1P4AA

Crystal structure of the purr complexed with cprpp
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
275
structure length
269
Chain Sequence
KFRRSGRLVDLTNYLLTHPHELIPLTFFSERYESAKSSISEDLTIIKQTFEQQGIGTLLTVPGAAGGVKYIPKMKQAEAEEFVQTLGQSLANPERILPGGYVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPLAYAAASYLNVPVVIVRKDSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLVEAEGVDERLVDEYMSLLTLSTINMKEKSIEIQNGNFLRFFKDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional dissection of the Bacillus subtilis pur operator site.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
molecule keywords Pur operon repressor
total genus 77
structure length 269
sequence length 275
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
A PF09182 PuR_N Bacterial purine repressor, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1p4aA01
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p4aA02
1UPUA 1Z7UA 2DPUA 4FYMA 1ZG3A 2QQBA 3QRFF 4RAYA 1ZN9A 4OU0A 2QBYB 4AIKA 4ENJA 1QK4A 5HLHA 2ZMEA 5BPDA 1NHAA 2ZKZA 3ZMVA 3JTHA 1MJBA 3GGJA 2XROA 5JVTA 2GWRA 3GLXA 3G6WA 5E8GA 4EJTA 2GXBA 5EEGA 1ON1A 2H27A 2OU2A 5K5QA 3CUQC 5TRDA 4P5OA 5BMZA 1R5HA 2K27A 3F23A 3ECOA 4EJVA 3I53A 3QOPA 3OZFA 2ZNZA 2ESNA 1DDNA 4L0YB 4Z2YA 1TNTA 4LGWA 1BM9A 2D2WA 1IXSB 2LNBA 3FMRA 3IKTA 1OREA 3WU1B 5IT3A 4HDUA 3E6MA 3TO7A 4IRHA 4LYGA 4Q5SF 2WNSA 3HSEA 4HF0A 1RUNA 1QNTA 2HS5A 1ZG5A 4ASNA 4ZYHA 3HTSB 1V3FA 3T5XA 2VBYA 1T38A 4RHXA 3HOSA 1P18A 4LMYA 3L2CA 4P81A 4RAQA 1ZHFA 5CJ9A 1KA8A 5L3EA 2M87A 4L5JA 5J6XA 3K2ZA 1FP2A 1DPUA 5HDKA 2M45A 3L7WA 1S8NA 3CO6C 2DK5A 2O03A 1O57A 2JI4A 1YFHA 3K69A 3LAJA 1KYZA 2ZXJA 3J81Z 2O61A 1I0LA 5LGUA 2MLKA 2A68F 1DQPA 1E2XA 2XUBA 1SD7A 2PMHA 2VBXA 2VXZA 2DFIA 2JPBA 2E7XA 1FYKA 2V1XA 1U5TA 4MTEA 2XAFA 3K1PA 3V7CA 4IPAA 1KQ8A 3J80Z 1QK3A 1BOAA 3ABTA 3IKVA 2QM3A 4KT5C 2H6CA 2ETHA 3Q5FA 3IL2A 5CVVA 2H06A 2HOEA 2KIFA 4KN6A 4KN7X 1O3TA 4HAMA 1ZG1A 1R58A 5HIAA 3WTUC 2YX4A 1QBJA 3VOEA 4P84A 3SZTA 4NB5A 1SFXA 2H6BA 2M1BA 1WQ2A 1W4MA 4U0YA 3T8RA 4RABA 3BJOA 4RHTA 5K5OA 4RACA 4PZJA 2F5CA 1IUYA 1H9TA 4IRGA 4B8XA 3RYPA 1I6XA 2FXAA 4HW0A 4I2OA 3BROA 4RQAA 5LHGA 2E7WA 4LJZF 5FD6A 4I98B 4XBFA 4F8EA 4FX0A 1AOYA 3KP7A 2IA2A 1USTA 4M72A 5BQOA 3F6VA 2VN2A 2QQ9A 4L9NA 2DPDA 1ULYA 2MC3A 3KZZA 3TQNA 4L5IA 1OKRA 1WI9A 4I0BA 1V4RA 2BEOA 1OROA 2ZCWA 2VODA 3WG9A 1FSGA 5HOOA 1B6AA 3T0YA 1Z05A 5ILSA 1UHMA 1HW5A 3HOTA 2Z3YA 3TOBA 3OZGA 3DF8A 3MEXA 3O2PE 1HXDA 1BJAA 5D5VB 1T98A 1HQCA 5ESWA 1ON2A 4YG2F 2F5FA 3CUQA 5LBQA 3N97A 3WTSC 2WWYA 1KGSA 2X4HA 3F72A 2PJPA 2LF8A 4G94A 2AEEA 1BBYA 2NAZA 3I0TA 1R3UA 4OIRF 1QGPA 4HBLA 3S5JA 4KA4A 2VOPA 2QWWA 4I7HA 1H9GA 3L00A 5F1RA 2DTRA 1P6RA 4O3MA 1RIOH 1Z91A 5KAPA 4B09A 3F8BA 1AWCA 2VONA 1YO5C 5A2QZ 3ML6A 4TWBA 4RGSA 2W25A 1J2XA 1IXRC 5HDNA 3MFKA 2PFBA 3H92A 5JV5A 4P83A 2HCRA 1W5SA 3FWEA 2FBKA 4L9VA 2O6GE 4GGGA 3M9AA 1PP8F 4YIIA 2HTSA 1ZLJA 3H83A 5IAOA 4ZFNA 3FMSA 1C0WA 1L0OC 4XLPF 4A5NA 3BY6A 4L9JA 3CUQB 2J5PA 1FSEA 1XN7A 2DK8A 3TGNA 1EV7A 4ESBA 5BRNA 4KIBA 1YW7A 5HVQC 3LQRA 2OAZA 2FNAA 5E20A 4U88A 1OPCA 3ZMTA 1AO0A 1R22A 1IAWA 2FF4A 1IN5A 3OOPA 1EH7A 1WD5A 4EGZA 4KNYA 4ESFA 3O7MA 1Y0UA 4IJQA 1TQPA 4RB0A 4IHTA 2FBHA 2DU9A 1WSUA 3LQQA 1FC3A 5CVUA 1P17A 3RYRA 1ZAOA 1USSA 3FMQA 3ZMSA 2HWVA 2W84A 3LWFA 1RUOA 1W7PB 4WXDA 4KN4X 4RB1A 1OR7A 4PGGA 2FBIA 2FRHA 3KCCA 5DDGA 4YFXF 1B59A 1HW1A 1IN4A 1YTYA 2O8XA 4LB6B 3ZN0A 1J7KA 4WCGA 2EFPA 2VT3A 4HQMA 3GEZA 4YFNF 1LEAA 1ZRDA 3GYHX 2GXGA 3HRSA 1TNSA 4P86A 3F6OA 4A5MA 2FNPA 1VTNC 5HLGA 1IRGA 4EJOA 1SD6A 3REOA 5DV5A 5E18F 4WWCA 2EFQA 5BPIA 3G73A 2GIVA 3V4GA 4OMZA 1ZRFA 5LGNA 4NHJA 3C18A 1HBXG 2ZNYA 1QPMA 4D0PA 4EGYA 3KETA 1XGSA 3F22A 5LEKA 2ACJA 1OPRA 1BIBA 3VEPA 1ZN7A 3DPTA 3W6JB 5DUKA 2Y0MA 3I59B 1L1QA 3OV8A 1SMYF 3F8MA 3AAFA 4M9XA 1TTYA 4Y15A 4I09A 3DXJF 1PZMA 4GO1A 3HTUA 4RAOA 3HRTA 1HW2A 3DEZA 3GGCA 2MLGA 4FX4A 2OZUA 1D6NA 4LLLA 2A07F 1XGMA 3IC7A 5D5WB 1ODDA 2BV6A 3MAJA 2W57A 1SD5A 1P19A 2PQ8A 4TV7A 2JTVA 4UVBA 2K4BA 5L3DA 4ZYDA 2DLLA 3EYIA 1ECFA 2QLZA 4Q47A 3E6BA 3I58A 3P7NA 2PRYA 3WTXC 1ZGJA 4RAZA 1J5YA 4PFQA 1WKMA 5A2QK 2L4AA 2KKOA 3TDZC 1R5GA 3MZHA 2AS5F 3HYIA 3PQJA 1P2FA 1PDNC 3KP3A 1CJBA 2CWEA 2HQNA 3FXRA 3KP6A 5KK1A 3KB8A 4PCQA 1FYLA 4O5VA 4L0ZB 2VFAA 2QUFA 5HLIA 1KQ0A 3KLNA 5ICGA 4RS8A 3C1DA 3D0SA 3KZYA 2QYOA 4PDKA 5LLQA 2STWA 1YYVA 3DMPA 2V79A 2K86A 5TJJA 1XTVA 2K4JA 3JSPA 3M3HA 1H0MA 2HDCA 2FXVA 3FXQA 1VCHA 4MEXF 1O3RA 4EM2A 4P55A 2L3DA 4X44A 5FD5A 2EA2A 5IPFA 1JHHA 4LLNA 2GA1A 2A69F 1ZARA 1KU3A 1J7JA 2Y48A 1R00A 2HEOA 1IRFA 4MB6A 1U9YA 1HKSA 2Q2EA 2XASA 3V7RA 2XAHA 4QYIA 1MJAA 2YSRA 1R7JA 3VODA 1J75A 2UZKA 2R7FA 1YS7A 3ELKA 4OHCA 3LRTA 3EDPA 3WE3A 2OD5A 1XGOA 2XGXA 1ZRCA 4LK1F 1ZN8A 2RC4A 1KU9A 2JBHA 5L3BA 5FLXK 3IWFA 3E5XA 3I71A 4M6YA 2Z99A 2HKXA 2V1DA 1IZ1A 1ZGAA 3GZ6A 1S3JA 3QP6A 2XIGA 3J80K 2KJCA 3JTGA 2LSOA 4BXUA 3V8LA 2ISZA 4GXOA 3IRRA 2GA2A 2EFOA 3KEQA 1TLHB 4HF1A 2NYXA 3CO7C 1BI1A 3DFGA 1SFEA 2DQRA 2ZO4A 3BPXA 3HSRA 2EV6A 1P4WA 3DP7A 4M73A 5FO5A 4ESJA 3O3KA 2KIMA 4I02A 4XSZF 1Q1HA 4MNUA 3HIFA 3SHFA 2K02A 1QZYA 3WODF 1KU2A 4UV8A 2XAJA 1G3WA 2ESHA 4BYYA 1U9ZA 5E8IA 5EUCA 1W7PD 2BE5F 3ISPA 1TBXA 1VSTA 1FZPB 4LFUA 1K78A 4PAWA 3M8FA 4M0KA 2A6HF 1MZVA 1Z9CA 2XHKA 1R1VA 2NNYA 2P7CB 2Z5UA 3ACDA 5ICEA 2NS0A 4KICA 5CYVA 1B9NA 1BN5A 4P9UA 1XSXA 1I1GA 5F6FA 4PGHA 5BS6A 3DKWA 4A2UA 1XDSA 3LA2A 2B0LA 2QQAA 5D8KB 2L02A 2LF7A 2UXXA 2A61A 1IF1A 1IN8A 4OIOF 3C3WA 3KLOA 1G9TA 3L09A 5HS7A 4IF4A 1O5OA 5JSQA 1R1UA 4GCVA 4HV6A 5L3GA 2PBIA 4M74A 5BQPA 3E3VA 1FLIA 1I5EA 1BC7C 2EWNA 4R79A 1TQIA 3Q9VA 4A6DA 4ZH4F 3FZVA 4CO8A 3DEUA 3VFZA 2EK5A 4LZOA 3P9KA 3HHHA 4GYGA 2A6EF 2O0YA 5LGTA 1EH8A 1U3EM 4JLSA 1QZZA 3GX4X 1ECBA 2H08A 1HKQA 4N9IA 1CF7A 3WTVC 3FXUA 4LG0A 2EB7A 1BI2A 2HGCA 1OYIA 4UVCA 3DAHA 2H07A 4NQWA 3DPLC 1KU7A 4IJAA 3FM3A 1ECCA 1S6LA 2O3FA 3DV8A 3K0LA 4U0WA 2K7LA 2WC2A 3HUGA 1LH0A 2D45A 4E70A 5BQTA 5DD4A 1MGTA 2OQGA 4UXNA 1G3TA 2MD5A 4BNCA 4BAYA 2P1ZA 4UV9A 4U7DA 4OIPF 4Q48A 2FE3A 3RKXA 4RANA 4HYEA 3JAMK 6PAXA 5E17F 3QAHA 5ERIA 1A98A 4WX9A 2HFHA 3RJPA 4YFKF 3CUOA 4A12A 2JRTA 4IRIA 2VT2A 3ROUA 1LQ1A 4UNOA 1XGNA 1J59A 2VE8A 3GVAA 4RB2C 5DYMA 4M0PA 2VBWA 1BI3A 1XZNA 2ZMEB 2R7DA 4LD5A 4WMLA 1YIOA 4L18B 3GF2A 5ED4A 3E6CC 1D8KA 4G6QA 5H6RA 4IHSA 4RV4A 5D4RA 3E6DA 1ZN2A 2GQQA 3RPUA 2JKZA 2XKOA 1A3CA 4A0XA 2HTJA 1XMAA 1O7LA 5DCFA 2V6CA 1FYMA 1VDMA 2YZKA 3BOQA 3BPVA 5FB2A 2AXLA 1K7AA 1MKMA 1LDDA 2DAOA 4HQEA 1TW2A 1YG2A 4UUVA 1DQNA 2PMUA 4KMFA 4ZYGA 3WGIA 2P8TA 1S29A 4AIJA 1SD4A 4LYYA 5J8FA 1DUXC 2FMYA 2ADUA 2GZWA 1UFRA 4LZNA 2MH9A 2W24A 3BDDA 2FSWA 1D3YA 2ISYA 1RI7A 2Q0OA 3G3ZA 3TKYA 3GFIA 4QLCU 4RGXA 4U0VA 3WGGA 1F4KA 1G3YA 4ZZLA 3HVUA 4CICA 3Q9SA 3K1NA 2L4MA 3V8KA 5LRRA 2G9WA 5LHIA 4MQVA 3QP5A 4S05A 1UHWA 5CVRA 4BH9A 1T0FA 2XRNA 1U2WA 3V7SA 3EYYA 4HV5A 1I5ZA 4GYIA 3VB2A 3BJAA 1LNWA 5LEJA 3B73A 4AD9A 2RGVA 5CVIA 4EM0B 3ZMDA 1XTUA 2V1UA 5IT9Z 4CXFA 1MZBA 4RQBA 2CQKA 4EMSA 3BZ6A 3GWZA 3P9CA 1HMPA 3GO5A 1B4AA 1LB2A 1DKUA 5FLXZ 3FF5A 1Y0BA 1B1BA 2F5EA 4HZFA 2IGBA 4EQQA 3EQLF 4IXAA 4LZAA 1XDUA 4L9TA 3CTAA 2D1HA 4OMYA 2IVMA 3CJNA 1MJ9A 2A5YB 3WTWC 2EV0A 3ZP5A 2EA4A 1D5VA 3GXOA 3K1MA 3LSTA 1A97A 2XBUA 2KRFA 2HYGD 1IN6A 4CHUA 4QYIB 1RNLA 3GEPA 1BD4A 1EH6A 1XTTA 4ZYEA 3BP8A 4ON0A 1G3SA 2P7VB 5JFRA 2HYFA 1B9MA 2CSOA 1JE8A 3QPTA 3GUDA 1JLSA 1Z1DA 5K1YA 5D8LB 3WTYC 5K5RA 4HX7A 4MHGA 1FWZA 1BI0A 2IA0A 2M8EA 4ENKA 2IRFG 1ZLKA 1REPC 5HS9A 3J7AO 1U6GA 3ZN1A 1I0IA 3RTRA 4G6DA 2NRAC 1FX7A 4Z1OA 3I54A 2XKPA 1GVJA 5ILVA 1L1RA 1LEBA 4Y13A 5KAMA 4MQ9F 4P3KA 1ECJA 2PLYA 2ZBKA 4MGRA 2COMA 3M7GA 2A3SA 3MCZA 1YS6A 5HDGA 1KYWA 1G2PA 2DY0A 1OMIA 2YR2A 5CLSA 3ZQ7A 3WTTC 4IVNA 1I1SA 3RPQA 1QCDA 5AIQA 3GZ5A 5FFZA 3NEUA 1W5TA 4K2EA 2HQRA 4UHTA 4R8HA 3I59A 4ENMA 1IN7A 5E1XA 1LVAA 4G7OF 4JITA 1K78B 2C4KA 3GFJA 4RHUA 3SQNA 3N4MA 5F64A 1SAXA 3D5LA 3C7JA 3HHGA 1WWXA 5D5XB 1JXSA 1Z7GA 4G9YA 3SXYA 4BHPA 2XVCA 1TW3A 3IRQA 4X45A 3M1EA 1CF7B 5D6FA 5D5UB 4JK1X 1FY7A 2MBFA 3T8TA 4EM1A 1DP7P 3LFKA 3O6BB 5E38A 1XB4A 4G8XA 1U8RA 3MWMA 5JHUA 3ZMUA 4HOBA 3R60A 2DQLA 4RHYA 1ONVA 2UWMA 5DCMB 3TO9A 1JHFA 1YLFA 3SFZA 4DQ2A 4CZZA 1PUEE 5L3FA 1T39A 5EEHA 2QZ8A 1XMKA 2HR3A 4DNCA 1QB7A 2JT1A 4XLNF 3IHUA 4A6EA 1QK5A 2PN6A 2PS1A 1S7OA 3OHPA 2HZTA 5JR3A 1K79A 1F9NA 2RDPA 1I13A 2IT0A 1W7PA 2P4WA 3FX3A 1FPQA 2EJRA 3M8EA 4KUMA 3KP5A 4KFCA 2R3SA 5LRSA 1T2KA 2P5KA 5AIPA 1GRVA 4WXHA 2Z9OA 3MQ0A 3FHZA 2EFNA 1BZYA 3PFIA 1Z6RA 2ELHA 2DW4A 2RN7A 4M0UA 1U78A 1R23A 1A4XA 3CDHA 2C6YA 4CDGA 2VC1A 1I27A 3JW4A 5BSKA 3CLOA 2P5VA 1DPRA 2DBBA 3QPHA 2P6SA 5DCMA 2FEZA 1MDMA 2EFWA 3GFMA 1X3UA 1G9SA 4I01A 3E5QA 1G6NA 3GFLA 5H20A 4XRFA 2W85A 4G7HF 2BYVE 3W6KB 2H94A 1J0RA 1BD3A 1BC8C 4MEYF 3P9IA 2D1VA 2M30A 5D6EA 3RIRA 1J9IA 2IJLA 1LDJA 1RZ4A 3F21A 4EJUA 4QRIA 1KQ9A 4BHCA 2VC0A 2H09A 2FU4A 1GPH1 4UVAA 4WXCA 2P5LC 3FM5A 1E17A 2PEXA 1XCVA 5ICCA 4AVPA 2JPCA 2RQPA 3WGHA 4EJWA 1SMTA 2WV0A 2RKHA 1O7FA 1DBRA 1IXCA 2BGCA 1STZA 2IPQX 3KP2A 4HLXA 4KYWA 3B02A 1XZ8A 4OOIA 3ACCA 4S2UA 3F8FA 5JI6A 3MZYA 3RKYA 1L3LA 1UPFA 5ICFA 1QQIA 3L9FA 1S7AA 2FQ3A 3E5UA 3RI4A 4P82A 5H6QA 4RADA 3I4PA 4I0AA 4QWQA 2RNJA 4CGZA 1HSTA 3WTZA 2WTEA 5HS8A 5K51A 1HGXA 4LG0B 2YPRA 4ZZDA 4BQAA 1ZYRF 4WK8F 3R61A 1DKRA 2GEBA 4S04A 4HDVA 2EV5A 2QVOA 1O3QA 2JZYA 2PG4A 4CYDA 4F7ZA 2GAUA 4FT8A 5L3CA 4BHBA 5BOXA 3RDIA 1XD7A 4A0ZA 2BBYA 3TOAA 1P4XA 3DQVC 3T1BA 1F1ZA 1TQMA 3QW4B 2RV8A 2VBZA 2ZJ2A 2KJBA 3ERED 1FSHA 2M5WA 1I14A 2TDXA 3F8NA 1W30A 1YW9A 2HKOA 2F2EA 3COAC 5IT9K 5D4SA 2ZFWA 5LHHA 3I5UA 1GXQA 2FOKA 3KEOA 1JLRA 2X0LA 5AONA 2LKPA 2E55A 2STTA 4JBAA 3E97A 1FBSA 3GW2A 1G2QA 5HKLA 2CW0F 1IW7F 2DT5A 2G7HA 3H3ZA 3SZPA 4HX4A 1FT9A 2CGPA 2CG4A 2NNNA 3KE2A 4KIGA 4LLGF 2QBYA 1GHCA 2Y75A 4P96A 3LA7A 3KFWX 3EUHA 3ZPLA 4JQFA 3U1DA 1F5TA 5KVRA 1A96A 1P92A 1U5TC 3JSOA 1ZH5A 4RB3C 4M6XA 3S2WA 2UXNA 2KIUA 1O3SA 4A0YA 2FMLA 3WE2A 2E1CA 1R1TA 3MJDA 3I64A 4M71A 3N2LA 2F5DA 1UB9A 3TDUC 3ECHA 4WN3A 2OZ6A 3MBIA 3V8JA 1IBSA 2OBPA 3R0AA 3F3XA 3KP4A 3LAPA 4LK0F 4Q4ZF 1FP1D 4KMUX 2Q8KA 2MH2A 1K6OA 1XSVA 5FFXA 2V9VA 2EHJA 1SFUA 3R0JA 1UCRA 4O6JA 3ABUA 1A95A 1FBQA 3H3UA 2JKYA 2YX7A 5FGMA 1OYWA 4R1HA 5J8CA 3R4KA 5DD8A 2FA5A 4P9FA 1A04A 3BJ6A 4RGUA 3U2RA 1ZREA 1HKTA 4OINF 4KIFA 2G7UA 4G7ZF 1PP7U 1BIAA 1JGSA 3R6SA 1HSJA 1CGPA 5E1ZB 1FOKA 4H0EA 2IW5A 3F8CA 4M9SA 4M9ZA 1QB8A 3IWZA 2IP2A 4OIQF 2Z33A 2L01A 1TC1A 2PRZA 4U7BA 2LDUA 4YIFA 1STOA 1FBUA 1OYYA 4KDPA 2YU3A 4N9HA 2PI0A 3WU0A 1NULA 2QENA 1U5TB 5E1WA 3U9GA 4WF2A 1GXPA 4AIHA 4MTDA 2L54A 3ZMZA 1TC2A 1LDKB 3PQKA 4P80A 2E1NA 5ESXA 3HRMA 1G4DA 3RKWA 5DEQA 4HX8A 4EVIA 1XCBA 1FNNA 1MD0A 2DI3A 2JSCA 4ETSA 3LPNA 4AWXB 1MDMB 3K9TA 4EV0A 3HSFA 3QU6A 4ENNA 4HF2A 1V9SA 1T6SA 2VOOA 1D8JA 4XSXF 3EETA 4HA8A 4N0BA 2OQRA 2XAQA 1NONA 2OA4A 2P6TA 1Z6TA 1YW8A 1P4AA 1LJ9A 2CFXA 2XAGA 5CVJA 2J5OA 1XSDA 3EFHA 5ILUA 3NRVA 2DO7A 2XV4S 2IA1A 2MA3A 2CO5A 5DUIA 1QO0D 3TO6A 3JAMZ 2VE9A 2RVCA 3HRUA 3LA3A 3QU3A 3NQOA 4HLYA 3NAGA 2CYYA 1WRJA 4Y17A 1YFZA 3BWGA 4RGRA 1UFMA 1ECGA 4FHTA 1QCCA 1R36A 4LB5A 3J81K 3ACBA 1YQAA 3ULQB
chains in the Genus database with same CATH superfamily
2NVWA 4ZU3A 4QT4A 2DPUA 2CFRA 4PFSA 4OQ4A 2KPOA 1K61A 3DM9B 1QF9A 4KODA 1EI9A 4R81A 2PZFA 5EKXA 3W5HA 4RAYA 4LITA 3ZCTA 2XR1A 4FT4A 1G8MA 3D43A 3KJFA 4M55A 1UM9B 5TSDA 4P7BA 5KVVA 4AIKA 4CM8B 4UJ3A 3PIIA 5IOYA 4LVOA 1DI0A 2WD8A 3MJEA 5G53C 2RG7A 3U31A 4XRSG 2W2VA 2IV7A 1A5JA 1YHYA 2F8LA 2JFFA 2R96A 4TWZA 3UJNA 5GADl 2HW8A 4WADA 5C3EJ 1QK4A 1UCFA 1NXPA 4CNBA 4NENB 3ENWA 1NF8A 5KO2A 5BPDA 4YLGA 4CQMB 1DWPA 3WLPA 4CV3A 1G8PA 3LDUA 4K0KB 1JA1A 2RHLA 2HF2A 4Q9IA 1XYVA 2X9DA 1VJTA 4QJIA 4WY8A 3KZIC 2XDAA 2QUBA 1N2BA 5DHAA 4BKOA 4DUGD 5JJKA 3HKEB 2AHOA 3B60A 1FVOA 2PS0A 4B48A 1BCSB 2XROA 1FUEA 3PC3A 5F12A 5JVTA 4P7JA 4DDVA 2GWRA 2IPOA 4CEJB 1I51A 1WABA 3G6WA 1FYDA 4YRSA 1JQ5A 4KLRA 3ZZ1A 1NZDA 3L8HA 5CNIA 1JIXA 4DDTA 5HQJA 3Q7PA 3U61B 3BBLA 2DT6A 2GYVA 5CXQA 1N2CB 4GDMA 3GPLA 4RW0A 4KLAA 4EWLA 1DB3A 3V4SA 1ODKA 2CZQA 4QYMA 2HOTA 5K5QA 3JVDA 3H5TA 4HNGA 4AVYA 6PFKA 4D41A 1PEAA 4GC9A 1ONPA 1W44A 5BVGB 3KT0A 4DCCA 2OK8A 4TTPA 1BDIA 1ADFA 5AIAA 5M5WJ 3HV0A 3G7SA 5BSRA 3T38A 2EG5A 4IGFA 4KVGA 1IMJA 4I14A 2ZU0C 4Y6QA 2D4AA 1KMMA 2ZNZA 1Q1QA 2PWBA 2AXQA 3E8SA 3HZJA 3FKQA 1O9GA 1PBNA 1VZ0A 5IPAA 1SJ9A 1WHSB 2G9RA 1TNTA 3CU5A 3FOWA 3GJ8A 2ZKIA 2VSFA 4YJ2A 2XE7A 1QGOA 2XUIA 2Z2ZA 1MXFA 1KU6A 2YHIB 3AR3A 3BWXA 3LBAA 3PPIA 5E6SA 5F9FA 2R6AA 3AIMA 2ZT5A 5K3CA 2YWBA 2D2FA 4FSHA 4M83A 5FUWA 3H1GA 1GNTA 3Q7RA 3PUFA 4H0CA 2DMNA 1ZD1A 2BFCA 2QZ4A 4AS3A 2Z2IA 3MXTA 1V25A 4AO6A 4LMRA 3EGIA 4O3FA 3ZLUA 2V96A 3E6MA 1NF3A 1R7RA 2KHZA 4AFNA 1HX7A 4IRHA 1Q1ZA 3VQTA 4ZP1A 3I61A 3M6IA 3IMCA 3BD7A 1JXQA 3S17J 4NHEA 3U21A 4OHKA 1C7QA 1NUUA 4URZR 2P77A 5LQSA 3UNXA 1LSOA 2N46A 1N6RA 3VKUA 3TD9A 1QNTA 1ZD2P 2CVZA 1EH5A 1XBTA 2QE6A 3L7MA 3LLCA 1MB0A 2D7JA 3K92A 3M9XA 1ZG5A 3PS9A 5E4FA 3HCFA 5SY6A 4QDOA 4WBNA 3H0KA 5AYVA 4ASNA 2WF8A 4BY1J 1VL1A 2X40A 3SJBA 2I1VB 3ABMH 4A27A 2FR8C 3VJRA 3C6XA 4WXPA 1U9OA 1X7ZB 1R8JA 1LA2A 1U28C 1P8AA 1NVAA 4HX9A 1ENPA 1HOTA 1O94A 3G49A 3K53A 3KT6A 4M89A 4BBPA 2KE5A 2R4UA 1NKTA 3ESQA 4KCGA 1XRLA 3WHIA 2E1RA 4KACA 4FSXA 4DRYA 3LO5A 3UHOA 1RQRA 1JKIA 3FJ1A 4AUKA 1V3FA 2QP4A 4LQLA 1T38A 4N4NB 2YDYA 2AIRA 3NYIA 2LNDA 1CQZA 4OGLA 3OIQA 4OOFA 1AS2A 4ND5A 2BM9A 2PVSA 1U2GA 4PC1A 2ODEA 1NVVR 3OBIA 3JWGA 4ZKEA 3E5NA 4EF4A 3L2CA 3CKKA 3LT0A 4DJEC 3PL1A 1JGTA 2QVXX 4UU0A 5CJ9A 4C3HJ 2P2DA 2FHSA 3CF2A 4D1QA 2H4WA 2RB5A 4E3WA 4L5JA 5J6XA 3VTAA 2NOJB 3G1UA 3J7AY 4TTRA 4A3BJ 2VNIA 4LXHA 2GZMA 1FP2A 2IODA 2QROA 4Q21A 3WK6A 4IIEA 3HJHA 5KEIA 4B4VA 5FROA 5HFJA 5L3QA 4M21A 4KR0A 3L7WA 4D98A 2CUTA 1S8NA 1EHCA 2G9ZA 1KMNA 1US8A 2OV2A 1USKA 2JNWA 4DIUA 1I7DA 3P9ZA 1L3CA 1SG0A 4ZOAA 2WTAA 3DWGA 2C5BA 3HCBA 3GY0A 4X24A 3FDZB 3MZ0A 1T3TA 3NGMA 1UFOA 1P60A 3K0CA 3M89A 3LAJA 2TECE 3GFRA 1Y5IA 2O20A 1NBEA 4BJ5C 1LBQA 1IQPA 1FP7A 4BWGA 1ZC3A 3PA6A 4UAVA 1I0LA 1IL0A 1DXOA 1I3CA 4BUPA 2YS7A 1HE2A 1N5IA 3E82A 3NHJA 2MLKA 2A68F 3KYCA 2V3VA 4HFNA 4PLZA 4ARZB 3FTCA 2GVDC 2LLKA 3BMCA 2V9PA 3BZCA 1J21A 1J0AA 2EWMA 5F1PA 1SD7A 5EKTA 3R7FA 4PXYA 3FUUA 2VBXA 1OVGA 5CNJA 1YAJA 3DEIA 2JPBA 2E7XA 1M1UA 1SA0B 1ZOSA 4CKCA 2J9RA 5JS7A 3GRVA 2A0XA 4Q3BA 4MTEA 1O77A 3LX6A 3P96A 4B2YA 1VQLI 4O2BF 4R8RA 4POOA 3MWEA 1AD2A 2H5IA 4UM9D 1CUZA 1VBFA 5AJTA 4ZQBA 3D5TA 4X91A 1TMYA 3AZOA 4PN3A 4YV7A 5CD1A 1NI4B 3FSJX 3RABA 2GEUA 4L4YA 3ZHRA 1E3PA 2B37A 2B82A 3ABTA 3CH7A 1LBTA 5F98A 1OIWA 4L3VA 3K4CA 4ITVA 2ETHA 4DE5A 3A6LA 3N5CA 2VZLA 1MB4A 3Q85A 5GWXA 5M2QA 1KETA 1M5UA 2R0QC 3NV9A 4KN6A 4BU1A 5L3SA 1N8SA 2QTRA 4DYCA 3LRPA 4HAMA 1NH3A 1E5XA 1H1LA 1TYCA 1XP8A 2G88A 3FNQA 4TXLA 1ZG1A 3F3KA 4MUFA 2J9FB 5IBCA 3SDGA 2ZT6A 3ND9A 3WTUC 2CN1A 1VRWA 4QVGA 4RVDA 1Z3YA 2CXOA 1FMVA 2I7VA 1WMSA 2PGLA 5CT9A 1P4RA 1I1HA 1Z68A 1VMKA 1XZDA 2F90A 3I4FA 4P84A 1OV6A 4ZI5A 4V0MA 2EAUA 2X0FA 4I5DA 3FVWA 4WY2A 2GS9A 4NB5A 4Z99A 1MG0A 1UZUA 4H7DA 5AVWA 5LOVB 2H6BA 2QMYA 1DJPA 4C4AA 1WQ2A 4V1CA 4Q3CA 1J2RA 3QKIA 3QOWA 4RWZA 2KJQA 1BS1A 3L9WA 3TIXB 1MAAA 1CVLA 2FUKA 3K4JA 1TM7E 3OYFA 1JLLB 1TLTA 3PNOA 2C7BA 5IZ4A 5DN6D 2LIPA 2JS7A 5J63A 3WP0A 6AT1A 2Q1TA 1V48A 3BDVA 1JT0A 1NC1A 3OO1A 2ANBA 1IUYA 5JU6A 1H9TA 3G1WA 3OIWA 1Z8FA 5T6MA 3BAZA 1E0DA 2PD6A 3F7MA 3ZBUA 1GILA 4J03A 1VL5A 4FYVA 5GM1A 4OLJA 3JWJA 4I2OA 4MVXA 2K3PA 3LSKA 3LPMA 4H6VA 4JKIA 4QOEA 3ZI7A 2HMYB 4UPEA 3EUHC 1SUDA 2VQ3A 4UBIA 2NU8A 4TLDA 3LKDA 3OYMA 5DBIA 1KZ1A 3AVWA 3IPLA 1L5ZA 2MOKA 1DEOA 3NM6B 3PC2A 3TW8B 3VU0A 4MKXA 3DEEA 2PV7A 3LUPA 2BM8A 1ZWLA 2C99A 2VDPB 2IA2A 3H84A 4J75A 5AK0A 2Q6OA 4M72A 5EIHA 2W4SA 3W2VA 1ZRSA 1MBJA 1Z8DA 4OBXA 2P2YA 4Q6WA 4RMJA 1B15A 4CR7A 5DGIA 1NJFA 3DYBA 4KAFA 3I6QA 2I3BA 1ZM9A 2PRSA 1ESEA 4JHLA 5LJLA 3FISA 4UW9A 2DU8A 4PYIA 4RTNA 4CF3A 2C1EA 1XZGA 3NIWA 4W6QA 4C7KA 4EFMA 2FOXA 2V98A 2XYPA 1U3WA 2HQOA 1XNHA 2JAWA 4Z0TA 2MCFA 1EVJA 1XEAA 3ID6C 1WI9A 1EFHA 1E0AA 3P32A 4LZPA 3I55I 4GDFA 5I7RA 2ZCWA 2VODA 4R98A 1GQQA 1ZX1A 3U48A 3IV9A 1LQUA 2CBXA 3HOTA 3H3FA 5LP6A 2GWHA 2B3DA 2ZWVA 1U2QA 3IT1A 3OZGA 3QQAA 2ZCJA 3UB3A 4LOCA 5UKDA 3PEVA 1QQ7A 1HXDA 5D5VB 2Q7XA 1E3MA 2C57A 1T98A 1HQCA 1RM3A 2QX6A 5ESWA 1IBKB 4C05A 1ON2A 4ZVUA 5CLJA 2AW5A 4M76B 4RL6A 4D0LB 5DCLA 1JJ8C 2C7RA 1UC4B 1RZVA 4CQMD 4MRPA 2OD2A 3M6AA 4PZUA 2VKHA 4BKPA 2V9ZA 5JH7A 1L7DA 1L1EA 4Q1BA 4Q15A 5MF6A 3ENVA 1ZZGA 1DC7A 1D2RA 1XSEA 3K6SA 4ZWNA 3B7WA 2WWYA 1KGSA 2PJPA 1AY0A 2R7AA 3OESA 5JLAA 5HKOA 2LF8A 1QANA 4PU0A 1B2RA 1U8TA 2FWBA 3ZJUA 4FEYA 2I2FA 3HM9A 1N57A 1KEZA 1XJ0A 2JFYA 4UBMA 3H4IA 3IP5A 2W98A 4JI2B 3L02A 3PFYA 6ABPA 5H4GA 3R6GA 5DM6F 4EO9A 5K3OA 1JAIA 5DSZA 2WAFA 1VFPA 4JB8A 3OAAD 4IBOA 1UXGA 5AVKA 1RHMA 1ULHA 2PL9A 2OZKA 3CCVI 1Z4MA 3THYB 4H6WA 1U6IA 2ZAIA 4BGIA 2MSEB 2LYCA 1H9GA 2BMDA 4O2BB 1W1IA 3VJLA 4QNRA 1QHHA 3H97A 4YN3A 5F1RA 3U7RA 2SKCA 2FQ1A 1EFTA 2YCLA 4NHOA 5AUOB 1Z2DA 3D4PA 4NOJA 3L2RA 2R84A 5DI3A 1WX1A 3VRHA 2WHXA 4Z7NB 4OYYA 3UMSA 5JDCC 1LD3A 1EIZA 5KNCD 5CB6A 5KAPA 2R9VA 3MQFA 4L0MA 3RQIA 4L4UA 2EWVA 2IT1A 4XDHA 3OPYB 5JISA 3F8BA 2E4ZA 2B0JA 3COWA 3CZMA 3OE7D 5TIIA 4TWBA 2JIOA 3R9XA 2PKYX 3PHHA 2HO4A 3OQJA 1P75A 2O4CA 1DFHA 2QGZA 3HEAA 4TMWA 5CA1B 2BSQA 1AKRA 4YFYA 4FMCF 2JAQA 3BAFA 4ZEOA 4H3KB 2IA5A 1YR1A 4PAGA 2PFBA 3MTAA 3A03A 4QEDA 1G6KA 2ZRKA 4GL4A 2QRZA 2BGIA 1ZVVA 1MMSA 3G79A 4EI8A 5LOVA 3BERA 3G2OA 4W8HA 3FWEA 2FBKA 4L9VA 2O6GE 1D7AA 1LKZA 4YT5A 1TEZA 1E3SA 2W7TA 3L8CA 4HWTA 3B36A 3QU9A 3LO8A 2Y2VA 2CVHA 4F56A 3UNGC 1ZLJA 2GEKA 2ZJPF 4IO0A 1ZHHA 2HLHA 2WLSA 4CYMA 5IAOA 4ZFNA 3FXAA 3C5WP 3FMSA 1I8TA 2PLRA 3E7WA 4XLPF 2BUBA 2GNPA 3FPCA 5C8ZA 5LIRA 3I9JA 1XTJA 4PJLA 5E6UA 3A0BC 2PE5A 2W2MA 4L9JA 3PWKA 4G5FA 5KYGA 2G0AA 1NVEA 1UODA 2NGRA 2X0JA 3RIMA 1SMKA 1YGPA 3VGJA 1N0VC 3ZWYA 4MMZB 4AY3A 3ZGZA 2F3TA 4AJHA 1RBMA 3TYXA 4XQFA 4ESBA 1YZLA 3JYHA 3O91A 3QY0A 4G89A 5HVQC 5FLKA 4I1RA 2JMWA 4MYTA 3C5EA 2Y0CA 1G19A 3LQRA 5FI0B 1YASA 5HF6A 4BNWA 1RXYA 3RS7A 2VDVE 2GSWA 3TDMA 1MFPA 5E20A 1XVLA 4X62B 4U88A 3ZMTA 2BFFA 3EFOB 3LWNA 2V5UA 5D2CA 3TP3A 1OQYA 2QTTA 3NATA 4LQCA 1AO0A 2VYCA 1T2VA 4K9LA 4OQMA 5I8ZA 2D0IA 4NJOA 1IN5A 5FUBA 4MO7A 4KKVA 4HWPA 2F9MA 3SIPA 4CLEA 5BN1A 4RS4A 1VQ5I 1KZ6A 3EXFA 1LJ8A 1YJAA 5AJVB 1JUMA 2YOGA 2ZE6A 2ZAYA 3WGQA 1SWVA 1KZ7B 2J9XB 2R00A 4HYTA 2QZPA 4YJGB 3DBRB 1PUFB 1WW2A 2A6PA 2PBFA 2IOFK 3LLUA 3O6VA 121PA 4MWGA 3K73O 4XD7D 2NUTA 1C3OA 1N2CE 1A5SB 1BJTA 2CJWA 2OGTA 1R0YA 1JQBA 3L01A 4XZ3A 3M6WA 3PUXA 1TQPA 2OKCA 2QN8A 2EPFA 3G2JA 5IHXA 3NVKI 4M7PA 1PS0A 3JQAB 2R5YA 2QM7A 3WLMA 3AEXA 3LQQA 5EPEA 4DMUB 1B8OA 3PE3A 3QKWA 5JRZA 4EI2A 5LIPA 1FC3A 2QTMA 1VFNA 3AFIA 4FZVA 5JYEA 4HAXA 3L7BA 5EMNA 1KHHA 1P5HA 3DTIA 2LW7A 1Y8ZA 3KZNA 4ISCA 4PS0A 4ZOQI 5BVHB 1NDHA 1ZAOA 3ZMSA 3H9BA 3ESBA 3NNNA 2GD2A 2O8DB 5C4GB 2JVHA 1ENOA 3LWFA 1UPTA 2PU7A 3AEUB 3QWHA 2HRDA 2VDLB 3MINA 2CMPA 4Q1EA 2WINI 2C95A 3JATB 2J4DA 4RYDA 5HIIA 4C0XA 2WYWA 2O5EA 2XUHA 1ODFA 3L6RA 4JLPA 4AP6A 2J07A 1E1RD 4RJKA 1LUAA 2ZJAA 4DPLA 1YI1A 4ND4A 1KAQA 3C2GA 3I1IA 3ZJ5A 1OBFO 1QBGA 2NYUA 1JTXA 3HL0A 5K0BA 1B59A 2EILH 2WAQA 1DKPA 1DOHA 1SKYE 3GT4A 5C8YA 3P4XA 1F17A 1XL1A 5JFGA 4IMJB 4Y2JA 5D87A 4Q1AA 4LB6B 1VSVA 2REQA 4K9PA 3KOXA 1D1SA 5FYQA 1BMFD 4WCGA 2EV9A 1DQRA 4OJQA 1A27A 3VKGA 5T4BA 2YVLA 4DFDA 2ORWA 2A33A 3DUFA 3K32A 1WDWB 1PW5A 4K9DA 3DMNA 4PHFA 1I7QB 4YRIA 1TGVA 4JZYA 1HQDA 4NZYA 3Q5GA 2ZUFA 5GPBA 4EHDA 4KWHA 1F0YA 4TKLA 3A1NA 4HDAA 1TNSA 5JQWA 4YHHB 4NKRA 5A9RA 3JRDA 4YP5A 3G2LA 4QIWN 4E33A 3HVKA 2YJ4A 3MGBA 3R0XA 1QLHA 3AEUA 4FW9A 2UV8A 1WW8A 3JRNA 3JR9A 1NBMD 2DG2A 3B5JA 2YWXA 4CM8A 4E2WA 4EJ6A 3EN0A 3FZNA 1KC1A 4BVFA 3PYXA 3BL6A 2ZCVA 1QM5A 2FNPA 1C7ZA 3BQNB 5GJVC 3RAFC 3B7GA 4I8XA 1CBUA 3D1LA 5HLGA 4QLAA 5CLLA 1IRGA 3VZCA 3PU6A 4EJOA 1OXTA 5AK4A 1TL7C 5JAPA 5C4JJ 3FTPA 1Q74A 1A6IA 4IWNA 3RC2A 2O8CA 3B82A 4WWCA 4FMCB 5SYAA 1UXKA 5BPIA 3OIVA 3RU9A 3G73A 2AFHA 5ERGB 2GIVA 1Z67A 1ZOIA 2QQ0A 1AHPA 2PY6A 3W5VA 3V4LA 3VTKA 5DZSA 3K1JA 4C7JA 3JAWB 4K3VA 1NN0A 3D7KA 5F08A 1E3TA 1AO3A 4XICA 3DJYA 3PHBE 5FORA 3SM3A 1NATA 4LJ9A 4OMZA 1L5FA 4TKZA 2R7VA 3QG1A 4RM3A 2RSLA 4JBLA 2GCNA 5AI0A 5K3FA 4G36A 1G3MA 2V4ZA 4LXQA 3ASOH 2YXPX 1ZSVA 2VSXA 4HSTA 1HBXG 1H6BA 1IUOA 2CL5A 2IYAA 2XQJA 3EZ7A 2JGFA 3A7DA 3ANSA 2QPTA 3H0DA 3FH0A 3KD3A 4F38A 1GTVA 1F2UA 5BWCA 1PYGA 3H9GA 5I4CA 1XGSA 2V5VA 5LEKA 2ACJA 3MLAA 5JW6A 3AF0A 3ZX5A 4NBNA 3W5UA 4INZA 1ZN7A 3ICOA 3DPTA 4XGKA 1FSZA 1QIEA 1SRRA 5DUKA 4O8ZA 2C9YA 3F5SA 2C00A 4UHFA 5HG0A 5M34A 4KR6A 1O5IA 4HTAA 2IGTA 3F5FA 3I59B 2IUYA 3OV8A 3AOEA 3DZJA 2D5LA 4HVAA 3QGMA 4BN0A 3EGVA 1X87A 4CL0A 1RPZA 1E3QA 4CG0A 3ZDEA 4IV5A 1VP3A 1WCIB 4FISA 4M9XA 4BV9A 4FMPA 3PQ6A 1I3LA 3THWB 4CEIA 3QNUA 2UYYA 2OCYC 1HEYA 2ZR9A 3GUYA 2OYCA 3U37A 5ADVA 3RYCB 1T4GA 1RE0A 1UK6A 4H7IA 3Q7SA 5SZHB 2DULA 3TTYA 3MOSA 3QHPA 3BJZA 3SVLA 2Y0SN 2QTGA 3N2KA 4OM8A 1ZITA 5JMPA 1EXNA 1JKXA 5FWNA 5FJ8J 1AMUA 3TPZA 1JSZA 2AQKA 4E22A 4EKNB 1FYFA 3GLHB 1ONBA 1CV2A 1NN5A 2GCPA 3MN1A 1MMNA 4NNOA 7REQA 3RKSA 1WXQA 2Q3CA 2Q4RA 5JZMA 3K2EA 2DFKB 4MI3A 4ZOLB 3PDIA 4W1UA 1XGMA 2WB1A 1KEEB 3ADCA 2BXYA 5E3MA 2YBDA 2R65A 5LBIA 4NE9A 2E0IA 4BJ1A 2EERA 3PGA1 4JOQA 4II7A 2XX3A 3KJZA 2GYWA 1AIPA 3M5DA 3L8GA 4WFKA 3SBDA 2XPVA 4KQEA 2YJZA 1U8UA 1K0UA 2Y8EA 3IB3A 3WYBA 1IG7A 5DBEX 4GKJB 3OL3A 1QZTA 1U2DA 3BWDD 3D31A 3ZHOA 2ZIWB 4ZDPA 2YRXA 2C92A 4L4XA 5A9SA 4WCFB 3FN4A 5JOQA 5E3JA 3TSOA 1M9NA 5GMOA 2RAUA 5L3DA 1IK6A 1O0CA 2PXHA 3OS0A 3PTAA 1W34A 3OZUA 2HRQA 4GMGA 4B44A 1PZGA 3ASZA 2BKEA 3PJEA 2QNIA 4Z1MA 3LX4A 4AUMA 2WADA 1NMYA 2QLZA 4LWQA 5CVTA 1YV9A 2OHIA 4Q47A 3OTQA 4HL6A 3I58A 1RWPA 2FPGB 4HQ0A 4QGBA 3U39A 3UH1A 1IEWA 2EC5A 3DA8A 2OFOA 4L3WA 2PRYA 1VHDA 5AQEA 3VZRA 3KKEA 1USIA 2AKEA 4RAZA 2DHEA 3GJZA 4YC7A 3H3JA 3G9XA 4LFAB 4PFQA 2UZ1A 4PIPA 4G1CA 2YY7A 3CH6A 3W5SA 2GEFA 1LSJA 4OI4A 4BVKA 1QAMA 2FLWA 1BW6A 4HS9A 4YIRX 4I3HA 1GG5A 2C9DA 4LJSA 4E13A 1U0SY 5CRIA 4FINA 4PTLA 3VNQA 4B0OA 1PWXA 1XL0A 2ZROA 4BBAA 4JI3B 1Z0ZA 5J23A 3ZGVA 5IJWA 2H9IA 4JEIA 1MH4A 4IVRA 4QQ8A 2YH2A 3HPQA 1BXZA 4IJKA 3E7PA 3RVSA 1WETA 1VQOI 4IXDA 1FE8A 1MB2A 4DLKA 2Q2NA 5HGXA 1PDNC 4KLZA 1QYWA 1C14A 1TA4A 1PL7A 1WJCA 2O57A 2XTNA 3V7YA 3KP3A 1V8BA 5AW8A 1CRWG 1L7EA 1I4WA 1OCEA 3LU1A 1CCWA 3RPEA 2KT0A 4E1VA 2CWEA 3X0DA 2L9RA 4UXJA 3RS0A 1G5RA 3FXRA 1N2HA 5KK1A 1W0JD 1N36B 3SS8A 1W46A 1WXDA 1DMRA 2HSEA 3HI4A 1JWAB 3KB8A 3LGSA 4MHOA 4YJFA 3C39A 2R92J 3OJLA 2QUFA 5IVIA 1GSIA 1TF2A 2E71A 2CFIA 3A37A 4FFLA 1KQ0A 2VKEA 2E4YA 2I66A 3HZHA 3VPDA 3NG1A 1UK7A 1WRBA 4C04A 5ICGA 1I2MA 2I8AA 4RS8A 2JH9A 3CLRD 2WWIA 5C4XJ 3M82A 5JG7A 3DLTA 3EQ8A 3ZHZA 3O83A 1ESZA 2GJKA 4E88A 4N40A 5J3JA 2G5TA 3AFHA 2L0KA 4RY2A 5B7NA 2YIMA 2PLFA 1DQYA 4X90A 3QMWA 1Z0JA 1MABA 4MWZA 4AICA 3DE2X 3LT2A 1DGQA 2XMGA 2PANA 4QYTA 1T8RA 3DMPA 4CHTA 4EQ6B 2V79A 1NX9A 2APJA 2I6TA 4FDVA 3Q3EA 2OGSA 5IYCJ 2BDEA 3PB3A 4KH0A 1M1NB 4IVQA 3O95A 3HGYA 4X1EA 2P9ZA 3B6MA 3P4YA 1U99A 4AM8A 2K4JA 4HVTA 4CVNA 5LP1A 3AIOA 1ZK1A 3DWIA 1R9NA 2NM0A 2PZLA 1QAOA 1UBCA 4HBGA 4ZXPA 2B8NA 1H0MA 3FOBA 5KSWB 1HKUA 4EB6B 4ZMBA 3U19A 3WOHA 3GEBA 2D2EA 4X1OA 1X13A 1EJ6A 1ZOPA 2XVMA 4RPLA 3UATA 3CW8X 2ZU6A 1TJ3A 2QLMA 3GLTA 4IKPA 3TD6A 4B4KA 1C7FA 3WLRA 1VL8A 3IQXA 4LYJA 4XOUA 3OLWA 2ZUSA 4Q4LA 1NUQA 2EJBA 2VDWA 4ZVQA 1WY7A 3RWBA 1VCHA 2HYDA 1I3AA 1KL7A 3SZMA 1B0AA 3PJGA 3NM5A 2FSVA 1TTQB 1KY2A 2CK3A 3V1TC 1KIMA 1T5LA 2MMGA 1VPDA 5I4BA 2O8EA 2WVAA 1CNFA 1HYHA 1ONOA 1UANA 2L3DA 1J90A 3Q41A 1IG3A 2J6CA 3JRXA 2Y1EA 2DA6A 4CRWB 2TSYB 3SSMA 3DB2A 4E7LA 4F7WA 2ZUDA 4N3GA 1D4OA 1OAOC 2O0LA 8GPBA 1YRNA 2CFOA 2IS4A 2EA2A 1SFKA 5B3SH 3P0JA 1KS9A 4U7HA 1JXAA 1MZPA 2YWRA 4R2WA 2WWVD 2CD9A 2Y1WA 3COJA 1A8QA 2XUFA 2W2NA 3HBFA 1D9ZA 1JHHA 3PLRA 4JBXA 2QP9X 1LJLA 5JPCA 3KPHA 3U7JA 3L4BA 4AP9A 3HCCA 3VU3A 2XA2A 5EP4A 1ZARA 3LOUA 5FB3A 4U00A 3WRXA 4DQXA 1Q19A 1GGHA 1U0RA 3VKHA 2VNKA 1R00A 4RF2A 3AU8A 4RVNA 2O48X 3K9NA 3CVYA 4EVSA 5KWIA 2Q1ZB 1P81A 2AMFA 3HU2A 3L8ZA 4JLUA 4OYLA 1MN6A 4D8XA 2BKLA 1ZW1A 1QYXA 1X7XA 2HLDA 4IDAA 4MARA 2ZXEA 4LMPA 2FPGA 1WHUA 1EJ9A 3FG9A 4QG7A 5ERXA 5BV1A 3U9SA 5CB4B 1AK2A 1WJAA 5EHQA 5ELMA 3DR3A 1LI4A 4ENPA 5IXYA 4QYIA 1MJAA 2PAFA 5TF0A 1CJVC 1P1IA 5C7OO 2GCOB 1AQ6A 5BRAA 4AJ2A 1WA5A 2F4IA 2BJWA 2VDOB 3K96A 3GLUA 1CDEA 1HM5A 1XGOA 3ONNA 4OEHA 3PQCA 3ZJ4A 4LJ6A 3VISA 4MMXB 4QPNA 3SS7X 3MEQA 3QIVA 4A2CA 3FWPA 5I9IA 4YMVA 3IUOA 1U1DA 1UM8A 2OPBA 3GAFA 1DRKA 4P2BA 3UO8B 1UP4A 4N4AA 4OSPA 3BB4A 4PXAA 4Z2AA 1A31A 2QVZX 3I71A 1EXWA 2EGUA 3FMGA 3OSZA 4IZIA 2PQ0A 2Y05A 3MCTA 4TT3D 3DV9A 3ZZUA 4EG7A 4ARZA 1UKYA 2HKXA 1GIAA 5EJ5A 4WBXC 4J01A 3GTGJ 1D4ZA 4H7KA 1UBOS 2AEJA 3IUEA 2KL4A 1ZGAA 2QN6A 5M3FJ 2H4JA 3ONFA 4GXQA 3LX5A 1DG9A 1V1RA 4WDRA 5L6LB 1N9KA 3V4VB 1IM5A 4DLRA 2WVGA 3CV3A 1AN9A 1WF3A 2B1IA 4BXUA 3KJNA 10MHA 2BZTA 1ZINA 2P68A 3TW8A 2DOEA 3W8EA 1J5XA 1W6UA 2R6CA 5HK8A 4PZLA 1WJGA 2IX3A 1FQOA 3QPAA 4QUBA 4YCBA 1TLHB 2G9VA 4Q7JB 4AECA 1BR2A 3GTQJ 1M1ZA 1YCDA 2QD3A 3N6RA 4WY5A 5AJHA 4J16A 5E1BA 5LUBA 4NJEA 2ZO4A 2DQRA 2V97A 3LOCA 5JO9A 3HLKA 1HTTA 4JQZA 1CUUA 1Q5PA 1P4WA 3AUJB 3DP7A 4O4IB 3VYUB 5FBRB 2DUNA 1CUDA 2NVOA 1U2EA 4EA6A 3MJTA 3DE7X 3EOZA 3WLJA 1XQWA 4FZRA 4QPPA 4BMOB 4I02A 4II3A 1U31A 3OT1A 2NVUA 2P5TB 2X58A 1L5HB 1UZNA 1Q1HA 4F5ZA 4MNUA 1JDSA 3SHFA 1IJFA 2L7MP 4MGIR 1EGQA 4PCLA 3WIEA 2JAOA 2A5GA 3GIWA 5H1YA 1T3LA 2QRLA 2W48A 3DAFA 4UV8A 2XAJA 4M36A 4V2IA 2K5UA 3ITEA 4AJEA 4X1KB 1SCDA 2ODWA 2XD4A 4CDMA 5E8IA 5EUCA 4P7GA 1A9XA 2FWMX 1P3DA 4N48A 2X85A 1AUOA 3FYDA 3R74A 1AKVA 2RH5A 3Q7EA 3UC5A 4G1FA 3LBYA 3G5TA 4F93B 4LAFA 1VSTA 1RQNA 3UK2A 1FZPB 3EC7A 3ZNNA 4YXFA 1U0NA 1IHOA 4LFUA 3OYBA 1K78A 1M2HA 3C8ZA 3P2EA 2IU4A 4IV0A 1NZJA 1R27A 2I4OA 2FW0A 3NC0C 1M1YB 2Z4SA 2A6HF 3FWYA 3HUDA 3VPAA 1BFDA 1P3JA 2W90A 1QOPB 1MZVA 2ZZKA 3BDAA 2R7MA 3CT4A 4ID9A 4RTOA 3ZDQA 3S1LA 3SPXA 1YBAA 1QE0A 2BY0A 3PO2J 2F4MB 4PJMA 2RJOA 1LUJB 3UZUA 4Y2TA 3OF3A 5F4BA 4NYMR 4H60A 4DRXB 3ACDA 3DU5A 1EFPA 1OLXA 2QU7A 2Y92A 3CVWA 3FCOA 1FS6A 5EJFA 1GGMA 3X1JA 3NC4A 3NNSA 3T7DA 5CIQA 1N9GB 1H2AS 4Y6RA 3K31A 1NN1A 3LFTA 3UF0A 4P9UA 4UVIA 3W6PA 3CVOA 1HNWB 2YN0A 3FXMA 3ZLBA 1CR6A 1U0JA 3TZKA 1L7XA 4MUKA 5F6FA 3CKMA 4RGYA 4B3JA 5FEUA 1U63A 3ZDFA 5BS6A 1G5HA 1ZONA 1J2UA 1YR9A 3BJEA 4GZ5A 5BNIA 2FW7A 1JHPA 1Q2UA 2I80A 2X8JB 4A2UA 2OPTA 2VSQA 4OQDA 1RADA 2E18A 2VO1A 5CPFA 5FFMA 4KMRA 4QOHA 1GZ3A 3VTFA 2BHZA 1P4GA 1Y3CE 3DE6X 4P4SB 4WKOA 5T67A 2B0LA 2CHQA 2ZUVA 1YH3A 3O2QB 4JP1A 2OHVA 3D3WB 1JXMA 3G2BA 4RE5A 5CJPA 3TR5A 3TVTA 5BWOA 1NVWQ 2H3HA 5FPYA 2GEVA 3RFUA 2REQB 4CLRB 5C81A 4CT0A 2A61A 3IAM2 1OBOA 2D2IA 1IN8A 4OIOF 1QS0A 1UT6A 3PGXA 2B30A 3QKUA 4TV9F 3OIUA 3C3WA 2QSYA 3IOYA 3RDPA 5IP7J 1TEXA 3AWIA 3CLTD 3JZAA 2F1IA 4K6FA 1M0SA 2R8ZA 5FPTA 3UJDA 1T0IA 3UGQA 1UJ5A 4EYKA 1YL7A 5LSAA 3CRQA 1DP3A 2YKGA 2G76A 1QC5B 5IC4A 4MIYA 4AJ9A 2CJYA 3I62A 2XYQA 1O5OA 1R18A 1QH8A 3TBKA 1MC5A 2W4MA 4WZAE 3T52A 4B35A 2QX8A 5JSQA 4GCVA 4RPJA 4TMKA 5AXBA 5L3GA 3GDGA 5ALEA 3FHJA 5IKMA 4COOA 1I5EA 1CQWA 4Q93A 5TQ2B 3GGSA 5KTMA 3GLIB 1PG2A 4ETMA 3JQEA 3VNVA 2EWNA 3PO3J 1IFXA 3GEHA 4H7EA 3I12A 4C2AA 5C1BA 3Q9VA 4UKDA 2QVGA 4DA9A 3NRBA 1JJBA 5FFFA 2OCAA 2V4JC 1E0SA 3C7AA 4B3MB 4K1LA 2G1AA 3OECA 1KI6A 5BPFA 2JVKA 5IYZF 4G26A 1YJNI 3VUFA 1ZS9A 3IQIX 1VSBA 1XNGA 3KVYA 3LUKA 4N7MA 3I9MA 1P2TA 4P35A 1M83A 1Z0KA 4LZOA 5U1PA 1FSPA 1NN3A 3I32A 3HHHA 1X2NA 1DDIA 3THOA 4GYGA 2A6EF 3RFXA 1JE1A 4UUQA 4W4TA 2XVXA 5LGTA 2IIBA 2WSBA 3IELA 4RLHA 3ROGA 4Z5XA 3NHZA 1QYDA 1QZZA 4QZVA 4JZKA 5FDFA 1ECBA 2H08A 3UWDA 1P91A 4N9IA 4TS9A 3OMWA 2QG9A 3FXUA 4EHHA 2HRZA 2YY5A 1T2CA 1TJYA 1UBLS 3DE4X 4DILA 3PDCA 4QG3A 4J43A 2KDZA 1MW9X 3AFMA 3TL4X 3FPKA 4XFDA 2CCGA 5E4JA 4UVCA 2JJMA 3FTFA 2DMUA 4P3XA 4I2VA 1OBVA 2IW1A 2ZT7A 5AOAA 1T2NA 3KFLA 2CRGA 2QVLA 4HH0A 4CF5A 3O74A 2VP0A 2AA3A 3DPLC 4FFMA 4L8FA 4IJAA 5C1IA 3VU8A 3B1YA 1GT6A 4DCNA 3BZWA 4E94A 1BYUA 3K7AJ 5CEJA 3ORFA 3DBLA 1S6LA 1JDTA 4QJBA 4R2KA 4DQDA 4ZC3A 4UM5A 4XYMA 3DV8A 1KO8A 4YB8A 1X9GA 3GWGA 2WC2A 5HQTA 1W5EA 2P30A 3UK7A 4CHGA 8OHMA 4KL8S 1B1AA 5EKDA 1PR9A 3A4IA 4UUBA 3DCNA 4NYIQ 3GFOA 3I01A 1G8JA 5FR2A 3U4AA 4DAEA 3H11B 2OQGA 5CDYA 4S0XA 4NCIA 3TZQA 2H7YA 4IX9A 2GBFA 2R1ZA 4A93J 1JKFA 3DKXA 1FOXA 2ZIXA 3RRZA 4OHMA 1DG3A 2BSAA 2GM9A 1GL6A 1L4HA 5F0HA 1Z0DA 2C2OA 2DRIA 2V7PA 2C8JA 3DAYA 4UV9A 3UKOA 2GH1A 4B6PA 1LPAB 2FW8A 4IO9F 2SHKA 4MV5A 5J2UA 3WIUA 4OIPF 4Q48A 3TUZC 1R0LA 1SXJE 2DFHA 5E1DA 4XH9B 4RANA 4HYEA 3ZTYA 1F0KA 6PAXA 4K28A 1JAYA 4QOSA 2VSNA 3C43A 3J81A 1OFIA 1Q1BA 2BCEA 3NJRA 2GBIA 2IP1A 3AGPA 4RJTA 4MKFA 1RRMA 5KHDA 3Q88A 1NXOA 2QTVA 2WF6A 4M46A 4WX9A 3I56I 1EVLA 2E4VA 2RGNC 2ZYAA 3EZYA 2OPHA 4DM3A 2PMZA 1V2GA 3BFPA 1KJNA 3ISVA 5F7OA 1YHZA 4KGVA 3D7SA 1XC5A 1VHWA 1TQ6A 4TOIA 3NGLA 4DQUA 4JD5A 3OOWA 3FROA 2XE8A 4D9NA 3IO3A 1AQNA 2PO5A 2IQIA 3ANXA 4PZAA 1W36B 2NVXJ 4BE9A 5T7BA 3TG2A 2XGEA 1OXBB 2VT2A 4FCTA 4EPTA 4CEJA 3ZV3A 5JCJA 3ROUA 3L1VA 4UNOA 2M4KA 2P7HA 1XGNA 1DRUA 1MCZA 2BZGA 1C3EA 1EQ2A 1E0KA 3EOBI 2ZKLA 3K9HA 3LUGA 3DZBA 3OJEA 4YRRA 1ISMA 1W88A 2VE8A 4RB2C 2YV4A 3F7TA 3QEBZ 5CDHA 5D3MA 5EJMA 1LGYA 5JD4A 1BI3A 2HMWA 2PWZA 2ZYGA 2Z2XA 5TVKA 1XCPA 5DNAA 1MAUA 2R7DA 2ENUA 2H92A 3IA7A 1JBKA 3V7UA 4ZYUA 1L5VA 3CC7I 4PX9A 3KJHA 1DUIA 4HXFB 4M1YA 4N8SA 5B1DA 4L18B 2D1TA 2MDTA 3CMEI 1PJ4A 2PUAA 5JARA 1WNTA 3LLSA 3E6CC 1HDXA 1RE1A 1I50J 3OYHA 3VZSA 2WWXA 1D8KA 3IRUA 1WV1A 4UE6A 3BIOA 2WM9B 2WSLA 1PR4A 3C7TA 3E84A 4GQAA 2NVQJ 4GG1A 2UAGA 1Z4NA 2YWHA 4F2WA 4OB7A 4N5HX 2CMKA 3B6CA 2GQQA 1GR0A 3W8FA 3MIIA 4MB0A 5KNBA 3WGOA 4CYCB 2P41A 4PXSA 4C29A 4F4CA 2B8JA 5EGOB 4AVZA 2XKOA 3NBQA 3PF8A 3KHUA 4XYBA 4OKIA 3UT5B 3IVGA 3FCYA 4Q7MB 4LHYA 3IH3A 3RPUD 1KMCA 2M6LA 3VH2A 2Q5HA 3IUPA 4PO1A 3G0OA 1FYMA 2QORA 3HEMA 4V2GA 2XGMA 1ETQA 3M8JA 2X0IA 1I01A 2XDQB 1IPEA 3VYWA 4KQKA 2WIAA 2AXLA 1LPOA 3MILA 4UBLA 1MKMA 2ZSEA 4A1FA 3QBTA 2RGCA 4ND6A 1U90A 1UJ8A 2LR8A 3R6TA 3R7SA 2VHTA 4B6RA 5I9NA 1VLLA 3FXJA 1U5BB 4HQEA 3RYHB 2VF4X 5ALUA 3IBFA 2ZXUA 1UZCA 1K9VF 3QFHA 1MABB 1DGWY 4HUQA 1TW2A 3JWHA 4C3VA 3G82C 1DQNA 4F4JA 5BSFA 1DJLA 2AD1A 2Q1WA 3GDHA 1VFCA 4KMFA 3K8OE 2X14A 3Q3GE 5JSZB 1GTSA 4FHEA 4WZZA 2IZ5A 1TK2A 3SI7A 3W05A 3R9WA 1N9GA 2D8AA 3Q2IA 1YS1X 3PL8A 1GKYA 3IIIA 4XM2A 2WHPB 3G59A 2RJNA 4Q9NA 1KI2A 1Z2CA 2ONCA 2QI9C 2OO5A 1ZH6A 3ASVA 1E7SA 4RPGA 3F46A 4LDJA 4ER7A 5CFNA 3BMNA 1X3LA 1RIFA 2C5GA 1P7PA 3I6IA 3D7LA 4HTFA 1O95C 1Z4IA 2W70A 1DHTA 3QY9A 5T4EA 4Q7QA 3R23A 2B0CA 5K01A 4H7FA 3HOUJ 1IV8A 3HL2A 3OKAA 4DOMA 1XPJA 1PUXA 1LRKA 3TM4A 3V4FA 1XPRA 1EVKA 4AXBA 2DKNA 4E51A 2BFCB 1CFZA 1QKIA 3LLMA 4DQLA 1A8IA 5HRUA 5T3YA 3MW8A 1T2UA 3NT4A 3OEHA 3MTGA 3QUAA 4LBVA 4P54A 3T3PB 3WGNA 5BRJA 4FGZA 1KP3A 2FSWA 1E4EA 1EG2A 1D3YA 3KAJA 3OMXA 3K4MA 4EO7A 1QVAA 3FHOA 2RC5A 2YN2A 3I9NA 1NE7A 1C1HA 2CSUA 2VHQA 4GFDA 4XM0A 4A8TA 1M5RA 2KLBA 2ODAA 4XQGA 4DNFA 4QLCU 1QF7A 1ACIA 3GLVA 4R2MA 3WGGA 2I29A 3SNHA 1F9AA 3A58B 5B1SA 2OUMA 1ZM4A 1F4KA 3AL0C 1D1QA 4ZZLA 1G3QA 2PJRA 1HO3A 1VGVA 2GAOA 4CICA 3Q9SA 1NQVA 2K3FA 3K1NA 3KB1A 4XLZA 5HQ3A 5LUAA 4L78A 2HU9A 2B7BA 2B7LA 2DMRA 1EFCA 2XOKD 1WEHA 1KORA 1GAQA 3EUWA 3E1GA 3DHNA 3OOUA 3F5QA 4JQCA 4PC2A 4QTUB 4ZOLA 5LRRA 4QFDA 1M3SA 4XE5A 5TISC 2PQ2A 3KPWA 2WMDA 4UREA 3C3MA 5DLYA 4CA0A 3X1XA 1YX5A 4S05A 1G0NA 1GCAA 1QH9A 5CVRA 2IL1A 2EFGA 2DCMA 2VDMB 3E81A 3FA2A 4HWKA 5CFQA 9MHTA 4PONA 2Q4TA 4CDNA 2F5VA 1VQ6I 1KMHA 1GU1A 1GGJA 4FNOA 3ADDA 1TZLA 1GTJ1 3W06A 3BCHA 4CCAA 4DLVA 2QSJA 4Y1EA 1U2WA 2C4VA 3L06A 3SOPA 4PHTA 2O0KA 2ZULA 1I5ZA 2LPMA 3GLKA 3WK5A 1V8DA 4NATA 4ECAA 4BDZA 3BJAA 3P9YA 2GK3A 5IC5A 1LNWA 3BG9A 4DYVA 5LEJA 2K40A 2DMTA 1NBMA 4E7JA 3UFXB 3ESRA 3B73A 3I2YX 5CT8A 1YIDA 2G9UA 3PIRA 5LWQA 2QMHA 5NULA 2V03A 1BR1A 4YRNA 4BJHB 2D54A 1C1XB 2G72A 4ZCRA 1NF2A 4L7VA 1KVTA 3B6KA 5TRTA 2FN7A 1LK5A 4IKFA 1I6LA 1U8YA 1KBQA 1KQPA 1TUEA 2CQKA 4GOJA 3BZ6A 4QL3A 1NX6A 1NT2A 3SG0A 1XZHA 3W2EA 3GWZA 1T43A 4RX1A 5JHHB 3R1IA 2V26A 2JA8J 1LSSA 1NJ5A 2XECA 4FP9A 4G5QA 3WIBA 1LFBA 4ZHQB 5DNUA 4GT1A 3H0CA 1ITZA 3MWDA 3BEDA 1C4KA 2C9CA 4CYCA 3GRYA 4COKA 1R66A 1X7YB 1YOBA 2EZ8A 4DANA 2ZWAA 5FLXZ 2ADFA 1PFUA 1CC1S 4LJLA 1B1BA 1THZA 4AU7A 5CA0A 1PAUA 5BN4A 1EDDA 3O8CA 4MDEA 3WLQA 3P9XA 3BH0A 5JD3A 1LLQA 2QVCA 1YU6A 1UKVY 3PNPA 4JEMA 4MUXA 1KZYC 2QSUA 1Q0SA 1CK4A 1SKYB 1XRJA 2OOSA 4IH9A 2WC1A 4XGNA 5IM4A 4EQQA 2X8LA 4L0CA 4MI9A 1M34A 2JJ8A 1FTTA 4C14A 4IXAA 3R3VA 4LZAA 4ZT6A 3VNSA 1XDUA 1C4OA 2PJZA 4ZTFA 3U6BA 4ALNA 1M74A 3DWFA 2D1HA 4ZDIA 2X3FA 4KQ2A 2HLNA 3CJNA 3EPRA 3NOVA 3OFKA 4Q00A 2FA9A 5JI2E 2PGAA 1DU6A 5LLDA 2XXAA 3VWBA 3HOWJ 2GNOA 5E4TA 4B34A 2EV0A 1NJSA 4B1FA 4BNTA 5HSGA 1C4XA 2PWPA 2INGX 4FJ1A 5CK4A 3K1MA 3LSTA 1A97A 1B6SA 2XBUA 4GLFA 3DEAA 2P9QA 2Z30A 4KQIA 3IULA 4F2HA 2HYGD 1JHRA 3KQLA 4HSGA 5BPHA 1Y1KE 3GTPJ 4F5EA 2EL7A 4MR7A 2QMUA 3AI3A 4LF7B 1SXIA 1FMTA 1XFAA 1Z17A 2RONA 3FHLA 1W1WA 1EJ2A 2DTEA 5JBQA 3BSFA 4HO1X 1J5EB 2HXGA 4JS0A 3UYLA 2KMLA 4M38A 1BD4A 3WV4A 3PI7A 4E6PA 5E6UB 1XTTA 1Q12A 4ON0A 4I08A 1G3SA 3SU8A 2ZS9A 1JTYA 2OOKA 5I01A 4H1UA 1KDVA 3CO5A 4BVEA 1C0IA 1II8A 2PIDA 1B9MA 5F76A 3LT5A 3LQ2A 4PC6A 1YZUA 2OHFA 3EMDA 1JE8A 3K9QO 1ETHA 1T91A 3GUDA 2O50A 5FQNA 5AD1A 3MB5A 3EVZA 3PUWA 2HWUA 2VA9A 4OGKA 3E7FA 4ROTA 3QLUC 1ETVA 4RGBA 5EZYA 1MA3A 2ZBPA 4H59A 4PPYA 2P6OA 2OILA 1VRCA 2JUCA 4HX7A 4MHGA 3PZBA 4MUIA 3NJ4A 2Y9YA 1BI0A 2M8EA 4PSWA 2VB6A 4ENKA 2GPTA 1ZLKA 3PXAA 5F2EA 4JJIA 3V8PA 4BMYA 1REPC 3FMIA 4ITUA 4D42A 5KMGA 1EFUA 2IZ6A 3QX7A 4L85A 2HEIA 3G2HA 3TGPA 1Z0UA 4IILA 4XLTA 3DSRA 1TYEB 4EDFA 3UG7A 5T4HA 3L6UA 5GJWC 3FDXA 1EKXA 3COZA 4JGIA 3LECA 5CDGA 1I0IA 3WX0A 3BH7A 4ME6A 4G9GA 4R1TA 3TTVA 3QKSB 3TW0A 4CQNA 3FGOA 1GAXA 4ILEA 1EQUA 1D6MA 2B5VA 2J9ZB 3G5MA 2Q5CA 4IPTA 3PWTA 4JBGA 2I55A 5EUBA 2V6FA 3WNDA 4CUKA 4F6RA 5CFZA 3M6FA 5EJ7A 1ADYA 3MJSA 1T2DA 1GVJA 3UWMA 1QV7A 3LPLA 5ILVA 3A26A 5CGQB 1JQLB 2CB0A 1E1YA 3E03A 3HXMA 4XIIA 3I39X 3O3CA 4MQ9F 1C8BA 1NJGA 1VL0A 3FOFC 2NIPA 4LY3A 4P3KA 2PLYA 5DNEA 3NOQA 2DUMA 4EUHA 3CR7A 2XMDA 2GXQA 3GFSA 4Y9UA 1V6AA 3STVA 1BFUA 1M72A 4F52A 2MIIA 2PEZA 4O2LA 1B0PA 1FUKA 1XA4A 1SU8A 4RIFA 2D74A 3MIZA 3NCHA 2A9PA 1QIGA 1VBNA 3H86A 3DD1A 4EZEA 1MOZA 3HFRA 4EHAA 2PN1A 5D84A 4ZICA 2IJGX 1GSOA 3BICA 4Q39A 1Q7CA 5F04A 3FMFA 2X2PA 2X5KO 3CZAA 1FX0A 1W96A 3AH8A 3GPCA 3IDQA 5CTAA 3ICQB 5EERA 4Z9XA 2YR0A 4ZJUA 3I5YA 3V34A 2M8GX 2O3JA 5K0NA 4F4IA 2HHJA 5A5GA 4PK4A 3QWIA 2ZJQF 2X8AA 4D57A 3ZQ7A 3Q0WA 4C87A 3GUHA 2QTBA 3D1VA 4OGFA 3U7GA 1KU0A 4OBWA 1F1JA 3RGWS 3RPQA 4MYHA 1U3FA 1Z39A 3KVOA 1Z4JA 4XOPA 4R1SA 1M2KA 1DXHA 3GDWA 3SX2A 1ODSA 3GVCA 1A7JA 4I55F 3QUTA 4D3FA 2WSSA 4YRFA 2QUJA 4QXMA 1W5TA 5DTJA 4DIOA 3FYHA 5B1EA 3BGDA 3URMA 1BDBA 2HQRA 4IIJB 1P29A 3SQLA 4RMGA 4ENMA 1C9KA 3ETJA 1IN7A 4QHTA 5E1XA 2IXSA 2FQ4A 1OQAA 4G7OF 1V3VA 3GJ3A 4UAGA 5C5DA 1BKYA 3EH2A 3GFJA 5CA0B 3FIWA 3AU9A 3NHUA 3SC3A 3G6EI 4DUGA 3OX3A 1JMYA 3B1JA 4ZT4A 5CYPA 3HHGA 3C7JA 1VQ7I 3BXPA 1NPYA 3ESDA 5KOHB 1P3Y1 2E1OA 4BYMA 4NC6A 5D5XB 3RBZA 4XVUA 2QLJA 2HI3A 1Z7GA 1NDUA 5JYCA 3OJCA 5FBVB 3SXYA 4KR9A 3TI9A 5I4KA 4BHPA 3KTAB 3WQBA 2NX2A 4LK3A 1B8PA 1MNMC 5EN4A 1I3KA 2XVCA 1CRZA 1HTWA 2VTKA 3R09A 4Q03A 4CMJA 1JUSA 1CEYA 1SBCA 5F52A 4PYLA 1RSZA 4OM7A 2LP4Y 2DTZA 1MO2A 1P2GA 2G17A 2EJWA 2R48A 5DP2A 5K99A 3QKRB 5D5UB 3HP4A 4RD6A 3SQMA 1JECA 1DC5A 4K5QA 2JJ2D 2M7AA 2IEZA 4FBGA 4DR2B 1HDYA 3PK0A 9GPBA 4XFJA 2PGNA 2GR9A 3MERA 3T8TA 3GCZA 2RGXA 2FPMA 3QNWA 1NL3A 2V4MA 4UXIA 2J32A 4KYVA 2HA4A 4UXHA 1DU4A 5E38A 1DAFA 4YRCA 2C7VA 4G8XA 1L7BA 1PFGA 4R71A 3P9PA 1KRWA 4M99A 4TROA 3NWBA 5LBUA 2F59A 4K3UA 5JHUA 2B6HA 4HOBA 3R60A 3ZQQA 2DQLA 4RHYA 4IQFA 3P52A 5DCMB 3B8EA 3KZ1E 3EE6A 4IIFA 3IILA 4L95C 1R4NB 1YLFA 3SFZA 2BL4A 1U8ZA 2PYZA 5TARA 5KC9A 1RM4A 4DQ2A 4PG6A 2VQLA 4CZZA 2EU8A 1FPMA 4TPKA 1OCZH 3CVJA 3JVEA 5L3FA 5AOVA 2D06A 1T39A 5IH7A 4IJ6A 1IVSA 2H16A 1FW8A 1YE9A 4G84A 3BOSA 4HFJA 2IKSA 1JWLA 3E2IA 5IFKA 4R6WA 3UMRA 1UJMA 1Y6FA 4KT6A 1FU8A 3WKCA 2JT1A 3CKYA 2VWPA 4B0PA 2O7SA 2QW8A 4TVBA 4YCNA 2VHWA 1M1YA 2G9QA 3HMKA 4L9WA 1BGXT 1GAWA 1NRXA 2HNBA 3QLVC 4PZYA 1O5TA 4H6XA 5DCUA 4XQ9A 1S7OA 2DCUA 2I4LA 4HOYA 4J2OA 3LCUA 3G1MA 4C20A 1FEZA 5JR3A 2QYSA 2HF8A 3CH4B 4MLCA 1YKSA 3FPFA 1F9NA 4RDHA 2TRTA 2E2HJ 1CSEE 4XJTA 4AKTA 2OBLA 4PQFA 2XPCA 3HTXA 1WD7A 3JQRA 1RBYA 4GI1A 3FGZA 2WR8A 4TZKA 3WLSA 5IXJA 2D00A 5DXFA 4ZCQA 4CPDA 4ZAZA 1BDHA 1G3UA 1DDGA 3T9CA 4KG7A 3TIVA 1GTG1 5H8WA 2CW7A 3GF4A 1T26A 4Q7KA 1JIIA 1FFHA 2NSHA 3WHLA 1YA6A 4UZEA 3STXA 1X0XA 1J39A 4ALJA 2C4NA 5DT2A 4BFCA 1ZHOA 5JSYA 1UADA 2AFIB 1VNDA 3DZHA 2UV1A 2R3SA 4RU1A 4IX1A 3I34X 2J48A 1E2BA 4UHHA 3I6BA 1UH5A 3S44A 1E9RA 2VC2B 2BFDA 5CW1A 4ZQIA 3U3KA 2CLDX 4I5FA 4U87A 4U2BA 1HFJA 2W6CX 3PFIA 1N5MA 2GLXA 1Z6RA 4LSZA 3PFGA 3GZNB 2NUTB 2HMVA 4MQ5A 4RK6A 2PUWA 5DHFA 2I34A 4A3DJ 4KWTA 2SICE 5ALDA 5B12A 2B1JA 5I47A 3L9XA 1EFPB 3DOOA 3KZCA 1XRQA 4CDGA 2EGGA 4RTQA 1FYXA 5FTKA 4IIXA 4OQYA 3FHTA 4FQGA 2BDTA 4UVDA 4AJ1A 5CBPA 2R93J 2D7DA 5JIBA 4FS3A 2V7BA 2P5VA 2XVAA 1GPAA 4LMAA 2XKJE 2OC6A 4C2UA 2OHOA 3FNBA 4JLNA 1DPRA 1PT9A 1YNOA 3C8DA 4E12A 3SZOA 3QPHA 1QNLA 3HB5X 1I6HJ 4Q1DA 1QORA 4AXXA 2FEZA 4YJHB 3OSUA 1MAVA 5DEOA 2LZ0A 5BSMA 1OCRH 1M2VB 4E2XA 1MG5A 2H8WA 2EKPA 2XNSA 4RLFA 2YHAA 2WU8A 1AOXA 1G7RA 5H20A 1TTHA 1F9EA 3L7YA 4ZAVA 4YDQA 5KJ1A 4IQ4A 2ZSIA 2HNAA 1BYIA 1YZQA 2PX3A 4O4HB 5IABA 3F1LA 1V7PC 3QXJA 4MR9A 4U2DA 4I5GA 1DRWA 4MEYF 2M7BA 4Q4AA 5F2OA 5J5AA 2ZUTA 4JXJA 1DBVO 1U3TA 2LTPA 3IEXA 3V2UA 4EP1A 1GTRA 5DLQC 4JI8B 3RIRA 1G41A 5FHRA 4EJ2A 2HR1A 1J9IA 2EZKA 4M53A 2YFQA 4X8LA 4Y6LA 2FSIA 4DMHA 2CYCA 1LDJA 3J81k 4B84A 4S0HB 1RZ4A 2CUKA 3JQ7B 3HYSA 1SOMA 4PFOA 1RMTA 2UDPA 3M8KA 5AVYA 3OCZA 3JQ6A 3UAVA 5ISMA 2B98A 8LDHA 3W34A 4MWOA 4QRIA 1GKKA 1MIJA 2FX3A 1KDOA 4BNDB 1XC7A 4PLTA 5I7OA 1RHRA 5IWCA 5CP8A 4DY4A 5FJIA 4C7OA 4J1SA 5JAUA 2HMUA 5FOTA 3ESZA 4F6CA 1IHYA 3D6FA 2H09A 3SCZA 5TQ2A 4UMVA 4TLEA 3U9LA 3GLIA 4R31A 4OX9B 2IYOA 1GPH1 1EHYA 2ONYA 3ADOA 3C3JA 3RG2A 1EESA 2Z5GA 1EE2A 4MQFB 2FWRA 4R01A 4A6XA 5G1NA 2JLBA 3TG8A 2PT5A 3KPJA 2PX4A 3D8RA 3A9TA 4X6XA 1QVUA 5B1AH 1IONA 2NYAA 1IWBB 3RUIA 1KBOA 4OCZA 1F2TA 4WXCA 4BFSA 2QRHA 2ESRA 3FM5A 1EWYA 1H6AA 3GVXA 3KB6A 3L6OO 1IC6A 1E17A 1NOJA 1WH7A 2ZE8A 4GE0A 4IIBA 1IULA 4WFIA 3LS2A 5J1SB 3U44A 1JNXX 2ZBVA 1H1DA 2H1VA 2E2WA 4RV5A 1V3UA 3UAWA 3SP1A 3KC2A 4IFBA 2ZDQA 3IDOA 4EJWA 2RK4A 1UELB 2VUMJ 3QTBA 4MTCA 5GJCA 3ZNQA 5HHTA 5AVVA 4CL3A 4XNFA 1R6BX 2QVBA 3NO4A 3GJSA 1W19A 1DBRA 6REQA 2A9JA 5K0GA 3COSA 1STZA 2O3QA 1T33A 2BVLA 3NANA 1VG9B 3RVBA 4PGAA 3RVOA 3KP2A 1YA8A 2OFPA 3CPJB 4EPXA 2O8KA 1N5LA 1BE6A 5FPKA 1XZ8A 3ADBA 1XZJA 2LR0A 4OOIA 1WP9A 3ZTWA 4TL8A 3QVUA 1JYSA 2JA5J 2GF9A 1ZK2A 2VYQA 3UXHA 5HFAA 3SLGA 3RKYA 1CQPA 3TZLA 1IUNA 3E0XA 3KV1A 2IXFA 5BMOA 1QQIA 2NXEA 2QTFA 3AF2A 4QQFA 4RMIA 4U0KA 5FPHA 5BN5B 3SBEA 4I6GA 1A9SA 5L3VA 2VHYA 3GCDA 3R3XA 3FRHA 2ZPAA 1XF1A 2VQSA 4I0AA 5FOUA 2WOOA 1KP2A 3GEEA 1KDZA 3X1DA 4QWQA 5IF9A 3RSQA 2RNJA 1MMDA 1TFUA 3R77A 3A1CA 1YONA 4M6WB 2JFBA 5CLQA 5HS8A 2JCVA 4JT2A 2X4IA 3EPHA 1TQ2A 4KB5A 5FOVA 4QICA 3KSZO 3X43A 2WV1A 2YPRA 4ZZDA 4KWIA 1UT8A 5I7FA 1IBLB 4XEUA 2FPLA 2LXNA 1JEOA 2I7XA 2R7KA 3EVCA 4GH5A 4JYZA 3CCCA 1BXKA 3RFCA 3ZBPA 4DCPA 4DV0B 3DZFA 5KYXB 1DKRA 1MB3A 3HKCB 3PTZA 2AKAB 5B4UA 3BR6A 4S04A 2AG5A 3W6OA 4UD6A 3DEFA 3GJ6A 3IPRA 3LUDA 3BWEA 2M6KA 1O3QA 1J9EA 2QXTA 4YK7A 1N75A 5EJ6A 2C5LA 1CJUC 1T6BY 2B63J 1UF9A 4CYDA 4F7ZA 5M5XJ 2B1QA 2OV1A 2GAUA 2RGUA 3BFXA 3DQZA 4H18A 4N6GA 3WP1B 4DGSA 1PNTA 4AJ4A 4ZEMA 2PUFA 2VAPA 2ZBRA 4OU4A 1SG9A 1VA4A 2VF7A 1AHIA 4EFNA 1D09A 4XVCA 4IICA 4BHBA 4PRZA 5JVDF 1ZSYA 2VR1A 2P2LA 4JL6A 4ER5A 4W9MC 3P2KA 2PR7A 3OEED 5B2ZA 4F12A 3PFCA 4KXLA 3ZRGA 2O2XA 2ZRPA 1OAAA 3NR2A 2W0MA 5LDGA 3H1AA 4BX3A 3DQVC 4RFSA 2KYRA 3ORYA 4FHDA 3RT1A 1MSEC 3SQOA 4JI4B 3GRAA 4ZVMA 4AKGA 2AFIE 4XXHA 2JBAB 4CLRA 3QW4B 4C2TA 3G7NA 3JVIA 1Y3AA 4P4LA 2VBZA 5J58A 4NFLA 4KYIB 4OXRA 2ZJ2A 4MA5A 5IP5A 5EC8A 1FSHA 5AW9A 1PZNA 1Q1NA 2GBLC 5ES4B 1NY5A 3UXMA 4Z1MD 3G2IA 2TDXA 3B3FA 2MW8A 3GVIA 4KQWA 2ONJA 3ROMA 1W30A 4EPRA 4JP5A 5K0ZA 2AXTC 2HK6A 2ODQA 2P3LA 5A5DA 5KYVA 2ODTX 3EEOA 2ATXA 1XXHA 3UC9A 2RHTA 1WB4A 4US0R 5IT9K 1E63A 1MX9A 4GPAA 1B93A 1NUHA 4B47A 1YRHA 4G8BA 4J16C 5CDSA 3I5UA 1IVNA 2DFPA 2WHQA 4S1NA 1FZTA 2XB0X 5IJXA 2QUKA 1JLRA 3A4VA 3H5LA 2R6FA 4JLWA 1VPVA 5DLDA 4ZCLA 1QP7A 4C7OB 3HJCA 2LKPA 5A3JA 2A9KA 4OHPA 1CUBA 4JBAA 4XR9A 3GW2A 1G2QA 2FPPB 1ULAA 2LCIA 4RD0A 3T34A 2RIPA 2EW1A 4C3JJ 2XGGA 4MYRA 5H0IA 2GHRA 3B1VA 1JWBB 1H2WA 5KYYB 3H2JA 3PJDA 1PLKA 3EZ9A 3EZFA 5JQGB 2G7HA 1X7WA 3DYIA 3H3ZA 3SZPA 4CCNA 1TQ4A 2HADA 4RD2A 3WK7A 1FT9A 3VI3B 5TY0A 4Q16A 2VP4A 1XVVA 4DY6A 2CG4A 2HCBA 2OFFA 1YQQA 4ED9A 3D7RA 4LVUA 5KX5F 5HE9A 1JR6A 2WWWA 1CF4A 5TQ0A 2XPWA 4LLGF 2MYTA 5JFTA 4REOA 2Y75A 5FWDA 5FYDA 1UM9A 1LK7A 3AR4A 3AO0B 1GQRA 2O2DA 5IP9J 3K2BA 3QE3A 3I05A 3ZPLA 1VHLA 2WWHA 2GXSA 4IHJF 3U1DA 3R40A 5LXTA 3PXCX 4C0BA 3VZBA 4D4GA 5IEJA 3R8CA 4EPYA 4M87A 4HSRA 1SVLA 1JYEA 3AFOA 1YSCA 2B35A 1P5ZB 2VQ6A 4RDIA 4E5NA 1ZJJA 5I9MA 4HAIA 1U5TC 3AP2A 3U3JA 2W82A 2MSYA 2E6UX 1NY6A 4DIFA