 4UPVA 3BH7A 3DHEA 2HPHA 3NJRA 4NYMQ 2GOYA 2ODEA 1QVWA 1THMA 2C1ZA 3LTEA 3D0SA 3GTJJ 1OHHA 5ED0A 2R5FA 4YXWD 3PD1A 5IT9A 3MINB 3AR2A 4JLOA 4AYBA 3U16A 4AKEA 1Q7TA 4XFKA 3UMFA 3HDQA 1BROA 4H4CA 3VYSB 4Z3DA 1E3MA 4EVIA 4YUXA 3KB6A 4Q3CA 2E6KA 3WBJA 1JLKA 3ONDA 2AFIA 3N87A 1FTSA 1M5UA 2V7UA 5E4FA 5I48A 1T8PA 5H6QA 1IZ9A 1IG3A 2MD0A 1T1EA 3IDZA 4IGAA 3ZY4A 4EHNA 3LX6A 1TYZA 3DBIA 1PSWA 1AU7A 1R0YA 2HSJA 4HQKA 2UVDA 4ZAXA 4EY3A 1VJ1A 2PPVA 4RA6B 1ZYUA 2B5OA 2FW6A 4TS3A 2O7QA 1VFPA 3HGGA 2PYIA 1XMVA 1MQSA 1XBTA 2ZYVX 1NVWQ 2XDAA 3AEXA 3W0LB 2M1XA 2HK6A 4KXVA 5KAFC 5DTEA 3NCTA 2CL7X 4GE3A 1TIKA 4PIPA 4A26A 3PNPA 5BXYA 1NQOA 2GCGA 3SZLA 3FOWA 4HAWA 5G4KA 5F1YA 4QA9A 3F21A 3AI2A 3KQOA 1NOIA 2ARKA 4V0RA 4BRUA 2BVNA 4J16C 4B3GA 2N3ZA 1GXPA 5IYCJ 4JQYA 2F6RA 3U62A 5KX5B 5L4NA 2V6MA 2FW1A 2XKPA 1RLMA 3B89A 4B76A 3LOUA 2QNIA 1X7ZB 2QLZA 3KP4A 2WPNA 5ILQA 1VHLA 5JOQA 2OBLA 3QE4A 1LK5A 3TRIA 3S1RJ 2YX7A 1AB6A 2PBZA 1RRVA 5H9VA 1Z4IA 1EUCA 3MS2A 4J0IA 4J9UE 3DZBA 4EUSA 3VZCA 4Y67A 5E6UB 4DJAA 1E3LA 1LPMA 1Y3FE 3MLBA 4H3KB 5KJ1A 5FWXA 3UT6A 4L9AA 1SBYA 1T6YA 1WXGA 1HT3A 1R9TJ 2B4TO 4UOZA 1UCFA 4Y15A 1HLDA 3HC7A 1SC1A 3I72A 1YR7A 2I6SA 3D5TA 3Q3EA 4KDEA 1C41A 1QCCA 3IQWA 4YHBA 3T0IA 2W8BB 2F90A 4CLXA 1PJZA 1S3IA 2GZ2A 3VKGA 3IEVA 4N0MA 2Q5LA 3IIIA 2MSLA 2OBNA 2XHEA 3MIIA 3BPXA 3AAFA 4OOIA 1Q7BA 2QN9A 3IJRA 3OYGA 2LBFA 1K98A 1SXJB 3OEHA 3VR1A 4WBNF 5J58A 2IF2A 4AD9A 3TRFA 4BH9A 2PUGA 4KRFA 3MCUA 1Y42X 1KVRA 5HS4A 1JDBB 2PUJA 3ASYA 3GJZA 3WOHA 2L17A 4M7WA 5ICSA 3ZWCA 2ICAA 1NL3A 3UMCA 2OZ6A 3W5AA 2Q5HA 1Z3IX 3JRFA 1JTFA 1RPWA 4FFNA 5HZMA 2OQVA 1KEEA 3TZBA 2KMUA 3IDFA 1DKMA 5A4KA 1CR4A 4CG1A 4I0WB 2AOTB 3P0RA 1D1CA 4E2FA 3N1UA 4G67A 3SFVA 3VSBA 5F12A 1U7ZA 4NYMR 1V11A 3V33A 3LK7A 5TMEA 4DC1A 3NC4A 4ZZDA 1HE2A 4JJ8A 3DE4X 4IXDA 3IV6A 3S17J 3LTNC 2LD5A 4YJDA 2GIZA 3JD1A 1IHYA 2B2NA 1K8QA 4MWEA 5KYVA 3OQMA 4JP8A 4CMAA 1LKXA 4N4NB 4MB2A 4TVBA 9GPBA 1H8AC 2CMDA 1Q21A 3STUA 3KT0A 2BW3A 2JARA 2JVIA 1OFTA 2C5EA 4KYIB 5HLIA 2A88A 1NQ5A 3IAEA 1LLQA 4BKRA 2OAGA 1DQUA 1XEXA 2EFCB 3WYBA 5T4BA 5I4CA 2W37A 5B66C 1JKIA 2CHEA 2WTAA 4RJJA 2WA0A 1CLEA 1TDJA 4WK6A 4A1FA 2XF6A 2BSQA 3HUGB 1YIAA 3FMQA 1U78A 1E0AA 1OR7C 1WZEA 2LD4A 4KVFA 5D51S 4U9HS 3CBGA 5JAQA 4EL0A 5LSAA 1BI3A 2RHLA 5FOQA 9ABPA 1R0BA 2E49A 3RNLA 3U60B 4LJRA 1LPBB 3P9YA 1QGUB 1R8JA 5ALOA 4ZT3A 1Z0AA 4BRZA 2O54A 3VNAA 4LXUA 1OCPA 2LBPA 5GONF 5BSVA 1J0DA 1K8RA 1EUQA 4YJ2B 1DP3A 2XLCA 1W4LA 3H3JA 4G84A 1ZWLA 2G9NA 4ERNA 2XTNA 3H0GJ 4XUCA 2FOKA 2PKWA 5A5FA 1KKMA 4HADA 2OCYC 4HBGA 1R0KA 4MQVA 2QMHA 5M5YJ 4B6GA 4CQLB 2BFDA 3E7XA 2E4ZA 4AF6A 3H2SA 4F60A 2XRZA 1BOAA 3T7TA 2XKJE 3WGJA 4CL0A 4U4AA 3KQNA 1OJLA 1CRZA 1E7SA 2ZSJA 1H2YA 1C9NA 3KKQA 2ONJA 1ZARA 2A84A 2EQAA 3FCSB 4FOTA 4G26A 4PYQA 4X1KB 2FHSA 4NH0A 5CLQA 1V96A 5AT1A 3M8FA 3RD5A 3VDQA 3QXGA 5FTNA 2ONYA 2QX7A 3H13A 2Z08A 5CH8A 4PHCA 2BD0A 5IJAA 1U0TA 2JEZA 1T8RA 1QZ3A 1XZIA 4LLLA 4HAMA 3HKEA 4WH0A 5FR2A 2D5LA 4EAQA 1IDN1 1JHXA 1TQHA 1TZKA 5DEIA 2HNBA 1DG1G 2DFKB 3VPRA 3PEUA 3ECOA 3FNBA 4RCZA 4HLYA 5IZCA 2G80A 1NWCA 2H48A 5D5QA 2H1CA 5EMKA 3OA0A 4I8IA 2OCBA 6ABPA 3ULQB 3K6SB 5B2FA 4WCGA 1I4WA 1WU7A 3I9V6 4NL4H 4OEHA 3RROA 3TIXB 2BIFA 3BGDA 1TP4A 2WYOA 2OO5C 4RDHA 4C3VA 2MYUA 3E9CA 5G0WA 2PX0A 2C5AA 4RVNA 4ARAA 4YV2A 4WVLA 3BL6A 4DSZA 2XAJA 3E05A 3L1VA 4TKUB 2NAFA 4DIEA 4QO7A 4FGJA 5CT6A 4E7SA 3OIGA 3RYTC 2GUWA 1AV6A 5A7HA 1JHFA 3GIWA 2YU3A 5L3EA 4YMLA 4YCSA 1A82A 1MH1A 3KR0A 2H8WA 4ZH4F 1M9NA 2B0CA 2IDKA 4HEA1 1KDOA 5JXIA 1X58A 1M5RA 2FMTA 1U0HC 3QUCA 3OX2A 2JLBA 1P1IA 2AG0A 2IOFK 3CGGA 1QHEA 3N2LA 3O47A 5IASA 2V7FA 5ICEA 4C9BA 1MT3A 2ZM5A 2YN4A 3UK0A 2A9PA 2ZCJA 1VJGA 5JRDS 5L3DA 3V1TC 4CR8A 1CYEA 1XSDA 2GZDA 1LSSA 2IYRA 3N3AC 4DANA 4F2GA 4D5CA 2IXGA 3U3JA 3H1CA 1V3TA 2NTEA 2NYRA 4J4TA 2JVJA 1V8FA 2P90A 4GLOA 2WLTA 3CUYA 5C1BA 4ZAVA 4FI3F 4IUCS 3IH3A 1VTNC 1HBJA 1WG8A 4OOFA 1EZ1A 4OQYA 5AESA 3ITEA 3C7KA 4U7FA 1B8IB 1R7RA 3BR6A 3F6YA 4P3NA 3W2VA 4N3BA 2IY8A 3USZA 4NNPA 1T4MA 4FKZA 4ETWA 3DMFA 3G82C 3S27A 2XVXA 3TEFA 5DBIA 1ULHA 1RKXA 4K9RA 4M6WA 3E6MA 2ZW9A 2Q0QA 1RZVA 1UC4B 4FW9A 1WD5A 3F7NA 4PSCA 3RKSA 2ODBA 2DLCX 3CZ4A 3GBPA 2E4WA 3WTSC 3PQ4A 5FTKA 4DBQA 1T10A 3OPMA 5H0IA 3CN9A 1GAWA 2EIHA 3TLEA 1Y8CA 4JC4A 3JRDA 5MDHA 3OZVA 2IEDA 5HM6A 1O96B 1BC5A 1L5LA 1I1HA 1NVKA 1LXCA 4AU7A 1SXHA 3EEQA 1PUFB 1LI5A 2BKUA 2YUIA 3K8QA 4IIYA 4D4IA 3UH0A 5DSZA 4UASA 4RTOA 1FYDA 1Y4AE 2E1OA 2PX3A 4BMNA 3AVXA 1GWNA 4XA8A 1TU3A 2AEJA 4BNVA 3HEFA 1BWQA 2XWQA 4YXFA 5JY6A 1WY5A 1I2AA 1DINA 4PEVA 3ZHUA 4X1YB 3PEWA 5EZYA 3SF8B 1NG7A 3OFND 3FWEA 1DPFA 2FFBA 3LGXA 4KDRA 4MV6A 2Q5IA 5LMNB 4N9QA 3TLJA 5CRIA 1W5BA 3RIYA 5LP6B 2L0KA 4EI7A 4F4JA 4RAZA 2JN6A 1OWNA 3CO5A 3NWJA 5K7SA 1TAUA 4CMKA 4L0ZB 3G4SI 3HSSA 4JFAA 2Y76A 1F5NA 4HD8A 2JHCA 2UUOA 1TA4A 1UPXA 3AUSA 3GRZA 3C1DA 1ZMBA 2JLRA 4HDRA 2MH9A 3CZ5A 5CTAA 5CJPA 4EVRA 3JQQA 1B41A 1JEDA 5EWLB 4FFSA 4M9QA 3IQIX 4K2AA 1HT0A 4EB3A 2O2JA 5CB0A 4D3DA 3QXSA 3UMSA 3DOFA 5DHPA 1KMHA 1P9NA 4LISA 3FXRA 3ZE8A 3QH4A 1ZINA 2VJPA 3CPSA 4M0KA 1O1YA 5CDHA 1BA2A 1IEQA 4C6TA 1JHVA 5CVRA 2IIVA 3TLAA 3OPVA 3D59A 3NUZA 1W52X 3OPYB 4J6FA 3OEYA 3H5NA 5IT9K 4MV1A 2XQVA 4U2FA 5EJIA 5J4KA 2NRAC 2OV8A 1Z77A 4B3IA 2HTSA 5K7HA 3ZCOA 1IC6A 2OV1A 4S1PA 2FWRA 2LR0A 1XB2A 1UWVA 1CIVA 4ESHA 1Z0DA 3S32A 3E1KA 4EMBA 3F9KA 4Q16A 1S1CA 5BXQC 1LBTA 5I9SA 5FLXA 2NO9A 3GT7A 3P7MA 3C7CB 4IHTA 2QX6A 3N07A 4FHEA 4GMKA 5CGZA 4LYAA 3SR3A 1PHRA 1BCSB 2GASA 1Z68A 3QKRB 4KWTA 4R2WA 4M7RA 3RVRA 4ARCA 4WLUA 3PP8A 1H4SA 3WG7H 2D0PB 3KXDA 2HXIA 3J7YJ 4LVNA 1DP7P 4V02A 5SY9A 1GPYA 4B7XA 4OQZA 4R51A 1TE2A 5FD8A 5FL3A 5C1DA 3AJRA 3H11A 1WWKA 1BMFA 1GFWA 3I4LA 3O4HA 1L4EA 3OMLA 3CNQS 3F74A 4IL5A 3BE8A 3L8CA 1QIKA 4PHFA 4IIVA 3IMGA 2J45A 1N5MA 4LF8B 1F43A 4MTLA 1EVYA 2YJ6A 3QPCA 3J7ZI 1NAIA 3ACBA 3L9XA 3H19A 3B9RA 1SNYA 4J43A 4YRQA 3VV2A 4HLCA 2QJTA 1G4AE 3CLQA 4OI1A 4OBXA 3K1JA 2CXNA 4I36A 2GRUA 1UIMA 2CUTA 1HQKA 1U2SA 1Z3CA 4KYVA 4OLHA 2J85A 1JSLA 2W6MA 3UJAA 4EHBA 1ZM2A 4YX9A 4BO3A 4E5SA 1HA3A 4NK4A 5JVDB 4CIBA 3HJGA 1S4MA 4JGGA 3ODPA 4MVJI 3S14J 1QZUA 1AMUA 1KMIY 1M2WA 3Q72A 2PGLA 2ZB8A 1JSZA 4EFNA 5JC8A 3D8SA 5DLDA 3A3NA 3SX4A 3C16C 5AKXA 5DM4A 2UUCB 3OYMA 1BS2A 1K7AA 4K6FA 5CDGA 1YRQA 3K31A 4J0QA 2FZKA 5EJGA 1SC6A 1PG5A 2F43B 4E4TA 4Q37A 2ZJPF 4KGVA 2C7GA 1ZEMA 2HDNB 3MMNA 4DUGD 5L4SA 2WV1A 1QFJA 3D4BA 2XGOA 2F3TA 3TTYA 1BE6A 1EX6A 1IOZA 2DN0A 3L01A 3N3BC 3G8BA 1F8UA 4R84A 5C5DA 1TKRA 4D0SA 3G9XA 1VL2A 1Z33A 2F17A 4NEGA 3K30A 1TMGE 4MW9A 2OQIA 1VL8A 1E17A 2Y6UA 2NYUA 5FNVA 2AFVA 3BR0A 3C6MA 5JZOA 3G2HA 3HOTA 1JBEA 3K9LA 3RTAA 2W85A 3QYFA 3AHDA 3L8ZA 1SFKA 2ZWOA 5AM4A 2JIRA 2MT9A 3JZFA 4NCKA 5ALLA 5M3BA 1XDZA 5CAEB 5K8VA 1HC7A 3BREA 3VNRA 1I1NA 2XYRA 3EA0A 4EI9A 3K4KA 2WE7A 3M5DA 5CVTA 1OFUX 1LLFA 5FBKA 5EJ5A 5K20A 2AO9A 4CM5A 1E4OA 5CLLA 5B57C 1OE0A 1QUEA 4B85A 4WZ6A 3F97A 3C6QA 1C80A 3L6DA 4MUHA 3LX5A 4YCJA 4HDSB 3AEUA 5IC5A 3ILYA 1OXVA 2FA9A 1XMXA 1E0SA 2XCLA 2YNMC 3VOSA 4N65A 2FUCA 1K4KA 3SIRA 4ZTZB 4ZO6A 3RT7A 1RHKA 2HRQA 5A5DA 1G2OA 5HPYB 1O3TA 2P2LA 2Q1WA 3LUBA 5LXTF 3RYIB 2BI8A 2X2PA 4YRIA 1Y6GA 3AFGA 1RQPA 4YMWA 4EF5A 2PGAA 2X3YA 3SSAA 1TX4B 2JA5J 2VUUA 3G1MA 3QZUA 2PN1A 2WWHA 3KL2A 2DQZA 3W6ZA 5G4LA 4DV4B 3EGIA 3STYA 4TTVA 2QMZA 5DVZA 2BHNA 3GN2A 2XKAA 3OZ7A 4RTMA 1RRJA 2BFCA 1KH2A 3PQKA 3LFHA 1QC5B 4EOGA 1FSFA 3SZTA 5AKYA 2YW9A 5LOVB 3TW8A 2X6XA 2JGFA 4XXHA 2WB1N 5DK4A 3K4MA 4IUDS 4GKJB 3KVYA 3AZOA 3RBZA 2AR7A 3KQVA 3LUKA 2W9XA 1MRZA 1PJ3A 4BN0A 3FTFA 1C2TA 2ZIUB 3BFVA 2V98A 1I3QJ 1JDVA 4HV5A 3L00A 1CX9B 2QGNA 4TQUS 3L0DA 5D1NA 1Q0ZA 3NC1C 4RQUA 1BZYA 1TA0A 2J48A 3NHRA 3AO0B 3WTBA 5FUXA 2ZANA 2IZ5A 4UEOA 5CM8B 5CXXA 2M6KA 1O6BA 1E4EB 1MNAA 3FTPA 3PHGA 2C57A 2YQ5A 5JD3A 3VKWA 3HRMA 4H1HA 1HLFA 4J1TC 5ARBA 4CL2A 1XVUA 2BEOA 2QKLB 2JQ7A 4BYMA 3JQBA 1VECA 5EKUA 2OYSA 2JJ7A 3U0VA 1OGYA 3RS5A 4RSGA 4FJ2A 1KJYA 1N6RA 2ZBVA 1H3NA 4DCJA 1SUFA 3WKBA 1XF1A 2XF8A 2WWVD 3QITA 1O58A 3OIFA 4ECEA 2GEJA 3HBFA 3Q6MA 3VOAA 2AE1A 4F46A 2HOQA 2WYUA 3MAGA 1CZLA 2HCBA 3OL3A 2VSOA 4I4CA 3WFZA 2FN3A 1P6XA 4FDLA 1Z83A 2YN0A 2IX9A 4X95A 5LBIA 3UZUA 1KH1A 4UUSB 1TKBA 1DADA 2DK5A 2B20A 2XMPA 4AF7A 4ZJYA 2DR0A 1L5KA 3F23A 2IJLA 1XGKA 4Y2YA 5REQB 2ODQA 4U7HA 1UM9B 5JVTA 2Y9PB 3EYYA 1ZH5A 1V7CA 2BMVA 1TM4E 2OZKA 4HLQB 4RGVA 1Z0IA 1ZU5A 5BN5B 3S2IA 5D5VB 4YCAA 3O8RA 5IKXA 3H75A 3JQ7B 3J81Z 4HQNA 5IUNC 4F86A 1WKCA 2YUSA 3HOYJ 3MZHA 1FLVA 1G8SA 1ZN9A 2G3YA 2H3EA 2QTRA 2W11A 3C74A 4HWSA 3RFFA 3D5LA 2IE0A 1TZBA 2O6LA 1QB8A 1UWCA 3OD1A 4P6VF 1KI3A 5BMVA 1OYVA 4IMJB 3V7UA 1A9PA 3AM4A 4GYIA 1F48A 3RVPA 1MAHA 4ZYAA 3FLAA 2JI9A 3G1LA 1DJOA 1QK3A 2FWPA 3WYDA 4C0AC 1CS0A 1UJNA 4YAKA 2VEOA 3RJPA 4EQQA 1NY5A 1CVLA 2EFGA 2N0SA 2JATA 3C4QA 1ON2A 1FIPA 4L57A 1Z2OX 4TMKA 2ZSIB 3QVJA 4WXPA 1AS3A 3T1QA 4NQRA 4HAUA 1DPRA 2OXRA 4MCAA 2E89A 5HMLA 4L2IA 3KQQA 4KQJA 4FINA