1P4AA

Crystal structure of the purr complexed with cprpp
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
269
Chain Sequence
KFRRSGRLVDLTNYLLTHPHELIPLTFFSERYESAKSSISEDLTIIKQTFEQQGIGTLLTVPGAAGGVKYIPKMKQAEAEEFVQTLGQSLANPERILPGGYVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPLAYAAASYLNVPVVIVRKDSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLVEAEGVDERLVDEYMSLLTLSTINMKEKSIEIQNGNFLRFFKDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pur operon repressor
publication title Functional dissection of the Bacillus subtilis pur operator site.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 77
structure length 269
sequence length 275
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
A PF09182 PuR_N Bacterial purine repressor, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p4aA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p4aA02
1MGTA 3IKTA 4MQVA 2Q8KA 1J0RA 4G6DA 4MTEA 1EH8A 3BZ6A 1HGXA 5IAOA 3KP7A 1QB8A 4QYIA 4WCGA 3ZP5A 5H20A 3VOEA 3IHUA 2BGCA 4EJUA 4GO1A 3GFMA 2QQ9A 5BS6A 4RB2C 3MQ0A 3VFZA 2YPRA 2NNNA 2F5FA 4EGZA 3MZYA 1B9NA 3N2LA 2RC4A 4CICA 1FSHA 1BI3A 2K02A 1QK3A 4OHCA 2QWWA 1RZ4A 1JHFA 1PUEE 2CGPA 3EQLF 2Z99A 2YX4A 1BC8C 3GWZA 1B9MA 5E18F 2NS0A 3GF2A 5E8IA 3RYRA 3T8RA 1IZ1A 3REOA 3G6WA 2GA2A 1D6NA 4HDVA 5E1ZB 4AWXB 1OPRA 3HVUA 2WTEA 3SZPA 2VODA 2J5OA 2DO7A 5L3BA 4I2OA 5LEJA 2GAUA 1LNWA 3OV8A 1RUOA 1MJBA 1WSUA 5BQOA 4OMZA 3E5UA 3HHHA 4HF0A 3JTGA 4U0VA 3BY6A 1R7JA 2A3SA 5HKLA 1UPUA 1JE8A 2ZKZA 2QM3A 5HDNA 2G7UA 2FE3A 4HBLA 1OPCA 2FBIA 2H94A 2FF4A 3Q9VA 1Z91A 4ZZDA 1QCDA 2M45A 2O03A 1J75A 2GZWA 2RKHA 3F8MA 4JK1X 2HEOA 1R5HA 3FMRA 2XV4S 2P1ZA 5BPDA 2EV6A 3GFIA 5IT9K 3JW4A 4EVIA 3IC7A 1ULYA 2XRNA 4RB1A 5F6FA 4KIBA 2HS5A 4HF2A 1I1SA 1R3UA 3COAC 4AVPA 5E17F 3MEXA 4M0UA 3B02A 4KDPA 4HYEA 5TRDA 4XLPF 2OBPA 1GXQA 4I01A 4BXUA 4RGUA 5K51A 1STOA 2MD5A 1KQ9A 4CO8A 1G3WA 2M30A 2DAOA 2PFBA 3ELKA 5D4SA 1NULA 4OINF 2E1CA 1Z05A 5K5QA 2HWVA 4FX4A 1G3TA 3LFKA 4QWQA 2KRFA 2P6TA 3KP2A 4A5MA 2VOPA 5CVVA 3L7WA 4FHTA 3FXRA 1XGOA 1FZPB 3QPHA 2VN2A 3DFGA 2VBXA 1MD0A 2OZUA 2FMYA 2EFOA 3ZN0A 1VDMA 3HHGA 1FNNA 1ZG1A 2KKOA 3T5XA 1Z7UA 3NAGA 4XRFA 4FX0A 3R0AA 5E1XA 2XROA 3CDHA 3LAJA 4G7OF 3OOPA 2A61A 4EM2A 2ZBKA 1TQIA 2GEBA 2O61A 4BAYA 1HW5A 1XSXA 2RNJA 5ICFA 4RGXA 2GXBA 1U5TB 3ZMDA 4EQQA 4TV7A 4OMYA 4JQFA 1W30A 2R7DA 3H92A 1J5YA 5CVRA 4KNYA 3EYYA 1BIBA 3MWMA 3HOSA 3EETA 3RJPA 1ZG3A 2HKXA 4Q4ZF 1DP7P 3GZ5A 4TWBA 1FBSA 2IW5A 1QBJA 4M0PA 1KU7A 4XSZF 1ON2A 4WXDA 1XZ8A 5L3DA 3EFHA 2XGXA 4P82A 3E3VA 2BEOA 4P55A 4Y15A 1JGSA 3FX3A 2CO5A 1PZMA 1IRFA 4IVNA 2LDUA 4MQ9F 3TDUC 1A97A 2P4WA 2DU9A 3TOBA 5L3EA 1R1TA 4LGWA 2A69F 2V6CA 2EFWA 3LPNA 2QVOA 4NQWA 2V1UA 4KT5C 2IJLA 2W25A 3U9GA 2PBIA 3WTXC 5LHIA 1T2KA 2XAJA 4M73A 1QO0D 2HQNA 4KMUX 3FM3A 1B6AA 2A07F 1YS6A 1WD5A 1HBXG 1IN5A 3LQRA 1F5TA 2K4JA 4WK8F 4HLYA 1FX7A 5FD5A 2PMHA 3V8LA 4CZZA 1USSA 2HQRA 1BD3A 3F3XA 4GYIA 3ECOA 1UHWA 1IN8A 1K6OA 1FBUA 1S7OA 3BDDA 1I5ZA 3HOTA 3Q5FA 2H6CA 3I58A 1CGPA 1P17A 4QLCU 3RTRA 3ZMTA 1BM9A 4P9UA 4JITA 5D8KB 2PG4A 1O3RA 2MLKA 4EJWA 3E6DA 3K1PA 4WMLA 4ESFA 2NRAC 4PZJA 5LEKA 1P4WA 3FHZA 3FXUA 2R7FA 3BJ6A 4Z2YA 3MZHA 2IGBA 2XVCA 3DMPA 4Y13A 3MAJA 5D6EA 5JV5A 2QYOA 5H6QA 5BOXA 1YTYA 1B4AA 2WWYA 2Q0OA 4KMFA 2WC2A 3I5UA 1LH0A 4U88A 3W6JB 1YFZA 1IUYA 3V8JA 5FGMA 4UVCA 3ZMZA 2P8TA 2PEXA 2RN7A 2OQRA 2AS5F 1JLRA 1ZH5A 3BP8A 2L54A 4I7HA 1P4XA 4M9ZA 3ML6A 2FRHA 4RS8A 3KE2A 5JSQA 1STZA 2W57A 2IRFG 3L2CA 4LZAA 4ZYHA 2XASA 1OKRA 5KAPA 5AONA 1GHCA 1TBXA 5HDKA 2ADUA 3QPTA 5CVIA 4RANA 1O7FA 4EM0B 2OZ6A 2PJPA 2HFHA 3DF8A 4RHYA 1H9GA 2PS1A 5FFZA 3LQQA 4HV6A 4EMSA 1NHAA 5JVTA 3HRTA 1UHMA 3CO6C 3CUQC 2ACJA 1XGMA 4I0BA 4G94A 1J9IA 1VTNC 2FNAA 1X3UA 2CWEA 1OYYA 4P96A 4FYMA 2XIGA 1DUXC 4H0EA 1P92A 2STTA 5CJ9A 1L0OC 3G73A 4AIJA 4X45A 3KLNA 1Z6RA 1YW8A 4QRIA 4LB6B 4ZYEA 3FZVA 3R4KA 1ZLKA 3HRUA 3KFWX 2PRYA 2CW0F 2W24A 1HKQA 2P5KA 2DPDA 1ZG5A 1V3FA 1B1BA 3C18A 3RKYA 3KEOA 4HX4A 4HA8A 4CDGA 2OD5A 2OAZA 1A96A 1MDMB 2ISYA 1Z9CA 1ZGJA 1WWXA 5D8LB 4U0WA 2KIFA 1J7JA 2HYGD 4A6EA 2EB7A 3AAFA 2QBYB 4Q48A 3F72A 3I4PA 5EEHA 4G7HF 1PP7U 1YS7A 3ACCA 4N9HA 1W7PB 2ZMEB 3GGJA 2UZKA 5LBQA 4OU0A 3RKWA 3ZPLA 4LYGA 1DQPA 3MBIA 2H09A 2MA3A 2PMUA 3GZ6A 2PN6A 3CUQB 2K4BA 1YO5C 1JHHA 2ZXJA 2FU4A 2CQKA 4P5OA 1TQMA 5J6XA 4U0YA 2KJBA 3GYHX 4A5NA 1C0WA 1OYWA 4JLSA 1XB4A 3K0LA 5D5UB 1R00A 3U2RA 2VFAA 1J2XA 2P6SA 3V7RA 1SMYF 2DFIA 3N97A 4RABA 5DEQA 5DUIA 2J5PA 2ZJ2A 4HQMA 4P86A 5E8GA 1K78B 3L9FA 3IL2A 1K79A 2F5EA 3WGIA 4LJZF 3M9AA 1V9SA 4M9XA 5H6RA 3EDPA 3PQKA 1FSGA 4M71A 4ZYGA 5E1WA 1BN5A 1ECCA 1GPH1 1HSJA 2P5LC 2FEZA 2L4AA 3JAMZ 5LGNA 3TKYA 2FMLA 2ESHA 1IN4A 2G9WA 5EUCA 2AXLA 2VE9A 1FYLA 4WXHA 5AIQA 2E55A 2ZNYA 3DEZA 3TOAA 4N0BA 2MH2A 2E7WA 1XZNA 3KP4A 1OROA 2P7VB 3RYPA 2V1DA 3V7CA 1BZYA 1FY7A 3N4MA 1LEAA 4KUMA 2C6YA 3RDIA 3DXJF 3LA2A 4S04A 3QRFF 2RV8A 3IWFA 5HLGA 2XAQA 4Q47A 1KU9A 2KIUA 4MHGA 4WN3A 2STWA 5DUKA 1O57A 3FWEA 2EHJA 4RV4A 2DLLA 1BOAA 2YU3A 2XAFA 4RGRA 4P81A 1F4KA 5CVJA 2XKPA 1WI9A 4N9IA 5HOOA 2V79A 3WTZA 2C4KA 5DD4A 4LG0B 2VONA 3SQNA 1IXCA 3KB8A 3O3KA 4OIRF 4KA4A 4G9YA 3LAPA 1S3JA 2EK5A 3C3WA 1H9TA 1EH6A 4RQBA 3F6VA 2CFXA 4M6XA 5IT9Z 1UPFA 2ZCWA 5L3GA 2EWNA 1RNLA 1S7AA 2A68F 1J59A 1KA8A 1V4RA 4RB0A 2PI0A 2Z5UA 4AD9A 4ZH4F 2OQGA 3B73A 2QQAA 2UXNA 3ECHA 4L0ZB 1WRJA 3U1DA 2HR3A 3LRTA 3OZFA 5ESWA 3ABTA 3E5QA 5FO5A 5IT3A 1O7LA 5HLIA 3WTTC 5LGTA 3T8TA 3SFZA 5DV5A 3H3UA 4CHUA 2D45A 1YW9A 1KQ8A 4UV8A 3TGNA 4A12A 1Y0BA 3WGGA 1HMPA 1IBSA 1CJBA 2UWMA 2O6GE 3J81Z 3VB2A 1MJAA 1VSTA 1A95A 1AWCA 1QB7A 4A2UA 4LLLA 1A98A 3TQNA 2CSOA 2V9VA 1IXSB 4XBFA 4BYYA 4PGHA 2HTSA 1BBYA 3E5XA 1CF7A 4YFKF 3I71A 4A6DA 3GFJA 1W7PA 4ESJA 1P4AA 1YQAA 4BHCA 4F8EA 4HDUA 5CVUA 3BROA 3LWFA 1XN7A 1QQIA 3T0YA 4CYDA 1W5TA 4M6YA 3ZMVA 2B0LA 1DKRA 3H3ZA 2X0LA 1D5VA 1REPC 2LNBA 1IW7F 3HRSA 1ZRCA 1KU3A 1MJ9A 3F8FA 3GX4X 4RAZA 2GWRA 3JTHA 2A6EF 3K1NA 4O6JA 1LVAA 1FLIA 2DQRA 1AOYA 1XCVA 3FXQA 3CO7C 2JPCA 3CJNA 4HX8A 2Z33A 1KYWA 1ECBA 1MZBA 5DCFA 5AIPA 4PDKA 1JLSA 1R36A 3KLOA 2VXZA 1QZYA 4XLNF 3E6CC 2EFQA 1BIAA 3FMQA 2H08A 4RGSA 3DPLC 4IF4A 3HIFA 2GXGA 3EUHA 4S05A 1YLFA 2DT5A 3WU1B 4I02A 1JXSA 2L4MA 1FOKA 5HIAA 2ELHA 3H83A 2YSRA 1RI7A 4BHPA 4G7ZF 4L18B 4IPAA 3I64A 4NHJA 4M9SA 3V8KA 1Q1HA 1FWZA 4K2EA 3WGHA 5KVRA 3R0JA 1HKSA 2JKYA 4DNCA 3GUDA 3JSOA 1IRGA 3BPVA 2XUBA 1SD6A 2JT1A 2F5CA 3J80K 3FMSA 4S2UA 4WWCA 4QYIB 4L9JA 4KIGA 3R6SA 5FB2A 4UUVA 5BSKA 3F21A 3OZGA 4LK1F 4ENMA 4IJQA 3BOQA 2JPBA 2IPQX 3GEPA 1U9ZA 4RAQA 4LG0A 2K7LA 2IA1A 2VE8A 3I54A 3DEUA 2MBFA 1HKTA 1XD7A 5JHUA 2H07A 4LMYA 2VT2A 3GFLA 1UFRA 4M72A 2FSWA 4RHXA 1YIOA 4CGZA 1DKUA 1XDUA 3NQOA 3P9KA 4RB3C 1RUNA 1LQ1A 5CYVA 1R23A 2ZNZA 1ECFA 5ILVA 2OU2A 4X44A 2HDCA 2O0YA 1L1RA 3F22A 1TTYA 4MTDA 1J7KA 2BV6A 4RHTA 1OMIA 1XMAA 3O2PE 2DBBA 1BD4A 2ISZA 1LB2A 1DBRA 2R3SA 2BBYA 5LHGA 5EEGA 3BWGA 4ESBA 2VBWA 4IHSA 2IA0A 5ICCA 3FM5A 4CXFA 1I1GA 2VBYA 3M3HA 2IT0A 1ZAOA 1ZHFA 3WTSC 1ONVA 2XHKA 3ZMSA 3KEQA 2QUFA 1XTUA 4P84A 4RQAA 4HOBA 2FA5A 3K1MA 2QLZA 4E70A 1MKMA 2A6HF 2FOKA 1TNTA 1O3QA 1KU2A 1TC1A 1R1VA 1BI1A 2M87A 4Q5SF 5BRNA 3EYIA 2GA1A 5LRSA 1U5TA 4A0YA 5D5WB 3M7GA 4EJVA 2LF8A 3NEUA 1ON1A 4ENJA 2EV0A 1IF1A 1DQNA 1W4MA 3DQVC 1PP8F 5HS9A 5BQPA 4IRIA 2KIMA 3GXOA 3K69A 4ETSA 4A0ZA 2DY0A 4UVAA 2W85A 4RACA 5JR3A 1YW7A 1A4XA 1QGPA 1R58A 4EV0A 1FBQA 2F5DA 3HTUA 4L5JA 3SHFA 1SD7A 3PQJA 1U8RA 2D1HA 4RADA 2HYFA 1QCCA 4O3MA 2H27A 1SD4A 1SMTA 5HS8A 4MEXF 1HQCA 3I53A 5ICGA 1IXRC 4B09A 4D0PA 4HX7A 4BHBA 1TC2A 2HTJA 5A2QZ 1I27A 4YIIA 1B59A 4I98B 3RI4A 4ON0A 4WF2A 4HAMA 1P6RA 1WQ2A 3WG9A 2VC1A 3HSFA 2HCRA 2YX7A 1Z6TA 3CUOA 4ASNA 4R79A 4G6QA 1DPUA 2WNSA 4GCVA 3QU3A 4OIPF 3ACBA 3GGCA 3RKXA 4IRHA 5FLXZ 2XBUA 1HW2A 1NONA 2CYYA 1ZARA 2E1NA 3WE2A 1ZRDA 1DPRA 3BPXA 4LZOA 4PCQA 5KAMA 3J7AO 3HYIA 1KYZA 4AIKA 1SFXA 2Y48A 4HLXA 3RPQA 2JZYA 1D3YA 2L01A 5DCMB 3ABUA 1U9YA 4KYWA 1QPMA 1R1UA 1TLHB 1LDDA 5HDGA 1LJ9A 4M74A 3JAMK 1MZVA 1WKMA 3ISPA 5ICEA 4R1HA 3KZZA 3ROUA 2QZ8A 5J8FA 2H06A 2X4HA 1YFHA 3NRVA 2XAGA 2DK8A 4LB5A 1P19A 1G9TA 1TNSA 1P2FA 1I13A 3LA3A 2FNPA 2PQ8A 2JTVA 3ZN1A 2JRTA 2O3FA 4LYYA 1A3CA 5D4RA 1F9NA 3L00A 1L1QA 3ULQB 1XDSA 1IN6A 4BQAA 2Q2EA 2MC3A 2M1BA 5K1YA 1E2XA 5KK1A 1HW1A 4OIOF 4Z1OA 1PDNC 1Y0UA 3R61A 1KQ0A 1T6SA 5IPFA 1ZN7A 2COMA 3OHPA 5F64A 1LDJA 4A0XA 5JI6A 2L02A 3MCZA 4UXNA 2XAHA 2VC0A 1YYVA 2KJCA 2F2EA 2DTRA 5L3FA 3F6OA 3KETA 3E6BA 4ZYDA 2HKOA 3SXYA 4P83A 3TO7A 3KCCA 1U5TC 3P9IA 2PLYA 3IWZA 3ZMUA 2RGVA 2TDXA 2RQPA 4LFUA 1LDKB 1G4DA 1XCBA 1FYKA 3K9TA 1ZREA 4BH9A 4IHTA 1ZRFA 1G9SA 3I59B 4HV5A 2V1XA 3GLXA 1ZLJA 1VCHA 4I09A 3F8BA 1BC7C 4HZFA 3RIRA 5ERIA 4O5VA 4EM1A 3S2WA 2QQBA 4MGRA 3PFIA 2K86A 2LKPA 4RAOA 1W7PD 1IN7A 2DQLA 2HOEA 1MDMA 4MEYF 3TDZC 2UXXA 1XTVA 3J81K 1HSTA 4YFNF 2K27A 2EA2A 4LLNA 2JBHA 2QBYA 3S5JA 1FSEA 4L0YB 2Z3YA 3GVAA 2GIVA 2ZMEA 2BE5F 2Y75A 3IRRA 3WTWC 4UVBA 4JBAA 1AO0A 2VT3A 3WODF 2VBZA 5DYMA 4PFQA 3CUQA 2GQQA 1Z1DA 3MJDA 2ESNA 4L9NA 4ENKA 3FF5A 2W84A 1U3EM 5DDGA 2XKOA 3D0SA 2NYXA 4M0KA 1OYIA 5D5XB 1SAXA 3O7MA 4OIQF 2JI4A 2Y0MA 4LLGF 4P80A 3M8FA 2VOOA 4MNUA 1K78A 1S8NA 4YFXF 3VEPA 2YR2A 1SD5A 2OA4A 1IAWA 5DCMA 4I0AA 4MB6A 1R22A 3GO5A 4G8XA 5ESXA 4P3KA 1RIOH 1LEBA 3O6BB 4IJAA 3F23A 3HSRA 3T1BA 5FFXA 1OR7A 1FT9A 4U7BA 3WTYC 1EV7A 1G3SA 1TQPA 1FYMA 4KN6A 1SFEA 5F1RA 2G7HA 2Z9OA 2EJRA 4L9VA 5E20A 4XSXF 5FD6A 2A5YB 3IKVA 2DK5A 5L3CA 5K5OA 2FQ3A 1ZN8A 5J8CA 4KN7X 1QK5A 1O3SA 4BNCA 1FP1D 3R60A 2P5VA 1BJAA 3LA7A 3QOPA 1F1ZA 2L3DA 3TO6A 1G2QA 3WTUC 5ILSA 1Z7GA 5LRRA 5D6FA 1OREA 3QP6A 5HVQC 2EA4A 3J80Z 3SZTA 1UB9A 1T0FA 3C7JA 2FXAA 4P9FA 3M8EA 3HUGA 4KIFA 2DPUA 1BI2A 1G6NA 3VODA 3K2ZA 5JFRA 1UCRA 1S6LA 3KP5A 2HZTA 3ACDA 3D5LA 1QZZA 2MLGA 4DQ2A 3G3ZA 2ETHA 5CLSA 3HRMA 1T38A 4WXCA 1XGSA 2FBHA 1O3TA 2D1VA 3C1DA 5BQTA 2M5WA 3DKWA 4HQEA 2JKZA 5HS7A 2DW4A 3P7NA 1R5GA 3L09A 2ZFWA 4F7ZA 2WV0A 5LLQA 4L9TA 4IXAA 3GW2A 4EGYA 3I59A 1U2WA 3KZYA 5E38A 2FXVA 3V7SA 4RHUA 2RDPA 1ZN9A 3DPTA 1O5OA 1I6XA 3KP3A 1UFMA 4YG2F 1E17A 1FP2A 3MFKA 3RPUA 4UV9A 1G2PA 2H6BA 3BJOA 2EFPA 3ZQ7A 2CG4A 4OOIA 1ECJA 2ZO4A 3HSEA 4GGGA 2EV5A 3QP5A 1I0IA 3QW4B 2D2WA 4FT8A 1FPQA 3CTAA 4UNOA 1DDNA 1XMKA 4KFCA 4RAYA 4KN4X 4GXOA 3M1EA 1XGNA 1GRVA 2IA2A 4NB5A 2FBKA 5ILUA 3DAHA 3QAHA 1I5EA 5LHHA 2YZKA 1TW2A 5BPIA 1XTTA 3CLOA 3F8NA 4ENNA 3LSTA 1GXPA 2P7CB 2QENA 2DI3A 2RVCA 4EJOA 3E6MA 6PAXA 4AIHA 4Y17A 2BYVE 2HGCA 3ERED 1GVJA 4L5IA 1KGSA 4U7DA 5ED4A 4HW0A 1H0MA 2E7XA 2MH9A 1ECGA 1QK4A 3F8CA 2JSCA 1TW3A 1XSDA 3QU6A 4YIFA 3WTVC 1XSVA 1ODDA 1USTA 1EH7A 4KICA 1ZYRF 3BJAA 4IRGA 2EFNA 4B8XA 3E97A 4LK0F 3I0TA 1ZN2A 1YG2A 2IVMA 1D8JA 1A04A 1P18A 5LGUA 1SFUA 1QNTA 4R8HA 4LD5A 3WU0A 5HLHA 2IP2A 1W5SA 3KP6A 3TO9A 1D8KA 3HTSB 5A2QK 5BMZA 3JSPA 3V4GA 2PRZA 4PGGA 3WE3A 4GYGA 1T39A 1U78A 3DV8A 3GEZA 1HXDA 1CF7B 3W6KB 2LF7A 2NAZA 3DP7A 2AEEA 1I0LA 4LZNA 5D5VB 4EJTA 2O8XA 1BI0A 1K7AA 4WX9A 4UHTA 1I14A 1ZGAA 3Q9SA 1T98A 3P9CA 1S29A 5DD8A 2LSOA 1U6GA 1L3LA 2M8EA 3IRQA 5FLXK 5TJJA 5K5RA 4HF1A 4PAWA 1G3YA 4ZFNA 2NNYA 4ZZLA 1FC3A
chains in the Genus database with same CATH superfamily
1KGDA 3T1OA 2BY2A 1UDRA 2Y0CA 4F5WA 3VR5H 4V1CI 4GMDA 4KAFA 1HGXA 4C2BA 4MW4A 4WCGA 3ENNA 5H4HA 1ACLA 4NX2A 4XGIA 2H4ZA 3L6CA 1IPEA 2XB0X 4GO1A 5KYVA 3ZD8A 1OFTA 3YASA 4AMVA 5JWOA 2VCHA 4NHEA 3ASNH 2B1JA 2EIKH 1NBME 1BI3A 1YZKA 4P9NA 1V6SA 2VI6A 4EPYA 1NOJA 3R5KA 3REOA 3ICPA 3F9RA 1EGHA 3QVKA 1CXZA 4XYEA 2XJ4A 3DUFA 3EJ6A 6REQB 4N4OB 4OMZA 5DEOA 3PI7A 2BFNA 3FVWA 2Z8XA 5HKLA 1T6XA 1IJKA 2HBQA 5EGSA 1C8KA 4EG3A 4Q05A 2EOAA 5AP9A 1JE1A 2ZYVX 2H2DA 4E5DA 4UVIA 3LWBA 3AF4A 4JP8A 3GGPA 3KE8A 4OI4A 1BE0A 2XRNA 5DSTA 5ALEA 2NU6B 2Z6UA 2WWGA 4KDPA 1T9GR 3PT5A 3R5SA 2HVSA 2QG6A 2EQAA 3Q88A 5F77A 1UANA 4D1QA 4N7JA 3MJEA 3WVNA 1RIIA 2PSEA 2YV3A 1NN5A 3DXXA 4A6XA 3FHTA 1Z05A 3I73A 1Z15A 3T9CA 4U8HA 3L7WA 4GVXA 2AN9A 2D4HA 3DFKA 1FRZA 3FK7A 4JA2A 3V2IA 5BVGB 1G41A 1XQWA 1E2MA 5IVKA 2WHEA 1M0EA 4FZJA 1FNNA 3JSXA 3TRHA 1S3IA 1X9HA 3Q7PA 3M70A 5A1TA 3AUFA 3NAGA 3G1WA 5B1AH 2ZIXA 3CDHA 2QAGC 4B87A 3O31A 2VK4A 3R9KA 2QRVB 2CK3D 2P3LA 1QE5A 3PIIA 3DHNA 4UC0A 4XA8A 1GITA 2QPLA 3B8HA 2G8NA 3NTXA 2ZSAA 4NJOA 2R7DA 1SA0A 5GINE 1FYXA 4GOOD 3CX8A 3MWMA 4IWYA 2WTBA 2E7ZA 4OGWA 4G1FA 4PXAA 5CJPA 2C9MA 2WD9A 3BHMA 1A4RA 4XW2A 3NBYC 2PKQO 3K4MA 3BRCA 4R2KA 5EIBC 4ZIRB 2CO5A 3W5SA 4H3KB 3N6XA 3R7AA 2QA4I 2HZBA 5B3KA 1V3VA 1T5LA 3MIIA 4YHHB 4QOSA 1XAIA 4Q93A 2ZRBA 3NHKA 2GZHA 1XMSA 2Q3HA 4PSWA 2IBMA 4N6NA 5JAOA 1NR7A 1QWOA 5JAPA 1W2GA 4CLXA 3AVYA 4PIVA 1Q7TA 3DOFA 2QWXA 4TUYF 3E1GA 4RD6A 1W5BA 3HEFA 4G1UC 5IVDA 3PHIA 1G8XA 4JIMA 1K8ZB 3HN6A 1UT5A 4AO7A 4YQYA 2ZR9A 1LLCA 2CS3A 2FRXA 5L9AA 2X3FA 3REQB 1T6NA 1ZJJA 4HEA2 1EFTA 2AN1A 2VVTA 4JZKA 4TWRA 3PWSA 1LPNA 3K2QA 3W3CA 2IAIA 2GF2A 3KJIA 3E70C 4LYAA 2FJUA 3Q5FA 3D8TA 5C5DA 1R74A 5HZKA 3FSJX 4JITA 6AT1A 1CT9A 5HHTA 4MVJM 4K9KA 4I2VA 1JKFA 2MLKA 3HE3A 2O7VA 3R6GA 4AZVA 1KZYC 4EFNA 3AZOA 1K66A 1ZICA 4QPOA 2NRAC 4B46A 3ZDCA 4AZ3B 5JI2E 4EFMA 2D0OB 4LSMA 4I19A 4WBXC 4GQIA 3CCSI 3FXUA 1JSZA 4R4JA 2IGBA 1Y1SA 3TIGA 1RFLA 4Y13A 3TP3A 3CMYA 2Z08A 5DHUA 4RESA 2QUJA 1SO8A 3DMRA 1Z5WA 1S89A 1EA3A 1ZQ1A 1F8XA 4O2RA 5FI0B 2ZRKA 2L54A 5G0TA 2FRHA 1R6BX 2BGRA 1WSWA 1N6IA 2PH5A 5FBKA 3H1BA 2ZIAA 3BB4A 3VNSA 4UUSA 1U3VA 2X1HA 1B0PA 4YVFA 2PJPA 2YOHA 4LMPA 1RD4A 1T91A 4TV8A 1X8KA 5CITA 3KXLA 1NNUA 1DGQA 4ZVUA 5L53A 3BC1A 1UM8A 1IHUA 4A7PA 4PUSA 4BE2A 2ZFUA 5C3EJ 3LD9A 1YJNI 3FJOA 1J9IA 3MMSA 1VG1A 1E3JA 2CWEA 1KTIA 4XH9B 4AIJA 3ABIA 4XICA 3EWNA 4QRIA 2QW8A 1FTYA 3QLVA 1SBZA 3OJWA 4AYXA 1ISMA 1H1LB 1C3XA 3ZWWA 5KSYA 2X7JA 4Y9RA 4CUGA 1ICEA 3C18A 1X1CA 4RIGA 2VZ0A 3ZD6A 2XA2A 1NSYA 4AZWA 1BW5A 2B61A 1FEZA 3T0IA 2VJAA 3OC0A 2DT7B 2WJWA 2DQ4A 2V6FA 1WUHS 3W5DA 1XEFA 1VMKA 3ZQ4A 5A3JA 2Z3VA 3KUXA 3SZ3A 3JZMA 1ICIA 1YOVB 3OESA 2E2IJ 2X1LA 5EEHA 2OQ2A 2KE5A 3ACCA 2HXYA 3GGJA 3BTUA 1XCGB 1N6PA 5GJCA 2JI9A 4YMTA 1RPNA 4CCYB 3AEQA 2WMYA 3QJ5A 3HB1A 1E2KA 2VZLA 1NG7A 1C0KA 2JGDA 4Q3BA 4CEIB 4P7GA 3WWZA 3JARB 5JBIA 1D4AA 4C4TA 3CMEI 3JQGB 4MKFA 2VFAA 1CRZA 5MN5A 3K0KA 3TAXA 3EVCA 3I1YA 4BTEA 3RAFC 1FYVA 3MJTA 3NHPA 1YHQI 4IX1A 3AOEA 1HQYE 3E1SA 1MFZA 1Q1BA 4GMHA 3DB1A 3VKVA 2HHLA 5CIYA 2KHZA 4MV3A 1XRJA 3NJ4A 4EA9A 1CZKA 3Q87B 1FU4A 1YE3A 5H80A 5ITZA 3GARA 2R1UA 3L8FA 1HTBA 3ILXA 3DVAB 2LDXA 5EZ6B 3UCEA 3RYPA 3BUSA 3RKRA 1MPTA 4I55A 4DQUA 5EGOA 4KWTA 2BY0A 2DTZA 4S04A 3CLHA 5LYJF 3IWFA 1KY4A 4AX4A 1J24A 2EQ5A 3TLAA 2BKLA 3FWEA 3EOAI 2C5HA 2J3EA 2BBTA 4FN4A 1TLTA 4ODIA 4F4FA 3CUUA 4RGRA 2I1QA 1U1CA 5CTAA 5KDOA 4P92A 3LUJA 3IBGA 1VB3A 1FTNA 5DN9A 1V6AA 4DJTA 4AU7A 4ZQEA 3K0FB 4G9YA 1S3JA 3OQIB 1GOTA 4JELA 4OSOA 3BF8A 3AO0B 1ETQA 1SQGA 4Z4QA 3U1KA 4YP9A 2ST1A 2GTIA 2QX8A 2ZYGA 3CN9A 3M4OJ 3R8FA 5GGYA 3RROA 4L2IB 1VA5A 5A1JA 5LOVF 3JRBA 3S3OA 1XL0A 4WZAE 4YRMA 4NYJR 2H52A 1J90A 5LC1A 4F6RB 4L0ZB 2L9SA 5AK3A 1JPUA 3QKSA 1TPYA 3E9EA 2D2VA 5IT3A 2MSYA 4B2LA 3WTTC 3VSDA 1W48A 1J5PA 3VYWA 1X3WB 3OKAA 4JK3A 4HKTA 3FLBA 3D4LA 5TDHA 2UUZA 1ADGA 2Q7OE 1E3WA 2PUGA 3H4IA 4B2IA 4QM6A 3SC3A 4I5DA 1Z2PX 3GNSA 3WL8A 3WKDA 2IYWA 1JSCA 1O94C 4GMFA 4LCBA 1NQTA 3WYGA 5JSYA 1N75A 3CBQA 1SHUX 4KQFA 2O52A 3J80A 2WJ6A 2XPWA 5MN6A 2BW3B 1YQAA 4F8EA 3WGKA 5AJTA 2Q6KA 3LLUA 5KJFA 1O8BA 4LGVA 3TZBA 1U04A 3NTLA 2AWNA 4PC2A 3FOWA 1IXZA 4PS0A 3OFSA 4KVZA 5TMEA 1VFCA 1OASA 4H7HA 4X3OA 3KB2A 3L1IA 4M8IA 2VL7A 1DB3A 2F3TA 1KWKA 1IHOA 2LNBA 3FIWA 4G0QA 5A3SA 4AKTA 4PFJA 2A6EF 4UNQA 1MGOA 2VSQA 2HPVA 2DQRA 2ZS8A 5DI9A 3LCUA 5P21A 2HIHA 1TTPB 4ZYUA 5AIPA 2QD4A 5CLIA 5JMWA 3BR2A 2FRDA 2H0QA 4KWHA 1K9VF 4RTJA 2WT8A 4HXFB 3CUSA 3JQBA 3QX7A 4IF4A 3HHEA 4TXLA 1PG5A 1SEPA 2FOLA 3QX8A 3NLLA 2FQXA 2QTVB 3L8EA 3O8LA 2WZCA 1FOKA 2A1TS 2YWBA 1E62A 3WLFA 2Y1CA 4WFQA 3CESA 4CG3A 4YCLA 4UAVA 3PJGA 4O2BA 1FWZA 3PJEA 3KR9A 4EL5A 1WI3A 4JDPA 2HWUA 4ZHSA 1KOGA 1VQ6I 1ZRNA 5ALZA 1MAUA 3NEYA 1CUVA 1DAEA 1HLGA 3ZW8A 1NN3A 3UMJA 2V9CA 3EK2A 2O7RA 1YE5A 3BOQA 4RTSA 4BVFA 4NMWA 1I3OA 2XGJA 1M2VA 1YRHA 2F8LA 4II7A 3TXYA 1HKTA 1BDHA 3N2ZB 4M72A 3IXLA 1JDTA 1JVBA 5IDQA 2VHTA 4D99A 4OLFA 3ZH9B 5C7YA 3TTVA 4PZLA 3NHUA 1Z0AA 2C94A 4UHKA 2VDMB 4X44A 2HDCA 2O0YA 3BCUA 5CDYA 3M1IA 3RIYA 1X7YA 5DTDA 2XRZA 2YJGA 3ZHTA 5JWRA 3WX0A 2CC2A 1YI1A 1ULBA 4IHSA 1UJMA 1Y7PA 3V9PA 3ID6C 2PT6A 2P91A 4MVJH 4GH5A 3EFOA 3M3HA 5E6UB 4K46A 2GFQA 1QZ3A 2VOEA 1BI1A 2QRZA 1I3AA 1JLLA 4Q5SF 1F48A 2PLFA 4AJJA 1DCFA 4N3GA 3UMMA 4I9NA 2AGVA 2PKEA 4MV0A 1X4OA 3L8HA 3B3AA 3M7GA 1Y34E 3MKYB 1ON1A 3QLUA 2GF0A 5AOCA 3PXCX 4MVJG 1YIJI 1DQNA 1EUCA 4JP3A 4P38A 1XI2A 3PP8A 2AL7A 1X2BA 3HA2A 3T7CA 5FT9A 1TA4A 4RH3A 2XRLA 5I48A 4C0QC 1FNMA 3H8VA 4RQTA 5J2UF 4Z9XA 5U1PA 2DBVO 1DEHA 2BFEB 3NWTA 3PQDA 3OF5A 2OTLI 1SQ0A 3EFBA 2XOKD 1ZPDA 2XSZA 1JZTA 2Y66A 4G4IA 3DH0A 1Z0KA 3NH9A 3S81A 4XIYA 3THOA 4FMPA 3DE6X 1P29A 4UQPA 5A2QZ 2WFLB 4TYPA 3UATA 1WCXA 1CS0A 2HCRA 3QPLA 5DTRA 2XNCA 2FWPA 3UAGA 1ESEA 2AMYA 3CZAA 2P4SA 1FQKA 3GGCA 1FDRA 4IRHA 4EHBA 3VYVA 2C9ZA 4ASUA 1NONA 1T9CA 3K10A 5HXAA 3U4HA 5KHAA 2G80A 2FGJA 4QBGB 3J7AO 3RVDA 1ZDMA 2OUKA 4BNJA 4BNKA 4LRUA 4UEJA 3W3ZB 3W5JA 4B43A 1P5ZB 5EJMA 4ARUA 4QOIA 1IATA 1NBMD 5TX7A 4XKBA 3ADBA 2W6PA 1V7CA 1H5NA 3MJ4A 3D3QA 3OICA 4QLBA 2DK8A 4W8HA 4JLKA 4QTXA 5TARA 3KPWA 4QULA 4KHPB 1GPWB 3V9AA 1KS9A 4JQZA 3QGMA 2W6MA 2C97A 2W6CX 3V8MA 5K8JB 4ZC3A 4BQAA 2E9SA 1Z6QA 3VAZA 5AK6A 3BFKA 3HLYA 1HW1A 2HL6A 3CC8A 1MH4A 4OUKX 3OHPA 1ZA2A 1UPCA 4UHEA 5D6OA 5AJHA 2GOXB 4G1MB 1T1RA 1RI5A 4EPWA 3OP1A 3OE4A 4Q39A 5F1JA 3TO7A 3G13A 3G1TA 3U4MA 3WADA 1MC4A 3ZQCA 1G5HA 1WCYA 1T9HA 4BFCA 5DK6A 4MQEB 5IJ0B 3FGZA 2DTDA 2Q6LA 4RK0A 3ZNQA 2XGGA 3DFUA 1IEQA 3UQYS 4ZPXA 1C81A 1IB6A 1E32A 3GLXA 2Q28A 3F8BA 2QG9A 1ZNYA 1U2DC 4FHDA 2LKPA 4ZAYA 2OV1A 2XMQA 4HGQA 3E0QA 2W8BB 2YUIA 4DUPA 2I2XB 2P6NA 1Y6GA 4E7LA 4MRPA 1FYWA 1TEHA 2CFCA 2I67A 3OBIA 2FX5A 3LTEA 2XW6A 4UBOA 4F5YA 1FUIA 4MB0A 2WAXA 4UCFA 3P9XA 3KWMA 1FSEA 4MYTA 2J3HA 1H22A 3DU5A 3CX3A 3DEJA 3M81A 1U2QA 2QXUA 2AEJA 4ZVVA 4ZC1A 4B4CA 2LGJA 4F3KA 4NNOA 1SUBA 4KL8S 4UVBA 2VBZA 4IQJA 3OIVA 3JD4A 4ITUA 4PFQA 3Q0UA 1UZCA 4YRJA 4LWPA 4RPCA 4HUQA 1UF9A 3PR1A 3BWXA 1GXSB 3NORA 3I72A 5JXGA 1DJOA 2O8FB 3QEJA 4J0IA 3LH5A 5D5XB 1YJQA 1YB2A 3ETCA 1KJ8A 1X42A 5HBRA 3CCJI 4Y30A 1GTRA 1UMCB 3UICA 3B1XA 1I50J 5TGZA 2YWRA 3LBAA 4YJHB 4DWJA 3G8AA 5AI9A 3JR7A 4MB6A 2V3VA 3L6DA 4TSKA 1J25A 3HCDA 2W98A 2VIIA 1EJ9A 3O6BB 5CIWA 2C07A 5JCPA 5B1DA 3ZK7A 1D1PA 4F46A 3TFOA 2BC9A 1E1KA 2O54A 1TQPA 2VWQA 3JYQA 1DRUA 4WH0A 1LTHR 5E20A 1UBFA 2Y1XA 3GLFA 1J8VA 1EFRD 3MB8A 1O3SA 1L0BA 1ORKA 5L4LA 2AFRA 4CM4B 1D5YA 1F1ZA 1BA2A 3M0EA 3TH5A 3TEDA 3HR4A 1OREA 1YWGO 2FXIA 3ZDBA 2Y1GA 5EXTA 4AKHA 3EVTA 4MR8B 2EA4A 1KEEB 3JQ8B 4EARA 4OQ4A 3ORFA 4D7MA 1BMDA 3VODA 1C9YA 2CNWD 2A2ZA 1JQ5A 3D5LA 1JECA 3L8YA 1T38A 1VHTA 4CEJA 1SKYE 1PJTA 2D1VA 4GYYA 1N2BA 4JXXA 1P4HA 2R2GA 1WHUA 4P4LA 3V1KA 3JALB 1MOZA 4H08A 5SYNA 5AUOB 4ALNA 4GD3Q 4RPKA 3HUDA 5B4UA 1I51A 4DCMA 3V7WA 4ETMA 4EOGA 3JRXA 4KGZA 3BJOA 2E87A 3BWYA 2EFPA 2D2FA 4FE7A 2OGWA 2ZIVB 4XUDA 2IOYA 2JH8A 1QH1B 2P2SA 1VP3A 4KC0A 4YI5A 4K03A 4M1MA 4NR0A 4WLFA 3CCBA 1ISSA 3UMRA 4MKZA 2KZVA 3LX5A 3ZBTA 1LPSA 1SVUA 1YQDA 4UM7A 2WWRA 4OREX 3SC2A 4UNOA 1JVSA 4JUBA 1KI6A 1DDNA 3ZE1B 2GZSA 1CP3A 4RAYA 4A3BJ 3HCBA 3S1AB 3DMYA 2OB1A 2YUTA 1GV1A 3RDPA 1XTTA 3JAWA 1JAZA 4AMBA 4CF5A 2VT7A 5LL6P 2WUEA 1B6TA 1CB0A 4OAZA 2YJ5A 2G1PA 3D6MA 4Y17A 5IKEA 5C44J 2FW7A 2PKXA 5AHRA 1USTA 4I99C 2GKOA 4KICA 4XOTA 3G2JA 1WJCA 3I0TA 2VQSA 4LGYA 4AL4A 4XYLA 3ZOBA 5HLHA 3KQOA 2GFIA 4RGVA 2IP2A 1QA6A 3FRJA 4TLCA 2E5ZA 2X0RA 3I6QA 3UXMA 3A0BC 4KI7A 3LVFO 1D1SA 2QD3A 2YV5A 3OT1B 1XEXA 4LYHA 4L27A 1RXIA 3GEZA 2C5SA 2O5EA 3W6KB 3N3BC 5JQWA 2X9NA 3BSWA 1FUYB 4Y2RA 1K7AA 4MUHA 3IHWA 2MINA 2IXFA 3QTLA 3ESAA 5I4BA 1JILA 3VR6H 5TT0A 3B9QA 1QRYA 2UUBB 4XGNA 1CNEA 3C6YA 3P5SA 4OQYA 4MIYA 1PR6A 4AY5A 1JH8A 5FKJA 3SKVA 1XJ0A 2JCXA 4F6CA 2YVQA 4HDQB 2WJGA 3PQ7A 4ZALA 3PFKA 5EXDA 3DXFA 4OL0A 2J0UB 1QB8A 2RNGA 3H5IA 4D92A 2WA1A 4RXTA 3L9WA 4TUYB 1KK0A 5IASA 5LQJA 3RKSA 4FM9A 4TQUS 4DCPA 1GL6A 1PO7A 3D6JA 3FB1A 3T15A 2MYUA 4HSEA 2OD7A 4B7ZA 5LQRA 3NGMA 1WUKS 2GHRA 1DQSA 1XRNA 3OQBA 3OP4A 3E7XA 4HDVA 1KC3A 2NP7A 4KR7A 5IT4A 4KSCA 2VRCA 3INYA 3KJFA 2GAIA 1KO7A 5KNLA 1QIHA 3FTCA 4QYSA 5HEKA 1SOUA 5FUWA 4F7WA 1WZ2A 3DQQA 1L3CA 1TX4B 3HJTA 5ALOA 1K97A 4WXEA 2FBIA 3CJRB 3FR7A 1J75A 1AKVA 2C3PA 4RBOA 3T6KA 3BWVA 1P1BA 1WMAA 4OB8A 4MVJI 2DCEA 2VDNB 3H17A 2NIPA 3AUAA 2BFCB 2O23A 3JW4A 3W2EA 4RB1A 1KYYA 1OHHD 2YNMC 3RIEA 2W4IA 4E6EA 4X90A 2ZVDA 1XNJA 3LUFA 1EUQA 1NFFA 13PKA 4U3JB 3PV0A 5G1PA 1KTVA 4OUDB 2PFBA 2TYSB 5K5QA 3P71T 3TB4A 2ZRGA 4FX4A 3JATB 4KK4A 1C8VB 1GGVA 2ZSUA 3W9UA 4DYVA 1P0QA 5CD9A 3HZHA 1QPIA 2EINH 4KQGA 1U6JA 2Q8PA 3N86A 2V5UA 4DAEA 2A9QA 3LPMA 4W1QA 1ZG1A 2C00A 1NUHA 5JDIA 4CTJA 5FTKA 1KHHA 2QHXA 2VJNA 2Q3CA 3BLYA 1KO4A 5CCEA 2OR3A 3CXRA 3BILA 2NTYC 5ERXA 4EJFA 3BFJA 1G8MA 1XSXA 2HYIC 1NLUA 3TVTA 3OHMA 1DTWA 1DWQA 1L1EA 4RL4A 2FPIA 3CCRI 2EIHA 1W30A 4DCUA 4L75A 3C8MA 4G5RA 4D25A 3LBHA 4CL8A 5J2TA 5IKPA 1X1PA 4QVGA 3VVBA 4DWVA 2QM8A 3GDOA 1YX5A 2BAGA 5C46F 2Y0DA 1OC4A 1DAOA 2J7PA 3TGWA 5J63A 3W06A 4JVNA 2X8WA 2NW6A 5GZ6A 1IEVA 2IIVA 4Q3AA 1S3FA 4LHVA 3TDUC 1YASA 2DGDA 1SH7A 3WQRA 3PEYA 2DU9A 5AIAA 1Z13A 2WYWA 4C5BA 3CEJA 3Q2OA 1N3YA 1VE6A 1R5NA 3SZRA 4PN3A 2ZUBA 2Y9ZA 3UAOA 1HG1A 1WE2A 3CCLI 4IBOA 3LCJA 2IJLA 4Z54A 3WTXC 4BC0A 2LFBA 2GLXA 4PZZA 4DCTA 3BKWA 1YJCA 1LPBB 1LGYA 4YAOA 1ECPA 4PVCA 3EODA 3GEBA 2JAHA 3QF4A 4M98A 4I4IA 3DPUA 2D54A 5JUWA 5BO5A 4G0UA 3IB3A 3EXEA 3CMMA 1NG9A 4LXQA 4C4OA 3FYUA 1YJ9I 2JRLA 4S2EA 5DLEA 3MJFA 1XPUA 3T94A 1OLXB 1M34B 2O07A 1JQJC 1W0KD 3M4ZA 4A3LJ 1CJSA 4JYBA 4PGMA 1J0AA 3RABA 4HLDA 3T5TA 4D0NA 5KDLA 5LEKA 1DAGA 5LYJB 3FHZA 1T13A 4BJHB 3BJ6A 4K7JA 4D3SA 2MMCA 3R6LA 3ZVKA 4EABA 3ETDA 4DUGA 1C1HA 4FI3F 4YN3A 3EB9A 1GKYA 1D2RA 4QDUA 4QBFA 4LEIA 4BLRA 4AIDA 3PQ2A 2P8TA 4OFBA 2VTVA 1EUDB 1ZH5A 4IHJA 4CR8A 4OKIA 4D4HA 4PLZA 5FEMA 3BGIA 2OBLA 3RU9A 4NMHA 4P3OA 3NCHA 5FUBA 5BYKA 3LL7A 4HUJA 4J01A 2OHFA 2EQRA 3AVWA 3FTFA 1ZGCA 1FTGA 3HB0A 2OZ6A 3UJNA 1E5QA 5FFNA 1V8FA 1Z63A 2HT6A 2PS1A 4LW8A 2AZMA 3OIYA 1XVAA 2XXBA 4EVSA 3AHFA 4WACA 1TEZA 1FE8A 1VL0A 3A1VA 4QD3A 2YIDA 4PX2A 3GZNA 4LOAA 2PUVA 2VK8A 4N9WA 4UBMA 3L8ZA 1VTNC 1EEHA 4MI6A 1XPOA 2HDDA 1J07A 5KYKA 2E4VA 1KMMA 2IXGA 4H0EA 1RWQA 3PC6A 4KDFA 3BFXA 3HCCA 1TQ4A 2WSBA 4AG6A 3B78A 2ZYWX 4N0MA 1YZVA 1GZSA 2AVDA 3PFYA 2P5KA 2KZGA 3CC4I 4YMGA 3WDLA 3NBAA 3OEWA 1ZUD1 2O1EA 2BTOA 2KS6A 3AM4A 2HM7A 4QJ3A 2WI8A 2NQ2C 1HNNA 2SCUA 4U0WA 4M87A 2XI4A 1DU4A 4DEVA 4KDCA 4C08A 1OR7C 1EJ6A 1UFOA 3EMVA 5GOZA 1MJHA 3UNXA 4MUAA 1P4RA 4HTFA 1JQAA 4YDSA 1XZFA 2GCPA 4FD2A 3U7RA 3UK2A 1VQ9I 1WXWA 3RNOA 5C1BA 2LR0A 5B4TA 1JHHA 5FUXA 3THWB 2DCMA 2P0EA 4TROA 3LDAA 1MNDA 2FP4B 2V7GA 3DU6A 2A5FA 4KE6A 3PKIA 3V7RA 5JADA 5FTLA 1T0FC 3N97A 4B8WA 3ZV4A 4JCOA 1K79A 5H0IA 3LYHA 5DB4A 4DA6A 4XWWA 4IEEA 3ASYA 2R4TA 3LLMA 4JWKA 1BWRA 1E92A 2REOA 5E1WA 1KHTA 2L4AA 3ISJA 3FXOA 2FPPB 3EZFA 1M1YA 2G9WA 1M6WA 4OQNA 1D1TA 1ZNXA 4HX9A 4LYJA 3S2EA 4EYKA 2GHQA 3RU2A 1I7DA 2CJWB 2HA2A 3GW8A 2W2NA 1LFUP 1I33A 5FJJA 1K92A 3ANXA 4ER3A 1ML4A 1ZH8A 4URXR 1NJ8A 4KUMA 1C1DB 3IALA 3L7DA 1EBFA 2C5FA 1MVOA 3VOSA 5IVPA 4BB0A 1RKTA 4Q47A 1Z0SA 1HYBA 3P32A 5AJUA 4B3SB 1Z0JA 3JQ9C 1B72A 2BDUA 2AZXA 3P5BA 4TT8A 2WA2A 3DP9A 1E9FA 2BI4A 4GGPA 3K05A 4FCTA 2XSDC 1VBKA 1QBKC 3LXUX 1RWNA 4YBRA 3LAPA 4EY4A 3FNRA 4DLBA 1GVNB 2AHQA 4W6QA 2M6RA 3G8YA 3RT7A 3BTCA 3V2UA 2BEVB 3UYKA 2DHCA 3LF1A 1S7AA 2AI2A 5L3VA 3K0CA 4D43A 1N2CE 5KO2A 3T5MA 3NHBA 2LC2A 2JGNA 3BXHA 2A4KA 3OEHA 1BA3A 3OZFA 2PGOA 3ZBQA 2HNBA 4KCGA 4BJ3A 3K4NA 1C41A 4J0EA 1BOBA 3IMFA 1RS0A 3H65A 3DMTC 5F0HA 3VU9B 2D45A 2Z2KA 5LXTB 1X94A 4Z4EA 3WMFA 3VH1A 5IBQA 4XFJA 3TQCA 2Y31A 3SZOA 5IBRA 1UBRS 2VLIA 4MARA 3M3YJ 3A4YA 1SXIA 3WNZA 4MMZB 3IS3A 4FNAA 1X14A 4FNGA 4ALLA 1RXWA 1H05A 4IRUB 1XZAA 3BORA 5J2UB 3G2PA 3I71A 2IEYA 3E3OA 3RF6A 1IWBB 1M2FA 4P0QB 4G1EB 4BBAA 3H2GA 3KZOA 4ADSG 4BHCA 1NJSA 1ZD2P 3PXAA 1EWRA 1VGRA 5EE1A 5BMVA 4CYDA 2NSJA 4X1IA 4FFLA 1ZJ4A 3CP2A 4U2GA 2FW1A 1KDZA 1QM5A 4Y6OA 1H0SA 4TQAA 4F55A 1D5VA 1G59A 3IE0A 3FWHA 4GUDA 3V4RA 4CCMA 2WTNA 1IL0A 1XJ5A 2H8GA 5DZSA 2GWRA 1QMGA 3RS8A 3IHTA 4O1MA 5C80A 2VJKA 4WOJA 3N5CA 5AR1A 2GEJA 3HJEA 1OGJA 1JLSA 4IL5A 1HA8A 1E2NA 1E2LA 3RUPA 2X5OA 3BMXA 1PR2A 4U9IS 2H08A 2XCLA 4PFOA 2XCUA 4N5IX 2GJ4A 1X7XB 4JT2A 4CDRA 2ZAYA 2W2PA 3TLXA 5E9AA 5J43A 1WCWA 4CTKA 3H83A 3AHDA 2VDKB 1ODLA 2IE8A 1E2IA 5CX4A 3DPSA 4RDUA 4TKLA 3EG9B 3B12A 3H84A 1KI2A 3U3DA 5I9SA 5EWJB 5IYDJ 4HS4A 3S2DJ 3RBAA 1T2VA 3ABQB 2G4LA 2BCJQ 1DIOB 1DUVG 1K98A 1R0WA 5F3WB 4PFKA 4DXAA 2SECE 4E07A 3OSFA 3OZGA 4LK1F 4JB2A 1YRNB 5MGBA 2I6FA 3FZEA 3SS9X 2F9LA 1FOEB 4W8GA 2OZKA 4FYYA 3HXOA 4RVGA 2WAEA 2H07A 2EBIA 3CW9A 3BYZA 1H89C 1T43A 5HOQA 1HQKA 1DKUA 5JO0A 1Y42X 2JHFA 3V8EA 4EB6B 1T2FA 3RC3A 5TJHA 4RFVA 2CQNA 4X62B 5CYVA 2YJ4A 1J42A 1EH5A 2Q8NA 1F8FA 1DJLA 1JLHA 2PLNA 4GZ5A 1XMAA 4ZVOA 4EJ2A 3O75A 3DOIA 1E1LA 3X1DA 2QNIA 2ROQA 4XUEA 3CVXA 1JN0A 2VBWA 2PS0A 4A3CJ 4KMSA 2R00A 1IFXA 1KAHA 3IQEA 3LK7A 1ZGHA 2X5NA 1SUCA 2PJRB 3G2QA 1RRCA 4RLQA 4RJJA 3ZS8A 3K1MA 4XSHA 4ENSA 2R5WA 3WHKA 4LDRA 1G64A 4D79A 4CKWB 5B30A 4MYRA 5HNKA 4BGDA 1CX9B 4YQZA 3FJ1A 3DYIA 1NC3A 3T35A 5IXSA 5AESA 1QRTA 2XTZA 3ILYA 2FETA 2HR1A 2ZI9A 2IUSA 3KXDA 4ME6A 3SJZA 3ZQUA 4N03A 3UMVA 5EYPB 1QHGA 1H8AC 2OYRA 3HTUA 4D8UA 3HA7A 4K6HA 1G19A 4UVHA 3ROEA 2WSYB 2WV9A 5L51A 4JL8A 4IX7A 1V7ZA 2HU9A 1QGOA 4FBMA 4PRLA 3EZ6A 4BFSA 2YINC 4PTYA 1RQRA 4PZAA 1WY5A 3FYTA 5EMLA 4CFYA 3QI7A 1SG0A 4UATA 2JGMA 1HKUA 4WF2A 4C7KA 5I6DA 2RGWA 1L7XA 4P5EA 1BCRA 3WG9A 4J19A 4DVGA 4CU5A 1HNXB 2WAYA 1JDUA 2FPLA 1QP8A 1UMQA 2I5UA 1SVSA 3E4DA 3QWHA 1SRQA 3FROA 1WPXA 2QZSA 1MIOA 1V1MA 4OQZA 5K2OA 1RJEA 3OMLA 1E9EA 1KE2A 3RVPA 5JS8A 2YQ4A 3UC5A 2VJPA 1YR1A 1JKIA 2N9UA 2RGUA 3ABUA 5HIIA 3L7LA 1R6UA 1TLHB 4G5SA 4MVJE 3W2VA 2OK8A 3TPCA 5K45A 5ICEA 5SV2A 4K9LA 3CN7A 4LDNA 1U94A 5DTIA 1Q74A 2R8YA 1TT0A 1FQJA 3MHTA 3C3JA 3QOFA 3NBKA 4CG1A 1PD1A 1TNSA 1Y5NA 2E71A 2EJBA 3K6SA 3VPHA 1NN0A 3TCXB 4LYYA 5EAIA 1I2AA 4I7EA 1MDFA 2D2EA 5K4HA 3DEIA 3GROA 1Z4KA 4KO3S 3L4JA 3ZWMA 3B3JA 1OFHA 1TCBA 1VZ3A 4C2TA 5F64A 1LDJA 3OPVA 2NM0A 1TU4A 2PH7A 3G2HA 2YN4A 5ES4B 4ZRMA 2A9PA 5HP4A 1YYVA 1LNZA 1JTVA 3W7AA 5J5AA 3EGXA 1LQ2A 4AYTA 3IILA 1P2UA 2WV1A 5BQ3A 2Z98A 4MYDA 4KACA 4NZPA 3H11B 2X6RA 2PX5A 4ZEXA 1RJDA 2XB6A 4DZTA 1FYKA 2JH3A 2Q1XA 4AIRA 3QLVC 2OYSA 3WLRA 4HPWA 2ZG6A 2R1TA 1G3IA 2X8LA 2V1XA 1RYHA 3GLQA 1EDEA 1Z17A 1BMQA 4TTQA 5JJBA 4LX0A 2XNHA 5CXSA 3KTAB 1Q15A 1KH3A 5ICSA 5M5XJ 1EP3B 1BXRB 1BRTA 5A04A 5FOQA 3LSPA 1G5QA 3OU6A 4JT9A 3KOWA 1OX6A 3VR5D 3LKZA 1F7VA 3E8SA 2JA1A 3IQGX 1QIKA 2E2JJ 2YY6A 3FBIB 5MFPA 3EAFA 4V0LA 2IS6A 3IMKA 2W7NA 1PGOA 3P2IA 1WBBA 2QR3A 5L95A 5FH9A 4C2MJ 1POXA 3SJBA 5TJ9A 3HEBA 1KWGA 4XMYA 4EPXA 1LQUA 1QLJA 1E6EA 2PZAA 4KXUA 2F1RA 3A70A 4KPFC 3TPZA 1HFKA 4IS3A 5DDGA 3N2GA 5FLMJ 3ZTTA 1Q0SA 3CCCA 3KSDO 3H6KA 4BB5A 2NLOA 3ZZ0A 4WESB 1QCZA 5AVZA 2HF7A 3DZGA 5A9SA 3WL5A 2JUCA 4MWGA 5D7NA 4WVLA 5EXSA 1BFUA 4FZRA 4JH0A 1XMOB 4BFVA 4IUBS 4ZOLA 3FWYA 3JQCA 1CUJA 2VKEA 4KN9S 4QASA 3QMMA 5IKMA 3EZNA 4QXPA 1C80A 3OZ7A 8AT1A 3D7RA 4XORA 4LJ7A 5FV7A 5ILOA 2AXQA 1V26A 1XN4A 3BE8A 4IIYA 4N5NA 2B8JA 3W6ZA 2C9OA 1ETWA 1E20A 5FLYA 1T26A 1KNXA 3QPBA 1SFEA 5EIFA 1Y48E 3HZZA 2G7HA 5GAGJ 4XSXF 5FD6A 1VI5A 3CT4A 2CBZA 5DX8A 1FP1D 5FHRA 3C6QA 1C30B 2AG6A 1V1RA 1TZKA 4F4DA 2J3LA 4DNXA 4B4KA 4JFAA 4UMFA 5BPHA 4KXFB 2FK7A 3DOHA 2PQ6A 5HGXA 1ORRA 3TSOA 2J8ZA 1N7HA 4PPNA 1ENPA 4FDUA 1U2EA 4HDNB 4LGMA 3GLIA 3H5AA 3KS9A 4BO0A 2KLOA 2XWQA 1QZZA 4PPGA 5SICE 2HU5A 2JAOA 1HO3A 3U09A 1R9JA 3WGTA 1SFKA 1IDZA 4DSNA 1XTBA 3P7NA 3LWZA 1R5GA 3RB8A 2ZULA 1F5NA 3HJUA 4UJ5A 2QPTA 2XMSA 2GLOA 4D9GA 3G17A 2IHBA 1ZN9A 1XP8A 3GRPA 1J0BA 1X3ZB 4M0CA 2C3YA 4KX3A 2ZPUA 1P60A 4NQRA 4GG1A 4IILA 3GYGA 2HWXA 4URHA 1T4DA 4LOIA 3RRFA 2FEAA 2EBWA 3J7YJ 3BRWA 5FLXA 3QW4B 2DPHA 4BDSA 1ZLYA 5KYXA 1QVUA 2W9XA 4KFCA 1Z6AA 3CEAA 4BFXA 1GRVA 5ILUA 4CV0A 1XDBA 3RVRA 1NE7A 5DRTA 3BWEA 2ZT6A 5JJ5A 4OAQA 2X40A 4Z2AA 3VZRA 4HDSA 4L5IA 5FPKA 3OM8A 1T34A 1ZSNA 4BUJA 3UXEA 1UIMA 3B7WA 3QELB 2EGHA 3QVMA 1KSHA 5C3MA 3QE0A 10MHA 2CB0A 1A71A 4D9NA 5KVVA 1WEHA 2FEXA 1X4PA 4OH1A 4YJ3B 1VMIA 3P9PA 3MOGA 4HX2A 4A3JJ 1WD7A 1RMTA 2V3CC 2ZSJA 4PJNA 1SFUA 2FRDC 5HKKA 4TN5A 2OUMA 3QMPA 5G2OA 3EEIA 3JQBC 3TDNA 4X3CA 1OFGA 3CUVA 3KAQA 5KB3A 3HMKA 1D6MA 1SKMA 3M2PA 3QPUA 3SQOA 3LOPA 2BONA 3K31A 5ENZA 2CUFA 3U48A 1FTWA 3BD7A 3GBPA 2O8XA 4P35A 5EIBD 5M3MJ 5KYNA 2RI1A 4GLFA 2SICE 4RY2A 1FB5A 4BACA 4BFUA 4N6OA 5GONA 2BOVA 5EJ5A 1IRIA 1G3YA 1CQTA 5EJGA 2HF2A 2OCGA 1U1GA 3JRFA 3KU1A 1I2DA 1P1HA 3FDZB 1B8OA 1YZGA 4MQVA 1FCJA 3B1ZA 4XX0A 2NZJA 4J76A 3SSNA 2XD4A 5BN4B 3V80A 5KJCA 1YONA 3D2LA 1GTG1 4G86A 5HTOA 2BEWB 3FNHA 1N77A 1FVHA 1LJUA 4MW2A 1JFFB 1EX7A 3S1SA 1A8SA 2YPRA 1GADO 4MGZR 2FQ4A 4CMGA 1I6WA 1FDOA 4P3YA 5B58T 3HCFA 1GJRA 4M6VA 3ZBPA 4AMYA 3KJGA 3FKSA 4K6GA 1BC8C 1LI7A 3SX0A 5E8IA 2ZRHA 1JWAB 1Y3HA 2ZCUA 5LP6F 3N8DA 4UE2A 1PFUA 2GA2A 1D6NA 3VZSA 2A5WA 1DKQA 4D4KA 3T5DA 3TAHA 4OXRA 3ZG6A 1H1TA 1V3QE 2NZUG 3E9DA 3KV1A 4D8XA 2GCNA 3OIOA 2HO4A 3EUEA 2ESRA 4GZMA 1BOFA 4DE5A 4ZWNA 3J7ZI 1XZKA 5HDNA 3Q9VA 5JYCA 1TVKA 2CNLA 3MLEA 3PEVA 2OBFA 2D5VA 2ANBA 5A4DA 4GPZA 2VXYA 3COYA 4Q9KA 2LG4A 4HF2A 2BFDA 4G0ZA 3S44A 4BTVA 5EUMA 4Y2VA 3DKYA 3QHQA 2EZHA 4FP9A 4BXUA 1LRJA 1OH7A 4AXXA 2VJMB 2MD5A 3HCOA 3QVTA 2H1RA 3TTUA 1JFLA 3A2MA 3PX3A 2H3HA 3WYDA 5JRJA 4LC1A 4NYIR 1XZMA 2HWVA 1RE1A 2ANCA 2WD7B 4ZODA 1EGVB 3E23A 1JIUA 3FXRA 4XYBA 3LDFA 4F38A 4QUBA 1MD0A 3GDFA 3H2JA 1WB9A 3L4EA 1U7PA 3IH2A 3EEBA 5F78A 4JYZA 4DV5B 3IV9A 4RBNA 1VGVA 5JMOA 1E2EA 3OOPA 5D84A 3R3JA 4Q1BA 3TE6A 2HA4A 1CF2O 3A6FA 4PSUA 2JJ2D 2AOTA 2VPQA 2GXBA 1U5TB 3WY9A 4BO2A 5EHNA 3VVCA 1KAMA 1B74A 2LBFA 1X0VA 5JJKA 4QX6A 1R5OA 3DTVB 3WLTA 3QU9A 1TM5E 3HOSA 3INRA 1RTTA 2A0YA 2EVWX 1R0LA 2W6IA 4TS1A 1QBJA 2I6SA 4IJUA 4O08A 2XGXA 4UBKA 1GGEA 2XDAA 3P26A 1U2ZA 5BNIA 1SK8A 1ZGBA 4FN5A 1JSLA 2Q1TA 4HLCA 3ZE2B 2GNOA 4E5PA 1GZVA 1UMDB 1OLUB 4ALIA 1NHGA 3U26A 4CUKA 5AW5A 4L3WA 5F2EA 2GBCA 4XPIA 4EDFA 4YC7A 3WK9A 3ETNA 2QL5A 1T0PA 3FM3A 4QUGA 1HKHA 4ZI7A 1UQTA 4KIJA 3V4VB 4PO9A 3IAS6 4WK8F 3D7LA 2DCUA 2YVUA 3MTIA 1JJ7A 4E7HA 1W5AA 4B81A 2KDOA 4PBSA 3D81A 3AKZA 1UHWA 4Q4JA 1Y3CE 2ODQA 3FI9A 4GICA 5A9RA 4QPDA 1PW7A 4O4LF 3KJHA 4G2TA 5BV8A 2C2HA 3OYKA 1ZELA 2P69A 1SIUA 1GEGA 621PA 3PQ3A 3JXEA 4TYYA 2P7IA 5GV7A 1WHSA 1QU2A 4KOEC 1AKNA 5ER6A 2FAXA 5JJLA 3E35A 2SKEA 3LLCA 3ZWNA 3G9QA 5D6EA 4MIEA 4BGVA 4PPYA 2A6TA 2IOFA 3BMCA 2CVQA 3TZ6A 2M0CA 1NRIA 3GUZA 2WC2A 2RH8A 2WWFA 5K8VA 1PJLA 3VI3B 2M7BA 2LZ0A 1HWYA 1UDWA 4N0DA 1PK8A 3C3KA 3I61A 3N2EA 3BP8A 4I7HA 5JD3A 1P4XA 1YGYA 4XARA 1ZXXA 1TPZA 1VFPA 3OYHA 1WXIA 4MYHA 4Y2PA 2WOOA 3ZE6A 3AEYA 2RH4A 3HRHA 5AUQA 4S35A 4YRVA 3EGDB 2BSAA 1Q3HA 3DF8A 3D2CA 4AN0A 4JU8A 1GQYA 4F4JA 2R8RA 4GF5A 3ZV7A 1SAUA 2DMTA 1F17A 5F2KA 1FW8A 4LIVA 1CZUA 2R6HA 3HU5A 2I8AA 1RXUA 3KXPA 3A05A 3VU8A 1YTUA 1RXSA 3RK1A 3EA5A 4F84A 2XSZD 5LXTF 3WHCA 2P81A 2Y1DA 1G3MA 1RHKA 5CPRB 1YW8A 2JGJA 2QXTA 3MZ8A 3DOCA 5CK5A 2PKWA 1TAGA 4PANA 1O94D 2GA8A 3S2GA 2EGUA 2D5CA 2ZIGA 1S2OA 1AHPA 1PNQA 1JALA 2XKAA 1JX6A 1N36B 3L0YA 4JENA 4NL4H 4E5KA 3IP6A 2ZW9A 4N39A 1MB3A 1X80A 4A93J 5L3SA 5KI6A 4EVQA 1PKEA 5LBQA 2UXCB 1F60A 1YU9A 3T3HA 1LBHA 3AP2A 2QV0A 2H1FA 1F51E 3HB5X 3CUQB 3WMWA 4WFJA 1VG0B 5DVZA 4RM3A 2CNOA 4M3GA 2WVJA 3FJYA 4I4NA 1A35A 3V4OA 5EL0A 1E4YA 2R1VA 3E81A 3AF6A 1MIHA 3K0LA 5M29A 3V4SA 2DFIA 3ZQ6A 3PWZA 5J1SB 4YONB 4C88A 1K78B 1M8GA 3BPSA 5H82A 4XB2A 4RJKA 4PLWA 5KTNA 3EPJA 4EHKA 2W6JA 3HXMA 4Q24A 4MVJD 5LMCA 1NWCA 2A1UA 2ZS9A 1IN4A 3NIBA 2EJUA 2VTBB 1WP9A 1Z88A 1TWHJ 2CHGA 3FWZA 4C0SA 4AKGA 1DAPA 4IIUA 4X65B 1Y63A 4IJWA 1KJJA 2RGAA 4CQNA 4GXTA 2P5TB 3S16J 4F2GA 3FCAA 4QNNA 2CB9A 4R1TA 1XCPA 2NVOA 4G5XA 2WHYA 1WVGA 1OIXA 1R64A 3F49S 5HLGA 2FMKA 2XZOA 2J48A 3R0QA 2O2EA 2PMWB 1V4BA 4RKWA 2X0DA 3V7YA 2XAFA 4ZRDA 5CVJA 4PAMA 4PWZA 3QRWA 1HFWA 2EYQA 2C8LA 3Q8MA 3ZLJA 1YUMA 1A1VA 3OZTA 1P61B 1Z16A 1DT5A 2N75A 4TSRA 1WJBA 3F90A 5HPYB 3DDWA 4KO8A 3PSHA 2R97A 1P1CA 4ACBA 3SMVA 2J32A 3SVLA 4RB0A 3REFA 1P2VA 1OIVA 3NASA 2PGNA 3LRTA 3AEXA 1AHIA 4ENPA 3H87A 3OD5A 5FO5A 1M33A 3EQ2A 1T8UA 1ACIA 3BT9A 5FOXA 1YS1X 1BOOA 3QP9A 1BDBA 1E1CB 2FY8A 4LXTA 4PLFA 4XM1A 4JBIA 4DYHA 2V9KA 4V03A 2IY9A 2W00A 3CJTB 1VRWA 2A59A 4HWRA 4C7OA 2VPYA 1Z4QA 3H9CA 4XBFA 1ZFNA 4PLHA 1S2MA 1FRFS 2AOUB 3EEFA 4ND2A 2YICA 2W2LD 1CUDA 3PXXA 1Q57A 3I04A 2JSPA 2GZDA 4I4CA 1YOBA 2X9QA 4X0GA 2FRVA 1ST2A 5A62A 1BW6A 1THTA 1DNPA 3K1AA 1D1QA 3TQSA 3NHMA 4EYGA 2BW0A 1VI2A 3RRXA 4A2WA 1CE8A 3H3ZA 3MK31 3QU4A 1QRRA 3UJ6A 2A35A 4MW0A 4Y2XA 2BHLA 5EDNA 1R8QA 3GJYA 4FSDA 4C3IJ 2ZYTX 2WKRA 1KU3A 1MJ9A 4AMUA 3JTHA 1HDZA 2VLAA 2F17A 4UCQA 3RZOJ 3ESZA 1ZOLA 3SIRA 2PYZA 2DMQA 4FDVA 1C1XA 4HLUA 1M6NA 1R36A 2C20A 4IH4A 2VXZA 1GZHB 3II6X 4K9SA 4JYMA 3EXFA 1J0CA 1JIXA 2N0SA 1UC8A 3AL2A 1RTKA 9MHTA 4L0QA 2QL6A 4JX8A 5EP3A 4DA9A 1J2EA 4YRFA 3H0CA 3BT7A 2FH5B 1YU6A 3HCWA 6Q21A 5KOHA 4CM6A 3I8OA 4MX8A 4J4HA 2R7MA 3UCXA 3OEYA 1B8IA 4J8PA 4BP9A 3V6LA 3L02A 3E84A 2DFNA 3THRA 1WHTA 1YFJA 3FOEC 3FMSA 1WGXA 4C87A 1X1EA 4EBFA 3KZIC 2O57A 2KBEA 3NXSA 4JN6B 2PGDA 2GYWA 1BROA 4AJHA 1EBBA 1QPBA 1J56A 2ZB9A 5JHUA 3T41A 4L3OA 4DGSA 4BVJA 3A4VA 4Q1FA 3GLLA 8LDHA 1JT0A 4IDNA 2ZQ5A 4DCSA 5F23A 1RUNA 1EUYA 1ETHA 4HBZA 2X9DA 4N8SA 4WY2A 2NVYJ 1Y5LA 4A6PA 3L1KA 1X6VA 2Q2EB 3R0XA 4Z3KA 1USVA 3U3ZA 1F8YA 1KZ1A 2YYZA 4POOA 5IX8A 3QTTA 3SD7A 4GRDA 1DXQA 1UMBA 1A9YA 5JDIC 1DBRA 3AI2A 5IS2A 3OYJA 3RREA 4H3VA 4O1HA 3QI2A 5EJCA 4ESBA 3DT9A 3S28A 2NU9B 2PYDA 4EMTA 3AIMA 3WWCA 3KQHA 2P9BA 2VBYA 1E6CA 4FCVA 1R0YA 1JHOA 3OLCX 5GMOA 3TIFA 4C1BA 2JJYA 2VNSA 4W5RA 1KVSA 3IRUA 3GD5A 5HQ3B 1Z9BA 3HYCA 4AAYA 3HDYA 1RAGA 2V7BA 3OL3A 3MWEB 3MS7A 5L6LB 1EK5A 1U9CA 3L07A 1GLVA 3P7MA 4C05A 2W37A 5IAAA 4YGYA 2BY3A 3CTPA 2IPOA 3SQXA 4E7KA 2ZJAA 4G5GA 4J94A 3OOHA 4OOFA 3R2JA 2NX2A 4AZTA 3TIVA 4QE3A 3Q8XB 4HEJA 4K2HA 4EY7A 1GA6A 4UUNA 3FHOA 1S01A 5DNDA 3U9SA 2L2OA 4UU7A 1IBKB 1QE3A 4WZAB 4MEXF 1PUXA 2CJYA 5IJZA 2Y9YA 3I53A 2I78A 4MKGA 4EG1A 4BQIA 2CT8A 4DCVA 1TIBA 1PEDA 2PIAA 4I6ZA 4YAGA 821PA 2DLCX 3QPVA 4Q5IA 1MNAA 4RPLA 1YDGA 5F2OA 1LW7A 4QFDA 1QPGA 3OPNA 4L02A 1RACA 3FYUC 4M37A 1GKLA 5DWVA 4N7MA 4IIGA 4IGAA 3I5YA 3BGWA 3WDMA 2XBMA 1H2HA 3JWJA 5AVOA 1ZARA 5TT1A 1WUJS 5LQUA 1E0KA 3WE2A 4K9NA 3V8RA 1NBWB 4N9QA 2MFZA 3O3NB 4I8XA 3WQSB 4IMRA 2VRCD 1TWGJ 1XF1A 2NACA 3RPQA 1NW3A 1GPYA 1TD9A 1J9EA 2I8CA 1OTXA 1QPMA 2J0VA 3UUFA 2HJVA 2GYUA 2ZSBA 3OYBA 1PKXA 3LGSA 2QLMA 4TV9A 2H06A 2X4HA 3U1VA 2QX7A 1F3OA 3OFKA 3OEEA 1YQEA 1JJAA 3V1LA 1YDMA 3C5WP 5K01A 3ZN1A 1ZUNB 1A3CA 4U2FA 4FOSA 3T61A 1T0IA 2FSFA 3OWHA 3H0KA 1E3IA 5I7HA 3FNBA 3VRHA 2MC3A 2M1BA 5LLDA 2VDOB 3B48A 1Q6YA 5CW1A 1YMUA 4Y2JA 4G24A 2Z43A 4Y3OA 3B3FA 3ROTA 1KYXA 3LYLA 5M5YJ 2JGIA 3ILSA 2IH4A 4Y0NA 1O58A 3W34A 3DV0B 2L02A 5CDFA 3Q0EA 1QYWA 1I1HA 4ZU6X 1LRLA 2ELKA 2QDXA 3F3SA 4EX6A 4NJEB 4LRXA 3W8NA 3CQ9A 3ZKAA 1L5ZA 1SPXA 5L3FA 4V3CA 3FTPA 3KHSA 2WVAA 2RBKA 2QTZA 3IEPA 3ZUPA 2HX1A 3WXBA 3UQZA 3N58A 5I45A 4XGRA 4XAQA 1ZESA 4NXNB 1ACMA 5COQA 5EWLB 3V4PB 4ROSA 3BTOA 3L6OO 4J29A 5A7GA 4RKFA 3DTYA 4GZLA 4CKYA 4PBRA 3I9V2 3P0JA 1LNSA 4CQLB 2BFBA 3VR6D 3ICCA 4Y2GA 4C2UA 4DFDA 4MGRA 2CD7A 1W7PD 3IIMA 1LLUA 2L5QA 4OWRB 4BLTA 1ZW6A 2VHQA 3P0IA 4DJDC 2PEYA 4OQQA 4Q9IA 4DR6B 4HR7A 1HSTA 3LPAA 4FMCB 5IC5A 3HY3A 5H9WA 4MWTA 2RSLA 2QTTA 1RAHA 3BH7A 1ANKA 4FYPA 4BNHA 4RZIA 4Q9AA 3TNDA 2DU8A 2J0SA 1TQ2A 2Y75A 3IRRA 4XKJA 3ZU5A 3DMDA 1U8ZA 1UBMS 1PSZA 3CRNA 3EQ7A 1ZMRA 2BF7A 5F9MA 4YJ3F 1Z1DA 2VNKA 3BWMA 2ZBEA 5TQ2B 1U3EM 5D3KA 1Z4OA 2GAAA 1W25A 1N6LA 2NYXA 3GJ0A 3MQ2A 1SUAA 3F9CA 2VA9A 3NAUA 4BLVA 4D82A 2FUCA 1XHEA 2B1RA 1KEZA 4LLGF 1II9A 4D6XA 1YCDA 4FHCA 5IT5A 1JA9A 2ZUUA 2GCOA 2V7UA 2ZUDA 4YP6A 3WQQA 2PE5A 4EY6A 3SI7A 4KG7A 2OTCA 2H2GA 2XZDA 3PKJA 1S96A 3TZQA 5C8VA 5ECGC 1LEBA 4QGAA 1OKKA 2GQ0A 1HEIA 1NVVR 3R24A 3ZXIA 4V1CB 1JGGA 1X13A 3LUCA 2A0FA 1HT2E 4J9UE 3DT6A 2O5CA 1AUVA 3FUVA 3A2NA 5K5OA 3PRYA 4OSEA 1BJZA 3HGYA 5KTPA 4BNCA 3R20A 5T3UA 1DOHA 3FN4A 4OTZA 5EPEA 1XU9A 2L3DA 4ZI5A 1CEYA 3K09A 1QO0A 4HNSA 2JLXA 3L0OA 2GAFA 4CQMA 5LP6B 1Z47A 4BBZA 1OLSB 1BIFA 3L06A 3T34A 1YZNA 3PC8A 3SHWA 2OFXA 2VAPA 1X1RA 4K26A 2W2OA 4CLRA 2Z2YA 1N32B 1S6LA 3BSYA 3P0HA 3N7UA 3K0CC 4PJ0C 3K4JA 4E6KG 3ETHA 5BYAA 4FFWA 2PV7A 1UBGA 3I1IA 3U6BA 3C1DA 2P1DA 2OC6A 5HF8A 5EZ5A 2M98A 3NOXA 4JMPA 3MUEA 3PHHA 4YG2F 1FP2A 1KEKA 1V16A 2C77A 2GN0A 2YHSA 5HQTA 2YNMD 1E7RA 3ILVA 2GT1A 4QREA 2CMKA 3NDJA 1U2SA 1PT6A 3T9AA 3ED5A 3PPIA 4P36A 2AH5A 2RHCA 2WMNB 4OOIA 1X7WA 4U2CA 3EXHB 1DE0A 3LT2A 4L6AA 2VN8A 1SEUA 3H9GA 1L4NA 1A2QA 3G2OA 3OS1A 1IAVA 2GN6A 2IEIA 1H42A 3CPSA 1TUBB 2GJ8A 1JMKC 3HN2A 4E2YA 4DGWB 5BPIA 3DDCA 2IK8A 5M3BA 4ENNA 3V3KA 3HG7A 2QENA 3W2AA 1RLIA 1NNSA 4RKQA 2VKTA 3OSZA 4XLAA 4IJ5A 1Z5NA 1CPYA 4X91A 1G5RA 2GIZA 2DQZA 2JSCA 4YIFA 3UV3A 2J6HA 3V8BA 4WCVA 1SC7A 1T9ZA 3IPXA 4MJ3A 5B1IA 4Q4DA 1OGIA 4IGEA 4CYMA 1ZK1A 1A04A 3G1MA 4X63A 2WJZB 1QNTA 1N8NA 3K5WA 2I2BA 5K3FB 2VJQA 1MX3A 2RK6A 2OMEA 2Y2ZA 4NWIA 4E3WA 2HU2A 4E1BA 3AW8A 3HABA 1TK3A 4E12A 2XMBA 1IY1A 2Y1FA 4JUFA 3T1NA 1SCIA 2V59A 1UBTS 1ZUIA 5EZYB 3BK2A 3AUXA 3PGXA 3F6PA 4ZOEA 5KU7A 5FD8A 3CU5A 4DRZA 5JATA 5DGIA 3TG8A 4GEKA 4DJAA 1RP7A 4HB0A 4S0HB 3L7KA 1Q3KA 3CUEF 4PAWA 2COBA 3EOBI 4DMLA 1VYTA 2XKBA 3GJXC 4J0DA 4IIVA 5KINB 5HMMA 3DGFC 3LHSA 4MTEA 2WINI 4NCJA 4DWOA 4Z8YA 2QLJA 2GF9A 4FCWA 1O97C 5KSZA 1PT7A 3VOEA 1KH2A 3O0TA 1W1WA 4OVKA 1PGJA 2RKOA 3K30A 2NNNA 1EFAA 3N2LA 1QK3A 2NZVG 1VMAA 2CGPA 1P0PA 4O2AA 2WIKA 4HLNA 3KHKA 4F06A 3IP1A 3EUAA 1U8TA 4FCCA 1RWVA 5JASA 3DUWA 4B1RA 4M86A 4JDUA 1GGJA 3TX2A 3RQ4A 4O4LB 5LEJA 3H5TA 1VLVA 4JXZA 4E31A 1ODJA 3CLVA 3HKEA 3M1LA 2HDWA 1WSUA 1EI9A 4JLMA 1BEEA 3LC0A 1EQAA 3MS4A 2ZRAA 2R00C 3CM0A 2ZP1A 3HV2A 4EF6A 3NGLA 2JWTA 1EUZA 3L8GA 2EFGA 2OGUA 3PQCA 3SN6A 2OB2A 2AA3A 1VSVA 4BU1A 3DFIA 3AEUA 4L07A 4LJAA 2X3YA 5LDDC 3EHDA 1V4NA 1IQRA 4KIBA 3B5EA 2OVFA 5E6RB 3U0VA 4EGAA 3DLHA 3B02A 2X1CA 2BZ1A 3R7DA 1NQUA 4ES6A 3VHLB 4LG1A 1T9BA 4LUCA 3L4BA 2A86A 1VXOA 2PH1A 3GK3A 3I09A 4RK6A 5CGZA 3HI6A 4R2IA 2ECPA 2QS9A 2P6TA 3ZGOA 4A3DJ 2GPTA 3R4VA 2P2LA 1HG0A 1NPDA 1X1DA 3NHWA 4EZEA 4G5HA 1E64A 2E82A 4L8FA 1UEIA 2OZUA 1JGTA 4D3FA 1JMYA 1U28A 1W85A 5I7VA 4I66A 4TZTA 2GNPA 2V7FA 1KBQA 5EEAA 1V8DA 3RG8A 5E1XA 2ZJ6A 3LAJA 4JQSA 2ID3A 1FLVA 3ZY6A 2RNJA 3SS8A 1DKNA 5CTJA 4PSVA 3ICEA 3CPEA 2ZZNA 3EYYA 2WW8A 4US0R 4D9FA 3KEFA 4YREA 1EWTA 2FW6A 4P08A 3LUKA 2HKXA 3RTDA 1PZGA 2VKVA 5DHAA 4YJGA 3ZKWB 3EFHA 4C0BA 2V65A 1R6RA 2PLRA 5LDGA 5ARBA 4AMGA 4HFMA 1QOQB 4A8JB 4RF5A 3MFQA 3QE4A 3I55I 5JI3E 1TK2A 4IZZA 3JASA 4M3NA 5EF6A 4AJEA 4UEQA 1VZ2A 4ZT6A 3PGMA 4IWXA 1A9RA 3U7EB 1FDTA 3I0MA 1V54H 3MWGA 2W25A 5BQFA 4LKOA 2C2WA 1OCRH 4S24A 1I2CA 1QGUB 1COZA 3CTMA 2HPMA 2HQNA 4GFDA 4Q9HA 2Y05A 2FPKA 1UDBA 1EGAA 5AXDA 1VJCA 4HN2A 4W99A 1E61A 4Q4AA 1T5BA 1GVDA 4BY9E 1EHYA 3BM5A 5FAXA 2ONJA 4LJ6A 3F2IA 4WNAA 1Y7LA 3PHJA 4I3HA 2CZQA 3ONDA 2EX1A 4OFZA 3M6LA 3FXKA 2Z9CA 2XQIA 3N1UA 3BMQA 3I8XA 1QAOA 2ECQA 2YWHA 2I22A 2FFJA 3V6MA 1Y8RB 4WN9A 1FBUA 3BDDA 1BGXT 1CGPA 1ISPA 3QA9A 2A3RA 2ZAGA 3KXIA 5D8KB 2PG4A 2ZWPA 2XUIA 3RFUA 1XT6A 3W3AA 3R3SA 2A9OA 4BKPA 5AHOA 3K1PA 4FZ5A 3RRYA 4RY9A 4U7PB 1P4WA 3NPMA 4NQZA 1FYDA 4A8PA 2AJ8A 1Z6YA 1OA1A 1AZTA 4I9HA 1YTYA 2PUWA 4A03A 2DOAA 1MCZA 1MPXA 5JZVA 5REQB 5KBYA 4ZV7A 2FX3A 2QB5A 3W6JB 2ID6A 5GV8A 3COPA 2OQRA 1GU7A 1JEYB 3RBZA 2BKEA 4IDDA 1T0HB 1SZCA 4JBNA 4TXMA 3D0KA 4KISA 1PNVA 3LCRA 4BV2A 1IEWA 2GPAA 4NC7A 5AONA 1M1NB 1QF7A 2CDRA 3RG2A 2ODWA 4TVSA 2QQGA 3N2KA 3TWOA 4A36A 4AYWA 4DLSA 1SVIA 1UHMA 1X19A 2PZGA 2RGGA 2GEVA 1C0LA 4BL5A 4BN4A 2DFEA 1PDVA 3CNOA 1GM5A 1AU7A 4Z3OA 1OYYA 4E0BA 1Z29A 1P92A 3B9PA 4Q9LA 2D5IA 4AMZA 1OUMA 3OFND 1F4LA 5EJ8A 3A4LA 3R4KA 3RD5A 3S2ZA 5IF9A 4QJIA 4I1IA 1SUEA 1ZJWA 5SZKB 1EBUA 3DOOA 2V7PA 4B71A 3RKYA 1CZOA 4CJXA 2YHIA 2D59A 4L5YA 3LCVB 2CXXA 4L5BA 3UVEA 3CGGA 2GLUA 3I28A 2G07A 4Y6PA 1WWXA 1WVIA 4MQ5A 3TW8A 2V3WA 2P4HX 2KIFA 1I1OA 3O8NA 2WT4A 2H9IA 3AAFA 3PNMA 2ZM5A 5CVTA 3D4OA 2PGAA 2RI0A 4Q48A 5E7QA 3KOMA 5FRNA 4YMVA 3F72A 1NR5A 2NUAA 3RYHA 1RYZA 5ELLA 4N9HA 2H85A 3MTAA 4UPEA 5HFAA 2PJZA 4AP5A 2FEPA 3QKTA 2XCRB 3E5RA 2NO5A 3UWOA 5JISA 5B7NA 1KYIA 3WV5A 4DLXA 3P9ZA 1MH9A 2H5IA 3EDMA 4X97A 3IIEA 2AYZA 1Z77A 3LA8A 2X58A 3QXSA 3VNUA 2KJBA 3GCWA 4HDMA 4DPLA 3NB0A 1RWOA 1S5LC 2ZJQF 4OLAA 4J91A 2XDQB 4LHSA 5JCJA 3ANTA 2YDYA 1I6HJ 2Z5VA 2W1OA 4NDLA 4LJLA 3ICVA 3G0OA 4RY8A 3BK7A 4YS6A 2XTJA 3FFWA 3F74A 1SCJA 4ZVTA 4L73A 2R6GA 4QDKA 1GEEA 2IXTA 3RT9A 2Q6IA 1Y82A 2AOWA 4D6PA 2IUUA 3PUJA 3LCCA 2KMUA 4IDCA 1ZM4A 3SE0A 2RMKA 3N7AA 2V1DA 1BZYA 3N4MA 5IUKC 3T5CA 4B9AA 2C6YA 3NI2A 2DOKA 2H63A 2VUSA 2XV1A 2WTAA 2LR8A 3QE3A 1K8YB 4Z0PA 4K9QA 1GPBA 3LBIA 3NUZA 3ANYB 1ZIOA 3DBHA 3C98A 4K87A 5AHWA 2FUEA 5HG0A 1G18A 3SQNA 4BMNA 4OL9A 1QX3A