1P4BH

Three-dimensional structure of a single chain fv fragment complexed with the peptide gcn4(7p-14p).
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
112
structure length
112
Chain Sequence
DVQLQQSGPGLVAPSQSLSITCTVSGFSLTDYGVNWVRQSPGKGLEWLGVIWGDGITDYNSALKSRLSVTKDNSKSQVFLKMNSLQSGDSARYYCVTGLFDYWGQGTTLTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed in Vitro Evolution and Crystallographic Analysis of a Peptide-binding Single Chain Antibody Fragment (scFv) with Low Picomolar Affinity.
pubmed doi rcsb
molecule keywords Antibody Variable light chain
molecule tags Immune system
source organism Mus musculus
total genus 28
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2003-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p4bH00
3SGJC 2CDFB 3TBVA 3C8HA 3K7UA 2Z93B 3QQNA 2I24N 4QHLA 3UJTH 2VXVL 3G5ZB 3FZUD 3K8LA 4Z5RA 4YUEL 2HLFC 1J88A 5C6TL 5F6HJ 5D9SA 4KKAC 4F9PC 3PXJA 2VABB 4OAWB 4PRHB 1HNFA 2GITB 2N7BA 3MJ9H 5T33H 1FYTA 4ZFGL 2I60L 5GGVH 1GAFH 3DYPA 2WV3A 4N8VA 3E3QC 3HMWH 1JYWA 1CFVH 4I77H 1U8LA 3OXSB 1WT5C 3PV7A 5CGYC 3EJYD 2J3SA 1KPVA 3R0NA 1YN7B 1DUZA 5C2UB 3GFUA 4GS7B 3UC0H 5IB3A 5DJAB 3B3IB 2MTPA 1QO3B 4IDJH 3VMPA 1NMBH 3U4BL 4P0DA 1RZ8B 5F9WC 1K5NA 3L5JA 4MNGB 1CVSC 3TZVB 3PP4H 2DI7A 3IFLL 4EN3B 4NQTA 5EU5A 4QT5B 8CGTA 2YWZA 2VLRD 1GIGH 1UB5A 2VR9A 3BO8A 3C2AL 3KYMA 1XGTA 1JZ3A 1MHEB 5EIVA 3OPZL 1UCTA 4S2SA 5L6YH 4NOFA 1FL3B 4XHJC 4P9HL 2DKMA 3VXRA 3BGMB 3NPZB 1RVFL 2JK5A 4M43L 3RDTA 3T8XB 5I16A 4GG6B 5E8EB 4G6KH 3O0RL 4KKBC 4PJXA 1U3ZA 5C08D 1IQWH 5JIPA 3HI1A 2VWEE 4XPBL 4MXQC 5IVXA 4W81A 2VZVA 4NO2A 1FGVH 3O45A 1S7UB 5DUMH 4NCC2 1G7HA 4KJQD 2FIKB 3MBXL 1A5FL 2LAAA 4NYLA 4NCDA 4NM4H 4A6YB 5FEBA 4UUJA 5ISZE 3WDIA 2XN9E 5JHLL 1LE9B 1JNLH 3O41A 3Q5OA 1VKXB 5E08L 3AB0B 3BN9C 2HJKB 3TNNB 1I85A 3CU1A 3MRCA 1DBMH 4L9LB 3QUYA 4JRYB 1HXMB 1SM3L 3OAUL 4OFKA 3DV4B 3KXFA 2D0GA 2J12B 5FV2A 1TZGH 5EU7E 1D9KC 3SDAA 4C58B 1X7QB 1FQ9C 2DMCA 3BOVA 5JTWA 3OGCA 4L8BA 5DFVD 4QRRD 2JKXA 3NCEB 3OKNA 4X6CE 4GUPA 2E6QA 4U05A 2I9TB 1Z5LA 5HHVL 4Y4KC 4R4BA 3MXWH 3UYPA 3G6AB 5DA0B 5ANMA 2Y5TB 3GMOA 5IMMB 4U1MB 1S8DB 3LS5H 4YHOH 5LGJB 4TSBL 5I0ZA 1HEZB 3SGJA 1B88A 1F3JB 2OP4L 4MLIA 5D1QA 4NDMA 4DQOH 1ED3B 2R1WA 1A7RH 4YHZL 1OSZB 1RULL 2ATPA 2IH1A 3EJJX 4HV8B 1EVTC 2DM7A 4DZ8A 1G7JB 5MEOB 1K4CB 5EZJB 1MAML 2RFXA 4M62L 2D7TL 2EH7L 3CVHL 4F9PA 2ZG3A 4DN4H 3QXAB 4QKXB 4PJ8B 3NCCB 4OCYL 1F4HA 3GSUB 3IDJA 5I1AA 1KIRB 3GM0A 3KPQA 3VFNB 3PQYA 1JI2A 5BRZE 4PJ7B 3RNKB 5I8KL 1LP9A 4FQXD 2VIRA 1G7QA 2R29L 4FFVC 3CCHA 4X9FA 1QSVA 1NLDL 2NW3B 3FZUC 2B20A 1U93A 3UTPD 5I1IL 1UENA 3MROA 5E6IB 1MCCA 5FUOH 4KUZL 2QQKH 2NY6D 1U8KB 4JAMB 4LLYA 2BSTA 3PHOB 5D1ZB 2DWDB 2NY0D 5C07E 3QAZB 3T4AA 3EYOB 1H3TA 3F7YA 4U1KB 1AGCA 4DN3H 4U3HA 4LP5A 3LY6A 1J1XL 1DZBA 5D1XD 4OLEA 1QSEE 3VG9B 1OW0C 2NTFA 1KEGL 1RZFH 5F9JB 3FB8B 4P46C 1A14L 1VFAA 4IRJC 3JSSA 3R06B 3OV6A 5B8CC 2F15A 3MBEB 3HN3A 3QUKA 4H5SB 4NQCE 4OQ1A 4LSPL 2VH5L 3NIDF 1TMCB 4ZSOE 3MACL 4HG4J 5GRWA 3UTTA 1NLBL 2CGRH 4POZD 4YC2B 3QDJB 3KPSD 3X12A 4WI8A 1NANH 4KH2A 3SE4C 4Y4FD 2DD8L 5TGBA 3VI3F 1OAQL 2VLME 4W4OC 4Z76A 3D9AL 3OKEB 1EBAA 2ZSVA 2GTWB 3S5LA 2X89A 2RBLA 5I1DA 1V7ML 1CT8B 5HYJA 5I76A 4ETQA 1ZHBB 4P4RA 4NRXB 3NFSL 4HK3N 3VXPA 1IC7H 3E0GA 3CFKB 2GCYA 2VITB 4Z95H 5DD3H 5FXCH 2EE2A 1IGTB 1GOGA 3HZKB 1D9KA 4JFDD 1S3KH 1DBBL 1I9EA 5EOQH 3IDGB 4MJIB 5GGVY 1VFOA 1XF3A 4KJYB 4PGZA 1JF6A 2VQTA 2NXZD 3GI8H 4C56D 4J6RL 3VWJA 1H0DA 3FAWA 4PRHE 4YK4C 2DN7A 4F7CB 1FYHB 2P5EB 3W9DB 4KJQC 4Y4KA 3THMH 1DQJA 5EOCH 4ZOEA 2AJSH 5IMKB 1GJIA 2BDNH 4ODTH 2GAZA 5E8OA 4OIBA 2X40A 4NZRL 5ERWB 3SEPA 4GQ9H 2BJMH 1G7LA 4UU9A 1ES0A 4RISH 1ZMYA 2IGFH 5DC0A 5HPOA 3BZEB 3BE1H 4O2EA 4MNGE 3O3EA 3PDOB 4PJHF 5C0AA 2XZQH 4LIQL 3O6ML 2X6MA 3FFCB 4Z0BL 3WDHA 1OD7A 3L3KA 2IPTH 3VFPA 1EFXD 5EIQA 5HHME 4FQIL 2ICEB 4HFWA 2QADD 4N0UB 2DLTA 5ELIA 2Y07H 4AEIL 4XP5H 4XXDA 2X4PA 1L6ZA 1P6AB 4GAGL 3C8KB 3ARBA 2GKIA 3L9RB 3MXVL 4M1GL 3QB7C 3DX7B 5D7JD 3WUZA 1KJVB 1PEZA 1N59B 1MCNA 2OR7A 3PE9A 6FABH 4WHYH 1A6PA 5IW1B 2AK1H 5KAQG 4GG6E 3DO7B 1T03H 4OZHB 4AY0A 3QP3A 4K9EH 1NKOA 3MUHL 3I50H 5BV7H 5M94B 3UBXB 4H25A 1CD8A 2Z91B 3QULA 4M61A 2ZPKH 4PY7B 5T1KD 3X13B 1E4XH 4XNXH 2GK0B 1TITA 5B39B 2I07B 1H3PH 2R1XA 1YJDC 1B4RA 3H7BA 3OJVC 1T2JA 3SCMB 1X4YA 1R3KB 4K3JL 3BKYL 2R8SH 4M5ZL 3TH4T 3TBWA 5EULV 4NKMB 1TCRA 1KIQB 1YEKL 4YPGB 1IBGL 3FOLB 4P5KA 2IAMC 4LLMA 3OG6B 1EMTH 1OW0A 4X8XA 2WIIA 2AJ3A 3QT2A 3DARA 5E4EB 4JKKA 5C6TH 4MVBC 5B8CA 4R90L 5EPMB 5KSAD 4POYA 2ESVB 4FXGA 2B2XL 3JTTA 1I3RB 5D96C 1BOYA 5GRUH 4QOKD 3RVXC 3WKNA 4GKNB 4KQ3H 1C12A 2EDEA 2NY6C 4ETYA 2VLRA 3ARWA 3SE4A 4KKLC 2FBOJ 4JG1L 3MODL 3G5YA 3WO4B 1KCKA 3FAXA 2NY0C 1PY9A 3HLAB 4MQ7A 3OKMA 1WCBA 4QF1A 3AU1B 2X9WA 4O02L 2J8UE 1IQDA 1VACB 4CKVX 1JTTA 1MCWM 1WSST 1AR2A 1TZIB 1FORH 1ZE3C 3CDFA 5MEPA 2AP2A 1SJXA 2H26B 5DUPL 3GSXA 1QRND 4MD4B 2YEZA 3HC3H 3C60D 3SKJL 3TBSA 1NANI 3QI9B 5F44A 3IFLH 1NAMB 4Q2ZA 4POZC 5KSBF 3ARFD 1HHIB 1K4DB 4HC1A 4HH8A 5F88A 1U8HA 4WW1B 5KJRL 1XZ0B 2VLJE 4JO2L 4NFBA 4Y4FC 3KDMA 1N0LA 5DK0A 3OPZH 5C0FB 5CWSA 1CDYA 3BDXA 3NABL 4P9HH 1T0MA 5CZVL 4KHTH 3L3DA 2NY4D 2IQ9H 3MNZA 4M43H 1GGIH 1H3VA 1DP0A 4OFYA 4LSUL 1F4XH 3CC5B 4JQVC 1BECA 3O0RH 4Z7OF 2JLLA 4TUOA 2HT4D 4J12A 1AGEB 1WQVT 3QIWD 4F15C 3PDGA 3AROA 1MRFL 4X99A 5E2VL 3VRJB 1KBGL 4OT1L 2V5TA 4K23L 5F7EL 3T3ME 1A9BA 1U8MB 2D03L 3IU3A 4QRRA 2GIYA 2YUWA 2EEBA 4P5MB 3MBXH 3DURA 4XHQA 3BP7B 3GMLB 1T7YA 3KYOA 1S5HA 1JPSL 5EH1A 4Y5XC 4YHML 3BRDA 1AO7A 4X6FB 5FHAH 1YEIL 1JGDA 4FZ8L 5C0DB 4M5YH 5LVEA 5JOFA 4B7LA 4WUKH 3PUCA 4G6MH 2FRGP 1NH6A 1EX0A 1SBSH 1N26A 4IS6A 2NX5D 1SM3H 4PLKD 3AAZA 1EHLL 3BQUD 4HUUA 3WEXB 4PRBB 4WFHE 4U0RC 4ZAKD 4QXTA 2LVCA 2E27H 4UINL 5FKPB 2BZDA 2D31A 3Q6FA 3ARED 4J7RA 3DROA 3VGGA 1UXSB 4PPTA 1PW3A 3IJHB 4QHMB 1HH6B 1QFOA 5JNYB 1SJEB 3FO9B 5L2JA 4MXWL 2ZP0T 3CFJA 3IF1A 3H6JA 4IRZL 2Y6SD 4TSBH 3ZHLA 5AD0A 4WTXA 2CKBH 3TBVB 3GZKA 3CDGA 2C3VB 4QHLB 43CAA 1JZ6A 4KVNH 1YJDL 2KBGA 2Z8SA 4Y16C 1AQKL 1B2WL 3LAFA 4FQXA 3QNYA 3H9ZA 2ZUTA 1PG7H 4JY5L 3S6CA 3VDAA 5ADPH 5D9SB 1E4XI 3O3UN 2FEEI 3QIUD 1NGWA 4HXBH 5J6HA 3O2WL 1LK3H 4ODHL 2VQUA 2D7TH 1UKTA 2EH7H 3KLAA 3BAEL 1CLYL 1RAMA 1FYTB 4HKZA 3WFHA 2W60A 1PX4A 3A6CL 1MLCA 3IDNA 1KJMB 5CJQL 5GS2H 4N8VB 3TBYA 4YHYB 2P5EE 4XP9L 4P57A 1I9IL 1U8LB 1XGPA 4ISVB 3ZDYF 1JHKH 3MOBH 1CG9A 5TQ2H 1KPVB 5AYUH 1NGPL 4RFOL 5I8KH 3U83A 1ZLSH 2YR3A 3P0VH 1JWMB 4F7EB 2G60L 5D1XA 3GJEA 1MY5A 2A6KB 5EUOE 5F70A 1JPTH 2VLKD 1K5NB 4XTRD 5I1IH 3GSOA 4P3WA 5D2LF 4EI5B 5EU5B 5F9OH 1FIGL 2QQLL 4RFNC 2P24A 1FC2D 3BUTA 4I5BA 3O2DA 4XCNA 1YPZF 3MR9B 2Q3AA 3MLUH 3FFCE 4HS6B 3SQOL 3VFGH 1C5DA 3EO0A 4B50A 3KPSA 5CSBA 3KYMB 2YMXH 4XRCB 3MV9D 2CMRL 4JRXD 2B0SH 4Y4FA 3VCLA 3FRUA 4ONOA 1CGYA 3RL2A 2DB8A 1HIML 3ORJA 1UQSB 4OD3L 1K8IA 4Z0XA 2NQCA 3UO1L 5GS1C 1DFBL 3RDTB 1KEGH 5I16B 2Z31D 1A14H 5AEAA 4OLWL 2H1PH 3S36L 2VH5H 4JQVA 3QG6A 5IQ9A 5JO5B 1TENA 4MCYA 5IVXB 3C60C 1NCDL 1WVZA 1XGRB 1JF5A 3FMGL 3WKMH 4Y5YC 3W11D 1LHZA 4JFDA 5GS0D 4N9GA 3GSVA 2NY5L 3DIFA 4C56A 4PJCA 5I18L 1JBJA 4MCZB 4UUJB 1RUAH 1V7MH 4V1DA 3O41B 4JGUA 4Y5XA 4NP4L 1MI5D 4LCYB 2HWZH 2C9AA 3NFSH 3IGAA 1JF1B 2NY4C 3UCRA 2V9RA 5AG9A 2BVUA 4FXKB 4XVJL 4RGNB 3QUYB 4EI6B 1MFCL 4QEGA 3KXFB 4Z7VB 2LU4A 1WBZA 3D39B 2HT4C 4WTWA 1PYWA 1VDGA 3QIWC 4YZFE 3OGCB 4XCEA 3OKKA 3MRRA 1LO3H 4M03A 5ICXB 1RJYB 3OKNB 1AD0B 4GUPB 5FYJD 1Z5LB 4IRSB 1KNOB 4PD4K 4RGOL 4Q0XL 2WSKA 2WUCL 2FX9L 1EFXA 3BVNB 3GMOB 5KSVB 3QFJE 12E8H 4U6VL 4R8WH 4R7NA 4OZHF 5AZEL 2C7UB 2R4SL 4MJ4A 5D1QB 1N5YH 1L7TL 4IBLT 3WUWA 4M6OL 1G9NH 5D7JA 4Y16A 3CVHB 2BSSA 4JHZA 3BQUC 2ZSWA 2BNQD 4GRWH 1B90A 1QFWM 4ZAKC 2YD7A 1EFQA 5HDLA 4PS4H 3BJ91 3S35H 5BS0D 5KS9A 1S7WA 4HJJH 4HS8H 2BSRB 3QUZC 4Z0BH 5JORA 3NTCL 4PP2A 3SDXB 4LCWD 3ULVC 5T1KA 1EO7A 4HWNA 5ACMA 5EBLA 4LRNL 1MHPL 4LAQL 3IDJB 4NZUH 2EDLA 1BQLH 4MZ2A 4GAGH 1A7BA 3MXVH 4R2GB 3GIZH 1IAIM 1BEYL 3C87A 1Q9OA 1VEOA 2BVPA 3CCHB 3I3DA 1ZTXL 3EFDH 4NWUL 1JRHL 3NIGF 4X7FC 1A9EA 2AV7A 4OZFH 3RKPA 2D4DA 3EHBD 3RA7L 3LOWA 1G0XA 3CH1A 3MRMA 4KK6C 1I4FA 5F96H 3QIUC 3GDBA 4XCCL 4MD0A 3ZDZE 1JK8A 4URTB 4OZIA 5JPMA 5FM5M 4R26H 4PJFB 1NC4B 2O26U 4LLYB 1IT9L 5C0CB 3FQUA 3UZVB 4QOKA 4DJMA 4YHPA 4RQQB 4CW1A 4K3JH 2EIDA 2NY7L 1V3KA 4G6JL 5HI4D 4EUPG 4WEMB 1I1YA 3PJSA 4MA3B 4U1GC 1MQKL 4M9OA 1IBGH 1BX2B 2EEAA 4ZFZA 4HAFA 1VFAB 3PL6D 4NJ9L 3T0EE 4YDIL 1MNUL 1F97A 5BZWA 1PG7X 3VD9A 1S9KC 5CIPA 2FJGA 1J0KA 2VL5A 3B8YA 3UTTB 1QRNA 1I1AC 5MENB 2A73B 1RJLA 3HCVA 2B2XH 1M71A 1P1ZA 3C60A 2NMSA 4JHAH 1QRKA 1OAZL 4JPWL 2FZ3A 3GHEH 4Y5YA 5TGBB 1BFTA 3WIFB 1G7MA 3MODH 3DNKA 4Z76B 5F7DB 3SO3C 1M4KA 3S5LB 2CK0L 5FFLA 2BC4A 1X6NA 4LDOB 5I1DB 5IJKA 5I76B 3GRWH 4BJLA 3ROOA 2D7NA 4U1SA 3WIHA 5GGRB 4ETQB 3HZMA 4NHCL 5I71B 3EYFB 5LCVL 3RY6C 5DUPH 1SVZA 2GCYB 4TSAH 3WIHL 2EDWA 3T0XA 3SKJH 2E9BA 3MJGX 2QSVA 2P7TA 1MCBA 3QIWA 3VWJB 5KJRH 1JNJA 3W11C 4OUOA 5GS0C 5KAQF 5LXGH 3A0OA 4FG6C 3L5HA 4G80B 2F5BL 4YLQT 1GGTA 1N7ML 4MWFA 5JW5A 1ITCA 1JGUL 1F6FB 1D5IH 4YFLI 2VXSL 5CZVH 3VU2A 1RPQA 3QUMH 4GXVL 4RWHA 1CN4A 5DURD 2DLGA 1C08A 4GRWB 1E27B 4HUXA 4RA3A 3AVEA 4LSUH 5TJWK 1G7LB 3ARRA 3BP5A 5EC1A 1DLHA 1MJ8H 3V4VH 2Q86A 4QXWA 4H8WH 3Q2CA 4QTIH 5DK2A 3U9UA 2NX5A 4KK8C 3MOAH 1MRFH 4NC0B 4EIZC 3BQUA 3HI5L 4PJDF 4K23H 4ZAKA 3MA9L 1P7KA 2D03H 4YIQA 3L3KB 4JDVA 2B1AL 4RGMC 3DUSB 3U6RA 2EKJA 4HFWB 3IB4A 3FB7A 3ZTNH 4YHMH 1RZKC 3QG7H 2W38A 3UX9B 4ELMA 1A2YB 3N1PC 4XXDB 2X4PB 5HVGB 1BPVA 3ARBB 2XICA 3VXRE 2W1NA 1M7DB 4ZUSA 1XGUA 4LLAA 3B9KD 1NGXB 3FTGA 4WRLA 3BPCA 1TVBB 1CLOH 3IT8D 2V7HA 5DJ6B 4PJXE 5I1EL 1DR9A 4XP4L 4UINH 1R0AH 2YA1A 1E4JA 1UZ6E 3ESVF 5CEZH 3RBGA 5I1KH 3QNXA 2OI9B 3QULB 3QIUA 3SPVA 1HWHB 4IJ3C 2QSCL 2R1XB 2HTLD 2VJXA 3H7BB 5E5RB 4NBZB 4CU7A 3DJ9A 1I3VA 3VXNB 4Z7UA 3DSNA 4IRZH 5IMOB 1QACA 3QQ9D 4JKPL 1Q1JH 3TBWB 3UP1A 1WUNT 1ORQA 3UROR 5GGRY 4HF5L 5KVFL 1HSBA 2WIIB 2AJ3B 4YQXL 3O6LL 4HG4K 5B8CB 3KXFE 1BQHA 2J6EA 5E94A 3EHBC 3O2WH 3BYYA 4BQ8A 3S35X 4FXGB 2VLKA 1CDGA 5CCKL 1C12B 2BXZA 2J6EL 4JQIH 5IV2A 1EO5A 3ARVA 3G5YB 3OG4B 3C6SA 5AWNH 1I9IH 4Y5VB 2DQFB 4LVNC 5ANME 2VN7A 3OKMB 3MV9A 1WCBB 4JRXA 4QF1B 2DM2A 2UZYB 2Z8WC 3FQTA 4NKDB 1IQDB 4LQFH 4E42B 5DHXB 2J5LB 2H6PB 2HFEA 5MEPB 2FD6H 3BUYB 3GI9L 3GSXB 3PL6C 2P8PB 1OSPL 1F42A 4NUGH 2YEZB 5D71H 3UYRL 5K9KB 3EZJB 4XH2B 2MQCA 4Y2OA 4PGJA 1NFIA 1NQBA 4YAQA 4XC1H 3QQ3A 5C08B 4Q2ZB 3HR6A 3HI6H 2XOTA 3OKYA 2A9NH 4HPYH 5I15L 1XF5A 4KUCD 1GHFL 2CMRH 3RZCC 5DK0B 5CWSB 4KQ4L 1HIMH 2R2CA 5BVJA 1UEYA 3M8OH 3E3QE 3UO1H 3ISWA 1NMCB 1T0MB 3C6LD 1NEZG 5EOTA 3L3OB 3PQYE 3B9AA 1E6JL 5TDNA 3L3DB 1NBZA 1FL6B 5GS0L 4F2MA 5EU6D 5HHOD 1LP9E 1MI5A 2BNRE 1IE5A 1D5BB 4OLWH 4TUOB 1BD2D 2ZCKL 5DVKA 3QXWA 1MHHB 5C0IA 1KIUA 4FA8A 3MLZH 5DQDL 4TULH 3CPLB 4XP6L 4JFYB 1A9BB 43C9B 3ARPA 3LKOA 5IMLB 1RK1B 2A6DA 2BVOB 1FV1A 1WAAA 4B5EA 1UZ8B 1IL1B 2DQEL 2VLLA 5IHUL 4DGVH 2D7QA 2DQIL 2HH0L 2XZCL 1JGDB 3E6FA 5DT1L 3TIEB 3REVB 4BFIB 5FYJL 3AAZB 1PX3A 3U0PB 1AIFA 3DYMA 3VXUD 5J13C 4LU5H 3PP3K 3RY4A 4LRIA 5I74C 3Q6FB 1KLUA 2BNQA 2IH3B 1Y6MR 1T7ZA 1PQZB 1FC1A 5BS0A 3W0WE 3CLEL 2X4SB 3P9LA 4LLUB 4RGOH 3QIBC 1FFOA 2ENYA 4LCWA 3CFJB 1JVKA 3ARQA 3QPXH 2NY1C 4WENB 2FNBA 5HYJE 5TH2B 3OB8A 4P2QD 1JI1A 1JV5B 5B22A 5C7XH 5GJTL 3O3AB 1PZUB 4M6OH 3B9KC 4P59L 2V2TA 5KSUA 4HPOL 2P4AB 1T6VN 2YD9A 3QNYB 4FQXB 3GKWH 4PJFF 5IB5B 4TUKH 1IAOA 1G6RH 1NCBH 4IOIB 1QOKA 4X4XB 1ADQA 1EEYB 2M26A 3RVTD 3V52L 3NA4A 5CMAB 3WFHB 2W60B 3P4MA 4CN4A 2NY6B 3IRZA 3TBYB 2HTLC 1G0DA 2DQJH 4LRNH 1MHPH 4P57B 2E6PA 5F6IB 4LOUD 4LAQH 2YPKA 3H9HA 1ADQL 5I75B 2NY0B 4KROB 5IHZA 3QQ9C 2CO6B 3WLBA 1EPFA 5F72S 1YMHB 2ITDB 3TA3D 4XXCA 4GRLC 4M7KL 1BEYH 3KPTA 3LQZB 5D1XB 2VDNL 3GJEB 5JHDE 3BKCH 5FDYA 3X11A 3RBSA 1CGSL 3PL6A 3RA7H 3RGVD 1KN2L 3GSOB 4NKOA 4CRPA 4TNVK 1AJ7L 5DDHA 4YFLF 2D0FA 2P24B 5C0AE 3LEYL 4FP8H 4I5BB 2QKIA 5AZ2L 1L7IL 3RWCB 3OAYH 2PUQT 4UOW0 4APQB 3LB6D 4BKLA 1J9CT 1CICD 3VH8G 4JKWA 5I1JL 1KTDA 3U7YH 3FRUB 4PGDB 2KH2B 4KK5C 2NY7H 4G6JH 4I1NB 5GHWL 2XQBH 5C8JA 3HC4L 3EAKA 5IB4A 1D5ZB 3MRBB 4MB4A 3G6JA 1ACZA 4NJ9H 3LS4H 1LO4L 1MLBB 3KHOA 5IQ9B 1Y0LB 4WFGE 2FB4L 4LQ1A 5DHVH 3T2PA 4JFDB 2EDQA 4N9GB 3DIFB 4G9FD 2NXZB 1IGIH 4FQQA 4YBQC 4MYWB 1DQQA 1WIUA 2VSCA 4O51B 3WXWL 3IRPX 1U9KA 3QUXB 3SE9L 4BH7B 4YE4L 1GVIA 4WDIA 3DX6A 3C6LC 3T1FA 2FECL 4OV5A 5ENWB 1VHPA 1AGBA 2ED7A 4R97B 1GSMA 2Y7QA 1N6QL 2BY3A 1TPXC 4RZCB 4LCCC 1U58B 3HS0B 5INDA 1FLTX 1NSNL 1MFDL 4ONFL 2F74B 1F6AA 1I7TA 3MRRB 2WWKO 4DGYH 3DRQA 4ZS7L 5C0RL 2DAVA 3OX8B 4JY6A 2HFFB 2VLRE 2CR3A 3V4PL 5C2BH 5I1LB 1EFXB 3T65B 1HOCA 2ZKHH 1KT2B 5DJXA 4F7MB 2QADB 3TT3L 1VESA 1VFBA 4R7NB 4OBRA 3V6OC 1YEGH 1UA6H 3KPLA 3MLWH 1G84A 1CU4H 2BNUB 3WUWB 1CFSB 3P9MB 1SYVB 1DDHB 1J7VR 2IEPA 4O2CA 4DKDC 5D7JB 3SKNA 3B9KA 1B6UA 2HG5A 2WAHA 3DETD 5MERB 1DLFH 5C9JB 4PTTA 4X9BA 1YC8A 5CSZA 5EC2A 4DKEL 4M6ML 1MCLA 4WJ5A 4KMTL 5KS9B 3MA9H 4S1SL 4N0YH 2DJUA 3VFTA 5JORB 2GSGB 2DRUA 2V2XA 1R5WB 1QHOA 1MCOL 4IHOA 1KXTB 2Z4QB 5EBLB 3K3QA 1XH3A 1FNGB 3PWLA 4NFCA 5D7KE 1UH3A 4GBXD 1RY7B 5D7SL 2GJ6B 3MLSH 1BZ9B 3VFOA 5EO1A 3P11H 4GRLA 1M7XA 4PJ9D 3QCVL 1R3LA 2CPCA 1T1ZA 5I1EH 4G3YH 1QBLL 1KC5H 2MKLC 4BSJA 3ZL4L 3CH1B 3MRMB 3DTXB 1I4FB 4Z18A 4MD0B 4PYGA 5A2JH 5KSAB 5JZ7D 1J87A 1DTUA 4QTHB 1BVLA 3RVTC 4QRRE 4K8RC 3SHSA 4QOKB 4UAOB 5H2BB 5IF0A 4ODXA 4XB7A 4NNYA 1HZHL 1AO7E 2WLYA 4JKPH 3TH2T 5SV3A 4OTXH 4R9HA 1F90H 4X4MA 2VE6A 1Z2KA 4ZFZB 3TA3C 2J4WL 4H1LG 4JFZH 5GRXG 4XWGH 4ERSL 3O6LH 5DHVB 1GC1L 5BZWB 1ZLWH 4Q97A 1JYXA 5CP7A 1BLNA 7CGTA 3LKPA 4YXKH 2KQMA 4WO4C 4J3TA 3OWEA 1KXVC 4E41D 1UVQB 5BCAA 1YA5A 5CCKH 4Y5YB 3H0TA 1A22B 1DCLA 1F2XK 2MMXA 3ARFB 5JXED 4BSVA 1G7MB 1KELH 3PABA 3BX7C 1KYOK 3LB6C 1ODAA 4K71C 1CICC 2XTJC 3HNTH 5DWUL 1F3DJ 2MPAL 4NQEA 2BC4B 2R2EA 3C08L 1O5DT 1UJ3B 3ROOB 2DJSA 2P8MB 4JFHE 3ZLQC 4UQ2A 3C6LA 3VGAC 3EYUL 5B3JE 3BSZL 4N0FA 1A6AB 3H9YA 1OSPH 5EU6A 3QYCA 5HHOA 2Y9RT 5ESAA 3QO1A 5LGHH 4PFEA 3LN4A 1FAKT 4JFXA 4LCCA 5H37G 1BD2A 2P7TB 5FDWB 3UTPE 1EGJA 3V6ZA 4PRPD 5BZDA 3NACL 4OD2A 3QWRD 3ZT7A 3OL2A 4G5ZH 1EGJL 1YY8B 2WINA 1E6JH 1C08B 4XWOD 2P46B 3V6OA 2I25N 4RRPA 2P44B 3CMOL 4JZJC 1OAYL 2FH6A 3DVNA 4HIXL 4M1DH 2HJLB 3EDJA 5DK2B 3U9UB 2NX5B 4MA7L 2H3NA 2ARJQ 4FNLL 5KZCB 3EO9L 4KU1A 3R4DA 1TJHL 3VD7A 3VXUA 4N5ED 4WI3A 5TQ0L 4Y88A 5CKGA 1ZWIB 4YIQB 2DOCA 4NNPL 3AREB 3U6RB 3STZB 4N68A 4YBLB 3KPSE 3SE8L 2AJUL 1QLFA 5KOMC 4MAYB 2F19H 3U0TA 2HLAB 1CZ8L 2CXKA 2HH0H 2XZCH 4X6BA 5ILTH 1N8ZA 5I2IA 4MNHB 5E0QA 3L7EB 2EDXA 1XGUB 3FTGB 3ARDB 4WIQA 15C8L 4P2QA 2X44D 4G9DA 3STLA 2WW8A 2V7HB 4XBPA 4XBEL 4M6AA 3MRNA 4LSSL 3B2VH 4LFHG 3J7HA 3STBA 2YD2A 3DETC 2R56L 3JWDC 5GRYA 1B0GA 3OKLA 3OAZH 2ORBL 3LPGA 2YPVL 1S7XA 2NLJA 1MVUB 4JPIA 4JFDE 3WE6B 3CLEH 3GO1L 4QWWC 3CX2A 4C56E 4PJCE 2FX8L 3RJDA 1JWUB 5CD3A 3BEVB 3EZ8A 4V1DE 5D93B 3ZZ1A 3R1GL 5DI8B 1FVEA 1TZHA 5E1AB 4AM0A 5GJTH 3LKQA 5H35B 4UIKL 2SEBA 4DUXA 1HSBB 4HPOH 4OLXL 3TA3A 1DN0A 2MNUA 1FG2A 3UZEA 3MZTA 1QP1A 4XNQB 4PJ9C 1BQHB 3O4OB 2W07A 4L4VE 3BD3A 1F58L 3U48A 1KTLA 3MGOA 4NNXA 2VLKB 5JW4R 4N8VG 3RGVA 4LSRL 4ENEC 1I8MA 4YWGL 1YQ2A 2IBZX 2VSDA 4PJIB 3LEXB 5JZ7C 2UZIL 5E6YA 3WNOA 2Z9TA 1JPFA 1ZVYA 4XNZB 5IV2B 3M17A 3QCTL 4MXVF 3C6SB 3WNPA 2DQTL 1CICA 3MV9B 3FOMA 1HQRA 4JRXB 4GKSB 2BHZA 3FQTB 3I2CL 5HI3D 4CVWA 4P48A 2HFEB 1Z3GH 2E7MA 2FATL 1T2QH 3QRGL 4ONHB 5GSVB 3K0WA 5CJBA 1NBYA 5C0BD 4LNVA 3ALWA 3DOSA 5HHXH 2Z31B 5IVZA 3GJFH 5BO1H 4UQ3A 2EDDA 3KPNA 2GSIA 3HC0B 2MSPA 1QSFB 1J1OH 2IBZY 4PV8B 1A6VH 5DVLA 5KS9E 3DVFA 1L7IH 3EGSA 3QJHA 4ODSH 4XCYA 3SDCD 3GUTA 3S37H 3OB0H 4GH7B 3KJ6L 4QRUA 3D3VB 1IZKA 1XIWC 5GHWH 2X41A 3RVVD 1AP2A 4GW5A 1IAIL 5EOTB 1OPGL 1A47A 5KANG 2IFGA 4PJGE 1OAXL 3T4YA 1CE1H 1CDHA 4ODVH 2Y06H 1A6WH 4PLOB 3LEVL 2J8UF 1MI5B 5CGMA 2OTWA 4GKOA 5C0EA 1LO4H 3NIFF 1V7NL 3ULUC 3FO0L 2FB4H 4W6YB 4X9HA 3VGFA 1SEBB 4OZIE 3LKOB 2EH8H 4EEEA 1FV1B 3IS0X 2CDGB 3OAZK 4P3DA 4QOKE 2W65A 4HZLB 3VFRB 1QQDA 5C70A 3WXWH 3ARTA 2Q6WA 3SE9H 1N0XL 3L95A 4YE4H 2W0KA 3VXMB 2CKNA 3E6FB 1CXFA 3EFFB 1A02N 1U8PB 4MB3A 4XWOC 1NCCL 5JR1H 1IMHC 4AIOA 3KNBA 4KY1H 4XNUH 1AIFB 1A7QH 4I13B 3W2DL 1NFDA 1NSNH 1ZT4A 3OXRA 5MHSE 2YPLB 1MFDH 1QRNE 3N1QC 3PWVA 2M8XA 1OGAB 3PWPD 5F7UA 4ZS7H 2V2WB 4PG9A 5BMFH 5BS0B 5ECJE 3UTSD 3F62A 1A3LH 1U8NB 1FFOB 4M4PA 3T3MF 4MNQD 4LCWB 3V4PH 5IGXL 3EOAB 2F5AL 3JWDL 4I4WA 4KV5F 5L2KE 4MDJA 1D6VH 3BGAA 4L5FL 3FO2A 3Q3GB 3HNSL 2DIJA 2GW5A 1XF4A 5KSUB 2HA1A 1FNEB 3B9EA 5EN2A 4AK1A 4X9IA 4JLRA 5JMRA 2YK1H 3C5SA 5F8QC 4PJ9A 3P4OA 4WWID 4M6MH 3ZKXB 4KMTH 3AUVA 3NBNA 3DWTA 4NIKB 4UT7L 2ZWLT 2K7QA 1I7RB 3O4LD 3P4MB 1LDPL 5GPRA 2LU7A 1P2CA 5B38A 4OSUL 2AAVA 4LGPB 4K7FB 5LJYH 3H9HB 3D69B 5CP3H 3IU4H 2LE9A 5IHZB 3UPRA 3MNWA 3P4NA 5TE7L 1AGFB 4M7JL 2VZOA 4HEPG 1EEZA 1RJCA 3LKSA 3ZYIA 3DX8A 5LG1A 4JB9L 2F53D 1BBDH 5E2TH 1FDLH 1CF8H 5JLZA 3G9VA 3QCVH 4BZ1H 5DEFB 2ITCB 4G42B 1IGFH 2YSSA 1F4AA 1MHCB 1NAKL 5K59E 3DVGB 5E03A 4GFTB 1T0NA 5DDHB 2QKIB 2AXGB 2NW2A 1MIML 3PWNB 2VUOA 5FCSH 3QR2A 3N85L 5EFIA 2M1KA 1BF8A 1R5VB 4UTBH 4WI4A 1KTDB 1OTTD 3ULVE 3P73A 5JXEA 1HZHH 2W59A 5C8JB 1I9JH 4ELME 5JPNA 4PLJC 3SKUD 2NR6D 1IGJA 4K3EH 5EZOL 5IB4B 5HYFA 1TQCC 2PYED 2AJYL 4ZD3H 5D7IA 3RWIB 2GT9B 3EOTL 3VXOB 5HYSA 4G8GA 5ID0A 3EIFA 3EYVB 1GC1H 4XCFL 4I18C 4I48A 4AIZA 5EUOF 1EHAA 4OQTL 5DMJB 5KVGL 2R0LL 3H3PH 1KJ3H 3RWEA 3DXAD 4ZFOA 5J1SC 3S5LG 4P2RE 3HMXL 5CEYA 4JKMA 3SDCC 3C9NA 1JN6A 3GMQB 4HCRL 1UB6B 4C83B 4PRPA 3D0VB 1MPAL 1DQQB 3RUGA 5KANI 2RR3A 3LN5A 3RX5A 4Z7UE 3HZYA 4WDIB 3QWRA 3RVVC 3INUL 1U8OB 1Z0NA 4UNVA 5FM4A 3EYUH 1N3NA 3VD3A 2DQDH 4YNYA 4OLYL 4JJ5A 5DURB 1N6UA 2Y7QB 2EYSB 3ME0A 3I84A 1ZGLB 4Y2DD 5IOPA 1U8JA 3NGBC 4DEPC 1JZ4A 4DAGH 5L7XL 4M1CC 1F6AB 1I7TB 5T5FL 4JREB 3RRQA 2VLKE 1IEBA 2HT3C 3DUUA 3ZTJG 3S37X 5CKAA 1WITA 4LBEA 2VUYA 4OB5L 3HFML 4Z9KB 2ED9A 5EUKA 5DJXB 2DTSA 4XZUA 4LLDB 1VFBB 3LN9A 2JB6B 3MMEA 4TVPD 1PZ5B 1OP9A 1W72H 4N9OB 4ZO8A 2CUIA 4I2XA 5E1HB 4GG8B 2X4QA 3JUZA 3L3HA 3S8WA 4L8SC 3SKNB 1KB9J 2O5XH 2IALB 5TDOA 4WY7H 3EO9H 5DMKA 5CSZB 3VGHA 4QO1A 4WJ5B 5J6GB 1NUFA 5TQ0H 1L0QA 3FT3B 3P2TA 1MAKA 3DHMA 3RWFB 4U2YA 2AJUH 3MRFA 2EKSB 1QNZH 1WFNA 2P49B 3IVKB 5HD8D 4OLZH 2NZ9D 2IADA 4LVEA 4IEFB 4M48L 1BVKB 3EW3B 2ICWJ 4Z7WE 2UWEF 4FQHB 2DBLL 1ZEAL 2HVKB 4Z78A 3WHXA 3VFOB 1MI5E 1QFUH 4BFEA 3D85D 4GT7A 3OJMB 3G5VB 4K2UL 4YHLL 2IFFH 4LSSH 1ZS8A 1AHWB 1OCWL 5I6XB 4OBSA 1U6AL 3RNQA 2VRAA 3IXTA 1IAKA 2X4OA 1U2HA 2W9EH 5CJOL 4OKVA 2ORBH 1DEDA 3JV4A 2CD0A 2J88H 3GNML 1OY3B 5KN5B 2AJVL 4FFZH 4WTZA 4TOYH 4ODXB 5DC9B 2QHLA 1X4XA 4OJFH 1WAAE 3MLXH 1GGUA 3R1GH 5F7FA 2MWCA 3BPLC 4RIRA 5DO2D 3RU8L 3SDDC 5ACZA 3S96A 5A2IH 3PNWB 5D5MA 2XWBA 2VE6B 1ZT1B 4UIKH 5T3XD 1A7NH 1OB1B 1MELA 4U3XA 4EN3D 3VA6A 4PJBB 4HUVB 2YUXA 1MCJA 5CP7B 1BLNB 2XXCB 4QY8B 5C0BA 5L88L 1ZLUH 3G04A 4UBDD 1F58H 5EZLA 3U46A 4O9HH 2YD8A 1JPGB 4TVSa 5DRXB 1QZ1A 2BNQE 2F8OA 4YWGH 4F58L 3CU7A 5A43C 2CRYA 4JO4L 1T04B 2UZIH 5BS0E 2EXWD 1R24B 4CMHC 3HAEH 4Q58C 3SDCA 2A2QT 4YJZL 1MY7A 1OTTC 5FO9B 1E28A 1XR9A 4LP4A 3P30L 4D9QE 2NR6C 2FATH 1CXLA 4M8QB 4ODUB 1WICA 1V3LA 5EU6B 8FABA 5ESAB 3QO1B 1C5CL 1T4KA 4GQPH 4G7VL 5HVHC 3Q6GL 4FQLL 5I19H 3W39A 1BD2B 4D0CB 2PXYC 1F3DH 3OR7A 3OKOA 1DSFL 4KMQA 4ZS6D 3V6ZB 4ZFFB 3MO1A 3NFNA 1QA9A 3IFPA 3WFBH 4JCMA 5BZDB 1AKJD 3WHE1 4LCIL 4NT6B 4OD2B 5EORL 4AEHL 3BZFB 1MFBH 1DBKL 4F57L 1GGBH 3QXTA 1WTLA 4NPYA 4GLRH 1OPGH 1HHHA 2XT1B 2WINB 5JUEL 1OAXH 3VXTA 2R0ZL 3D0LA 3VXSE 2FEDD 3WFCH 3O6FD 3O81A 4HK3J 4J3OC 4ODWB 2E5EA 4LLQB 4L8SA 1Z9SA 1G7PA 4BYHA 3FO0H 3V7AE 1Y6NR 4ZQKB 4P2CG 3HUJF 3B43A 2JCCF 1MEXL 3RWGA 1A4KA 1J1PL 4G6FD 1QSZA 3PWPA 3VFWB 1QLFB 5GJSL 5HI5D 4KZEH 1ZHKB 3V95A 5FOBA 4JR9H 4NN7C 4MNQA 4X6BB 4PREA 1N8ZB 5I2IB 2ZUQB 4H20L 2MQ0A 2GUOA 5DMYA 4LCUA 3PV6A 3O8XD 1UXWA 3G6JE 3STLB 3R0MA 1HKLH 2A77L 4DFIA 3R8QA 4UMGA 4X7TA 3ROLA 4NO5A 3IKCA 4PJ8D 4PJ5D 1B0GB 4L3CB 3A67L 4LF3A 3OKLB 3GSRB 4PR5A 1XF2A 3IFNH 1S7XB 4PRDB 1OT2A 3CZFA 1ZLUK 4TTDC 4RFEA 1J5OL 3V5HA 5IGXH 3O4LA 3I9GH 4OI7A 1OAUL 3WDJA 2HAZA 4PTUA 1PKQA 4XVSL 4AZ8A 2AABL 3ZE1F 1FVEB 4KDTC 1TZHB 2C1PA 3HNSH 3RIAF 2IBGA 3VFVB 2AKRA 4BZYA 3LKQB 4ZODA 2SEBB 3JZ7A 2D7PA 5AUMA 3K46A 1U8QA 5L8JB 3Q0HA 5IW3A 1FIEA 1FG2B 4PYHA 4XMKL 2F53A 3TWCL 1PBYA 5SWZD 3BGFB 4GAFB 4OZGA 2PO6D 2JELL 5D1ZD 4G8FB 2I27N 3HAEB 4NNXB 1FNSH 2VDOL 1I8MB 4TQEL 3RGVB 1CL7H 1CXKA 4UT7H 2BOCA 1JWSB 4D9LL 1WWWX 3F5WA 3MSPA 1S78D 1LDPH 1X5IA 1JPFB 2AEWA 2DQGL 4WEBH 1LEKA 2OQJA 3M17B 1WEJL 4OSUH 5TE4H 3LQAC 1RZIA 3U2SA 1IGMH 5BJTA 4GS7C 1ZA3A 4MQXD 4J4PC 5DD1H 3TO4B 3EKCA 3MBED 4FRWA 4YX2L 2P1YA 1EUUA 4JB9H 4D9RD 4UDTA 2ZCHL 4OM1L 1HKFA 1SEQH 3TZVC 3QDJD 5IBUG 2PYEA 4EN3C 4QHUA 1MCIA 2A74A 4DK3A 1B0RA 3S7GA 3LPFA 3KPNB 2GSIB 3OSKA 1NAKH 2VISB 3DVIA 3QSKB 3CLFL 5J56B 3GBNH 4OLVL 4X0KB 1DUYA 3BDBA 3EGSB 3GIVA 3N85H 3GUTB 1CGTA 5F97E 2E6JA 2WNGA 3S4SB 2EXWC 4G9FB 4G43A 4GW5B 2X4RA 4LDLB 2BCKB 4LASL 4OFVA 3T4YB 1LEIA 3QEGH 4LVHB 4LLVA 2OTWB 2YD1A 4MJID 4OGAD 2X4TA 4XCFH 3QCUL 5GZND 2E9WA 4ZG1A 3T2OA 4OQTH 4Y2DA 5KVGH 2R0LH 3T3PE 1B0WA 1RUKH 1LQSR 5FKAA 5IIEA 1PLGL 4MDIB 1FFPB 3QDHA 4ZS6C 4Y7MA 2BVQB 4HCRH 3AB0C 1JGEA 3HE6B 4PP1D 2XV6B 2DQHH 2CIIA 2EIBA 1SY6A 3BP6A 4MS8D 4L9LC 3INUH 3GGWB 5DXWA 4F37F 2BSED 4HT1H 5KW9L 3U7WL 3I6LD 5HPMB 1RJZA 4X4ME 5GRVL 2BMKA 3K8MA 1SY6L 4OF0A 4KTDL 5E8NA 3KNBB 1LP9F 1EAPB 3TV3H 1NFDB 1P5UA 1ZT4B 1U3JA 3OXRB 3TCXA 5DGRA 2X5PA 5L7XH 3PWVB 4TVPL 5JW4M 3F8UB 5FB8A 1T22B 4H0HB 4PJHA 2O5YH 3WNLA 4PJEB 1EAJA 2DS4A 4JZOA 4QYOB 4NRZA 4NQEE 4JG0H 3UJIL 4KKCC 1A6UL 2JF1A 4MDJB 2EC8A 4G7YL 2Z93A 4M9PA 3RAJH 3WUWG 2DL2A 1FJ1B 1KCVH 5JW4N 3QZWA 4LHUD 3VFSA 4LLWA 3EYQD 3FO2B 5DEGA 4WUUD 4KDTA 4GBXB 3DO3A 1XF4B 2JIXD 1CTNA 4XVUD 3H2WA 3AS3A 3K80A 2L7JA 5EU6E 4O00A 5HHOE 1NBQA 4JLRB 3D85A 2VABA 2B5IB 4OAWA 4PJ9B 2DWEA 2GITA 4PJ8C 3JV5A 5GQBA 3CX5J 1FVCA 4HIHA 3VD4A 1XFPA 5DRZB 2K3TA 3K4AA 5CINL 1EK3A 3OXSA 4LHJB 5B38B 1RFDH 3P0YH 5H94A 1A6TB 1HHJA 4M48H 1J0YA 4PJBF 3MNWB 4F8QA 2Q7YB 1HH9B 4H88L 3DX8B 1CLCA 4J4PA 2GEEA 1BQUA 5SX5H 1UM6H 3V6OE 1NCAL 2ESVD 2GYSA 5JLZB 4Z8FL 1RZ8A 4CJ0A 5E6IC 1YEEL 2AGJL 4ZXBD 1RU9L 4HKJB 4TSCL 3ULSA 4EN3A 5I30L 4QT5A 1CL7I 2FO1A 4UDUA 4YXHL 4MD5B 2PO6C 3QHTC 1T0NB 3S34L 5C3LD 5D1ZC 3MUZ1 3VXUE 1CXEA 3MLYL 3MV8D 1GOHA 3JWOL 3QAZC 5T3XL 2AJVH 1DVFD 4E41B 4OCLC 1NL0L 1OT1A 5ALCL 2UV3A 1FL3A 3MCG1 3VG9C 4EDWL 3N9GH 4M6NL 5GGSB 4MQXC 3E6HB 3T8XA 3MBEC 4N90E 2IANB 2IPUG 4JPKL 4JGMA 5CIPH 5DJ2B 2VZSA 5ID0B 1SJHB 4P2QE 5F1OB 2VDPL 4MAUL 1C7TA 2GK2A 1W0VB 4LSVH 35C8L 1LO2L 4L1HA 4R7DA 1YYLL 5MI0B 3RWEB 4F58H 2BRRL 2FIKA 3OBAA 5E9DD 4A6YA 3C9NB 1JN6B 5KSBA 1R3HB 1LE9A 3UTOA 3RUGB 1AKJA 4H26B 4KRLB 2HJKA 4PGEB 4ZDHA 2YBRA 1W2KT 4L9LA 4JRYA 1HXMA 1N3NB 4YNYB 3BESR 3BPNB 3DV4A 4JJ5B 2VOTA 5D7LD 4K94L 4RMVA 4OGAC 3FN3A 3Q6GH 1U8JB 1P4LA 3O6FA 5IOPB 1A1NA 3VGEA 4MSWA 3ZKND 4OF7A 2AI0L 2DMBA 5ALBL 2PW1B 1U0QA 5BOPA 3QISA 1DSFH 1IEBB 2I9TA 3DUUB 4QXUL 1T1XA 2NNAB 2E7CA 3G6AA 4LBEB 4AEHH 4U1MA 1S8DA 1DBKH 4ZNCD 4PP1C 5LGJA 5EUKB 2FBJL 4XP1L 2XTJE 4XZUB 3HPLA 1HNGA 4GRMA 3WHE0 4MS8C 1ED3A 3MMEB 3UJTL 1VGEH 1G9MH 1J12A 2GFBA 1OSZA 1T66D 3ILPB 3MJ9A 4FQ1L 2X4QB 3L3HB 2WLZA 5MEOA 4JQXC 3WNMA 3O8XA 5EU3A 1K4CA 1AXTH 4RWYH 3FL7A 1VEPA 4JO3H 4QHKI 5DMKB 4LEXL 2FSEA 3MJ9L 5T33L 5LAXA 5IUSA 2FHBA 1GAFL 1MEXH 1Z0MA 4PJ8A 4PJ5A 1J1PH 3ULVH 2V5SA 3HMWL 3MRFB 3GSUA 4AYFA 2ADGB 4ZOCA 4WGVB 1IM3A 3MGTB 3FN0H 4UNTA 3VFNA 2APXA 4R96B 3H3BC 4NQSB 5ESQA 1EO8L 4Z78B 2EDNA 3WHXB 3EYQC 5GGSY 3H8NA 4IDJL 1JHLL 4ZYKB 3T0BA 5FUZH 2VDMH 2HJFB 2CRZA 2WBJB 4XGZA 1ZS8B 3GSNH 3KYKH 1GIGL 5SWZA 1IAKB 3ZMRA 3A67H 2X4OB 2PO6A 3SCMC 3JV4B 4PY8I 3PHOA 5D1ZA 4BZ2H 3FQNB 3K81A 4OZ4A 4U1KA 5L6YL 1OAUH 4DOHB 2F58H 4U6XA 4KRNA 1OQXA 2JJTC 3IETB 3S96B 5F9JA 3R06A 1TQCB 3DSFH 5FA3A 3Q1SH 3MBEA 4H5SA 4L4TB 4JZNA 1I8IA 3GBMH 1IQWL 5JIIA 4POUB 1WBYB 1WZKA 3TWCH 1F8TH 4P23B 5EO0B 3RGHA 3QDJA 1TJIH 1NFDE 2B1HH 5GXBB 2VXTL 5EZLB 3U46B 1EEUA 5J1TC 2DICA 3WO4C 5DUML 5IBLC 4L1DA 5D2LA 2OMNA 4HEME 3CSYB 3OKEA 2H32H 3ARZA 4OM0H 1WEJH 2GTWA 3CFBB 1KJ2H 3N1MC 1MRCL 4JN2A 1CT8A 4Y1AD 5F9DC 5IBTH 1CTOA 2YOCA 4OV6F 5DHYA 1E28B 4NRXA 4OCMC 1DBML 3X14A 3FHQA 1JGVH 3CFKA 4OM1H 2VITA 5I1CH 4HUNB 1RIHL 3QI9C 1TZGL 3HZKA 4DVRH 1T4KB 2N4IA 3L3JA 3IDGA 4MJIA 1NBVH 1P5VA 5ITFB 4KJYA 3W39B 4DEPB 3OKOB 1CGUA 3KS0H 3PGFH 4RAVB 1MCPH 3W9DA 3H9SE 3NFNB 1QA9B 3IFPB 4WWKB 2D9QB 4NO3B 2I5YL 5IMKA 3MFFB 3LS5L 4RNRB 4KXZH 4RGND 1HHHB 1NJ9B 4DQOL 2YD4A 2VQ1B 3NFPB 1A7RL 2Q8AL 4FMKA 5MP6L 3D0LB 1KB9K 1WZ1H 3MRKB 1G7PB 4AMKL 3MCLL 3MRQA 4XPGL 1FO0H 4IRSD 2BY2A 2WBKA 5HYQA 3KPMB 4DN4L 3UTZB 2D3VA 3RWGB 2CUMA 2ICEA 3MOQA 3PWPB 4N0UA 4LK4A 4AQOA 1RZKH 1KGCE 1BFVH 3ALPA 5HGBB 4QGYA 4ZTOH 3V4UH 4NQDB 3UTSB 5GSRB 2LU3A 2AK4B 4K9EC 2YRLA 3RI5K 2DKUA 3C8KA 5FA4A 5FF6A 3L9RA 4MNQB 4XAKD 7FABL 4PREB 2KDGA 3DX7A 5E8PB 2GUOB 1N59A 1YNLH 3GSNB 4LCUB 3PV6B 5ICYA 5IM7A 1DQML 4LHUA 1UACH 1UXWB 5D7IE 3DO7A 5GS2D 2X42A 4OZHA 2A6JB 1T66C 1CXHA 4G8GE 4WUUA 5E2UH 1KCLA 5ESVB 2OTUA 3O2VL 2EDBA 2ICWB 3UBXA 5CJ5A 5FUOL 3LD8C 2AS5M 2Z91A 4PY7A 2GK0A 5B39A 2I07A 2CLVB 3OHXA 2YUZA 1RZJL 1YY9D 3SCMA 4RFEB 1R3KA 2EE3A 4R2GD 5FOJA 4DN3L 4JFEB 4BK4A 4PRPE 3JUYA 2LFGA 3RJQB 3UJIH 5C09D 4E9LA 4PTUB 2Q8BL 4NKMA 4R0LA 3UJJH 3FOLA 3O11A 1TQBB 2C1PB 2JJTA 3ZO0A 3MUGA 5B4MD 1Q9WA 5C92A 4HWZB 1T3FB 2X70B 2F53B 1QEWB 4CVXA 2ESVA 4LHQB 1NC4D 3L6FB 1I3RA 4DUVA 5C0CD 1BQSA 4ZXBA 2ICWI 2QQNL 3MJ6A 4GKNA 2LVEA 3VI4E 4YHYC 1J18A 1FAIH 1FZJB 4YDKH 1RZGB 3DECA 2B7DT 3F5WB 3H7LA 3N06B 4UNUA 5CINH 2OQJB 3SBWC 3TO2A 2FCBA 3HLAA 3ETBF 3AU1A 3KLDA 1DVFA 1RZIB 5HGAA 3QDMB 4CMHB 5BJTB 5B21A 1ZA3B 5F7YC 4PJCF 2MFNA 4YXLH 1TZIA 4H88H 1K6QH 1ZT7B 1HYSC 4MA8H 1IC7L 1PJ9A 1NDGB 2H26A 3V7AG 5J3HD 2IQAB 4MD4A 5MEND 4UDTB 1UC6A 2R9HD 4Z95L 5DD3L 4I2XE 1DQLL 4EI5C 2PYEB 1YEEH 2A74B 1HWGB 2AGJH 3QI9A 4FQJH 4TSCH 3RVWD 1S3KL 5EOQL 5ITBH 4YXHH 1BHGA 1CD1A 1IFHH 4P9HC 3CXDH 2QSQA 3GI8L 5I9QB 3S34H 4JO1L 4WW1A 1XZ0A 1QVOA 3JWOH 4Z7QE 5D8JH 3GIVB 4MQSB 4JFQB 3DXAB 4NKQB 3THML 2ATKA 5E9DA 2AJSL 2BDNL 5HHNB 3RDTC 4EDWH 2J8OA 2EE9A 4LKXB 4M6NH 4GQ9L 2BJML 3IDMB 1Z6JT 1X5XA 4RISL 2VDPH 4KAQL 2X4TB 3VRJA 4WW2B 3BE1L 1R3IH 5GRVK 35C8H 2XZQL 5D7LA 5T5NF 4Y2DB 5E00A 1LO2H 1YYLH 3LCYA 2IPTL 3RY5A 4P5MA 3QFDB 5FKAB 2EC9U 5GS3A 3BP7A 4KXZI 2VXQL 5C6WH 3MYZA 5GGUB 2HT2D 5ETUB 2Y07L 2X4NB 4X6FA 3KPPB 2WP3T 5C0DA 1I85C 1UM4L 4KGLA 3MYJA 4RGNC 3RX7A 4EDXA 4YDJA 5D5ME 3BHBB 6FABL 2AK1L 2ZCLH 4PJGF 4PRBA 4JVPA 1IGCH 2LQRA 4K9EL 5TDPA 1FH5H 5BV7L 1TTUA 1LNUB 5C0BE 2ZPKL 1E4XL 4YHIA 4IRSC 2FEEL 1CFBA 1JGLH 1ZA6B 3ZE0E 3T2NH 1H3PL 3IJHA 3HRZB 5CEXB 5JNYA 4PJHB 1SJEA 4HK0A 1BJMA 3FO9A 5D72L 4JZOB 4HIJA 4JM2B 3K1KC 2R8SL 4Y89A 2QBWA 4NRZB 2FBJH 5D1QC 4XP1H 1K85A 4U6HA 2C3VA 5GIRA 4KI5C 1UG9A 3QZWB 3VFSB 4LLWB 1EMTL 5DEGB 5ISZD 4KMLB 2XN9D 3HE7B 5EG6C 4UV4H 4FQ1H 3L5IA 2G75A 3GKZA 3V0VB 3DI3B 2EYTA 4RDQG 4IIQB 1WV7T 2X1QA 3D85B 4LEXH 2OMBA 1EERB 5GRUL 2DWEB 5GZOD 4KQ3L 4R3SA 3B2UD 3T2QA 1FVCB 1KJMA 3HZVB 4HIHB 2XQYK 1YY9C 2IPKB 2Y23A 4ISVA 5GGTL 5H94B 3SBWA 4R2GC 1HHJB 3FB6B 4ESKA 5I1GH 1H9VA 4M7LT 3CD4A 1SYSA 2CDEA 4U49A 1FORL 1JWMA 1EO8H 4F7EA 4ONGL 1QHPA 2QLVB 1YQVH 2A6KA 1ZVSA 1JHLH 3HC3L 1P4IL 4X4YB 2HKFH 1DANU 5B4MC 3ULSB 4EI5A 3FT4B 4UDUB 3L1OL 3MR9A 4HS6A 3NCJH 3V0AC 5FECB 3BYTA 2NCMA 2R1YA 1FNFA 4XRCA 4JFFB 3TESA 4PBXA 4UT9H 4MLSA 4OIIH 1UQSA 3WL9B 2O61A 4KHTL 4HBCL 5DD5H 3F6IA 1N6VA 5JDSB 2IQ9L 1FHGA 4Y1AA 1GGIL 1A7PL 1MJJA 3OR6A 1UWEH 1F4XL 2ENSA 3OJDB 1S7VA 1XCTA 5BRZD 5KVEL 5JO5A 2R9HC 3CAFA 3MLTB 4UV7L 3TPUB 3NH7L 1XGRA 4ALAL 1S9WB 4FFWD 3RVWC 2VXTH 1LE5A 4R7DB 4RA0C 1EXUA 3LZFH 1GGYA 5K59F 3CNKA 4QRTA 4MCZA 5KSBB 1MRCH 5FHAL 4YHNA 4PJAE 3O4LE 1AKJB 3QWQB 4M5YL 3GMMA 4LCYA 5I71C 4ZDHB 1PKQE 4I3SH 4WUKL 4M8VA 5I73B 4G6ML 1YZZA 2YBRB 1JF1A 5C07D 3ULVF 5IK3A 4FXKA 1SBSL 4ELMF 2EECA 3MPCA 2EZ0D 4EI6A 4Z77B 1NC2D 1RIHH 5T1DH 4Z7VA 3HB3D 2XKNB 3D39A 2E27L 2F53E 3O6FB 1P4LB 1A1NB 3VWJC 4MSWB 4OZGE 3NCFB 5ICXA 1RJYA 1U92A 4HIEB 5GRJH 4NQCD 1AD0A 1CGVA 4S0SD 2F54E 4IRSA 2CKBA 4LDEB 1KNOA 3TVMB 1T1XB 5FK9A 1IARB 3V5KB 1EHNA 3BVNA 5KSVA 1IC4H 2HT2C 2R2HB 2I5YH 4G6FB 4PRAB 5CEZD 2VLMD 2CKBL 2C7UA 2RB8A 3HPLB 4GRMB 4KVNL 5H8DA 3RI5F 3WO3B 4Z7UF 4YDVA 5BXFB 2Q8AH 5MP6H 1OQOA 2GFBB 3CVHA 4XC3H 1DE4B 3SOBH 1PG7L 3QXVA 5ADPL 2PYEE 3O8XB 4HXBL 3LQMA 5EU3B 4AMKH 1LK3L 2BXYA 3MCLH 4XPGH 1X5JA 4GAYB 2BSRA 2FSEB 3CX5K 3K4ZA 3K2UL 3SDXA 5CLTA 5LAXB 4MJ5B 4PJ5B 1OWWA 4I3RH 5C9KA 1J0JA 2OXHA 3BFOA 3RWDB 3SGEH 3WN5B 2VDRH 1JHKL 3ARBC 3MOBL 1IM3B 4NHUB 5TQ2L 1ROWA 5D6DC 5AYUL 7FABH 3N0PB 3MRLA 4NGHH 1KN4L 1ZLSL 2XZZA 5ESQB 2DQCH 3P0VL 5C09A 1DQDL 2ZUWA 1DQMH 1P7HL 3MZGB 1JPTL 2L4OA 2FHCA 2DI8A 4XGZB 2OI9C 3O2VH 3WFEH 5F9OL 5SWSD 5MEQB 5FYLE 4GSDL 5SWZB 5E95B 4X5LA 3MLUL 4PJFA 2PO6B 1KTRL 1NC4A 3VFGL 5GZOC 5C0CA 4K8RH 1RZJH 5JA9A 2YMXL 4RQQA 1GZPA 1KLGB 1VERA 4KROD 2B0SL 4OZ4B 2Y4SA 1TETL 3VE0B 1M1SA 5FYKE 4MA3A 4KZDL 4U6XB 1KEML 3EJYC 4RMRA 4I0PD 5HHMD 2Q8BH 3E2HB 1KACB 1BX2A 3JBG7 3MV7B 4N8CL 1P53A 4K07A 3MRDA 4KPHH 5F7NC 5FM8A 5FA3B 2H1PL 4Z7WF 5SWQB 4JZNB 1I8IB 2IMNA 3CMGA 4ZPVB 5MENA 2A73A 3ZHKA 3WKML 4APQD 4RMSA 2QQNH 1FE8H 5HDQH 5F1NA 3WIFA 3LSOB 4HQQH 4Y5VC 5D2LB 2BFVL 5F7DA 1QFWH 1RUAL 1S7TB 4LEOA 4JN2B 4S1DD 3S97C 3IAPA 1YPZB 2J5LC 2V17H 4LVOB 3QJFB 5GGRA 3UAJD 5DHYB 4HS3B 2HWZL 1FNLA 4WW2F 3EYFA 3X14B 2OM5A 1DQLH 4WI6A 3H3KA 1G9EA 3L3JB 4NO0D 4P5TD 1A21A 2OJZL 1LO3L 3SE3A 1J8KA 4FFWC 3WJLC 4JO1H 5J4MA 4K7PH 5DYOA 3QUXD 4G80A 4CADA 4DVBA 3CSPA 4U0QB 1RUMH 2ZOKB 1PEWA 1NMCC 4H8WC 5DJ8B 12E8L 4R8WL 5IT2H 3NPSB 1W8NA 2CJUH 1E27A 2H9GB 1N5YL 3AS2A 5IJVB 4HDIB 3AXLB 1G9NL 1VSCA 2ZOLA 4NUJB 1LEGA 3UEZA 2DYPD 4KAQH 3HB3C 4XPFH 5ID1B 1H5BB 4DWHA 5T3XE 5IWLC 4B0MM 3JV6B 1KB5L 4XPAH 3MRQB 4PS4L 5DFVC 3S35L 1UCBH 4HJJL 4HS8L 5F1KC 5HYQB 3VFUA 1AQDB 3VJ6A 4JM2F 3PGDB 1YDPB 5CZXD 5DRWB 3DUSA 1T5XB 1GL4B 5HYIA 3D2UD 2VXQH 1A1OB 1H3XA 4NZUL 1A2YA 4HW6A 1BQLL 3BEWB 1UM4H 5FA4B 4OZFA 2DIAA 5FF6B 2YS4A 4NWTH 5D6DA 3GIZL 1M7DA 4ZUTB 3OKDA 1NGXA 5DF0A 1TVBA 2RCSH 4QHNA 5IM7B 5ICYB 5IVNA 3EFDL 4LHUB 5DJ6A 2XIDA 1ZK9A 4X5XB 5ISZA 4WUUB 2XN9A 1UH4A 4FS0A 2JIXB 2OTUB 5F96L 4P9MH 3ZT5A 4YHKH 4R26L 2AQ2A 4XMPH 3SGEI 3OHXB 3K1DA 1YYML 2QQQA 1CIDA 3JTSA 3K4DA 4WNQB 3VXNA 5D72H 5IMOA 5KSBE 4Q9BA 2BVEA 1IVLA 2GJ6D 4R0LB 3BZ4B 1MF2H 3O11B 4FQXC 1ZLVH 1HILA 4JRYE 1S9XB 3MUGB 4LNRA 1Q9WB 4P2OB 5BW7A 4CVXB 1T89C 1X6LA 1KIPA 4JHAL 4KGJA 4ZXBB 4Z7OE 3GHEL 4U1JB 3ECBA 5B38G 3GRWA 5F6IC 3ALXA 1ZGLM 1RK0A 4Y5VA 5I75C 4KROC 2DQFA 3MV8B 2LTQC 3TO2B 2I26N 1WC7A 3IS1X 5GGTH 5K9OA 1WWBX 1DVFB 3GRWL 5HGAB 4NKDA 4HMEA 3MJ7A 4W70A 4E42A 1CK0H 2H6PA 2XA8H 5D1XC 1X5LA 5DSCA 3KVQA 3CXHJ 4ONGH 3T0AA 1CFNB 3B9DA 3BUYA 3QNZA 2P8PA 5IR1A 3OF6D 2X1WL 4TSAL 1P4IH 5I8OL 5K9KA 4XH2A 1SHMA 5HGHB 5E99H 5BRZA 5C08A 3UDWA 4DW2L 3BD4A 1F13A 1CD1B 3L1OH 2C4FU 2ARJA 4APQC 1QFWI 1QVOB 1OAKH 5J9PA 3WJLA 4EKXA 3QUMA 5LXGL 3U4EA 2ERJB 5C6PB 5F3BA 5A2LH 5CSGA 1GGCL 2XZAL 2ATKB 1D5IL 5E9DB 3O3DB 4HBCH 3QUML 3L3OA 4PJ7E 4BM7A 4M4RA 1FL6A 3UAJC 5HYSG 4HGWA 1A7PH 5IFJB 3VG0L 1D5BA 5CUSH 3WJJC 2MKWA 1JYNA 1MJ8L 3V4VL 2NY5C 4H8WL 5KVEH 4QTIL 1BREA 1JNNH 4UV7H 3ULUH 1MHHA 1YECH 5HDOA 3MOAL 3NH7H 1NC2A 4EOWH 3A6OA 4ALAH 3CPLA 3EBAA 3MRIA 5IWLA 5D7LB 1OWRM 4P5TC 4JFYA 5E00B 2OTPA 2NXZC 43C9A 5SWZE 3DRTB 5IMLA 1RK1A 2BVOA 4NQCA 1UZ8A 1IL1A 3QUXC 3ZTNL 3VWKD 5INCA 3V5DA 2YA2A 3QG7L 4X98B 4MA1B 1MSPA 3L3GB 3TIEA 3FRPA 3MLVH 1IAMA 3MYJB 4GW4A 3REVA 3CSBA 4IOFD 4EDXB 4R97C 3ELAT 4BFIA 4YDJB 3MX0A 5BV7B 3RQ3A 4L3EB 1CLOL 3QXDB 5FHBL 3ZDYE 1J05A 1D5XB 1BVZA 3VFMB 5KZCD 3U1SH 3U0PA 3C5ZB 1C16B 1OOAA 1AXSA 1BBJB 5TDPB 1R0AL 1ZLVK 5CEZL 2P43B 5I1KL 1FSKB 2PW2A 3RWJA 2CLZB 3QDJE 3QWOA 4L29B 1EJ6A 4LPWA 4YHIB 2IH3A 4MAYD 3LD8B 1PQZA 4K7PX 4WFEE 5K33A 4RMQA 2X4SA 5CZXC 5EWIH 4C57C 4LLUA 3T3PF 5I8EA 1BOGA 1V8HA 3RTQD 4PJDB 3SGKC 4HK0B 2QADC 4UTAH 5F3HA 4HIJB 4DKAA 3ARDD 1Q1JL 5TH2A 1RI8A 4U6HB 2X4UB 2UUDH 5GIRB 1JV5A 2BK8A 3O3AA 3BWUC 4U1LA 5D7JC 2A6IB 2XY1A 1H8OA 3U36A 1FG9C 1X5KA 2G75B 1EEQA 2LAGB 5IB5A 2EYTB 1Z9LA 2QJDA 5T3ZH 3AFLA 2HRPH 4K7PY 1JL8A 1C7SA 4MJIE 1T89A 4IOIA 1KCSH 4D3CH 1P7QB 4X4XA 3G9AB 4NFDA 1EEYA 3K2UH 4R3SB 5CMAA 2NY3D 5SWSA 1QUNA 1QYGL 4J3XA 1RQ5A 4JQIL 3TH3T 5AWNL 1QLRB 2FLBT 5TF1H 4NN5B 3BPOB 3B5HA 2Z8VC 4LQFL 4I9WE 1SYSB 1KN4H 1YMHA 2ITDA 2CDEB 4QNPF 1JTOA 5HTSA 1DQDH 3LQZA 4I0PA 2FD6L 2JB5H 1ZVSB 4QXGH 4NUGL 5D71L 4MZ3A 1EZVX 4XC1L 3IKKA 2K9UA 5KSAC 2HFGL 4GSDH 3HI6L 4WTZG 2A9NL 4JDZA 4HPYL 3RWCA 4L8CA 4UAOC 3MFGB 4WV1B 3DPBA 4OI9A 4APQA 4X6DF 32C2A 2R1YB 3IDXH 4YEEA 1LO0L 4PGDA 3ZE2F 3IDYB 4NM8L 4N0UE 1TETH 3M8OL 2KL6A 2O61B 3RL1B 4EQ3A 4KZDH 1KEMH 4JFPA 5K9JH 1D5ZA 2P42B 2B4CH 3MRBA 4NBXB 4Y1AB 3HNVH 1MJJB 3OR6B 1NGYA 4N8CH 1HE7A 3BKML 4WI9A 5TPWL 3BH9B 1EZVY 1MLBA 1S7VB 1XCTB 1QSFD 3WJJA 4S1QH 3T77A 5F89B 4OZHE 3KLHD 1Y0LA 4OCNC 3MLZL 3BI9X 4TULL 3QO0A 1LE5B 3BMVA 1NGZA 1EXUB 3ARFC 1WLHA 3D3VD 4NO0A 4P5TA 5CLWA 1YNTB 2BFVH 4HGMA 1CDBA 5IJKC 4QRTB 3IXAA 3TBTB 5LQBH 1UJ3C 2Z0BA 4O51A 4DGVL 1JPST 2OL3L 3QUXA 5A16B 4BH7A 4NQVB 3RKDD 1YEDB 3BWAA 4YHNB 4CNIA 1MIEL 5J7CC 3GMMB 4S0TD 3TN0B 1A3RH 4Q6IC 2AERT 5IK3B 1MFEH 1IM9B 4HUWB 5ENWA 2FL5B 2ADFH 4FZEH 2GTZA 2VDKL 2UUDK 4RZCA 2XPGB 4YH6A 1U58A 4E0RB 3HS0A 4U1IB 5E56A 4LU5L 3PHQB 1UH2A 3O6KL 1INEH 2F74A 2J8UA 2XY2A 2ESVE 2DYPA 4CN6A 2Z35B 2OJZH 3T0ED 4RBPH 1U92B 5I66A 3OX8A 5LWYH 2HFFA 2CKBB 2NXYD 1VENA 5FK9B 3VXMD 5J1AB 4OGXL 1I3GL 5I1LA 3T65A 3ZDXE 3KPOB 1KT2A 3SGKA 3D2UA 3QPXL 4F7MA 1AD9B 5DTFB 4LFHD 1V3JA 3EYSH 3RVUD 2C26A 1EUTA 4IOFC 5C7XL 2BNUA 1CFSA 3P9MA 4YDVB 1SYVA 1DDHA 1TNNA 4LPXA 2YPLD 4PLKC 3GKWL 3TM6A 5MERA 1OGAD 5C9JA 4TUKL 2AJZA 5DD0L 1KB5H 3JV0A 1G6RL 4DTGH 1NCBL 1XGQB 3AREC 1GPOH 2GSGA 2ZNWA 5L0QB 4YBLC 4OFIA 5I17A 1R5WA 4MAYC 3KAAA 2FYYA 3NZHH 4L3AA 4JVWA 3V6BR 2WIMA 2Z8RA 2Z4QA 3BH8B 5FIEA 2DQJL 4X9GA 1FNGA 1MJ7L 4HXAL 3S9DB 2WUBL 2Y6SC 1MWAH 3TYGL 5E9DE 5HYEA 3ARDC 2A0LD 3MRLB 1RD6A 2GJ6A 5C09B 1BZ9A 2QSTA 5KOVC 4KTEH 3EDFA 5BVPH 3VMNA 3BKCL 4PIRF 1FLRH 1RHFA 3DTXA 1ONQA 3NMEA 3W5MA 4FP8L 5KSAA 4BH8A 1EV2E 4QTHA 1CDCA 5H2BA 2NY3C 1YYMH 4WCYL 1FL5B 1GZPB 1U95B 4MB5A 3A6BH 3U7YL 5D93C 1WWAX 2XQBL 2JTDA 2PN5A 4EUPH 4Y4HB 5HJ3A 2F8VA 1QKZH 1DL7H 1NGQL 1MCFA 3LS4L 3MRDB 3O4OC 5DHVA 5IROA 2DF3A 3I6GA 3OF6A 4XTRC 2MJWA 1KUMA 1U91A 1UVQA 2W0LA 1OP3H 4WU7B 4XNZC 4GKZB 3ARGB 5F1NB 3ARFA 1BZ7B 2QHRH 4WHTA 2VMFA 1IGIL 2OSLB 4N0RA 1A7OH 1P69B 2B8OT 4LEOB 1UJ3A 2P8MA 5DUBA 4YO0B 1HDMA 4RAUA 3DV6B 4Q6IA 2Z31C 1A6AA 5I8OH 2VR5A 1QPXA 3JVGA 1SMAA 3CUPB 3CFCL 1T7WA 4DW2H 3KLHC 1K8DA 2JJVA 4X7DC 5FDWA 4DGYL 1I1RA 3L5WA 2OBGA 3MREB 4LARH 1FYTE 5DYOB 3SKMA 3LDBB 3SDAD 2YN5A 4CADB 4DVBB 5C2BL 2VL4A 1GGCH 2XZAH 2ZKHL 1N4XH 4L8DA 3RKDC 1YY8A 3VWKA 5FAAA 1YEGL 1Z9OA 1UA6L 4YEFA 3MLWL 1CU4L 5L8LB 2AEIT 1KB5B 3VG0H 1GH7A 5DFTA 1VGKB 2FHFA 2ZOLB 1UADC 5DR5L 1LEGB 5FYLH 2HJLA 1DLFL 5KVDH 5DMIH 3L5XL 4N0YL 3VFUB 3VJ6B 1ZWIA 3GEWB 5GGQH 3AREA 1K2DB 1X3DA 4M93B 1MWAB 3STZA 4ZO9A 5FYKH 4MAYA 3V7MA 1FRGH 4MX7B 2HLAA 2PF6A 4M7ZB 3RTQA 1I8KA 4OZFB 1MCHA 4MNHA 1GYAA 3L7EA 1BGXL 1QG3A 2MHAB 3OKDB 4Y1AE 3ARDA 2W9DH 3KWWB 5AAMA 3W9EA 3MLSL 5FHBH 4QHNB 1KV3A 3P11L 2E9JA 3F12A 4XB8A 5ISZB 4OFPA 2XN9B 4LRIC 4G3YL 1KC5L 5IVXE 2BNRD 2AEPH 5KG9A 1KPUB 4HBQA 4Q9CA 1MVUA 3WE6A 4EUPB 4EBQL 4MMZC 5D70L 3GM8A 3JTSB 1OP3K 1JWUA 2BVTA 2ZUSA 3QZWG 3MRJB 3BEVA 1MOEA 3KYNB 5DI8A 2W9LA 4OTXL 5E1AA 1ZOXA 4X6CB 1F90L 3OTTA 4AQ1B 3OZ9L 2A0LC 5H35A 4JFZL 5FYJU 4XWGL 4RGNE 1HILB 5HXMA 4XPHL 2J2ZA 1TDQA 2UWEA 4XNQA 4LNRB 4R4FH 4Z7VE 4CDHA 3WLWD 3ZKXC 3D39E 2AV1A 4XHJD 5D7IF 2YWYA 4YXKL 4XNMA 1KIPB 1ND0B 5JQ6H 2M2DA 2EXYD 4UB0L 3DMMB 3LEXA 3ECBB 4PJIA 1NUNB 1QYGH 3FO1A 4GXUM 4KKBD 3ULUF 1KELL 2X1OA 1RK0B 3HNTL 3LQAH 4MXQD 1WC7B 5K9OB 3I6KA 4YBHA 4GKSA 5HI4C 1Q9LA 2H2SD 3W0WD 3MJ7B 4XXCC 1YMMD 2W92A 2APFA 5DSCB 1WWCA 4PLNC 5GSVA 4ONHA 5EA0H 1H15A 2NY2B 1U8IA 4KI5E 1VPOH 3QNZB 1OF2A 3BIKB 5IR1B 1GRWA 2Z31A 5LGHL 3HC0A 4CDGC 1CFTA 2QEJA 1RIUL 5BRZB 2G2RA 1QSFA 4PV8A 1S9YA 1MCKA 4P3CH 2HFGH 2ARJB 2VC2H 4XMLL 1F2QA 2RQ8A 3SDXE 5J9PB 3QUMB 3U4EB 1LO0H 5F3BB 5M95B 3D3VA 1ZHLA 3VI4F 4NM8H 3WXVH 4G5ZL 5ACLA 2HYMA 2WZPD 3ESUF 3U79A 5IB2A 1EJOH 4HGWB 1ZAGA 4CMMA 4V2BA 3NA9L 5C09E 5TPWH 3BKMH 5HHQA 5C07B 4AT6B 1I9RH 4M1DL 3C8DA 1QR1B 1C1EL 4AL8L 1NC2B 3MRIB 5JHDD 2ADIA 1SEBA 4IM8A 4PJFE 2Q76B 5D2NA 2CDGA 4NQCB 4QGTA 5C0CE 2F19L 4HZLA 4ZSOB 3VFRA 5INCB 3V5DB 2OL3H 3VXMA 2DL9A 5ILTL 1MIEH 1AR1D 3I02A 3EFFA 4GW4B 2DLFH 1IC5H 1U8PA 2AEQH 2E8ZA 3B6SB 5CBEA 3S3SA 3TIDB 1QR4A 4LSQH 1BMGA 1J05B 1F5WA 1GCFA 2OZ4H 2VDKH 3UPCA 1WZMA 2FX7L 1AXSB 3ZKSD 3O6KH 4PV9B 1RMFL 3B2VL 2YPLA 3UTTE 5MENE 4JREC 2YRZA 3LKRB 5J11B 2PW2B 3CVIH 2QR0A 3RWJB 1OGAA 3QWOB 2V2WA 1NEUA 4FFVD 2VDQH 1U8NA 4WFGD 1CDIA 5I8EB 1BOGB 3HUJA 4OGXH 1I3GH 3ARUA 3EOAA 4IOSD 1LMKA 3MA7B 1NMAH 2JCCA 5F3HB 2DM4A 1UWGH 1CR9H 3C09B 1RZ7H 5F93C 3Q3GA 2YRPA 1HHGB 4U1LB 4WI2A 4O58H 3CSGA 3U36B 1FNEA 4N5UA 1G6VK 5D5MF 5IW6B 5DD0H 1ZGLP 4QRPD 5E5UB 1Y18B 1N2RA 4P46D 2VAAA 4Y8AA 1I7RA 4IRJD 5SWSB 1CBVL 3ZE0F 5DQJA 4K7FA 1MJ7H 3D69A 4HXAH 2WUBH 2VZ3A 2LTQB 2HP4A 4XBGB 3TYGH 1AGFA 3GJFA 1ZXQA 3CXHK 1Z3GL 4GRWE 1XR8A 3C2SA 1T2QL 1MAJA 4I0PB 5HHMB 1JNHA 4PRID 4LIQE 1AHWC 1AFVH 5I6XC 2YD6A 5HHXL 4K3HA 5DEFA 5BO1L 2A83B 1Q0XH 1TLKA 2ITCA 4G42A 1WISA 4PUBH 5FO7B 1MHCA 3WLWC 2P5WD 3DVGA 3BW9A 1J1OL 5EBWB 2OR9H 1A6VL 3RZWA 3SKOA 2AXGA 3HPJB 4JDZB 3PWNA 2EXYC 5M7QA 4L8CB 4ODSL 1E6OH 1H8SA 3S37L 5SV4A 1R5VA 32C2B 1NEZB 4WCYH 1N64L 2VXUH 3TO4D 3VDBA 1GC1C 3U82B 4JFPB 3TNMB 4F80A 2H2SC 1CE1L 4ODVL 2Y06L 1A6WL 3DLQR 4X8JB 3RWIA 4O2FB 2GT9A 3VXOA 1NGQH 1EBPA 1NGYB 3TEUA 4Y0GA 5D7KD 3EYVA 4OUUB 5LBSH 2JJUA 4AENB 3BT2H 3F58L 3T77B 1FGNL 1DQTA 3CFEB 3QO0B 4I0KA 4OFYD 4AIXA 2IMMA 4WVRA 2OL3B 2EDOA 1NGZB 4OF5A 4NO0B 4P5TB 2ZG1A 3D48R 3MC0A 5ICZA 2EH8L 4GW1B 3GMQA 1UB6A 3CDYA 4C83A 3D0VA 3IXAB 4JM4H 5B3NA 3BWAB 4CNIB 1U8OA 1KTKE 1M6OB 1MCSA 2Q1EA 3G6DH 4UILL 1AO7D 2GTZB 3MJ8A 2EYSA 5JR1L 1ZGLA 4KY1L 4XNUL 1A7QL 1BIIB 2DIBA 5CZKA 3CFCH 3MGAA 1MREH 2J8UB 2DYPB 1EDQA 3H42L 3IAQA 5I66B 3HE6D 1HQ4A 2HKHH 5BMFL 1JHTA 5CJXC 4F8TA 1A3LL 1V5JA 3W81A 3D2UB 1VCAA 3ILQD 1D6VL 4LLDA 4LKCB 5JIHA 4JPVH 2JB6A 2MCPH 1PZ5A 1AR1C 4PJAF 5CHNA 1WK0A 1ZANL 2VLJB 1G6RB 1T20B 4GG8A 2PCPB 2WP3O 2Y5EA 4JE4B 2IALA 5DR5H 1QBMH 4JFHD 2AJZB 2YK1L 1XF1A 3IFOB 4A2MA 5JW3H 1J0HA 1WT5A 3L5XH 5C08E 5J6GA 2DI9A 5C1MB 5SX4H 3FT3A 2IAMD 5CP3A 3RWFA 5I17B 2BNRA 1TVHA 4OZGF 2FYYB 3S88L 4MVBD 4X6CF 2EKSA 3IVKA 1R5IA 3OAYK 2ZUQC 4JHWL 5J12B 1BVKA 3Q48A 3IU4L 3OJ2C 1S5IH 4KJPD 4FQHA 3RVXD 4LHUG 3X3FH 2HVKA 1BGXH 1UWXH 2PKDA 4KKLD 1LWRA 1BBDL 4WHCA 1FDLL 5E2TL 1CF8L 3UBXG 4TPRH 3G5VA 5E2JA 4BZ1L 1PFCA 4EVNB 1AHWA 4QRQA 1HI6A 1IGFL 5B39G 1ONQB 4OCRL 9CGTA 3VH8B 3QRFM 1NFKA 2KZ1B 3EOYG 5C71A 3VMOA 3BDYH 2HVJB 4BH8B 1YEHL 4WFFD 5KN5A 3TYFB 4S1RL 5CAYB 4OCWH 1MCRA 4EBQH 2BX5A 5D70H 3QH3B 4UT6H 5C0GB 4XAWH 4UTBL 3TLRA 4R6UA 2EEDA 4E5XB 3L7FB 2E7HA 2MOVA 2PYFB 3DUHA 1YEFL 4LOUC 2PR4H 4Y19D 1I9JL 1AE6L 4K3EL 2F8XC 3PNWA 1A4JA 5HJ3B 3BN3B 3OZ9H 1ZT1A 4ZD3L 2ID5A 1OB1A 3W0WA 4O4YH 5CEZE 1YMMA 4H1LH 4PJBA 4XPHH 3BGFC 4HUVA 5KVMC 5D6CA 2XWTB 4QY8A 3T0WA 3IDUA 3I6GB 3RGVC 5FGBC 4M7LH 1U91B 4OFDA 1JPGA 1KJ3L 3H3PL 5DRXA 4UB0H 4NCC1 4HH9B 1T04A 4Q74A 4WHTB 3E8UH 5E24E 1R24A 5DRNB 3NZ8B 4JANB 1XGYH 3REWB 1VFMA 3KLSA 5J89A 5DJDA 3TO4C 5FO9A 2IAND 5DUBB 1G7IB 1HDMB 4RAUB 4OF3A 3GMPA 1BM3L 3CFDB 1FFNA 2DQDL 4QCIA 1YN6B 4M8QA 4ODUA 4Q6IB 2K1MA 2VKXA 4V1DD 1NAMH 3LRGA 1B6DA 1FPTL 4ZPTA 1DBAL 3QEQD 1RIUH 5DJ0B 1TFHA 4D0CA 5H37H 3DGCR 4DAGL 1K8DB 5DS8B 4XMLH 3L5WB 3M45A 5ADOL 4ZFFA 4H0GA 2FGWH 5JHDA 5EUOB 4HIIB 4L4VD 3SKMB 5SWSE 5HDBE 4NT6A 1W72A 2ZJSL 5CJXA 3BZFA 3PDDA 3ZSSA 2XXMB 4MJ6B 4GMTH 2RAMA 4P4KB 1HXYB 4L8DB 3VWKB 4DKFH 2A1WH 4LVHC 3RHWK 1W72L 3LIZL 3I75A 1MFNA 2C3WA 4PG2C 4HWBH 3NA9H 3D18A 4U1NB 2O5XL 1VA9A 4ODWA 4LLQA 1UWXK 3PWJB 5F7LB 3TJHD 1C1EH 5FUCC 4WY7L 4ZQKA 4AL8H 2XKUA 1A3QA 2FJHB 4Y16D 3BKJH 1XEDA 4WHYG 3HE6C 5C0ND 3VFWA 3T09A 1VEMA 2WANA 1QNZL 1ZHKA 2XNAA 4OLZL 4OGYL 3RTQB 4F33A 3WNNA 4BELD 3ILQC 2EYRA 1I8KB 2VDLL 3UTQA 3S3JA 1Q94A 3RPIB 3TFKD 2P45B 4MXVE 3W9EB 4FN0A 5F8RC 1F11A 4JVUA 1QFUL 1SJVA 4HJ0D 4ZUWA 3F12B 1INDL 2FX7H 2IFFL 2YXMA 5SX4I 1RMFH 1L9MA 4BFBD 2J1KA 1ZLWK 1PGRB 4L3CA 5IEKA 2W9EL 5KG9B 3GSRA 3P0GB 1OGTA 4PRDA 2J88L 1MCEA 1WBXB 4QRPA 4OD1L 2VXVH 4FFZL 4TOYL 1LVEA 4YUEH 2YN3A 4P46A 4OJFL 3AMKA 4IRJA 2NY3B 1AI1L 4ORZC 3O9WB 5DZOA 4H1LB 4ORGB 4LPUA 1ETZB 3MLXL 4XX1E 4YGVB 5DQ9B 2FO4B 2AXFB 1R6VA 2BERA 3P9WB 3RWHA 3C5JA 3FFDB 2CUHA 1H3WM 3F7PC 4GBXC 4KJPC 4NN6B 2YD3A 3VFVA 3UBXI 2WBJD 1A7NL 4ZFGH 2I60H 1OLZA 3WSQL 2UWEB 4W4OA 2B5IC 4PRIA 2AV1B 3QFJB 4GG6F 5CFHA 4IMKC 2VZTA 4XNMB 4G8FA 3HAEA 4O9HL 1P4BL 5FGBA 2P5WA 5CILL 1JWSA 2DJ4A 3NIFE 1E0OB 3D87B 1T1YA 2PTTB 3FO1B 5MHSD 1CBVH 4GMSL 5DJCB 3U4BH 5A1AA 4TUJA 3I6KB