1P4BH

Three-dimensional structure of a single chain fv fragment complexed with the peptide gcn4(7p-14p).
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
112
structure length
112
Chain Sequence
DVQLQQSGPGLVAPSQSLSITCTVSGFSLTDYGVNWVRQSPGKGLEWLGVIWGDGITDYNSALKSRLSVTKDNSKSQVFLKMNSLQSGDSARYYCVTGLFDYWGQGTTLTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Variable light chain
publication title Directed in Vitro Evolution and Crystallographic Analysis of a Peptide-binding Single Chain Antibody Fragment (scFv) with Low Picomolar Affinity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 28
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2003-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p4bH00
1KJ3H 1T1YB 5AAWA 4LOUD 1ZWIB 2ZSWB 4KHXH 5DT1H 1BAFH 3K0WA 4YXHH 4EUPH 2IEPA 3IFNH 3E3QE 3QUMB 4J8RB 2EXWC 4L8SB 3VGFA 3H9ZA 5HVHC 2H3NA 5FYLL 4DZBA 4U6HA 5LGJA 2CO6B 3HUJA 3OAZK 1LE5B 1U95B 4NGHL 3W11C 1BD2B 4S1RH 2VZSA 2CJUH 2DQUH 3NPSB 4HWBL 1TTGA 3RA7L 4R4FH 2AJSH 1J0HA 3CK0H 4G8FB 5DGRA 3RPIB 1HKLH 2N4IA 4JRXB 5CWSA 5B39G 3S36L 4E41B 1KPRB 1HDMB 3DUUB 3VFMB 4B0MM 1QLFA 5HHPB 3R06A 4ONHA 4CU7A 4DUXA 1PGRB 1Q0YH 3KPRA 4HPOL 4V2BA 5AEAA 4I0PB 4NO0B 3EOBB 5IVXF 1FCCA 3SQOH 4CU8A 5T1KD 2ADFL 1R3IH 3DX8B 2BK8A 2XWTB 3PL6D 2YPLE 2IAND 3AC0A 3DIFB 1CLCA 1QSED 1DQMH 4K94C 4D9QE 4OZ4A 1I1AA 2NQCA 5E8NA 2VJXA 1EXUB 3MR9B 5IB1B 4D3CH 1GCFA 3B9DA 3K4ZA 5GRJH 3MRIA 1KXTB 2XXMB 1OW0C 2VAJA 4E42A 5FXCH 5DJ0A 1FVDB 1I9RH 1V7MH 3RKPA 1FL3B 1MCDA 4J12A 3O2WL 1UB6B 1JHTA 3DV6B 2WP3O 1AIFB 4DGYH 1FAIH 2ZG3A 3M17A 2BJML 2P8PA 4OI7A 2VC2H 3CU1A 4J3UA 5FGRA 5EZJA 1AGEB 1TCRA 5IEKB 4HV8B 1MCWM 2JTDA 3VFVB 4UBDD 2AEQH 3UDWA 3EO0A 3CUPA 4DAGH 4UAOB 4PJCA 4HIJA 1L0XA 4NN6C 4CW1B 1OAZL 3FFCB 3O4LA 3UYPA 5EC2B 3DVFA 5D7IB 1HI6B 1LK3H 5HYJB 3B2VH 3TYGL 4KUCD 3DYPA 4TVPD 1IQWL 4BQCA 3MRHB 1GIGL 2XA3A 4MDIB 1XF5A 4V1DA 4PTTB 2R2CA 1OWWA 4Q9CA 3KYKL 1RUKH 3QZWB 4LSTH 4MXWH 4KK9C 4OSUH 1G9ML 2SEBB 2R2HA 4EIZC 3GIVB 1JMZA 3VXOB 4PJ8D 4X7TB 2GK0B 5ID1A 5SWQB 1DTUA 4HD9A 3NGBB 4ZSOA 3STLB 3BH8A 3IJSB 3FO0L 4JY4A 1U2CA 2HFGL 2H9GB 1GGCL 5C08B 1NC4A 3MV11 2F5BH 3SKNB 4APQB 5IFJB 4LL9A 3DOSA 4QOKE 4LAJH 4O4YL 1DL7H 2ZCKH 3RWIB 3ECBB 3G6DH 5KSAD 3QO1B 1HKFA 4O51A 1FNHA 4M7JH 4OCXL 3T1FB 4RISL 1P4IH 1D5XB 4HAFA 1F58H 4V2CB 2W65A 2XTJD 1FIGL 1XGUB 3BT2L 1WBYA 4PB0L 3ARDD 4LP5A 3IFOA 5CCKL 3FHAA 5ILTL 5KJRH 3RU8H 1QR1B 3NAAH 1IKNA 3FQUB 3TLRA 3GJFH 4Z5RA 3NA9L 1M7IB 5I1IH 4LEXL 4Z6AT 4Y5XB 4ZS6C 1F3JA 4OKVB 3QB7C 1HZHL 3OQ3B 4JRYD 3MJ7B 1D5MB 2X05A 4C56B 4YK4C 4Y19A 1FE8L 1GHFL 2DM2A 4NJ9H 1SM3L 5D96B 1U8LA 2PCPB 2H2SC 4M1CD 3VG9B 1JHKL 2DOCA 3LQAH 2VITB 3VXUD 1K4DB 4P23B 2R8SL 3CSYA 5E8DH 5KBNC 4X83A 2A9ML 2W9DH 5E8EB 5GJTL 4QRRD 1CICC 3E6HA 1GGYA 1QFOA 4TTDC 3BZEA 5E2WL 4JEGB 2HA1A 5ADPH 3WEXA 4BQ8A 4IDLA 3R1GL 3ZO0A 1KTLB 1NMBH 2GITB 2BCKA 2EYTA 3VRJA 3P30H 1X7QB 1KJ2A 4W6WB 4ELKA 2BZDA 3GJFB 1YA5A 3LIZH 4X6BA 3KNBB 2MPAH 5FKAA 4JFHD 3VH8G 2YEZA 3BN9C 2M2DA 5F97E 2A9NL 1BWMA 3E6FA 3AXLA 4ZO7A 1YEEH 4K2UH 1S7RA 1TZHB 2X10A 2EDTA 3K80A 1BQHA 4UOW1 3PP3H 5DTFB 4LPTA 4XTRD 5KS9A 5I9QB 4L8BB 1WWAX 4XPHH 2HJLB 4OZIE 3WJJC 2CIKB 4ZYKA 4C59B 2EH8L 2I5YL 2ZUQB 5FGCB 4AL8H 4U3XA 4ONHB 5F1NA 5BJTA 2BVOA 4KVNL 4XWGH 2I9TA 4JM2C 3RWCB 4IIQC 3S3JA 4TVPL 3QIBC 1M1SA 1NLDH 3PXHA 2D4DA 3FT2A 3K3QA 3QQ4B 3NCJL 4M6AA 4OCRL 4Y5VA 5ENWA 2H1PH 3DX9A 5DMIL 3N85H 3BP6A 4JKPH 4Z7UE 3ETBF 5BVJA 5I2IB 3U7YL 1K9TA 3NTCL 5F9JA 1NAML 3DWTA 4LHQB 1FZMB 1FNSL 3VU2A 1NGXB 1QVOB 1U3HC 1YEDA 5IVXA 5D1QA 4GMTL 4MA1C 3KXFE 1JI1A 3AGVA 3P4NA 3RWJB 4LF3B 1FQ9C 3TIDB 3CFKB 2Y7QA 2CQVA 3WO3B 2XG5A 3MCLL 4QRTB 1XF4A 3SKUD 1S7SA 2QBWA 4P5MB 2BHYA 5DF0A 3SKOA 2ED8A 1PQZB 1ZVYA 5GGVL 4MX7B 2NXYC 1T0PB 8FABB 1NUDA 4Y1AA 2AEPL 3QFDB 4NQVB 3I84A 3O3DB 3OHXB 1A6UH 1ZSDB 3KR3L 3I02A 3C5SB 4U0QB 3CUPB 4QY8A 2O5XL 4PP1C 3KJ4B 4PJCB 4QNPE 4CL7A 2C7UB 1MHCA 4OJFL 4I0CC 1Q0XL 3QZWG 3GSNA 2JF1A 2R4RH 1OAZH 3GMOB 3CIQA 4TNWK 4XXCC 3AVEA 1KNOA 3C9NA 5CD3B 3TYGH 1BGXL 5FM8A 4JO4H 2AQ1A 4OCYL 5FUCE 4ISVA 4XXDA 2EIZB 3JV0A 1XF3B 1XF5B 2IG2H 4V1DB 4Y0GA 2V9RA 1LO0H 1JWMA 5DHXB 4WNQA 3WKNA 3S88L 1WIOA 4CVZA 2ITCB 1J1XL 3U0TA 1X6NA 2EDKA 5E99L 3FMGL 3PDOA 4AG4L 2AABH 3T0DA 2DI7A 4P3DA 3OXRA 1NCBL 1S9KC 1NMAH 1EA9C 4NWUL 4KMTH 3TA3D 4JY4B 3ZDXF 5IP4A 2VABB 3HPLA 2HFGH 3RZCD 2VE6A 1IGJB 4IMKA 5JHDB 3MRCA 4YXKH 1W0VA 1DFBH 2P5WB 1MJUH 3VA2C 4LU5H 4JQXA 2HT3C 4ZO8A 4BQ9A 1EX0A 4X7FC 3IDGA 1A7RH 3MACL 4YUEH 2FECI 2DBLL 1BEYL 4HUVB 5K59E 1EUUA 2FBOJ 4NQDB 3QEGL 1F3RB 4OZIF 1G7IA 4OCXH 5IUSA 4U1SA 3U7WL 5C0FB 4PJIB 3X3GL 2DB8A 1Q9KA 4URTB 2BMKA 5GS1B 4PREA 1DQJB 1DVFA 2ZOKA 3UAJD 4P5KA 3KPPB 3ZKSD 1IARB 4LLVB 1IBGH 1KJ2H 2NY6C 2R23B 5MHSD 1UWGL 2VLKE 2A1WH 2EKSB 2XFXB 1I1FA 4YDJA 5GRVK 5L8LB 2NY3D 4M3KB 1HYRC 1MPAH 1Q1JL 4S1DD 5AYQA 4XT1C 4XCEA 2CUHA 3V5HA 4Z7UF 4OQTL 4LHUD 2KKQA 3G5YA 1J0YA 1JK8A 1V5JA 3OKLA 1U8LB 4L3EB 1MWAB 1KCSH 5CP7A 3ARFA 5ETUA 3OBAA 4POZC 3CSYB 2VXTL 2N7AA 3MCKA 1KCUL 4M8VA 2W38A 1F4WL 5IBUB 3E6HB 3I3DA 5GRWA 2WK2A 2X1XR 2YPLA 1RUQL 5D7JA 2WLYA 5DJ6B 3MODL 2V2WB 2QSVA 4L8CA 3VD7A 2P5EB 3CFIC 4XAWH 3BKMH 4JG1L 3H0TA 3R1GH 2EYTB 3VRJB 4MJ5A 3DMMD 1FC2D 4KRLB 1BECA 4FOMA 2A6IB 1NLBL 1PAMA 5I1DB 4RX4D 4NM4L 4D2NA 1BBDL 3B8YA 5A16A 2IALB 2CMRH 1JNLH 4QNPF 3G9AB 3OV6A 4XI5D 2HN7A 3CMOL 4ZNEE 5DQJB 4OLXL 4OQTA 5HGDB 1MVFA 4BSVB 1BFVL 3DO3A 1U0QA 2GUOA 2MFNA 3LSOB 3S4SB 5K33A 4CNIB 2C3XA 3PHSA 2ATKA 5F6IC 3HFML 1R24A 1O5DT 2Q7NA 5I8OL 4P46A 5F1NB 1LEKB 2BVOB 2FL5A 4ODXB 1MAMH 1IAOB 4TSBL 4J4PA 1UKTA 5ID0B 4A6YA 1T22A 2DTMH 2FJFA 2ERJB 1A14L 4XPBH 4PRHE 3BWAB 3DX9B 1G6RL 2XZCL 3LRSA 4XMLH 3WDHA 4KZDL 5IG7A 1MCEA 5CD5D 3WS6C 3GSNH 5CGTA 5F9JB 1NAMH 4YWGL 4XH2A 3GJFK 5DQDH 1HSBA 2I26N 5DJAA 3LPFA 4P0DA 5DK0A 4YZFE 1DBKL 4GMTH 2CDFA 1QKZH 2D3VA 2EXYC 5EZOL 4YHZH 5BV7C 2D0HA 3WFBH 5K59F 1FJ1A 4G43B 5H8DA 1JNNH 2IBZX 1A4JB 2WBJC 3HKFA 4QLRA 3IFPA 4LSUL 1W2KT 5L2JA 4HS8H 4DQOH 3N0PB 3ZTNH 3MXVL 5LWYH 4QOKA 3P4MA 4YHNA 4U1KA 5TE7L 3UZQA 1WQVT 3I02B 1CGXA 4TSAH 4YDIH 2O5XH 4ZFFA 4TULH 2DQGL 5I1JL 1OT2A 2CLRA 5FHAH 2UYLB 3UPRA 4ENEC 4LSQH 4ZUVA 5GZND 1AGFB 4BA8A 3SDXB 4ZD3H 3TJEH 3SE9L 4WNQB 4M61B 3KPLA 1TTFA 3RTQD 1P4BL 3BVNA 5EB9A 4FQLH 1AHWA 4L29A 4OCMC 4EVNA 3IF1B 3PP3K 4HKBA 1K4CA 3BD3A 2ICES 3PGCB 1IZJA 4RGOH 3O8XA 3U30B 2D31B 4X9GA 1X5JA 1UM4L 2MMXA 4GLRH 4NUGH 4LPUA 4DWHA 3CFCL 3ARED 3WSQL 1KBGL 3L3HB 5J12B 3ARGC 3V8CA 1H3VA 2ZUWA 4WFGD 4EDWH 1OAUH 5JTWA 3VRLE 1IGTB 5KSUB 1HXMA 4R9HA 5JA8B 3T2QA 4M1GH 4N90D 1DQDL 1BEYH 1CL7H 1G7IB 3M1BA 5JLZA 3FQXA 3GI8H 4X7CC 5DD1L 2RFXA 3ELAT 3H9HA 5E8OA 3U7WH 3S5LB 4M02A 1Q9KB 2C4FU 3O3AA 4WI4A 3QUXD 3O2VH 2B8OT 3T0XA 1NEZB 3IDYB 2AJ3B 1VFAA 3H3BC 3A67L 4P5KB 3VWKD 2BVPA 3LEYL 5KTEL 4AIZB 3U4AA 3OPZL 2AJYL 1R5IB 3B9KC 4MGXA 3GNML 2VZ3A 2Q3ZA 5ACMA 1J0ZA 4H1LB 4YDJB 3X12B 4HH9A 2BDNL 3OKNA 5IBUG 4OZIA 1L9MA 2EH7H 4KI5C 3TEUA 3GIZH 4OZFB 1MSPA 4KMQA 5IM7A 1Q1JH 5I66A 3BYYA 3O41A 1SEBA 3G5YB 1FNAA 3OKLB 3V6FA 4OQTH 3TT1L 4JPIB 2YD9A 1KN4H 3ARFB 4JM4H 7CGTA 4FFWD 3BZFB 3MCKB 5FYKU 4YZFF 2VXTH 1ES0A 4OD1L 2GSIB 3O0RL 4F7CB 4KTEH 5ISZB 1BD2D 2IADA 1JZ3A 1I3GL 4NFCA 5HGAB 3P0GB 5GS2D 2AKRB 1IEBB 4PGCB 5D2NC 4B53A 5IT2L 1MJ8L 4JRXD 3OR7B 3OF6A 4E41D 4LLAA 1S9WB 3I3BA 3IFLL 3I75A 2XZQL 3VFTA 4HFUH 3S4SG 1CL7I 4HEME 4YH6A 3KXFA 4A6YH 5BS0A 3LKSB 2IF7A 4WW2F 5A16B 4TUOB 3TO4B 4LLQB 4I0PD 4NO0D 2EDRA 2YPVL 5ACZB 5JW4M 2E9IA 4M6ML 1RK0B 3WHE1 5JW4Q 3LPWA 5T3ZD 4ONOA 2Q87A 1D5ZB 2ICEA 5L88H 2F5AH 4JZOA 5DJXA 3OZ9H 3SEPA 2H8PB 4P2CG 1KB5L 2N7BA 5DWUL 2IBBA 3O9WC 3IVKA 5JW5A 3L3KA 5E08L 1T21B 1C08A 1OLZA 4MA1B 1P7KA 1N0LA 1FFNA 1LNUA 2XICA 2Q8AL 4ZQKA 5SX4H 1T22B 4PJDE 2C1PA 1SQ2N 5KANI 1DSFH 3T3PF 3D0VB 1CD0A 3I2CL 1RU9L 3SGDH 4HMCA 2FSEB 1QLRB 1UKSA 4Y2DA 1MRFL 2XPGB 4LARL 4WI8A 3VRLF 2B20A 3NN8A 4PBWD 2ORBL 3FFCD 1GPOL 3OAUL 1A0QL 1HHGB 3SQBA 5DFTA 5HYJD 1RULL 4O02L 1E4XL 1FJ1B 2ED9A 5LJYH 2VTFA 3QHTC 2A6KA 1FV1A 4JPKH 4GG8A 2X40A 4K8RH 2V7HB 2B2XH 1VFUA 3HR5A 5HPMA 1E4JA 1VA9A 2YXMA 1A21A 4YGVB 4HH8A 1SYSB 5EZIL 1G7MA 2P4AB 3TZVA 4Q0XH 4NO5A 1T1ZB 1MRCL 3ULVE 5D5ME 4GRLA 5B3NA 3NFNA 3CLEL 3W9DA 4ZFFB 1NDMA 1V8HA 3OG4B 4P2OB 3ILQD 2DQGH 1VFMA 1D6EA 1VEPA 1A7BA 3VXTA 1BVZA 2AXFA 3OWEA 4K7PX 1MFAL 1NDGB 3H7BA 5SX4I 1YEIL 1QG3A 4JFEE 5JOPE 4L4JA 1U8NB 4APQD 1U8JA 1K2DA 2VLKA 3EHBD 3QYCA 4MDJB 2IMNA 2XRAL 4KFZC 4WI3A 3D18B 2RHEA 3MA9L 4HKBB 2UY6A 2A6JA 2KZ1B 4LCCA 2B1AL 1RZIB 2FZ3B 2QADC 1H0DB 1DUZA 3IDIB 2WZPD 3CVHB 5E56A 4MD0B 3H9SB 4UB0H 5E9DA 1NGQH 2I9LB 2DTSA 2QEJA 4FFZH 4JPWH 4X99B 4RNRB 5DC9B 1B2WL 3WSQH 4HSQA 5IF0A 3QDJE 2A83A 2H32B 5CZVL 1I1CA 1XIWC 3MZTA 3FO1B 5K9JL 3S5LG 4TVSa 5C0DA 5FFLA 1LP9E 5DD5L 5DJCB 5HHNB 1NEZG 2HT2D 2NY6B 2X4NB 1A9BB 4G42A 5I19L 4HFWA 4C56D 1FAKT 4G6MH 3UTSB 5JLZB 4JQVA 3V6ZA 4P3WA 2EDOA 3FN3A 4H1LG 1TVHA 1C5BL 4ZTPL 1PZ5A 2GTWA 4P23D 2IWGA 4N1CA 3QO0B 5C92A 4OZFG 3MYJA 5IVZA 5T3ZL 4O5LH 1XEDA 1VFBA 1G7LA 2FX9H 2XYCA 5IESH 4MJIB 4R7NA 4K55A 4X6CE 5TDPA 3OPZH 1MVUA 4MCZA 4PJDF 5ICYB 4PJ7E 1AQDB 1A6PA 5IM7B 1E28B 1JPGA 2Q1EA 3GJEA 3HS0B 4U1IA 1XR8B 2PTTA 4WFED 4YE4H 3CU7A 1FFPA 3P77A 3KPQB 3J7HA 3X13A 4NP4L 1ES0B 3TBWB 4X6DE 3T65B 3X11B 3VXRE 1FFQA 2R0WH 3EYVB 1PY4A 1CFSB 4PRHA 4PBVC 1DCLA 1I8IA 4Z7UB 1UJ3C 4IOFC 4XCYA 3QCUH 5TQ0L 1I3RA 2XA8L 5EUOB 4H20H 3QG7L 4AMKH 1MOEA 2I25N 4YQXH 3QUYC 5JW3L 1I3VA 3KXFB 5FYJE 3SPVA 1G7JA 4CBPA 3V7AE 4KJPC 1A6ZA 3QHZH 2ED7A 5D5MF 4DK6A 4XBPB 3ULVF 1I8KA 4XC1L 3TCLB 3GSQB 4F8TA 5FO8A 3P73B 4PB9H 4JZOB 5GRVL 5DJXB 5DFVD 3G6AB 2LV4A 4WW2A 4Q9RH 1HK6A 3NFPA 4LVNB 5JW5B 1MAKA 3BSZH 5FK9A 2I07A 3P9MA 3RUGB 4QXGH 2NY0B 1P9MA 4JPVL 3BP7A 1WEJH 5T1MA 3S3PA 4TQEL 5F96L 1OTUD 1HQRB 1VGEH 3QR2A 2WUBL 2G5RA 35C8H 1U41A 4GW1B 3RVVC 1IEAB 5GHWL 1S8DA 4G80A 5B38A 3S34H 4P59H 1KCVL 1LP9F 2OI9C 3NN8B 1RMFH 3ARUA 1NFKA 3GO1L 4G8EA 3V4UL 1B6UA 5BVPL 5IKCA 3OAUH 4F7MB 1BX2B 5DZOA 3RVWD 4ZFOA 2KDGA 1BJ1J 4GBXC 4ZOAA 2E8ZA 1XFPA 4OLWH 1Z6JT 2FNBA 2F58L 4ZXBC 5HPMB 1KN2L 1AGBA 3MBEA 1A7OH 1CDIA 1GZQB 4MA3B 2Q86B 4C83B 3VFRA 1FVCB 5J11B 2MWCA 5I15H 3HZYA 1G7MB 3TZVB 2KBGA 1MUJA 1I85A 1U8QB 3NFNB 4EOWH 2ZNWA 4NZUL 4JFFE 1EK3A 3CLEH 4X4ME 3F5WA 3QIUC 4QRSB 2I60L 3VXTB 3JWDC 1SYVA 4LLDA 4JHWL 4H8WL 1KJVA 3H7BB 1RUML 4S2SA 3P0VL 4NNXB 3C6LC 5C0CE 5JHDD 4ETQA 4NNPH 2B1HL 1MFBH 2P5WD 1K2DB 4U7MA 4BKLA 4X6DF 2VLKB 4UDTB 1EH9A 3V6OC 3LCYA 4KXZH 1JPTH 3PJSB 4KJYB 1CDHA 1WISA 1TJIL 3RDTB 1DN0A 4NQDD 1DUZB 2NXZC 3MRNB 4P57A 2E3VA 4F9PA 1LDPH 3C2AL 4X9FA 5J9PA 1MFEH 2F9BT 5AD0A 3OGCB 4D9LL 4MNQE 2A83B 3I6GB 1NBQA 3IXTA 2AV7A 2I24N 5IMLB 3QWRD 3MLZL 4F57L 5E03A 4HWEH 3IU3B 4R4NC 4XX1E 4OI8A 2XI9A 2WIIA 3FJTA 1RIVH 3G08B 1BF2A 3SDAB 1OB1A 1QYGL 3BWUC 4LVEA 2AK4B 3NCCB 2YOCA 4L3ED 4Q7DA 2D4FA 1PZ5B 3RKDC 1N64L 2JJUA 4P4KB 2IBZY 1C5BH 1FYTB 4BUGA 1S7TA 1J87A 4NUJB 4R4BA 1NC2A 1AXSA 4OV5A 2BNQB 1S3KL 1REIA 4NHUB 4LSPL 5TDPB 1MVUB 3W11D 2P5ED 4PGJA 4MCZB 4FQHA 4OFYD 3TP4A 4MNGA 2GQHA 5BW7C 2HRPH 2GW5A 2BNUA 4OFDA 4DK3A 1NGYB 2GJ6E 2XQBL 4LPCA 1F97A 3GJEB 4I3SL 3IS1X 3MREB 4UNTA 3VGGA 1PD6A 4ZS7H 2PTTB 2WSKA 4DKFL 1D5BB 4I77H 3N1PC 1EGJA 5D1ZC 5KSVA 4Z7VE 4F80A 4FQ1H 4OGYL 4X7DC 4WY7H 4PJDA 1KEGL 1EEYA 2YS4A 3V6BR 2ZOLB 4XVJL 2Y9RT 4X4XB 3LV3B 3QPQD 4LAQL 4KPHH 4M7ZC 1NMCC 3QG7H 5D9SB 4FQQB 2NW2A 4YHYB 5EBGA 3SPVB 3IETB 3K2MC 3BIKA 3O4OC 2ZUXA 5D6CB 5JXAH 3MMEA 2E9WA 5JDSB 3V0AC 4OZGB 4HQQL 1A6ZB 3FFDA 3RGVA 5C7XL 2CO7B 3NBNA 4ORGB 1U8MA 3FOMA 1G0YR 2VL4A 1SBBA 4HDIB 1F6AA 1AGCA 3RP1A 5FA3A 3PP4H 4P99A 5KSBB 1RJLA 4N5UA 3OB0K 1CLOL 4MCYB 3PHOA 1IKFL 5LBSL 2MCPH 3MPCA 4OUUA 5D5MA 2Q8BH 4YJZL 2FECL 1GAFL 5DRZA 4FABL 1TNNA 4EXPX 1KXVC 1YC8A 3BP7B 1HINL 4JDZA 4UT9L 4UU9B 3E8UL 4JDVA 5DJ8B 2VLJE 4JFEA 2J88H 1QA9B 2WWMD 4FQJL 5BRZE 2DI9A 3QCVL 3ZL4H 1BJ8A 1BPVA 2XZZA 3MRKA 3C60A 5D7SH 3JBG7 2K7QA 1S8DB 4X8JB 2VB5A 3STZB 3DETC 3WNLA 1QBAA 4WIQA 4KKBC 2BNRE 5HHVH 1O7VA 4FQXA 3GO1H 1IT9H 3VFSA 2FEDC 4PRNA 2NNAA 4OFVA 3GHEL 3TWCL 3KWWA 5GZOC 1RQ5A 1S78C 3LS4L 1DQLH 3TVMA 3KLAA 5F21B 1U91A 3PWPE 1EFXB 2PYEA 1B0GA 4IRZL 5SX5H 1BZ7A 3H6JA 4PRPB 3O2DA 1LP9A 1WV7T 3MBEB 1VKXA 2R29H 4EI5B 3W39B 1T5WA 4QHNB 3RIAK 5INCB 3W81A 1MUJB 3TT3L 5HHOA 4F3FA 5F72S 2X42A 1MWAL 1NUFA 2QADB 5J06A 1FL5A 4PJXE 3DPBA 2JKXA 2Y06L 3LY6A 4WJ5B 2MQ0A 5F9WB 3ARRA 4S2SB 2E6QA 5GS0C 4RGMC 4RWYL 1WBZA 4M48L 5CIPA 5E0QA 9CGTA 1WWCA 2OL3B 1EHXA 2F53E 2MTPA 4JDTL 4MNHB 5HI5D 1J88A 2Y4SA 3D6GA 4YHLL 3NFSH 3O11B 4A2LA 1DN0B 3PWLB 3FHQA 3QDGE 3C8KB 1IRAY 5IROA 5IB2A 2Y72A 3SDDA 5EU6E 2VL5B 4O2CA 2A74B 1QPXA 2PYFA 1LEGA 3QUZA 1S7UB 3RWFA 3V4VL 5J9PB 1QD0A 1QNZH 4Y16B 2V5SA 4P49A 4D9LH 4X6DA 1MCJA 2WLZA 1UH2A 2IFFH 2VWEE 5SWSB 2W91A 3MLZH 5DO2C 1P7QB 3QNZA 1FH5L 4IHOA 1KC5H 1EPFA 4K94L 3N1MC 2PO6C 2IGFL 3NCYP 1MQKL 3QI9C 1GGBL 4ZDHA 5D6DC 1EGJH 4JM2F 2YD3A 1AP2B 1JGLH 2VXQH 3ARFD 4M03A 2YZ1A 3QEHA 3IGAB 1B0RA 1YEFH 3K7UA 4RFOL 4P5TC 4OGXL 3EDDA 1T1XA 5ISZD 4GQ9L 4DN3L 3O3UN 4OGAD 3TBYA 1XGQB 1C12A 4HF5H 4D9QD 3MBXL 1S3KH 5CMAB 4LSPH 1AD9B 1UT9A 1MH5B 4EN3C 1HXYA 3MV01 4ONFL 4ZFGH 2D2OA 4LLYA 5IBLC 1I7ZA 3S37H 2XQBH 3TC9A 4I3SH 5K9OA 3ULUE 4LEOA 1LO5A 3TO4D 1N5AA 4K7PY 1NKRA 5L2KB 1IL1B 1V3MA 5TDNB 1DJSA 3UBXA 4PJDB 5GGUA 4OGYH 4PYGA 3PWUA 2X09A 3SKMA 4XVJH 4JFOA 3TV3L 1UCTA 3UYRL 5D71L 1Q9WA 5DGQA 2GKIA 5KAQG 3LKOA 2LTQB 2QQQA 2A73A 5L8JB 3NCEB 1PFCA 1S7WA 2W9EH 4OGZA 5EUKA 3RBSA 4MLSA 4U0RB 1IC7H 2D9CA 1L7TL 1FN4B 3MMEB 2OLDA 2XN9E 3QWOA 2FCBA 5MEOA 1E6JL 3NCFB 4WHDA 5DR5H 3ZTJG 1FYHB 2X70A 3D5OF 1KB9J 4WHYH 5DEZA 1J10A 5F70A 2JCCE 4PJXF 3OXSB 1ZS8A 5CJQL 2YSSA 1T0NA 3ARBB 4PRDB 5HPOA 5JO5A 4L3AA 5I71B 4IM8A 1RJLB 1BZ9A 5KVDL 3BISA 3PHOB 4BSWA 2GHWB 4K3JL 5DRZB 2OI9B 4XPFL 4XPTL 1KGCD 4X4MA 4FABH 5C07A 4NN7C 5TQ2L 4JDZB 1P4LA 4MMXC 3O2DH 2R69H 1YQVH 3MROA 3MLUL 3VFPB 1OGAE 4NN5B 1NL0H 5GPRA 2HLFC 2K7PA 1L6ZA 1PG7H 1WZ1L 5CSGA 4DOHE 2V2XA 4F2MB 1CBVL 4LFHD 2YA2A 1BQSA 3W2DL 3IT8D 4DGIL 1EAJA 1FLRH 1V3LA 2E7MA 5T1DL 2YC1A 3VFSB 3HNVL 4P2OD 3MV8E 5J3HC 1ZTXH 5CIPH 4AENA 3T0EC 2ADGA 5DQ9B 4G7VL 3HE7C 1RIUH 3QDJB 4MNQA 4ZMAT 3LS4H 3HI6L 2JELL 4MQ7A 1U91B 1B0GB 5DURB 1L0QA 2A77L 5DUPL 3AS0A 2DQEL 1H3UA 2UVEA 1EERB 5CJ8A 1N7MH 3RWDB 3JTSA 2LVCA 3VMOA 1MIEL 3MRBA 4OD3H 3MV9B 3D69A 1ZA3B 1NCTA 3TT3H 4M93C 2VDPH 3H9SD 4JHBA 1W8OA 1YZZA 2NXZB 3GM8A 4FXGB 4G7YH 4IRSC 4KTDH 4RGNE 4W81A 5EC1A 3G04A 4R90H 4X80L 3SBWC 3AAZA 3T77A 1RZFL 2UUDH 5CUSL 4G6KL 1VACB 2YN3A 4TRPL 3ULUF 4KAQH 4LPXA 3FB6A 1VGKA 2AERT 5CIPB 4CVXB 3VFNA 5FECA 4X6CB 5GS3A 4Y4HC 1H3TA 5FYJH 4JDTH 4PJ7B 3F12A 2NY6D 4LQFL 4EI6B 2VXVH 3CGTA 1S5IL 2IAMC 2OXHA 4YHLH 3UTSD 4KUZH 2GJ6A 1CICA 2DWDA 3QP3A 2WINA 3CZFA 4G8IA 1DLHA 4L8DB 3QUZB 4XNMB 2ADIB 2ZCLH 2VDLL 3WJLA 3V4VH 4AEHL 5CEYB 1P84J 1W72B 2APFA 3VXRB 1KELH 4GT7A 1EVUA 5TH2B 1MNUH 4MJID 3QXDA 4PRIB 5I1AA 3QNZB 1A6WH 2V5TA 4IHOB 4TPRL 2FYYA 3JWNC 5JXED 4LCIH 4N0FB 3U36B 3FONB 1F4XL 5KVFH 1U8KA 1T2XA 2WUCL 5I16B 2JCCF 4K94H 2FGZA 3CH1B 5HDQH 2E9JA 4ZDHB 3H42H 1ZHKA 2DYPB 1CTNA 1GGBH 3MNZA 4NFBA 12E8L 3HZMA 4LVHB 5FGBC 2E7HA 4NKMB 1I7UA 3QFJB 5EBLB 5FUZH 3L3IB 3Q6FB 3RAJL 5TDOA 2PF6A 4GMSL 4PLKC 1PJ9A 5CGYC 1OSPH 4X4YB 4LSDA 3WFDL 4OGXH 5C8JB 1XGTB 3NIGE 3GBLA 4XBGA 2VXSH 3VFOA 5GGSY 3GK8L 4JM2A 4WGVB 5GGTL 4IIQA 4JANA 2YMXH 3B5TA 2IJ0C 5SX5K 5DD6A 43C9A 1JP5A 4M7ZB 5J6GB 5BMFL 3UTTE 3KXFD 2CK2A 4L4VE 4Y4KB 3HCVB 3PWJB 1Q9LA 3CXDH 1LO5B 1ORQB 4NBXB 5D2NE 4JZNA 4HW6A 5IMOA 4P3CH 4PJHE 1KIPA 3EJZD 1U42A 2ZKHH 3O45B 4Y4FC 3PWUB 2VLJA 2P43B 2NLJA 5I8CA 4NQCE 5BRZA 3EBAA 4Z77A 5HYSB 3C5JA 3X3FL 4JG0L 2HKFH 2VDQL 5HJ3A 1M7DA 1DUYA 5DRWA 2J8UB 1B90A 1BIIA 2BNRA 1F4YH 3QXAB 3UBXI 4F7PA 2NY0D 3ZKND 4F7TB 5MEOB 2CLZA 4U4BA 4OBRA 1E6OH 2KQMA 1CN4A 4LCWE 3VD4A 2WBJD 4QHKI 5FKPA 5JUEH 4QCIB 4OF3A 4XXCA 4ZTOL 3BZ4A 1N4XL 2DQJH 4PFEA 1YY9C 1S7XB 2EZ0C 1MCOH 3MOBH 4WO4B 3MLRH 1INQA 3EUUA 3CVHL 1N0XH 4L5FH 1T6WA 1ZXQA 5C1MB 4C58B 5CEZL 4JFFB 1NAKH 1A4KA 1QFWL 3LKRA 4G6JH 4OKDA 3RVTC 1AJ7L 4WHCA 4MXVE 3CLFL 3WO4B 3MROB 1AGDB 1DBJH 3IDMB 3UO1H 1MIML 1JMXA 1NCDL 4JREB 5C0CB 1HCFX 5IBTL 1HSAA 5LGKA 2F53A 2DWEB 2EYSB 5E5MB 2NX5E 2B0SL 3BPCA 2V2XB 3X14A 1WZ1H 4OF6A 3BP5B 1FG9C 5E00B 5ERWA 1FG2A 3UXFA 2R1XB 3TZVD 4IJ3B 3QDGA 1VADA 1AO7E 1FNFA 3KYOB 3PHQB 5DRXB 2YC1B 2H45A 1YMHA 2JB5L 1XCQA 2ZSVA 3P4LA 4BK4A 1KT2A 1MRDL 5D4QA 3JVGA 5D93B 3HNVH 1I7TA 1JGVH 3HN3A 1CD9B 3MUGA 3QIWC 4MNQB 4M5YH 1D5IH 5E2VL 2Z0BA 1E0OB 4ODHL 1RJYB 3D39D 4KI5F 1INEL 2DQIL 3GHBL 4B7IA 5GSRB 4LOUC 4R97C 2WV3A 8CGTA 3JTSB 4GKNA 2NTSP 5DUBA 4JKMA 4CN4A 3MRBB 3TFKD 3NIGF 3RDTD 4PG2A 4N1HB 3KPTA 4YFLF 1UCBH 4HXAL 1KFAH 2LU4A 5DHVA 2VDRH 1NGZA 4XAKE 1VB9A 1V7NL 4QRPE 2VR5A 3T77B 2NYYD 1EVTC 5FF6B 5IMKB 3FB6B 4LPYA 4WGWB 4XP9L 1QBMH 3VRIB 4PJHF 3MNVB 2EC9U 3BE1H 3R4DA 2AJXH 3SDAD 4LQFH 4S1QL 4XNZB 3KDMA 4QF1A 2AK4D 4U1HA 3PL6C 2DWDB 3TBVA 2WINB 3VFUB 3CZFB 4G8IB 4YAQA 1DLHB 4X8XA 3L3DB 5DHYB 3VJ6B 4I13B 4P4KD 2QTEA 5FO7A 1UQSB 3LKPA 2VDLH 1FYTD 3NH7H 1JZ7A 4Z7VB 4UV4H 4ZOBA 2X4QA 1DEEB 1BVLB 2F19H 5FO9B 4HIXL 2BNQD 1CLYH 3QXDB 4KDTC 3V7AG 3HZKA 1LILA 1ZHNB 2R9HD 2YD5A 4KROB 4TPRH 4D0BB 1I7RB 2ESVE 5FUOL 1XH3A 1DLFL 3MNZB 3HE6A 4OZHF 4EN3B 4P9HH 3EYSL 2Z4QB 5C0GA 1I7UB 12E8H 4KY1L 1C7TA 2VZTA 5L0QC 4UBDC 1ZHBB 5BV7L 4M43H 4P4RB 1CQKA 3SDCB 2EYRA 1OPGH 4GAGH 2JCCA 3WFDH 1KLUB 1QLEH 4MXVF 3WYRA 1R3KA 3P3YA 2CIIA 3U9PL 2O5YL 1VERA 3UBXG 4J6RH 1UG9A 4HIHB 1V3KA 3OKOA 4MA7L 2MHAA 4Y8DC 4MLIA 5HYSG 5IW6A 4JZNB 5CBAA 3DRTB 3WS6A 3RIFF 1ZEAL 4MHHI 4LSSL 1QSVA 1BFTA 4GKZB 3EDKA 5DVNA 1CVSC 2OJEA 2APWA 1OP9A 3C08L 3HZVB 4CADA 4JVWA 4NO3A 2ITDB 5HJ3B 4M6NL 3UJJL 1M7DB 4J3TA 4GW5B 5CKGA 1T04A 5F6HJ 1EHNA 3REVB 2BVQB 2IH1A 1H15B 3CDFA 4O2EB 4QYOB 3P0YL 2B4CC 3BIAX 4JR9L 4DKEL 3L1OL 4TSCH 1ZT7A 2FWOB 2J12B 5F7YC 3HI1B 1J05A 1DR9A 5KSAC 4FZ8H 5F7DA 5A3IC 4EQ2A 4KK5C 3PWPB 1XF1A 3THML 1U6AH 1ZLWH 3PWVA 1IGCL 2XTJC 3O3BA 1J1OH 3OKEA 5I1LB 3D2UA 4DEPB 1INQB 3DGGB 4H5SB 2X9YA 4OIAA 4UIMA 1WWBX 1KG0A 1A3RH 5JIIA 2FX7H 5CEZH 2ICWA 4G9FA 4ALAH 4PJXB 5D2LF 3MOAL 3MLTB 1LGVA 4WCYH 5AZEL 3DXAE 1EFXD 5EO1A 2GJZA 4OLEA 2J4WH 2XG4A 2FX8H 4PRPD 3B3IA 5IBTH 3C6SB 3ZE0E 2ARJB 1YDPA 1NCAH 2VXUH 3TYFA 1ZVSB 4EI5D 5DHVH 1IVLA 1MY5A 5GGRA 4NRZA 2AI0H 3ARGA 1IAII 5MEPA 2BRRL 4XX1G 2ZSVB 5IJVA 5EU6B 1NFIA 5DS8B 5J1AA 2DQHH 2QADD 1B4RA 1A1MA 1YPZE 1TCMA 3RL1B 2K1MA 2EDDA 4L9LC 1W0YT 2VIRA 1T7WA 1ZGLB 5KN5A 3CCHA 4TOYL 3H9YA 4HKJA 3TESA 2HFFA 5DUBB 2ENSA 5ADOL 4IMLA 3ULUH 3FT3B 2X4TB 2GY7B 4HUXA 2VRAA 1TZIA 2HYMA 5F6HI 3VXME 3GSWB 4GXVH 2C3HA 2DLHA 4TUKL 3O6LL 5D7LB 5JMOC 5E4IA 4M8QA 4HJJH 1DBMH 3B9KA 1D6VH 1HYSC 2JK5A 4GUPA 1KIRA 4Y16D 4M5ZH 1V7NH 4Z9KB 5T5FH 3F7RA 3MFFB 2OJZH 5SWSD 2DLGA 4XP1H 1SBSH 2EDQA 4ZPVA 4I3RL 4M9OA 3FQWA 1P7QD 3UJIL 3MRGB 2GYSA 1OD9A 2XXCB 3L3GB 4Z0BL 1X5GA 4M9PA 4U1HB 2OTWA 1MFDH 3ARXA 4MA8L 2FD6H 1NCCL 3I50L 3UTTA 3KHQA 4L4VA 3IDXH 1JNJA 1IGIH 1TETH 1TQBB 1R0AH 4XVTH 3LKPB 4K3DH 5D2NA 5I73C 1RHHA 1ZOXA 4WI5A 1T89C 1MCPH 1TIUA 4PJHA 5F7WC 4JFXB 4YGAB 1J8HE 3QEQE 3A6CL 3JXAA 3F8UB 4XCNA 3SE4A 5TFSH 1CD8A 1H9VA 4I1NB 3ESVF 4GS7C 4HUUB 5GSVB 4KHTH 5DEGA 3MRRB 5C09E 1PSKH 2J6EL 1BFOA 2X9XA 3MGOA 2V9TA 1P2CB 4Q6IA 1XF2A 2O5ZH 5MENE 2R0KL 1LO3H 1S9VA 3EYSH 4N68A 2XN9B 1AE6L 4RA3A 1J5OH 4J23A 4KKCD 5L2KD 5C3TA 5FB8B 2EYRB 4LCWA 2AJZA 3QJFB 2JCCB 3O9WA 4P9ML 4K7FB 5J6HA 2IH3B 2CIIB 1UM6H 1MI5A 4OZHA 5BO1L 5BOZG 1YN6A 3CSBA 2VAAB 3ZE0F 1H8SA 1Y0LA 3QXVA 4JZJC 4HKZA 1XAUA 3VI4E 2AGJH 4UQ2B 4C4KT 5HGHB 1D9KC 1JPFB 1ZEAH 1IGML 5I1CL 2YKLH 1I4FA 4R7DA 1OGAB 3OKDB 4PUBH 5D8JH 5TGBA 4AQOA 4JY5H 1RK1A 3ARBD 3KPSB 4HPYH 3C08H 4JO1H 2ZUUA 1QEWA 4POUB 3TA3C 5CHNA 1FSKB 4PLJD 3OTTA 5GGQL 3RZCC 3ULVD 1AO7A 3RWHA 3EZJB 2E7LC 3P0YH 4LSRL 3IAQA 3MV8B 3L1OH 3GRWL 5FOJA 3FB8B 4H88H 1AR2A 5B22A 1OP5H 2R39A 4JVPA 3BPLC 1IGYA 5IK3A 4AIXA 1K8IA 5JOPD 3AB0C 2OL3L 1X5KA 3PWVB 4R2GB 2XWBA 4ONGH 4D9RE 4OD2A 4X98A 4ZXBD 3OKEB 3I6KA 1YMMA 2EO9A 2CKBB 3D2UB 3N50A 1LO2L 4MWFB 5T3XE 3UAJC 3PV6B 4UIMB 5F7MC 2RR3A 1KG0B 4RA0C 3HC4H 4MD4A 3QDME 4ETYA 1KV3A 4DVRH 4RGNB 1NGWB 2FGWH 2DQFA 3B5HA 2NY3C 4BH7B 1JF1B 3QDJD 4S1DC 5IEHA 1KPUA 1AY1H 5EO1B 5HDLA 3ILPA 4IDJL 5DURD 3EDJA 3C6LD 4ODWB 1YDPB 3K74B 5EOCH 3SJVE 1T7XA 3WN5A 5EN2B 5GGRB 1AFVL 3MV9D 2ICWI 4KJQD 5JW4R 5MEPB 2XY1A 5D2LA 3U46A 2WQ8A 2FJGB 1XIWA 4PJ5E 4HJ0D 2KUTA 1A5FL 1IM3A 3BAEH 2NXZD 4IOSD 3WXWL 3FQTB 3VFGH 3WFEL 3GMLB 1RZ8B 1RZGA 2AXGA 3VG0L 5LAXB 3VXNB 3DMMC 4S10A 2VIRB 2FB4L 4OLYL 4NO2B 5EFIA 3GI9L 4LRNH 5J13C 2VZ1A 4LLMA 1C1EL 3VXPA 4TOYH 4XI5C 4JJ5B 4Z7OE 2GTZA 3L6FA 3ZT6A 3U6RB 4KRPC 4ELMB 2P8LA 3FAWA 3HMXA 5FYKD 3WXVL 1OAKL 3QUZD 4N8PA 4QXTA 1NBVH 1JHLL 1KIRB 1JV5B 4OLZH 5C3LD 3G5VB 4X6FA 1CFVL 3VXRD 1U8PB 4JN2A 5GGSB 5DRNA 3U82B 5TE4H 1B6DA 5E2UH 4PRID 2OK0H 4D0CA 1IE5A 1KPVA 3BEWA 5C0BB 1A47A 4UTAL 1OAYL 5ALCH 1ZANL 3KLHD 4F58L 4UT6L 2DYPD 2CPCA 3LN4B 3R0MA 2C9AA 3JTTB 4FNLL 5EOTB 3QFJD 5I1EH 5CD5C 1U3ZA 3CNKA 4RBPK 5DA0B 5FEBA 3PGDB 5EWIL 4G9DA 3O6FA 3U4BL 5L0QB 2QQNH 1CR9H 5IHUH 2CSPA 4YFLI 1MCRA 1PYWA 3QUYA 1CGWA 1U58A 4NQCB 2X4RA 4XCFL 3KVQA 2H26A 4BYHA 5I8KH 3ZYJA 4XNXL 3KS0J 5LKNA 3MGOB 1WAAE 3UTPE 3ULVL 4G8GB 4Q6IB 1J0JA 1XF2B 4OIIH 3LKNB 4Y4KD 2J3SA 3LHPL 3QCTH 1GGIH 3UPAA 5F7EH 4I18C 4QWWD 3WIFA 3VDBA 4L9DA 1GGUA 4QHUA 5GRUL 4NJAL 3LRHA 5DVOA 3BD4A 4YR6B 3CFDB 5INDB 1ADQA 3FO2B 1CXIA 5E5UB 5F88B 1KENH 1HHIA 4YPJA 2BSTB 4UINL 5HVFB 2RGSA 2XZAL 5GZNC 5E8PA 4Z8FL 5L7XL 4NZRH 2ADJA 1HIML 4RQQB 3RWEA 3S35H 5KVEL 4XB7A 3RNQB 4OFKA 4OLVL 2BXZA 4Z7WE 1DBAH 4RAUB 5LXGL 3Q1SL 2O93L 5EU4B 3B6SA 1RUPL 5E94B 4ZUTA 5DYOA 3DXAA 1I4FB 3OB8A 2X4SA 3HI5L 4UOJA 5ESAB 5TGBB 2BSED 2UWEF 3LDBC 3LN5A 5F44A 4Y89A 1I8LC 3GMQB 2NX5B 3GBNH 5DLML 3AREC 5E1AA 1QEWB 1NGPL 1S7VB 1TJHH 4WO4D 1EMTH 1SJHB 4XP4L 1AO7B 2XNAB 3OJ2C 1MCLA 4LKXB 4QRQB 4YC2B 2PNDA 5IMMA 4U05A 4JFFD 4Z7OF 1HQ4B 4NT6A 5F1OB 2JIXA 5CJOH 2WP3T 4WWKC 4ODUB 2V5RA 3NZHH 1PY9A 2DLTA 4QXUH 1CT8B 3O6MH 1EBAA 4F9LC 5IFHL 1M71B 2R0LH 2CH8A 3GMMA 5C0CD 4IOIB 4UIKH 2YBRA 3CC5A 4S1SL 1TQCB 2HJFB 4JFZH 3HLAB 4OD2B 1CIDA 4RFEA 5FAAA 3SGJA 3QIUA 1DBBH 3EYUH 3QUXC 3VCLB 2HWZH 2AJUH 4ODVL 3H3PL 2RCSH 1CFNA 4CKVX 2VISA 5FYKL 5C0RL 4YNYB 2NCMA 3FRPG 2HTLD 4X7SL 1HNFA 1TPXB 4QRPB 3VWJB 2AEIT 3V6OA 4LNVA 1W72L 4K07A 43CAA 4MNQD 2X41A 3V52H 3ULSA 3WIIL 5ITBH 5A2FA 4OT1H 4ZAKC 3HRZB 4RMSA 3AU1A 5ESQB 3ILPB 25C8H 3LKQB 4FXKB 2EE3A 1CGYA 3RWGA 1YEHL 5DVLA 4CN1A 2DQTH 3HMXH 2AV1A 3MLYH 3MUY1 4FFWC 3WN5B 4L8SC 2YXFA 4OCSH 4WDIA 3MA7A 2VZVA 4MAUH 3BDYH 3KGRA 4RMUA 3BKCL 3NPSC 2G75A 1FZOB 1WAAF 1JFQL 5C0AE 3LZFH 4OLUL 3VG0H 4DGVL 1Z3GL 1J8HA 3QEQA 4WU7B 5C0JA 5JQ6L 4WUUE 3MV7B 2XWJA 2BFVH 3DX6B 4NOFA 4IS6A 1MFNA 3DVIA 3DROB 4I0PC 2V7NB 2DLFL 1C1EH 2ESVB 2GTZB 2BVEA 4PJBE 1SY6L 1FORL 2VUOA 5FHBL 2PO6D 2P8LB 1AC6A 2YUVA 4XCCL 3QI9D 5MENA 3CFBA 2CGRH 1YJDH 3WXVH 3BQUA 1G9NL 3EO9H 3LS5H 4PV9A 3GKZA 5FM5O 4R8WL 5BW7A 4X6FB 5DZLA 4U6XA 3BP4A 4DKDC 4BFGA 1ZT4B 3PQYE 4Z7WF 3HR6A 1Q9OA 3A6BL 5I1HL 4D0CB 5JNYA 4U1MB 4GSDL 3IJYA 2EICA 1OP5K 5EZLB 4KROD 3PGFH 5C2UB 5GJSL 1VFOA 5EIIA 5D1ZA 1J0KA 4XBEH 3BOVA 4W6YB 2OBGA 3WNPA 5IHZB 3B9VA 1CGSH 2CKNA 4OB5H 1JWSA 1HWHB 4EN3D 1BM3L 4AJ0A 3H8NA 1S5HA 4ZUWA 2ZJSH 1L7IL 4GAJH 4PJ9B 5DJDA 1MCSA 3FB7B 5FYLE 1KF9B 2VR4A 3SDCD 4LLWA 2VDMH 4UAOC 5ANME 1KIUA 2CLVA 5DK2A 4Q58C 3GMPA 2X4RB 3K2UH 4NCC1 2C3VB 1E4WH 4Y5YA 4RFNB 2VLMD 3CX5K 2R4SL 4BFBD 2O61A 1DDHA 2VQ1B 2VDOH 4Z95L 1Q72H 3MGAA 2DS4A 4OBSA 1RIHL 4ZOCA 3QPXH 1ZA6B 1FC1A 2DBJA 3MJ8B 2DAVA 3P11H 3INUH 3RHWF 4DZ8B 3D0LB 2RB8A 5JORA 5FOBB 4JZJB 4J3XA 4NQTA 2NW3A 3FTGB 3S98A 4D0DA 3OSKA 1NSNH 1KLFA 1SVZA 2DIAA 1EJOH 3LEVL 2HH0L 3ROLA 3JUYA 1Z9OA 3BRDA 1OCWL 3NGBC 3ILQC 4NQSA 1EEZB 1FL6A 2FATH 1OP3K 3LEXA 4HIEA 4R0LC 4TNVF 5EBWB 4HWZA 3TNNB 5C0EB 2UZYB 3ARZA 4APQC 5L7XH 2YUWA 1JNHA 2IQAA 4WRLA 3QDMA 1LHZA 3VGAB 3EHBC 1T2QH 1F8TL 3Q1SH 4JY6B 5E70A 3BKYH 4FTVB 3ZDZE 5DK3A 1XT5A 5IIEA 3JWDH 3L95A 3PWPD 4LMQE 2HG5A 5GS0L 5KG9B 3MLVL 5EO9B 4LSVH 1U93A 4GAFB 4FMFA 4LCYA 1F2QA 2Z93A 3F7VB 4ZSOE 3M8OH 4LRIC 3GUTB 1RHFA 2GCYA 4OTXH 3WV0A 1T83C 5IMMB 1JGUH 4PJ5A 3FB5B 3JWOH 4NT6B 1BOYA 4PJBF 2IPTL 4PY7A 1HHJB 1YPZB 2HT2C 2NY1B 3NOIA 1RSFA 2UWEA 2V17L 3FZUC 3ZHKA 1EAPB 4N0UE 2ZPKH 5F89B 3BO8B 1BVKA 5D96C 3U0PA 3VE0A 3VG9C 4RFEB 1AQKH 4P23C 5E2TL 4AH2B 5AAMA 4FQ2H 5F3HB 2EIBA 4H8WC 4M7KL 3VXMB 3S97C 2FBJH 5EU6D 1FO0A 1I3UA 3ZE1E 4UILH 4KGLA 4EQ3A 3CVIL 5SWZB 3MLWL 5EULV 3ZHDA 1ZV5A 3EGSB 2DICA 3R0NA 3WD5H 5MERB 5CILH 2OQJA 5EH1A 3RWGB 3MJGX 4CRPA 4A2MA 3EO1B 5H94B 2DMBA 2AV1B 3K8MA 5CBEA 2DDQH 2R0ZH 2WANA 4KZEH 4ODSH 4WDIB 5J13B 5CSZA 5IV2B 2FLRT 4JKWA 3RX7A 3RIFK 1MAJA 5D7LD 4C4KO 4KRPB 2ZG2A 4HUNB 1ERNA 4KVCL 1X4ZA 4YHOL 1UJTA 4DW2L 3QEUB 4OLUH 2ZUQC 3QEQB 4DGVH 5CZXD 1X9QA 5I17A 5DUMH 4IS6B 3G6JB 4R3SA 4X0KA 2X89D 4HHAB 5C09B 1ZHLA 1IJ9A 2DLFH 4M62L 1WAAA 2Z91A 4P5TA 1A3LH 3ARWA 1YNTA 5HD8D 4R96A 5MENB 3CFBB 3EW3B 3ULUD 1I1AC 4OCWL 1P1ZA 1QRKA 3A6OA 3I6LD 4PV9B 4ZPTA 2CK0H 3DSFL 5DFVC 3S6CA 3GGWA 3NABH 5LCVL 5D1XB 3WKMH 4P2YA 1N5YL 5T1LA 1OVZA 4NRXB 2E27L 1QSEE 4HX1B 4UV7L 2VMFA 1HOCB 2R2BB 3IJYB 2AJVL 2JE8A 4OCNC 2HVKB 3MXWL 3BN3B 3H7LA 5F7FA 3ZDZF 2BOBA 5EBMA 4WTZA 4UTBL 4UQ3A 1VPOH 3MUHL 3SKJL 2DM3A 4W70A 1CE1H 1Z5LB 1S5HB 2XN9D 5EU5B 4YO0A 4RZCA 4EBQL 4PRAB 2Q6WA 1QRNB 1IM9A 3BGAA 5HYQB 5EA0L 1ZLVH 3BGFB 3KJ4C 4U6YB 1K8DA 5DK2B 4OFPA 1YC7A 1FFOB 1SMOA 4Y5YB 5FDYA 1JBJA 4MS8D 1KSRA 3HMWH 3RVWC 4XVSL 3TNMA 3L9RB 4JFDD 4Z95H 1ITCA 4FFYL 5JORB 1MEXL 3ALWA 3F6LA 1IAIL 2NW3B 3MNWB 5I18H 1MF2L 2FIKB 4F7EB 5E6IB 2X4UA 2W9LA 3ZE1F 3ZYOA 4LP4A 1OGAD 3DVNA 1HEZA 2ICCA 3N9GL 1CU4L 3GMNA 3KPSD 1IQDA 2QHRH 5DJZB 1IFHH 5IR1A 3MRMB 3F7YB 1YUHB 3LEXB 3Q6GH 5F3BB 3L7EB 2QKIA 3E0GA 4HWZB 5DD0L 4CUCA 3UCRA 3OR6A 1FZJB 4L4TB 3MV8D 5TE6H 5C6TL 4OF7A 4YHPA 4P2QB 2D03L 3KPOA 3LQZB 1TVBB 1GRWA 4WWKB 1SMAA 5GIRA 2NR6D 3SE3C 5DFWH 5MEQB 4UNVA 1A1NA 2BSRB 4R2GD 5AZ2L 1ZLUH 3WE6A 5GS0H 2X6MA 2QR0A 1FO0H 3SE8L 3SJVB 2QL1A 3RL2B 2BOCA 1FHGA 3T0EA 1JGEA 4GG6E 3BW9A 3HE7A 3GSUB 1YNKL 1QFWM 3MCG1 4NKDA 1VDGA 1WFOA 4XC3L 2A0LD 1T20B 1FBIH 3QAZB 4RGND 1CYGA 2DQCL 3MJ9L 1JWUA 1AKJB 2UZIL 4JKKA 4X5WB 1Z2KA 1AXTH 1A22B 1JF6A 4WUUA 1A1OA 2OP4H 4ZAKB 3V0VA 1NUNB 3D85A 4MAYA 2F54B 3U0WL 4IRSA 1FNGA 1HHHB 3EYFA 2YD4A 3SBWA 1QSFB 4JFPB 4PJEB 4PJBA 4K7PL 3U1SH 4C57C 1FNEA 1M4KA 4M7KH 4XNYL 4N9GB 5EORL 1FO0B 1EHAA 1XZ0A 2UY7A 4DUWA 3OJDA 4I9WD 3BPNC 4Y4HA 1JRHH 3AY4C 3VH8B 3F58H 1T0MA 4ZFZA 1NCWH 1RZKL 4U1NB 2IAMA 3GB7A 3ZKQD 3ROOA 4U49A 1E27B 1U8IA 3DRQA 3PQYA 5DMKB 5DI8A 3HC3H 2P8MB 2NTFA 1IC5L 5FDWB 1YECH 2E7CA 3TN0B 3IDNA 4YDLB 1Z0MA 2C1OA 2Q76B 3MO1A 3RFZC 4TYUA 3MRPB 5EPMB 2NY5L 3CFJB 3WFHB 1G7QA 4Z0XA 3FCTB 1A6AA 2VDKL 3MGTA 4QHMA 4KU1A 2GFBA 1UACH 4RMQA 1QFUL 3RI5F 4BZ1H 1WSST 3QPQC 4EUPB 3EZ8A 1BBJB 3G5ZB 4NYLA 4FZEL 2D9QB 2J5LB 1UB5A 4I5BA 4HUWB 5ANMA 3IU4L 2PXYB 1X4YA 4KUCF 3TPUB 4IRJB 5FGBA 2KL6A 2CDEB 1CTOA 4HWBA 2OR9L 4UOW0 5C0BD 1BQLL 5FA4A 2Z91B 3QH3A 4E5XA 5I74B 1X5LA 1YNTB 2ERJC 4R96B 3BMWA 4Y5VC 1UEMA 2BSSA 1GYAA 1TZGL 4N8CH 5AYUL 5IB5A 1HH6A 3V5DB 3C5ZB 4OCWH 4N0YL 1JRHI 3TH4T 4NQEA 3GGWB 3DSFH 5B4MD 1OAQH 3S96A 5HHQB 1O0VA 3BEVB 4DTGL 2PR4L 4NQCD 1I1YA 4XNUL 4F33B 7FABL 1LD9B 4UV7H 2V2TA 1IC4L 4LNRA 1F11B 1X5IA 3BYTA 4G8GD 1VENA 4HZLB 5AWNH 4Y4FA 2WWMC 4GG6F 3WL9A 4Z7WB 2X7LA 2EDHA 4M1DH 4XRCA 4YHIB 2IC2A 5DSCA 1LO4H 5IB3B 1TJGH 2Z92B 1RURL 6FABL 1RUAL 2BY0A 5BZWA 2DIJA 2DKUA 4N0RA 1CLZL 2AK1L 1M7XA 2CKBL 5LQBL 2G2RA 1A9EA 4PP2B 4ERSH 1ETZA 3ARQA 4OV6F 1A6VL 2CUMA 4R0LB 5B8CB 1XGYL 5JIPA 2Z31A 4ORZC 5GISH 4FRWA 4F8QA 1YEKH 3T2NH 5MP6H 1MF2H 1RFDH 4N0UA 1F4HA 3U30C 2OSLA 1MCKA 4YBLC 3HAEA 1HEZB 5A3ID 3BI9X 3O3EB 1MLCB 4KK5D 3GMNB 4PGDA 4HGWB 2EDJA 4PGEA 1JYNA 2NX5D 4BK5A 4EIGB 3ESUF 3UPCA 1OOAA 3V2AR 2HVJA 4TUJA 4U2ZA 2QKIB 4O9HH 4AEIH 4FQIH 5J12C 4KC3B 1L4IA 4XP6L 2G9HA 2WM0A 1ED3A 2R2EA 2YWZA 1YEGL 5FIEA 5HI5C 2X1WL 4JAMA 3RNKA 4CGTA 3UEZA 4N9OB 2GIYA 2HLAB 1CXHA 4KMLB 4MQXD 1QO3B 5TF1L 1JCKA 4JB9L 4JHAL 4K71B 5AUMA 4Z7QE 3GSRA 3V4PL 3FKUS 3HC0B 2OTPA 3HG1B 4HAGA 5D70L 1OTSD 3NZ8B 5JOEA 2BOCB 1N59B 3E3QC 1JGEB 1ACYL 1V05A 4KQ4L 4PS4L 4NM8L 1ZLSL 3BW9B 2BC4B 2DI8A 1QBLL 2GT9B 3IDYC 4YPGA 4MD5B 5CZKA 1YY8A 1JZ8A 5HHXL 1AI1H 4XC3H 3BUYB 4GXUN 4BZ2H 4WU5A 4QRPD 3VWJD 1XGRA 4JLRA 5C0AB 5KOVC 1UXSA 3S37X 2R56H 3QQ3A 2NY7H 4JKLA 5H35A 1GC1L 1LE9B 3U9UB 1HE7A 3D85B 3L5XL 4MAYB 3ARFC 3ZDXE 1ZLVK 3WS3B 1CDUA 3EYFB 2F74A 5ELIA 5EOQH 3WDIA 2DD8L 2NY2B 4HBCL 5IB4A 4EDXA 4NKIL 2H3NB 4DZBB 4U6HB 5LGJB 5E6ZA 1F13A 4GQPH 3HUJB 4OGAC 5EORH 3B2UD 3L5IA 5FYLH 3OJDB 3CXHJ 4NGHH 4CVUA 1S7QA 2YD2A 1BOGA 1T0MB 5T1KA 4HKXA 4HWBH 1HYSD 3C8HA 3RA7H 1Z9MA 3VGHA 3PL6A 5CWSB 1MJ7L 5DI8B 3MV7D 5GRZA 2ATPA 3S36H 1QLFB 1QSEA 4B41A 4EUPG 4XGZA 3R06B 3TO4C 4FFVD 3IDNB 3MO1B 2ESVD 3Q48A 1OM3L 3KPRB 4FP8L 1K85A 1RZJC 3MGTB 1A6AB 4QHMB 3B83A 4HPOH 1HCVA 4XMPL 2Q7YA 2VDKH 4NBZB 2ADFH 2P1YA 5C71A 4KDTA 1I75A 2CUIA 3PDGA 2AQ3A 1GVIA 2DKMA 4OZ4B 1I1AB 4XPAL 5E8NB 4I48A 3ARYA 1NFDE 4I5BB 3RX5A 3MRIB 4S11A 1MHPL 4DJMA 3K4DA 3IU4H 4E42B 3VW3L 5DJ0B 5BS0E 5FA4B 4PTUA 1JHTB 4LVOB 3O2WH 1A7PL 1ZLUK 4NHCL 1PG7X 3M17B 2P8PB 3TO2A 1J1PL 2BJMH 2D7MA 3L7FA 4PJ9D 2B4CL 4U2YA 4WTZG 4PJFA 5EZJB 4N0YH 1Q94A 1TCRB 2IQ9L 2OMNA 3EO0B 3SN6N 4QTIL 1M6OA 4HIJB 2CDGA 3O4LB 1YYML 4Z7QF 1LMKA 3KPNA 5HXMA 3QQ9C 4F37K 3IB4A 1NAMA 1PKQE 5MI0B 5CJ5A 1PG7W 4PY8J 1DZBA 1S9YA 1IQWH 4PJ8A 1K6QL 1ITBB 3ZSTA 2ZCHL 2JJSA 1GIGH 1WC7A 1UYWL 4PG9A 1WF5A 3HAEH 1N8ZA 4AQ1B 1BLNA 3MLXL 3FQNA 1UA6L 1JVKA 3KYKH 3KPMA 4OM0L 3M07A 1D9KD 1G9MH 2R2HB 5BZWB 3ZYZA 1YNLL 3W5MA 3QHFL 4P2OC 4XMKL 5F1IA 2PTVA 5ID1B 4BFIA 1NANH 4ZSOB 4MJ6A 5KZCB 1WZMA 3BH8B 4GG6A 1A9EB 1DANT 2BY2A 3IXAA 4LQ1A 3KYNA 3FO0H 1NC4B 4NWTL 1GGCH 2FEEL 4XWOD 3UTQA 1A6TA 1XCTA 1WT5C 2PW1A 3AS1A 1WUNT 2Z8SA 4LMQI 4KKLD 1I9JL 3P9LA 5ECJE 1M05A 3KJ6L 3ARDA 3QNXA 4FTVD 2OSLB 4O4YH 2D7QA 4O51B 5E5RB 3LB6D 4K3EL 4RRPA 1C5CL 1ULVA 1ONQA 4PGEB 4JO3L 4U6TA 4RISH 4XNQA 2W65B 4RIRA 1WBYB 3RVXD 1FIGH 4HS6A 1EHLL 2BX5A 1KCRL 4NRYA 3BT2H 4YHKL 4LPWA 3IFOB 2R2EB 4PB0H 5CCKH 3V5KA 5ILTH 1FVEA 2NY1D 3O6KL 5C0NC 4JFYA 4Z5RB 5F9OL 2FR4A 2XKSA 3DVGA 3R8QA 1F3JB 3FQRA 3NA9H 1RVFL 1KEML 4PD4K 4LEXH 1UEYA 4PJAE 4WFGE 1HZHH 4Y19B 4JB9H 1QP1A 2NZIA 1C8PA 1G7HA 1QOKA 1FE8H 1NFDF 1GHFH 3D9AL 3RVUC 5E9DE 1SM3H 4NPYA 1JHKH 4YPGB 3VXMD 4L9LA 5HHME 3GFUA 4GAYA 4PY8I 2R8SH 1YY8B 2A9MH 3BZEB 2OCFD 3BXNA 5GJTH 2QQKL 1XGRB 5JXEC 5SWZD 1QACA 3MYZA 5E2WH 3WEXB 1INDL 3PABA 2GEEA 2OZ4L 3BPNB 5F1SA 4RMRA 2BCKB 3LQMA 5H35B 1CQYA 5F9DC 1KJ2B 4ELKB 1JPST 4X6BB 5FKAB 2YEZB 2KQNA 2EE6A 1MHEA 4LIQL 3EOYG 3E6FB 2VLLA 3ISWA 3AXLB 2A9NH 1T3FA 3U4EA 3LMJL 1S7RB 1KCKA 3FRUA 4NKIH 3S7GA 4KRPD 1BQHB 5FV1L 1S7QB 5KS9B 3L5WA 5ESVA 4XB8A 1B88A 1YQ2A 3JV4A 3QNYA 4CU6A 1Q8MA 2VUYA 2F8OA 3QEQD 4UUJA 4ZYKB 1BD2E 4OM1L 3DBXA 4JN1L 3DX7A 4NZTL 2EH8H 2I5YH 4XZUA 4HLZH 4NDMA 5BJTB 5C09D 4Q9QL 2X4PA 2I9TB 5IJKC 5I75B 4JRXE 1F90L 4KVNH 1T89A 3EJZC 4DCQA 4HCRL 4TVPH 5MEND 3NA4A 1OARL 3JZ7A 3FT2B 2WNGA 4Y5VB 5ENWB 3RQ3A 5JHLL 3NCJH 3BP6B 3ALPA 4OCRH 5BVJB 4KQ3L 5DMIH 5D1XD 5T3ZE 3U7YH 1G1CA 4LVNC 5D7KD 4FQCL 1TXKA 4NKOA 3NTCH 5HTSA 3WHE0 1YEDB 2NY0C 1FNSH 4XP5L 5D1QB 5IVXB 3ZKNC 5D72L 3P4NB 4JFQA 1V3JA 5EU3A 2Y7QB 3W0WE 1MCIA 4K23L 1XF4B 1S7SB 5I76A 3MCLH 3SKOB 1A7QL 3RY6A 3SHSA 4N8VA 3EIFA 2G60L 3D25A 3TO2B 3BGMA 3CFEA 4Y1AB 5GGVH 1OAXL 4B5EA 4JQIL 1QRND 2B4CH 2AEPH 1WTGT 1FLTX 4QY8B 3KR3H 1IGFL 5IQ7L 1KLGA 3ME0A 1MHCB 1UWXH 1G6RA 3ORJA 3GSNB 4PJAF 3EOTL 4OJFH 4KKAD 3PDDA 3KPNB 1Q0XH 1NAMB 2GAZA 1KNOB 3C9NB 1ZT1A 4DN4L 4ISVB 3FFCE 4XXDB 1BGXH 4OCYH 1JWMB 4MB5A 3H3KA 5LGHL 1OGTA 1N8ZB 2LQRA 1UYWH 1FZKA 3TA3A 5E6ID 4CVZB 3S88H 5DC4B 5J11C 3U0TB 3TZVC 1J1XH 3RZCA 3PDOB 5E99H 3EFFA 3GSXA 3MLSL 4Z18A 3FMGH 1AH1A 2P24A 2E7LA 4D9RD 4AG4H 3NCYS 4YBLB 2NMSA 4M00A 3PNWA 4P3DB 2H2PD 1UZ8A 3OXRB 1KUMA 3T3PE 1NCBH 1RY7B 3MRLA 5ICXA 5T3XD 3HB3C 4NWUH 1ZGLP 1JL8A 4U6VL 3HPLB 4L4TD 2VE6B 1CFTA 3MRCB 1W0VB 4P2QD 3P4OA 1M05B 3TFKC 4ESKA 3IDGB 3MRFA 3RDTC 4WWKD 2HKHL 3DTXA 1RAMA 2W0FA 1P7HL 3MACH 1CIUA 3CXHK 1FDLL 2DBLH 1ONQB 2XACC 4JE4B 4ZUUA 1FPTL 1GJIA 3SJVD 3QEGH 1C5CH 4U1SB 2NYYC 2VQTA 2BMKB 3X3GH 4NRYB 4PREB 2I27N 15C8L 4LHUA 4RAVA 1DVFB 5A2IH 1CDBA 2ZOKB 2B39A 5CP3H 3GBML 3EOAA 5DJYA 4JCLA 1AKJD 1WK0A 3SDAC 5TPWL 4OF5A 3K1DA 1I1FB 4YHML 1UWGH 3QG6A 4WI2A 4XCEB 1WBXA 1CDJA 3V5HB 4ZAKD 5F93C 2GJJA 2F54D 1JK8B 1T66D 4P4KC 4HGKC 5CP7B 4GLRI 1QSFD 4NPYB 3DMMA 5ETUB 3TBSA 5K9QI 5DMYA 1ZVHA 1DQTA 4YX2L 4RX4A 5IHBA 1KCUH 2YPLB 1F4WH 4NSKA 5D7JB 5JR1L 3ES6A 1NUGA 2R9HC 5IQ9A 1RUQH 3V95A 3PABB 5CSBA 4L8CB 3EJJX 3MODH 1INDH 2BERA 1NFDA 3H0TB 4WHTA 4MJ5B 4JG1H 4O58L 4CMMA 5B39A 6CGTA 1BF8A 5F8RC 1BQHG 2BVTA 2APXA 3DARA 4AIOA 3NIDE 1NLBH 3TN0D 3GMRA 1QUNA 2VLLB 3U2SA 3IDJA 1FRGL 2YZ8A 2HJKA 4NM4H 3NACL 4HK0A 1SEQL 1BBDH 3U4EB 2HN7B 5JZ7C 1H3PL 3N1FC 3ZDYE 3FRUB 3QJHA 3GSOA 5FYJU 3CMOH 1JUFA 2EEAA 4GKSA 4OLXH 1CDYA 1IC1A 5HY9A 2GUOB 1BFVH 2X5PA 2OTUA 3CMGA 4J1UA 1GZPA 2YK1L 4MNGE 3WUZA 2A6DA 4YHYC 2PXYD 2ATKB 2RIKA 3DBXB 4IRJD 3DX7B 3QULA 1R24B 4HWNA 4P46B 3BX7C 4ZO6A 3FN0L 3HFMH 1SVCP 2FL5B 2WW8A 5I8OH 3KYMA 2AXJA 4QGTA 1OQOA 1PKQA 3UTPD 1EZVX 4TSBH 3SDYL 4A6YB 1BHGA 1RZ7L 4MJ4A 2FJFB 2EC8A 4MYWB 2OMBA 1PZUB 1OARH 2MCG1 5J1TC 4LHJB 3C5ZD 3QUKA 3DV4A 1A14H 1UXWA 3DURA 3LRSB 5IG7B 1G6RH 1WCBA 2XZCH 4X6EA 1HHKA 4KQ3H 4ACPA 4KZDH 4WFHE 4XH2B 1YEJL 2D7OA 1HSBB 5DJAB 4YWGH 5DK0B 4I3GA 1W0WA 4JFQB 4HC1L 2CDFB 5EU3B 4G3YL 3TIEA 1DBKH 2MQ3A 1KB5A 3WFCL 5T3XL 5EZOH 5H37H 1II4E 1K3IA 4N8VB 4C55A 3D25B 3OAZH 3IFPB 5L2JB 3CFEB 4LSUH 3SCMA 1XGPA 3RGHA 4Z76A 4JVUA 1F02I 3HNSL 4QOKB 4LK4A 3P4MB 4YHNB 4L1DA 3MXVH 4U1KB 5FCSH 4BM7A 3WBDA 3VGDA 5TE7H 1KLGB 3WNOA 5F7LB 2R1WA 1MFCL 5DVKA 5IQ7H 3RTQA 4YDVA 3RBGA 4QT5A 4XPGL 2GAZB 2CLRB 5I1JH 2HAZA 1IILE 1FGNL 5T33L 3UPRB 1NCNA 2NPLX 4ZUVB 5C08D 1OGTB 3KPLB 3MBEC 5HSFA 2O26U 3SE9H 3AREA 4EI5C 1CE6A 5EU7C 3BVNB 4H0HB 1P4BH 4O00A 3SGDI 1AHWB 1CG9A 1I85C 3QXUA 4L29B 4K9EL 4PJAA 5IVNA 3EFFB 4EVNB 3TBTA 1K4CB 1F00I 2UV3A 4NIKB 3O8XB 3NCBB 3SO3B 4U7KA 2FIRT 4RMVA 1P6AB 1UM4H 5IFAL 4NQXA 3RI5K 5F9WC 3QUML 1F4AA 3NIDF 4RRPG 3CFCH 2ZP0T 1KBGH 3LH2L 4OFIA 2BXYA 1CF8L 4O2FA 4PGBA 2PYEE 3ZDYF 4HJGA 3QQNA 4M6OL 3P4OB 1HXMB 4LPVA 1MREL 1CDCA 3QUXA 1KTRL 2PW2A 3FZUD 3VWKA 2HKHH 2P5WE 5K9QG 1DQDH 3HA0A 5HHOE 3HG1D 3BPOC 4NC1C 4LASL 3M1BB 3FQXB 4H0GA 5FCUL 4YFEA 4Y16C 2RFXB 3H9HB 5DD1H 1KTDA 5E8OB 5IGXL 3O3AB 3ZKMC 4NQDE 2VN4A 1KJ3L 1VFAB 2BVPB 1T4KA 4KHXL 1T1YA 1BAFL 5DT1L 4YXHL 3A67H 3IFNL 1ZWIA 2ZSWA 3EOAB 5DJYB 3LEYH 5KTEH 5C0AD 4J8RA 4L8SA 5F71A 2AJYH 4HH9B 3OKNB 4OZIB 3GNMH 4S1RL 5TPWH 1LE5A 1U95A 4YHMH 5HDOA 2BDNH 2DQUL 1BD2A 1F3DJ 5I66B 1LK2A 3O41B 4U1GB 3D85D 1SEBB 4MAYD 4R4FL 2AJSL 5IWLC 3CK0L 3V6FB 1HKLL 3K8KA 3RPIA 3E1F1 3TT1H 2NY2D 1MCWW 4JRXA 4E41A 1JYVA 3UZVB 1KPRA 1UWXK 1HDMA 3DUUA 3VFMA 1GXEA 2MOVA 5HHPA 3VFWA 4L3EE 1Q0YL 4KRNA 4OD1H 2IADB 3O0RH 3SQOL 1R3IL 3EOBA 3L3OA 2Z8WC 3DX8A 1NFDB 1I3GH 4KV5E 3V79C 3UYOD 2XWTA 5IT2H 1A3QA 1MJ8H 1DQML 3G9VA 3I75B 3DIFA 1J18A 3VFTB 3IFLH 2P5EE 2YN5A 2XZQH 5BS0B 4KKCC 5GRJL 3U2SB 1EXUA 3MR9A 2HJKB 1N26A 5IB1A 5KANG 3KPRD 1FRGH 2Y5EA 3W0WA 1PW3A 4Q2ZA 1SEQH 4J7RA 1V7ML 5TF0A 1JUFB 3OKMA 2YPVH 4MZ3A 1FVDA 4M6MH 4GFTB 2EE2A 4P2RE 2ICEB 1UB6A 1I1AD 2LTQC 3DV6A 4DGYL 1FAIL 3Q2CA 3DSNA 1AIFA 1GZPB 4U0RC 2A6DB 5FM5M 2VC2L 1JGDA 1KB5H 4N1EA 3QULB 2HT4D 3IVKB 3L3KB 5DWUH 1AGEA 2AEQL 4EXKA 5IEKA 1C08B 3WIHL 5JMRA 1KJMA 1HILA 4DAGL 5E08H 1P7KB 3UZEA 1FFNB 1EV2E 1LNUB 4ZQKB 2FDBP 1LK3L 3FFCA 2C1PB 2Q8AH 5EC2A 3ARBC 3B2VL 1HI6A 1QTYT 3QUKB 1LWRA 1UXWB 5HYJA 3N1QC 5I71C 3I2CH 4PLJC 1RU9H 3T0WA 1B9ZA 5I6XB 4N8VG 4MDIA 4Y2DB 3ULVC 3SY0A 4PTTA 1J7VR 1MRFH 4WEUD 1RUKL 2EDLA 4LARH 4LSTL 4PGZA 4MXWL 1OD7A 4OSUL 1W0WB 3O4LD 2ORBH 3TIEB 1GPOH 1T7VA 1D3CA 2SEBA 4WFFD 1A0QH 4UDUA 1KB5B 4G3YH 3GIVA 3VXOA 1RULH 3GZKA 4O02H 1E4XH 2A6KB 1FV1B 5CAYB 4NN5C 4X7TA 5SWQA 4GG8B 4JO2L 4V1DD 3SCMB 1UADC 3STLA 2V5YA 3IJSA 3HR5B 1CXFA 2F5BL 2H9GA 3HNSH 4PJIF 1CD1A 1Z0NA 4FQXC 4APQA 5EZIH 5H37G 4NO5B 1DL7L 4GRLB 2ZCKL 3W9DB 3D87B 3G6DL 1NDMB 1MRCH 1KXQE 4MZ2A 4QT5B 2GSGA 3TVMC 1D6EB 3QO1A 4M7JL 5C07E 1CGUA 2AXFB 1P4IL 3T1FA 1F58L 1NC4D 3RRQA 1IAIM 3LN9A 1D5XA 1MFAH 2VO5A 1YEIH 3KLSA 1XGUA 1U8JB 1VEOA 3TH2T 1YN7A 2X1OA 4GH7B 5KJRL 4LRIA 3RU8L 1CG9B 2YD1A 3SDXE 4KJQC 4B50A 3TBTB 2XRAH 1T83A 2A6JB 4HJ0C 3MA9H 1H8NA 3FQUA 4LCCB 5I1IL 4KV5F 1H5BA 1M7IA 2B1AH 4Y5XA 1DP0A 2LU3A 5IW3A 5E9DB 2XKUA 3MJ7A 1D5MA 4NQXB 4C56A 1MCFA 4NJ9L 5HHMB 5IF0B 3QUMH 1B2WH 1E4XI 1T6VN 3LH2H 2PCPA 3LQAL 1WFTA 4X4ZA 5CZVH 4WV1A 2APBA 5E8DL 2VITA 1K4DA 4P23A 4W4NA 5C0DB 2W9DL 1ZGLM 5K9JH 1AR1D 2PW2B 5DD5H 5E8EA 5GS2H 4G42B 4HFWB 5IROC 4Y19D 5ADPL 4U1LA 5CS7A 5I19H 1CXLA 1JIBA 3QUZC 3V6ZB 1H3XA 1NMBL 5BZDA 5M94B 1SJXA 4LASH 1F5WA 3P30L 2GITA 1TVHB 5FCUH 2IBGA 2GTWB 2Z9TA 3LIZL 4GOSA 2YUZA 3T8XA 2MPAL 1X7QA 3MYJB 4ZTPH 5IVZB 3KNBA 1UKQA 1NEUA 1VFBB 1G7LB 1YEEL 5T3ZH 4K2UL 5L6YL 4R7NB 3KLHC 1TZHA 3OKYA 2WIMA 4KXZI 1LK2B 4XPHL 5DTFA 4LVHC 1JPGB 4DFHA 4L8BA 4U1IB 2HJLA 4KDWA 3NMEA 2CIKA 1FFPB 3P77B 4AL8L 1L9NA 3X13B 3VFWB 4XWGL 4NP4H 1F42A 4NCC2 4PRHB 3RWCA 4RWHA 1NLDL 1I8IB 3L3OB 1EO8L 4H0IA 4XCYB 5DEFA 1IZKA 1I3RB 4RAHA 3T4YA 5TQ0H 5ISZE 2H1PL 3S35X 4Y4KC 2XA8H 3QQ4A 1G9EA 3N85L 4JKPL 2H6PA 4QWWC 1G9NC 2YWYA 5I2IA 1G7JB 4UNUA 1GOHA 5JW3H 3W0WB 1OTTC 4Q2ZB 1FZMA 1NGXA 1QVOA 3TM6A 3OKMB 1I8KB 1HN1A 5E1HB 3RWJA 3AM8A 4LF3A 2CRMA 3TIDA 3CFKA 5FO8B 4XC1H 4QRTA 4P5MA 1KTKE 2E6JA 1PQZA 2LVEA 4MX7A 4WW2B 1JGDB 8FABA 3NFPB 5D1QD 3QFDA 4NQVA 3MUJA 1A6UL 3O3DA 3OHXA 2I07B 2Z35A 3P9MB 5FK9B 3SDXF 2ZUSA 2K9UA 1KJMB 1HILB 1ZSDA 3KLDA 2JJTC 3C5SA 3WIHH 5T1MB 4D8PA 2C7UA 4JPVH 1PDKA 2ILLA 2R4RL 3A0OA 5E4EB 4TQEH 5F96H 3GMOA 4Y1AD 1U36A 1JZ5A 4JO4L 2WUBH 5CD3A 2IG2L 4WO4C 1LO0L 3WHXA 2QQLL 4G80B 2EIZA 1XF3A 5GHWH 3SY0B 5B38B 1N6VA 4U3HA 4G8EB 1JPSL 1KCVH 2ITCA 5IKCB 4X5XA 3V4UH 4UDUB 3WO4C 3W9EA 2AABL 2PTUA 4ZFOB 5BVPH 4HBQA 4JREC 2CRZA 1VSCA 1VESA 1NMAL 1X5YA 4GW4A 1KGCE 2EDYA 4JO2H 4KMTL 1B0WA 2F15A 3EFDL 2F58H 1AGBB 3ZKXB 1KN2H 4ZODA 2P42B 3VFRB 2VABA 2MJWA 4IJ3C 4OCLC 4YXKL 1CD1B 1DFBL 1IGJA 3HZYB 5JHDA 1MJUL 4LU5L 2P5WA 3QDAA 3CPLA 5D93C 2HTLC 1A7RL 2H41A 4LBEA 2Q3AA 4Y2OA 4YUEL 2GSGB 3F5WB 4NZUH 2DM4A 1SYVB 4LLDB 4HUVA 1XR9A 2I60H 3MFGB 4NNYA 4NQDA 3SE3A 1KJVB 1Z9LA 2DF3A 3CAFA 4JHWH 4H8WH 1RUMH 3T08A 4ETQB 5C0FA 3P0VH 4PJIA 3DHJA 4BKLB 2B1HH 1YN7B 2ENYA 5DZNA 2QV2A 5GS1A 4LGSB 1DQJA 2AP2A 5CJBA 1CK0L 1IBGL 1KJ2L 3KPPA 3IAGC 4LLVA 3QWRA 2A1WL 1TJIH 1H5BB 2R23A 4KJWD 1MPAL 2EE9A 4P57B 2EKSA 2XFXA 1EZVY 3BPOB 2AXHA 3Q0HA 3C2AH 3GDBA 4OAWA 5AD0B 2FH6A 1DVFD 4L3EA 4P48A 1KCSL 3IXTB 3H9SE 2AV7B 5CEZE 1MWAA 1C7SA 4WV1B 4F57H 32C2A 4XNZC 2WIIB 3G5XA 1AC0A 2EDXA 1OB1B 4U1LB 2NZ9C 4FMKA 5DJ6A 2V2WA 4XAWL 3BKML 1QYGH 4UZGA 1LDSA 2P5EA 3WJLC 5BZDB 3GKWL 3AY4A 4OFYA 4XVUC 3T8XB 4NZDA 4J3OC 3UTSE 1N64H 2A6IA 3QISA 5I1DA 1S7TB 4R4BB 1NC2B 2CMRL 1JNLL 2YPLD 4PR5A 1AXSB 2PKDA 5D7JD 4OV5B 4P2RA 1UZ6E 2IALA 4KROC 5L6YH 2XT1B 5SV4A 1SJVA 4FQHB 4OIBA 5DQJA 2J8OA 3WCYA 5HGDA 4MNGB 4BSVA 2BNUB 4MJIE 3BH9A 3LSOA 3S4SA 1R3HA 4IEFB 4CNIA 2IPUG 4DKFH 3SDCC 2Z8RA 5KSVB 3FL7A 1CFQA 1MAML 1HNGA 1OW0A 1LEKA 1EEYB 3C09B 4ODXA 4QEGA 4YBQC 1IAOA 1KEGH 3ARVA 3ALXA 5ID0A 5DEFB 1EO8H 2DTML 1TDQA 3T4YB 4XPBL 4LAQH 1Y6KR 3RZWA 4RMWA 4XMLL 3DNKA 3BWAA 2NW2B 2FRGP 2H6PB 3GSNL 4P46D 3BIKB 3IRZA 5EUOE 4YIQA 4P9HC 1EEQA 4J4PD 5DQDL 3FFDB 2EDBA 4HQQH 1QKZL 3RGVB 4YHZL 3PG2A 3WFBL 1U8MB 3FOMB 5C7XH 1S9XA 3DHMA 1F6AB 1AGCB 1JNNL 2EEBA 4G43A 1VCAA 5FA3B 5HBBA 1A4JA 4HS8L 4DQOL 3ZTNL 2W0LA 4QHLA 2RJMA 3DYMA 1RJZA 1EO7A 1EUTA 5LWYL 2VNCA 4OUUB 5D5MB 1ACZA 2Z35B 1CLOH 3FAXA 1IKFH 1CCZA 1CVRA 2EDFA 2XV6B 3IJHA 4XHJD 5LBSH 4TSAL 4YDIL 3D48R 3DI2B 1GAFH 5B38G 3B9AA 1UH3A 4D8PB 3QQ9D 1HINH 4TULL 1LQSR 3RUGE 4JDVB 2ZZUT 1JTOA 4JFEB 5FHAL 2FHCA 4UT9H 3E8UH 3AROA 4LSQL 3AFLA 3OMZA 2UYLA 3MRKB 4FQJH 4ODTL 3C60B 4QOKD 3QCVH 4U3CA 5DDHA 4ZD3L 4DEPC 3TJEL 3WHXB 1AGFA 2Y25A 3SDXA 2QQLH 2HTKD 2IPUK 4M61A 2Y6SC 1X4XA 3K4AA 4FQXB 4FQLL 1JPSH 2X44D 3NPZB 4X5XB 3W9EB 1G6VK 4PRNB 4RGOL 2NNAB 3IF1A 3KWWB 3PGCA 3DYOA 3GHEH 3TWCH 3TVMB 3KLAB 2D31A 4NUGL 1OF2A 2D7TL 2PYEB 4GW4B 1BJMA 1BZ7B 2W92A 4IRZH 1LP9B 1VKXB 3EFDH 4Q74A 3L3HA 5I30L 1JZ6A 4EDWL 1UC6A 1OAUL 2HRLA 3QSKB 4K8RD 1T5WB 2Y23A 1UZ6F 3OKKA 3O8XD 5KVGL 3CPLB 3JVGC 4F3FB 5HHOB 1IGTA 5KSUA 5HDBE 1FCGA 4M1GL 4LBEB 1UFUA 1EIBA 1MWAH 1FL5B 4G9FE 5CJXC 3U7AA 1CL7L 1XR9B 2VWEC 4NNYB 3GI8L 2Y06H 1WBZB 1NPUA 4RWYH 3O2VL 3S5LA 3IKCA 4M48H 1NEZA 5CLTA 5C0ND 4PG2C 2AJ3A 1OWRM 1CK0H 4AIZA 3D39E 5HI3D 4Q9BA 5IB2B 1R5IA 3SDDB 1JN6A 2EH7L 3GIZL 4H1LA 3X12A 4O2CB 3PWNA 5GGRY 2PYFB 1LEGB 3RWFB 4OAWB 3RVUD 4OZFA 3F7PC 1RJCA 5CZXC 4X6DB 1RZJL 5CEXA 1KN4L 2M26A 4JPIA 4JM4L