1P4BH

Three-dimensional structure of a single chain fv fragment complexed with the peptide gcn4(7p-14p).
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
112
structure length
112
Chain Sequence
b'DVQLQQSGPGLVAPSQSLSITCTVSGFSLTDYGVNWVRQSPGKGLEWLGVIWGDGITDYNSALKSRLSVTKDNSKSQVFLKMNSLQSGDSARYYCVTGLFDYWGQGTTLTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody Variable light chain
molecule tags Immune system
source organism Mus musculus
publication title Directed in Vitro Evolution and Crystallographic Analysis of a Peptide-binding Single Chain Antibody Fragment (scFv) with Low Picomolar Affinity.
pubmed doi rcsb
total genus 28
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2003-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p4bH00
2H8PB 4GT7A 3TFKC 4GQPH 1OCWH 5IW3A 5T33L 4OF5A 2WIIA 4ZFGH 2AJ3B 5ESAB 4LARH 3O8XA 4WVRA 3NCFB 3G5XA 1CLCA 3KPOA 4NQDE 4TSBL 4P59L 4HG4J 2HLFC 5MENB 1AQKH 1QFHA 1MAML 4HIHA 1KJ2B 4TUOA 4X6EA 1FZOA 3QUYA 1MCSA 1MY5A 1DBBL 3E3QC 4NUGL 4X99B 3RIFK 4HGKC 1D5IL 1RZJC 4R9HA 1BZQK 3TO4C 2W1NA 5DGQA 2FD6H 2ZSWA 4PREA 2ED7A 5AUMA 3QCVH 3WIFA 1IT9L 3REWB 3PQYB 1XFPA 4HUWA 5I1AB 3CFCL 4HX1A 1ES0A 2BNRA 4J3VA 1MCPL 4S1DC 3EDFA 5KAQF 5A43C 4X6DA 5T1DH 2CSPA 4EDWL 5IKCA 1V3MA 2X9WA 4RFOH 4KHTH 4OZGA 5E56A 3GJFB 1Z9LA 5H2BA 3UYOD 3T4YA 5D6CB 2QL1A 3TH2T 4HFUL 4HCRH 1MVUB 1TITA 3C8DA 2E9WA 4MSWB 1VGKA 4C4KT 3T0EA 3DHJA 3FL7A 4EN3C 1DLHA 5IHLB 4RGNC 2UYLB 2OMNA 3VI3E 2VDRH 3MRQB 3MSPA 3GSQB 1LO2H 3DV4B 5HYQB 1KGCE 5LKNA 4OLZH 3PWJA 1A9EA 3DOSA 1XF1A 1DBKH 4Z7VF 2NY0B 4MB4A 2HRLA 3VXTA 3ZSTA 4D0BA 3SE3A 2F58H 4NWTH 2D03L 1JNNL 4LLVA 4PG2A 3MJ7A 5GIRA 1ETZB 3MJ9H 3IU3B 1OP3K 3QO1B 2AJXL 5IG7A 3DRQA 4YK4C 3VFPB 3P4MA 3GM8A 4AIZA 3OKKB 1T04B 2ATKA 2I24N 4JZJA 5DHYA 3FHAA 5KSAD 1QO3B 2NYYD 3I3BA 2E27L 2X4SA 1LWRA 2OXGA 1KN2H 1Z6JT 5J4MA 1S78D 3MLWL 1P4BH 1C5BH 5DK2B 1SJXA 2IANB 4ODWA 4LQ1A 4NC1C 1JGDA 4N0CD 3GSUB 1YEHH 2HFFB 2ZP0T 5I1KH 1QSFE 4MCYB 3TNMA 1KN4L 1TJGH 3UX9B 4CRPA 2OLDA 5LGKA 2XTJE 2AJUL 5DVOA 3WYRA 3PL6A 4WUUB 1FZMB 3VXUA 2M2DA 1NLDL 1M4KA 1R3IH 2DQTL 3NABL 3SGKC 2DICA 5CJQH 4BQ9A 1X5LA 2P48B 5IFAH 3U0WL 4CN4A 1LILA 4CJ1A 1I1YB 3X14B 1BVKA 4S1SL 1RJZA 2Z93A 4DZBA 4HKBA 4K9EL 5CHNA 3BDBA 4DGVH 5DD1H 1A4KB 1G84A 1OAZH 1P5VA 4R7NA 1BVZA 1AGBB 3S4SG 2DJSA 4CMHB 1INDH 4JAMA 3DYOA 4NBZB 3GSXB 1ULVA 4AMKL 2V7NB 2FLRT 4XBGA 2VIRA 3G5ZA 4ZOEA 4M6MH 3ARRA 2YWYA 5TE6L 3MGOB 3OBAA 4WI2A 4R90H 3GHBH 2IPTL 25C8L 2DQDH 4J4PC 1LD9A 3RVWD 8FABA 4F15B 4LEXL 4YK4B 1UJ3A 4LCWD 5HGBB 4XP6H 4HS6B 4P2RD 4P5MB 4RAUA 4L8SA 1NCTA 2Q76A 5EO1A 1NAKL 4ZD3H 1NFDF 1C12A 4GJTB 4NQEE 2XKNA 1A6TA 4OGZA 3KPMB 1L0YA 1KC5L 2AABL 4NO0D 2R23B 1ACYL 3QXAB 4M02A 5EN2A 4O58L 1QA9B 2D9QB 5KVGH 2W0KA 3KPNB 4DUWA 4RNRB 4NRXA 4WI3A 4O2FA 4U1IB 1JPFA 1BFOA 4NFDA 5CEXA 2X4RB 4QF1A 5DR5L 3VGEA 1KUMA 3C60D 4N0RA 4ESKA 2WWKO 4NQED 1KC5H 1YY8A 1OWRM 5C0JA 3BP4A 3R8BB 1IGYB 2FL5B 2R2EA 4J1UA 3N9GH 1XCTA 4M3JA 5FXCH 4MNGB 3TCXA 3REVA 1FL6B 2W0LA 4L8CA 1AGFA 1P4LB 2X4PB 3VRLE 2EYSA 3IAGC 3KPSB 4OFYD 3X13A 3OZ9H 4JQVA 2OM5A 4ZOBA 2FHFA 3MGOA 5HHXH 3CK0H 2X2YA 3NVQA 5I18L 5D71L 3C5JB 1EH9A 5B3JF 1JGUH 1QYGL 1DQDH 2LTQC 3F7VA 4BJLA 5D70L 2B2XL 1U8PB 2QQLL 3VFGH 2ITCA 3WN5A 3L5XL 3IU4H 3CDFA 3KPMA 3CC5B 4MYWB 5ALCL 1VFAA 2CXGA 2H6PA 3BP7B 2FX8L 4PJAE 4JQIH 1NUGA 1AR1C 2FSEA 4XNMB 3KJ4C 5D2NB 1PX3A 3QFJD 3V8CA 3TWCH 1RZ8A 2NX5E 4F7PB 4L8SC 2X89D 5IVXF 1GC1C 4F37F 5I76B 4Q2ZA 3MYJB 4PTTA 1NBQA 1AH1A 5EBGA 4WEUD 3UTTD 5ESVA 5T3ZD 1JV5B 1YY8B 5IR1A 4GQ9H 3IRZA 2GFBA 1EUUA 2O61A 5I73C 4Z7UE 1CDCA 1E28A 3H0TA 1GIGL 4WTZA 4XH2A 4HV8B 4MVBD 1ITBB 3TBSB 2GEEA 1JTTA 2BJML 4NQDD 2XQBH 1CICA 2VXUH 1VEOA 3LEXB 3T0AA 2ZUUA 3O4OB 2QV2A 2JELH 4S1RH 3O4LE 3QIWA 5FUZL 2CLZA 5TQ2L 5GJSL 4Y5VC 1CLZL 1K2DB 3SDDD 5JO5B 4ZXBD 1MY7A 4YE4L 4N5EC 1XZ0B 4JN1H 4JQVC 1MFAH 1WK0A 2VLKE 1JZ6A 4WFGD 4JY5H 5C08B 3EJZD 3SN6N 1MH5A 3QQ4A 4P2QA 5DK2A 3OJDB 1IARB 2WK2A 5FO8A 5I19L 2IMMA 5C0FA 3LKQA 5HHNB 3TNMB 4RRPG 5DK0A 4OCMC 3TNNB 2F54D 2R2CA 3L5WA 3PJSA 3QI9D 4MS8D 5ICYA 4M7ZB 1JBJA 2WBJA 1JGVH 2B4CH 2X1PA 3ARGC 1MJJA 2VO5A 4JFPB 5LWYH 2R4SH 2NY1B 4OKVA 1JHTA 1TCRB 3CD4A 4JRYB 1Z2KA 1RJLA 1CZ8L 3LKPA 4GRLC 2VZSA 4EBQL 4BKLB 1T66C 5B4MD 1RJYA 4TN9A 5JPMA 2CK0L 1MFEH 1UACH 2BDNH 4I0PD 2YD9A 2HKHH 3LS5L 5E5MB 1MCOL 2V6HA 2CO7B 4L3AA 5KSVB 4TUKH 4PP1D 3PP3K 3FO9B 5DT1H 1EZVY 3P73B 4MJ5A 4UIKL 1PX4A 3MBEB 3FQXA 1YN7B 1BHGA 1RUKH 3L95A 1GZQA 5HYJA 2HLFD 4HBCL 3U1SL 1A5FL 4F2MB 4MJIB 4DVBB 1K5NA 3U9PH 4WHCA 4U6YB 3BGMA 2XKUA 1MI5B 2X1WL 3T0XA 4TNWF 3PWLA 1N6QH 4IIQB 3S5LB 3WE6A 4P5MA 3JWOC 5KOVC 3KVQA 4G6KH 1NBYA 3BPOB 2QSVA 1FYTA 1AP2A 4QTIL 2W0PA 3HPJA 3I50L 4ERSL 4R96A 3V2AR 4OKDA 2MCPH 4L4JA 3C5ZB 2RGSA 5JDJA 2R1YA 5DMIH 1F90L 1J1PL 1VEMA 5GGRY 7FABL 3GRWH 2ESVB 4MDJB 2PYEE 3RTQB 2ORBH 1HIMH 2MNUA 2OXHA 3ARBC 3QCUH 1S9VA 5EU3A 2QSTA 3F6LA 3VE0A 1GVIA 2DQEH 3VXQA 2WW8A 4YXKH 4YFEA 2F58L 1S9WA 5LGJA 1UWXK 4DN3H 5HXMA 3TZVB 3ARGA 3E1F1 4LSRL 1NPUA 5ILTL 3UYPA 3R0NA 1EEYB 3FT2A 4XBPA 5A2JH 3E8UL 1E6JL 3N0PB 3TA3D 1FG9C 5DVKA 2UV3A 2Y5TA 1NDGB 4QT5A 5ADPL 1WIOA 3IDGA 5GSRA 5L88H 1GHFH 5IB5A 4TQEL 3NZHL 5IWLA 4ZSOE 4OB5H 5DF0A 5FUZH 1AGDB 2YUWA 2VQTA 4H8WC 1H0DB 1HXYB 5ECJE 3UZEA 4HUWB 2VZOA 5I1AA 3VWKB 1JGEB 3RVXC 3RJDA 1IFHL 4KJQD 4DW2L 5ERWA 2BOBA 3VH8G 3U6RB 4PJBB 3HE7C 2Y7QB 2VDPL 4XPBH 4N0UA 2W60A 3H9SE 5LGHL 5CJ8A 2OTWA 1KYOK 1MCIA 3DARA 2YD5A 3MBEC 4PRNA 1XF3A 4YBQC 5INDA 1TZGH 1JZ5A 2DOCA 3HZKB 5CMAA 4JB9H 1VFUA 1FNEB 5CIPB 4PRIE 1LP9F 3RU8H 4JDZA 5SX4I 2FEDC 4YPJA 4F33B 4UILL 2YA0A 3CAFA 1WF5A 1I7ZB 3VJ6B 4UU9B 1G0DA 4YPGA 1UQSB 3D25B 3JZ7A 4QHNA 1KEGL 1KIPA 2XNAB 3SDDA 2A77L 3QO0B 2VNCA 2DTSA 3T2OA 1OT2A 3VFPA 1D5BB 3VD3A 3NCCB 1NMCB 4P5TD 4CU7A 3ULVH 2R56L 1F00I 4QHKI 4KVNH 4HGWB 2ZPKL 1S7WA 3JV0A 5F8QC 5LBSL 1FVCB 3MQIA 1UEYA 3ILQD 4QHLA 3NCYP 3DO7A 1WQVT 5EO0B 2VABB 3O3EA 4PB9L 4APQA 1QSVA 1G7HA 2Z91B 4X80L 3VRIA 4IDJH 3P30L 3IVKA 2R69H 3RY4A 1RURH 1GJIA 1CXHA 3ULVD 3L5WB 1MWAB 3M07A 2NY6D 3P9MB 3M17A 3UTQB 1MRDH 2AK4A 3O4OC 1E4KA 4K71B 3BW9A 4ZOCA 1MPAH 4UT7L 3UXFA 2H26B 5D5MB 5CILH 5FB8B 1CFQA 2L7JA 4XBEH 6FABH 1J8HE 2J1KA 5F7MC 4GAYA 3S37L 1JNHA 4BQBA 4EIZC 5BW7C 2ZCKL 3IJHA 3T09A 5EBLB 1DN2A 3OXSA 3O6ML 1IAIM 1RZ7L 4HCRL 3B5TA 5DURD 3TBVA 1CF8H 1MVUA 2DTML 4P3DB 2R0WL 3D0VB 3C9NA 2P24A 5MP6H 1PSKH 2GHWB 4IBLT 2ZSVA 5DZOA 5D5MF 4YGAB 1QR1B 4YO0B 4JM2F 3IDJB 1GC1L 1T21A 5F6HJ 3V6OE 2IALA 3S96B 2Z31B 3KLHD 1XF5A 5DUMH 3ETBF 5IHUL 2DWEA 2V7HB 2BHUA 3REWA 4PD4J 1MJUH 1YNTA 3ZZ1A 2KH2B 4Y7MA 1FH5H 4KKAD 3HMXL 3INUL 4E5XB 3ZO0A 3P4MB 3WKMH 3D48R 2ADIA 4UQ2A 5JHDE 4G6ML 5DO2C 5GISL 4HMEA 1YJDC 5JW4Q 5E1AB 5HTSA 1HSBA 1YEJL 3X3FL 3OKMB 2APVA 2R0WH 4YDJB 2YKLL 1FL5A 4IJ3C 1M6OB 5I1KL 3UTZA 5CP3A 3FOLA 5TGBA 5IQ7H 2P5WD 3TIDA 3PF2A 1QFUH 1WFUA 3ULVE 1QLRA 3WUWB 2LVEA 3AS2A 3G6JB 5IJKC 4LIQE 3QDGD 1KPVB 5A2KH 2X4TA 4JG1H 1PG7W 5IBUG 3E0GA 1OWWA 4NO3A 1YYLH 5BW7A 2F19L 4W6YB 4HUUA 1AGEA 3SDAB 2CR3A 2YR3A 2EYTB 4OM1H 1HH6A 3FMGH 3V5DB 4ELME 3LN4A 2GSIB 1F8TL 5DVLA 5C0IB 4XI5D 4ZUSB 3F7VB 2J8UE 4KZEH 4Y16A 4NUJB 4I0PC 2E7BA 3NCBB 3H3PH 3FO1A 1VFAB 1R24A 1FAIH 2VN7A 5FYJH 4Z7QF 3WKNA 5GGRA 3GRWL 2HJKA 1KIRB 2ORBL 3QQ3B 3RVTC 2IPTH 3TZVC 4DGYL 5KSUB 3OGCB 2Q7NA 4H88H 3WNLA 4ETYA 4UQ3B 4P4RA 3KLSA 1U58A 3BKCH 4NNYB 4M1GL 2C1OA 4JLRB 4U33A 3MRPB 5T3ZL 3KJ6L 3G5YA 2JCCA 4QXUH 5BXFA 3O8XB 3VXPB 2DQJL 4JFFB 2NY5L 4X0KA 2X10A 3G5XB 2GFBB 5IR1B 2RIKA 4KRLB 5E8DL 2ZOLA 3VXSE 1I9EA 4LVNB 5EOTA 4B7LA 4K9EC 1BQSA 4QHMA 5SX5H 2FIKA 3EOBA 3I75B 1UM6H 3BGFB 1CG9B 2VR5A 3V4UL 2AK4D 2DQCH 4CW1A 3QHZL 3SDCD 3FQNB 3L3HA 4HK3N 1YQVH 4KHXL 5DO2D 3C2AL 4PJHF 4ZUSA 4QXGL 4Y2DD 4LRIA 2J4WH 3MXWL 3U83A 4UIMB 4ALAL 4OLXL 5FKPB 3LH2H 4H5SB 2IPKB 1JUFA 5FKAA 4M7JL 2G5BA 1G6RH 4Y2DA 2Q76B 1FAIL 4PGEA 1ND0B 2QADC 2JIXA 4YHNA 5HGDA 4G7YL 4IRZL 3VG9C 3ZYZA 5IEHA 3ARTA 1SM3H 5FECA 4EZMA 3HZYB 4S2SA 4HIXL 3KNBB 1T0MA 2CDEA 2VL5B 2W0FA 3EOAA 1WCBA 1F2XK 1NSNL 8CGTA 5K59F 3TFKD 4MJ6A 3VCLA 5AZEH 4AEHL 2BVQA 4OZFB 1IGYA 1QO3A 2MJWA 3CSBA 4OGXL 2MQ0A 1AGCA 3O2DL 5E8EB 1IZJA 4OTXL 3ABZA 4FTVE 2JCCE 2JF1A 4ZFOB 2CDFB 1KT2B 1EEZA 1XH3B 1GGBL 3O41B 1WFTA 3HC4L 4XVSL 4FZ8L 4O9HH 5E6ID 1TTGA 5JA9A 5ITBL 3DRQB 1JWMB 2Y5EA 2BHYA 4MX7B 3V95A 2O5YH 1ORQA 4B53A 3MR9B 3E6HB 1BD2E 1N2RA 4R8WH 4O5LH 3UTPD 4CVXB 4OV5A 4WJ5B 4GS7B 3OB8A 4M6ML 4PJ5D 4MZ3A 1BQUA 3K4ZA 4N5ED 5L2KD 1T5WB 1TJHL 3GHBL 3DROB 4QXGH 1UH4A 2X4OA 4PJ9D 1Z3GH 5KVEL 3BZFB 5CWSB 4O9HL 3U2SA 5IGXL 3TN0B 1J10A 5EU6D 4Z7OE 4PTTB 5ISZB 5L2KA 4FHBD 4LHJB 4QYOA 1YNLH 4FQIH 1DVFA 4F8TA 4DWHA 3LDBB 3EJYD 1ZT1A 4LRIC 4QLRA 3VRLF 1YMMA 4NM8H 3OKLB 4KQ4H 4DKAA 4OZIB 2V7NA 3I02A 5I73B 2EE9A 5TDOB 2XKSA 4HJJH 4U6VL 5D72H 3T4AA 3LS4H 5DMKB 4NHCL 4F9PC 4O58H 2GJJA 1KV3A 1QQDB 3JV5A 4K7PL 4Q74A 1DEDA 4ODTH 2Y06H 5E8EA 1CWVA 4TSBH 3F6IA 4L4TE 3QFDA 3KYKH 5EO1B 3QDGA 4AEIH 4X6BA 3TA3B 5DJDA 3FZUC 2VSDA 3Q1SH 3RVUD 1LQSR 2OR9L 2W91A 2A0LC 3ALPA 3DUSB 3KJ4B 5D2NC 1WAAE 1NBVH 4MVBC 1KJVB 2FH6A 4LMQE 5INCA 2IF7A 3VI4E 1HXMA 4N0YL 4JPIB 3BVNB 4NQVA 4IOIB 4J6RH 4XXDB 2YPLB 3H7LA 1KTLA 3LVEA 4NSKA 3RGVD 5F1IB 2GJ6E 2NX5D 3DGCR 1DUYB 2BCKA 1T7WA 1IC5L 1NGYB 4PY8I 4FXKA 4PRDB 1V3LA 2KBGA 2UVEA 4J3OC 2AJSH 2K1MA 1LEGA 1B6DA 2ICCA 4I9WD 2VLRD 2BOBB 1UKTA 1K85A 1J0KA 2HJKB 4WFHD 3EHBC 1AJ7H 2HJLA 3KYNA 4LRNL 1MEXL 5D96B 2N1KA 5KAQG 2VDRL 5KJRH 1ACYH 3QIBD 1NGWA 1CFNB 2NY4B 4LCYB 5TFSH 3RTQD 1RUPH 1I9RL 4JFHD 4K7FB 3T2NH 2CIIB 3QEUA 5D7KD 1MHEB 3N50A 3BKCL 2X1OA 2X89A 3O6MH 3BOVA 1S7VB 1II4E 3TVMB 2SEBB 3RUGE 3BPCB 3IJYB 5C0AB 1P4BL 3MOBL 4OTXH 4ZS7L 3TYFB 4PJGF 5IFJA 5TE6H 1QUNA 4LSPH 3TBWB 4PJCB 4RZCB 1WITA 5IVZB 2F53B 5E5MA 4JB9L 4KZEL 4MXVF 2PR4L 3O0RL 3DNKA 5HHOB 1T2QH 4XHQA 5IMKA 5IROC 5E99H 4BK5A 1F3DH 1F4AA 4O2EB 4U1JB 3IDIA 4HW6A 1TMCB 4I3SL 5IV2A 1CICD 4KKBD 4XTRC 4I18A 4AG4H 4NQTA 3UBXA 4X9BA 5C0ND 5C0EB 4DTGH 4P46C 2XWTA 1NGPH 2Z8SA 3I6LE 4ALAH 1TXKA 3ULVL 3VXNB 2JIXB 1DQJB 4ORGB 4TVPD 1MCKA 3GB7A 2CPCA 2D7TL 5T1LD 3Q3GB 3VXMD 1PZ5B 3PIQA 3ZYOA 4F3FB 2QSCL 5KJRL 1BLNB 5IMOB 2CIIA 4GRWB 3K2MC 3CLEH 2NTSP 4Y19B 4S11A 4IRJD 3TLRA 3DVNB 4ONOA 1H3WM 3CFKB 1BFTA 2FCBA 5D1ZC 1V7ML 1NCCL 5DTFB 2OK0L 4FMKA 3K80A 4Z95H 4U05A 3NACL 4YIQB 3P0YH 4YFLF 2IMNA 1UACL 1DE4A 1WAAF 2VKXA 3BJ91 4LAQL 5JMOC 1FZMA 3VXUB 3T1WA 3SBWC 1KEMH 3V0VB 2A2QT 1ZHBB 4LEOB 4KROB 3MJ8B 4WUUE 4JFOB 4NP4H 3QNXA 4RQQA 5I30H 3HMXA 4QOKB 1RHFA 4WI7A 1IGMH 4D9RD 1JF1A 5DUPL 5CGYD 3D5OF 4CMHC 1T21B 1MELA 3HR5A 3QULA 3MV9A 3PHQB 1ORSA 2ZUQC 2OTWB 1T1XA 1S7QB 1EXUB 3QRFM 5D1ZB 2BERA 4HSQA 2PTTA 4G6KL 4WV1A 3C6LB 3S5LG 2VQ1A 4JFFE 3RAJL 2EIEA 2MPAL 3LKOB 1X5JA 3QPQD 3OAUL 3QXVA 1Y18A 4WFFE 3EYOA 3HAEG 2W60B 4MQSB 1T3FA 2EDJA 3NH7L 2A38A 5D4QA 5IBLC 3QIBC 3BUYB 4OLVH 4CBPA 4G80A 3UTSA 5T1DL 5AUMB 1JMXA 3PWLB 4X6CB 4N0FA 2OR8A 2IQ9H 4KZDL 3LN9A 2Z92A 3MLTB 2DQEL 4KDVA 4I77H 3QXTA 4K23H 1IGFH 3L5HA 4P57B 4LNRA 2NXZD 1AD0B 4PD4K 5D7LB 4AEFA 4ZS7H 1I7ZA 3VJ6A 5FYJE 5H2BB 1DUZA 5EU5B 3L3KB 1LGVA 2DMBA 4P2QE 4JFOA 4M62L 4KXZI 3C08H 4RDQF 3QEQD 1ZTXL 5H94B 4RAUB 3WIHL 1SJHA 1JZ3A 3OF6A 4U4BA 1SEQH 1MNUH 5GZND 4HPYL 2VDNL 4YDLB 1WV7T 5J11B 3ZDZE 4WI8A 1UADC 2V17L 3RUGB 1ZANH 2IG2H 2D9CA 3S36L 1ZLVH 5CZXC 5FO9A 5CKGA 4LCIH 1NCAL 3WFHA 1J05A 1RD6A 1KCUH 4HKXA 4OF6A 3RL1A 5AZ2H 1M1SA 5JOPD 3DXAE 3S88L 1OSZA 4HDIA 3HZVB 4X7TB 2A9NH 3UJJL 4PY8J 2H26A 5D5MA 2VDLL 4G8GB 3DTXA 3O8XD 2NTFA 3OAZK 4HWEL 3G6AB 2Z31A 5TQ2H 3H3KA 5F9OH 4EXKA 3P9MA 5FYKD 4FXLA 4K7FA 4W4OC 3W0WA 4MB3A 1MUJA 4PIRF 4X5XB 1ZTXH 4Z7VE 3WIHH 5T1MB 3S37H 2P8MA 5IQ9A 4NBYB 1DBKL 2RB8A 4FQ1H 1N8ZA 3IJSB 3SDCB 2APTA 3NGBB 3MUHL 3P4OB 1YYML 3WIIL 1KG0A 4R0LA 4PGJA 4Q9RL 1C5DB 4BUHA 3U7YL 3QJFA 1CL7I 4GRWE 2MKLC 2ITDA 5CZVH 3N1MC 4JM2B 2FJHB 4LQFL 3HNSL 2UUDH 4OCYL 5F6HI 2FATL 1C1EH 3MMEA 3SQOL 1BZ9A 3T0EC 5L2JA 4JZNB 1DSFL 1IC4L 2UZYB 2YA1A 3HMWL 5E2TH 4NHUB 2VDKH 4FQJH 1IAOB 5KVFH 2HYMA 5A3IC 2YZ1A 4BSVA 3QQ9D 4GKZA 3OV6A 2GY5A 4FP8H 1MJ8L 2Q6WB 1MFAL 4JQXC 1XGUA 1QFPA 1RURL 3MUGB 3QB7C 2J6EH 5CEZH 5MI0B 4LPXA 2GUOB 4Y4KB 4QRPB 1A1OA 3I84A 4P23B 3N06B 1C08A 2P7TB 4TULH 5ITFA 4HFUH 3VU2A 1PZ5A 5IBUB 1PJ9A 1Q0XL 3OPZH 1S7WB 1CE1L 1RPQA 3WLBA 3SO3C 1OW0A 3WHXB 1K4CB 4P4KD 3B3IB 5KW9H 2E7LA 3DVFA 2CLRA 1RZKL 4XGZB 1YNKH 1CFSB 3T4YB 1MCNA 5KSUA 5HVHC 4QTIH 3MLUH 2CLZB 5L0QB 1BF2A 4GBXD 1J11A 4MD4B 4NBXB 1UB5B 5J1AB 2AAVA 5IT2H 3FZUD 4QRPE 2QHRL 3L9RB 4RDQG 4X7FC 3QG7H 1B4RA 4DGIH 1JHTB 5HGBA 3B9KA 3MV01 1NUNB 4YHLH 4L8BA 2EDXA 3DX9B 4OGYH 3SDYH 3RVVC 1EJ6A 3ARXA 4HEME 2FRGP 2AABH 1EDQA 4JPKH 4MA1B 5J1SC 4P2QD 3RX7A 1FV1A 1AXTL 3WEXA 1ED3B 1A1NA 3WMSA 1UH2A 4PGCB 4OLUL 4UOW1 4IMLA 4H88L 3IFPB 1X3DA 3WL9A 4P23A 1DTUA 1AI1L 1X4XA 3QQ3A 4JVWA 1NEZA 1EAJA 3WHE0 3GUTB 1N26A 4XPGH 5DMKA 2IADB 3VMNA 4ZXBA 1IQWL 2IPUK 5I74C 4CVWA 3BGMB 3GO1L 3U36B 4L4VB 1Z0MA 4RGNE 1UJ3C 5C0BA 5D7JC 1T20A 3I75A 2OX5A 3VW3L 4YHIA 4WWKC 3UTTE 4MD5B 4LCWE 1FFOA 2VL5A 5DD1L 4CADB 3MRFB 5AD0B 4QRSB 1A3QA 4H20L 1MCCA 3D85D 1HWHB 4KI5E 1U36A 5E6IB 4BQCA 2G2RB 4R4BA 5H37G 4OZIF 4XP5H 1E28B 4U6YA 3AREC 1QEWA 2YPLA 1H3GA 3FN9A 1U8NA 1HDMB 3KPQA 2Y07H 5EU3B 3FRPG 1A6UH 3OAYK 5J8OA 3U7YH 3BEVB 3RKDC 2VLRB 5E5UB 1AO7B 5EBWA 1JYNA 1N64H 2WBKA 4PJ9A 5KTEL 4M5YL 4ZUTA 3EOAB 5IEKB 5JW3L 2VR9A 3DWTA 1I7UB 4EOWH 4OLWH 2OZ4H 4XBPB 2AEQH 1D6EA 4R8WL 3EYVB 2VLLA 3FB8B 4CJ0A 2NLJA 3U7WH 1VHPA 1SVCP 5FIEA 4CMMB 4Y2OA 4Y1AB 1NL0H 2IADA 4ZXBB 2WNGA 2BNRD 2BC4B 4UV7H 1INQB 4M61B 1H3PL 1X5FA 3AREB 3WFEH 1UM4H 1NCCH 1T5XA 2HT2C 4ZNEA 5KSBE 5C08D 2QR0B 3FT2B 1ZXQA 3BD5A 4HXBH 3UZVB 1M71B 4ZXBC 3WO4B 3MRFA 1XAUA 4YXHH 1U8LA 2Y7QA 3MV7A 5FO8B 1J1XL 1DP0A 1CGSH 4XZUB 5F89A 5TF0A 3FB6A 1XR8B 5EOQH 3MV9E 3WD5H 2AEQL 5KS9B 1T89C 3V9FA 4KUZL 5HSFA 4N8PA 5I74B 3NZ8B 4LK4A 1LK2B 1N2RB 5DI8B 4GKSA 5J9PA 5AYUL 4MA1C 5F96H 1VFBA 2NR6C 2NXYC 3NN8B 2B8OT 2Q7YB 3EDEA 3T3MF 4RMVA 5IEKA 1MLCA 2C5DC 3I02B 4PJ8B 1RI8A 4HG4K 1Q38A 5EZIL 3ARGD 3U46B 3T2PA 1FBIL 5JLZB 4HF5H 1PKQE 4MQXC 3FT3B 3PWNA 3OKNB 3OMZA 3QDJE 3MROB 4NM8L 2FIKB 1OTUD 1FPTL 3PDDA 5KS9F 4PJ9C 4KKCD 2K7PA 3ZTNL 3K0WA 4EI5A 1ZKAA 3U30B 5AWNL 4OFVA 3MACL 4G43A 2R0LH 5ESQB 5E08L 4BK4A 1YN7A 1BFVH 1I1CA 4NPYB 1ZEAL 3FAXA 5IMOA 3GMLA 3S4SA 2DIAA 1A7RH 3MFGB 3IKCB 4M8QA 1CXFA 1P7KA 2A74B 5I8OH 3DVIA 3A6CH 2AI0L 4RIRB 1RZ8B 4J8RB 4APQB 1UXWA 4S1QH 1IE5A 4BM7A 3K2UH 4WWKD 2NMSA 2ZUXA 3T8XB 1IQDA 3BMWA 3DSNA 3FQTB 1IGCL 4XWGL 1HYSD 4FZ8H 5E00B 5HVGB 3OKYA 3G5VB 4M9PA 5DJXA 3DV4A 3GI9H 1KTDB 3HTLX 3O3DB 3B5HA 1XGYH 4PRIA 4N68A 5I8OL 4BA8A 5BS0A 5C0BD 3NAAL 1D9KA 2DQFB 2DQIL 1IM9A 1MCFA 3KYOA 3QR2A 5F7EL 1NGXB 3QDMB 5FGSA 3CIQA 3E8UH 2XA3A 1G7JB 1M7IA 2WINA 4UI2A 5D5ME 5EOCL 1KPUB 2W9EL 5E94B 4DGVL 3KNBA 4K3JH 5GS1A 2EEBA 4CL7A 3AFLA 2UWEF 2E5EA 3OR7A 2OQJA 4BYHA 2KPNA 4OFKA 4QY8A 2AKRA 5IMKB 1TENA 1A0QH 4OV5B 1RMFL 5E8DH 4P5KB 1GGTA 3VXUE 4YO0A 5EC2A 3WFDL 3MLVH 5ALBH 1HQ4B 2NXZB 5EU4A 3VGAB 1A1MA 3SCMA 1HXYA 4YEEA 3P9LA 3QEGL 2AJVH 1MRFH 4FQ2L 4AH2A 1QR4A 4LSQL 1ZK9A 3TNNA 4MAYC 4FMFA 3N1GC 5DJ0A 3AAZB 3FOMA 4AEIL 3DSFL 4F15C 3BPCA 3NA9L 3OX8B 1FO0A 1FJ1B 5BOPA 5HI5C 1AHWA 3MLYL 3V7AG 3IF1A 3K1KC 1L7TH 5J6GA 3L5JA 4I48B 5C0RH 1A3RL 3VXUD 5E1AA 4OKVB 4BFIB 5KVGL 2KKQA 1FYTD 5C08E 2Q3AA 4KRPD 1XF5B 4MQTB 3LHPH 2XA8H 1XIWA 4GKNA 4PJ7F 3LPWA 2YEZA 3M8OL 3ARBA 2OSLA 3PV6B 4QOKD 3O2DA 4JEGB 2FYYA 2M26A 4PJBE 3S3JA 4UNVA 1WZKA 4TVPE 3GSXA 4HIHB 4HS8L 4FTVD 2DBLL 5DEGA 2FR4B 1DBJH 1TJHH 3AS3A 4HLJA 3U6RA 4JFED 4G8GD 2BNQA 3NIFE 3UBXB 4FG6C 4GSDL 1QFWM 1J8KA 2AXJA 1IGTB 4PRPE 1L9NA 3DVGA 4FQPA 2RFXA 3BGAA 2AV1A 3H9HB 1J87A 4E9LA 4TNVF 2YC1B 5J11C 4FFYL 3CFKA 4XXDA 3MCLH 4OBRA 1RUMH 5DMGD 1AD9B 3T3PF 4C83B 4UTAL 4F57L 4Z7VB 1KTRL 5D1XA 2OP4H 1PQZB 3HPJB 4XMPH 4DKDC 1FZKA 4U7MA 3QFJA 4X5XA 4OJFL 5F97E 4ZFZA 1WTLA 4LPCA 2EC9T 4GW4A 4JGJA 5JIHA 1M71A 1H3VA 5IT2L 3QRGH 5ILTH 4D0DB 3HE7A 4U3XA 2BNUA 5I15H 1KEML 1G9MH 3NCJL 4ODBD 4PLNC 3UTSB 4JZOA 4MQ7A 3RPKA 3EYFA 5IVXE 1OOAA 3ZDXE 4I2XE 2NNAB 2BRRL 4XAKE 1CDBA 3RWDA 4QHLB 3FN0L 3OGOE 3GMNA 4P3DA 3ARYA 5CEZD 1F42A 2XN9B 2VLJD 4LNRB 4P46D 1R5IB 3U7WL 3MA7A 3DURB 3B5GA 1BPVA 3A6BH 1J88A 2HT4C 1G7MA 2AXHA 1GYAA 2YBRA 1XIWC 3V4PL 5IMMB 3HC3L 2GSGB 4PJXE 4WW2F 3MXWH 1IGTA 3AB0B 2P45B 4HK0B 4LGPB 1P5UA 4FOMA 3PWUA 4NM4L 4O2CA 4Z7UA 1NH6A 3BP6A 2H2SD 2C3GA 3V52L 3RL2A 4KROC 1QOKA 4JCMA 3TBYB 3VFVB 4PRBA 1QFWI 4ZQKB 3WIHA 4C56B 1I8KA 4U3HA 4AEHH 5DMGC 3U4BH 3FQWB 4NZTL 3H42H 3DXAA 3OKOB 4YXLH 1CE6B 5TE7H 4P2CG 1FO0L 2VRAA 1DN0B 4BSWB 2BK8A 4QXUL 4FQHA 4R6UA 5DD6B 3ME0A 3G6AA 4YGVA 3TCLB 4PJAF 1VERA 1EA9C 1UG9A 4I3GA 5I1GH 3KPLB 1G6VK 2YUXA 1HI6A 3MLSL 1DBAL 3RNKB 1ZA6A 3V5HA 2XQBL 4PGDA 5FYJU 2B1HH 3BQUC 4FQXD 1FFPA 4NP4L 1OAUH 4AT6B 4LDOB 5M7QA 4DCQB 5DUPH 1J8HA 5HGDB 1EEZB 1XH3A 4HT1L 4QHNB 1JTOA 2X4UA 5ENWA 3QUXB 4N8CH 5ACZA 1AQDA 3ARDC 3GGWA 4YHOL 4NN5C 4MQXD 5DEZA 4P4KA 3EOYG 3T0WA 1M7DB 3D3VA 1UVQA 1VGEH 3WXWH 1I1RA 4MWFA 15C8H 1VADB 1KCKA 2BVQB 4HUXA 3SDAD 1R6VA 1WGOA 1ZHBA 1BLNA 1GOGA 4LAJH 3C5ZC 3H42L 4YXLL 4NO3B 1WBYB 1WT5A 2EH7H 1DDHB 1XR9B 4DKEL 1J0JA 3LKRA 3EOTL 3D2UD 4UTAH 4PLJD 43CAB 4MA3B 3JWOH 4FRWA 1MIML 5ALBL 5D93C 3U9UB 1FNAA 4NCC1 2ITDB 5GGRB 5IB4A 2FIRT 2R2HB 5ADOH 4K8RH 5EZJB 2VZ3A 4JFFA 4EBQH 3VFUB 3NPSC 3VD4A 4GG6E 2EXYD 4JN2A 3CSPA 1HHKA 2YPKA 5BRZD 4HJGB 1DQQA 1F4XH 5E24E 3HPLA 4FQCL 4JFFD 4FTVA 1KCVL 4QWWD 3NCJH 1S7TB 1UWXH 4K3JL 3JWOL 1MOEA 1EXUA 1XF4A 3SKJH 3O9WB 3JUYA 3FB5A 2J6EA 3N85H 1V3JA 4NJ9L 5A40E 5DRNA 1IAOA 5IHBA 2Y4SA 2Y9RT 4FP8L 1QRND 1U91B 2VXVH 4LSPL 2MMXA 3CU1A 1FQ9C 1T83A 1BBDH 4RAVB 2NY3B 1QQDA 3MJ6A 4LSDA 4JO3H 4Z7OF 3BUYA 4G8EA 1RZIA 1JIBA 5CEZE 2JK5B 4NM4H 3CU7A 4RFEA 1LE9B 1YNLL 3FQNA 1PEZA 4ETQA 2PCPA 4WU5A 3IDYC 5F21B 1F2QA 2VISB 1P69B 1HEZB 1WZ1H 4PGBB 5IB3B 3O4LD 4G6AC 5DVMA 4ZDHB 4P57A 3C5ZA 5JUEL 5HDQH 3DECA 5D7IE 1FORH 2ADIB 2LU7A 4KTDL 3PE9A 5T3XL 1DVFD 4KHTL 3CDGA 1CT8A 5HGHB 3VFTA 3LMJL 2XI9A 4H26A 5FHBH 1VKXA 3PGFL 5I1DB 4UV4L 4Y16D 3GIVB 2K7QA 2L0DA 2YRPA 4GRWH 4NSKB 3N85L 2Z8RA 3VXQB 1A7BA 1VCAA 2G9HA 4ZYKA 3ES6B 3FRUB 4PJHB 1LEKA 2I9TA 4DVRL 3VW3H 4LCCA 3VCLB 2LABA 1GGBH 5DJZB 3RWGA 3QUYD 1JWMA 1XF4B 4MZ2A 3AM8C 2WZPD 4MD0B 3VA6A 3TO2A 3RL1B 1IC4H 2WQ8A 5KANG 2D0GA 2H2PC 5IOPB 3ZTJH 2CDFA 2FX8H 5MI0C 4LNVA 3O9WC 4HUVA 3X12B 1EPFA 4XXCA 1EO8L 5DQ9B 5FGBC 4LOUC 1A9BB 2DYPA 4U1NB 2CXKA 5C0IA 4L8SB 3D39D 1Q9WA 1S7SB 4XP6L 4KKLD 3IFPA 4L29B 5DS8B 4HPYH 4GXUN 4PJ9B 3UJTL 1VA9A 4DN4H 3GNMH 1BJMA 1OPGH 3ARED 1T66D 3LKNA 3FCTB 3PNWB 5D93B 3RWHA 3VI3F 4ZO8A 2YK1H 2NY3C 3SDCA 1CK0L 1TDQA 2R9HD 4XMLL 5T5NG 4JRXD 1URLA 4HJJL 1XGTB 3BZ4B 1BWMA 5E08H 5ID0A 4NYLB 5KSAA 1YECL 1T03L 1N59B 3NGBC 4OAWA 3MLUL 4JANB 1BFSA 3VXME 3PIQB 4BQ6A 4HWUA 3F5WA 2OI9C 2EICA 1P1ZB 1WLHA 1WBZB 4LLDB 1ZWIB 5T1KA 1GL4B 1VACA 1MFBH 4ZUWB 5A2FA 3IAPA 3TO2B 1CBVH 1N5YL 3BEWA 5D70H 1LO2L 1IGCH 5JQ6L 3W2DL 4NN5B 3VXTB 3WO4C 3HNSH 4OCYH 2YD7A 2IFGA 4KTYA 4HWBH 2MPAH 2E9BA 3BPLC 5BZWB 1FNFA 4ONHA 2VDMH 5BRZE 1H15B 3HRZA 1UENA 4RMQA 1QNZL 2J3SA 4NKIH 4NJAL 4NQVB 4JKKA 2EIDA 4LEXH 1YMHA 1ZA3A 4QWWC 5J3HD 4J3WA 1N3NA 5KVDL 1LDSA 4L8BB 1Q94A 2G60L 3S35L 3IVKB 1U8JB 2D31B 4JDVA 4G6FB 4YHNB 1DFBL 5IEHB 4YIQA 5DJDB 3DUUB 1O7VA 1G9NH 4PJDF 4UDTB 5AWNH 1ZVYA 4NKQB 3QEUB 4KRPB 4XP1H 1Z0NA 1YEEH 2R2HA 2XV6B 1IL1A 2O61B 5CBAA 1AGCB 1BVKB 4BZ1H 1NMBL 3BQUB 3MNVB 5CJQL 4Z7UF 3W9EB 4F9PA 1KT2A 1Z9OA 2JTDA 2EDHA 4RIRA 3QUZA 4QRUA 2MKWA 3PV6A 1CFVL 3BRFA 4MA7L 3PUCA 4ODVL 4NQSA 3PHOA 4OBSA 5E2VH 3C6LA 1AGBA 1TFHA 3ROLA 1CGTA 2AQ1A 4YFDB 3OAZH 5CEZL 2H32A 4LCUB 1A7QL 3SY0A 5L0QC 1KJMB 5K33A 4G43B 3KPTA 5ESQA 2VIRB 3PGDB 4Q58C 4X9HA 4AEEA 5EULV 4U1JA 1ZOXA 1BOGB 2IPUG 3FB7B 3SDAC 4CVZA 1P4IL 5F7NC 3J8F7 2VXTH 2IALB 3S96A 1EERB 4KJYA 4PB0H 2LVCA 5L6YL 4I3SH 5CAYB 3HMXH 1HNGA 1YEKL 5C0NC 1B4JL 2KZWA 1ZLVK 2P46B 1EVUA 1LE9A 3D18A 2Y36L 2FATH 3SQOH 3H8NA 1LEIB 2HFEA 5E70A 4RMSA 1W2KT 4Y4KC 2CMRL 2ARJQ 1ZV5A 5IFJB 1GGIH 1I85C 3F12B 2D7OA 1A6AA 1BX2B 1T0PB 4PJCF 4Q9CA 5DD0L 3HS0A 1QZ1A 2RJMA 3DETD 1FORL 4W68A 3NFSH 3MRCA 1SY6A 3HNTL 4OZFH 2JJVA 1OGAB 5CMAB 1QBLH 5FUOH 2XN9D 4I77L 1T0NA 1HHIA 5C9JB 1MQKL 3MJ9A 1JP5A 4LCCB 3UP1A 3O2DH 2XQYK 2Y07L 4MDIA 1BBDL 5C86A 1MFBL 4X4ZA 4EUPG 2Q20A 4L4VE 4RGNB 5FO7A 3QNXB 4RQQB 3SKMA 1BJ8A 4UNTA 5TE4L 4GW1B 3K8LA 3DX6A 3ZE2E 1WUNT 4M7LT 2Z4QB 5KS9A 4LCIL 1SY6H 1QHOA 4HGWA 3PQYA 4PB0L 1JFQL 3IDMB 3OHXA 4G8IA 2NW3B 4JKWA 5BV7L 5DVNA 2PKDA 4KKAC 5IQ9B 4NUGH 2FH8A 3MA9L 5EFIA 1G0YR 1WZMA 1MLCB 3ULUH 1NCBH 5SWZE 3TJEL 5SWSB 4G6MH 5GISH 3EBAA 1XCQA 3P3YA 4JFHE 5ADOL 4JR9H 1ZE3C 4FZEH 2B1AL 4NO5B 3Q0HA 2VLJA 4P46A 3DMMA 1QG3A 3IFNH 1MHPL 3BT2H 4ZODA 4X6CA 5GGQL 3T0EB 4FQXB 2GUOA 4Y4KA 3ZE0F 1UWEH 4IRJC 3SEPA 3NPZB 4PJ7B 3U0TA 4OGYL 4XRCB 3T65B 3UCRA 3V5HB 4M00A 2ICEB 4BSVB 1ZWIA 5T1KB 3EO0B 4POZD 5E4EB 3IFLL 4IOFC 4TRPL 3C87A 2E7MA 4JE4B 1RSFA 5SWQB 3ZHDA 5D1ZA 2HKHL 2FJGB 3LS5H 2W9EH 5C09B 2B2XH 2OTUB 4TUKL 4U0RC 5BS0D 1S5HA 4UV7L 4GW5B 4WO4D 3VWJB 2C3WA 2VXSL 3ZE1E 3P0GB 5LGHH 3GBNL 4MA8H 5GS0H 2RCSL 1ZLWH 3TEUA 3MV9D 1AQKL 4OCSL 1BBJA 1TQCB 2AERT 2V2XA 4L1HA 3HC0B 1HHHB 4M93B 1WISA 2Z92B 5ACMA 4KMQA 3ARFD 4G7VH 1CI5A 5L7XH 4OCRH 4WNQA 1KIUA 4WI6A 2ADFH 2DL9A 1B0RB 5IP4A 1DANT 3EDKA 1D5MA 4TRPH 2EH7L 3KHQA 1QVOB 4JRXE 4HX1B 1LO4H 5ANMB 1R3LA 4MMZC 2EDEA 3HKFA 2UY6A 4QRRB 2A6JA 5FK9B 4XRCA 3T65A 2EDWA 3MLZL 1A3RH 1PKQA 3IDUA 4XB7A 5F3HB 3X11A 5GHWL 1BZ7A 3NFNA 5DFWH 4PGZA 3WJLC 4OF0A 5LBSH 3T0VA 2VDML 3KXFD 2F54E 3UAJC 5GJSH 5I2IB 4CU6A 3MNZA 1NC2B 4LGSB 5MENA 4Q9RH 3RBGA 3U82B 1K3IA 2A77H 1I7TA 4F7TA 1WBXB 3HI5L 2NCMA 5J13B 3VWJA 5A16B 1LO3H 5E6IA 4G3YH 1HN1A 3JTSB 3LDBC 8FABB 4RGOL 4WI9A 2EYRB 4OLXH 3DO7B 4A6YA 4MHHI 1IKNA 4TOYH 2RCSH 1BAFL 2P8LB 3MRIB 5DSCA 1PVHA 2IWGA 3O81A 5D1QA 3WIFB 1T1XB 2HT3C 3HE6C 4WFFD 1RIVL 1DVFB 1FP5A 4OUUB 2VISA 4TTDC 5FEBA 2BZDA 3FO1B 5L6YH 5IBTH 1PY4A 1AP2B 3KDMB 4B5EA 4GS7C 3LRSB 2CH8A 3S97C 3BPLB 4OZGB 1RZFL 3EYSL 1HSAA 2DI9A 2CRIA 3GSQA 2VDPH 3MRHA 5HYQA 3UTTB 4RBPK 4PJ8C 3B9VA 1CF8L 1L7IL 4P23D 2PXYC 4LDEB 2J7LA 3BT2L 4NQCB 3ARBB 3LEYH 3UBXI 4ONFL 1I1AC 5C0CB 5LCVH 4JM4L 5F7WC 1T0NB 5C9JA 5HYIA 4GRLB 1SEQL 4KKNA 2FR4A 1U8KB 1XCTB 4ZAKA 3MNZB 4GO6B 2YRLA 4Y5XB 3L1OH 1EEYA 1FE8L 4YJZL 5IFHH 2FDBP 2XTJB 2GQHA 1WBXA 3CCHA 1CVRA 1U8MA 3VFUA 1K9TA 2AV1B 3QIUA 2V2TA 3MACH 5DHVA 5CLTA 1FLRL 4HS8H 4YEFA 2V9TA 4M4RA 1UB6A 4DFIA 5DFVC 2GTZB 3H9SA 4HKBB 2I07B 4OD1L 4E41E 4I4WA 1HINL 1BIIB 1EVTC 1OAZL 1W0VB 1OQXA 3BESR 2APXA 2FGZA 2ADJB 3STLA 1N0LA 4OUUA 5FYLD 4P3CL 5E6IC 1T7YA 5IB1A 3M8OH 1X5XA 4URTB 2JJSA 2G5BB 3QXDB 3EZJB 4M03A 1DDHA 3RBSA 3O4LA 5I1JL 3DBXA 1L7TL 5D96C 5L8JB 3B2VL 1FL3B 2C7UA 2OP4L 4UINL 4M6OH 3HE6A 3RAJH 5LJYH 3EJZC 4GMTH 1UJ3B 4LPVA 2IJ0C 2W38A 1I8IA 1P6AB 3F7YA 3MX0A 1WSST 3OL2A 5INDB 1YYMH 3RWCA 1NFDA 3BP5B 4OM0H 5GRZA 2D4DA 1GAFH 2XQYG 1Q72H 2NY7H 1WFOA 3FB5B 1UM5H 4ACPA 3SHSA 5F7DB 4P9HH 1U8KA 2ICWJ 3GJEB 4C54A 4LHUG 4PJ8A 4LIQH 5MHSD 1REIA 3DURA 4L5FL 1N6VA 3GJFA 5K93A 5EPMA 5I1EL 4ZUVA 4K23L 4PJGB 4HBCH 3AMLA 1QEWB 4R7DA 3QDAA 2DWDA 1I3GL 5C7XL 1RUQH 2IC2A 3GJFK 1OM3L 3D0LA 3MJ9L 3OXRA 5HHOA 2E6JA 3BKYH 4XMKH 4ZAKC 4YHYC 1SJVA 3FO2B 5B21A 5K9OB 3I2CH 1BD2B 3IXAA 4TTGA 2M1KA 1D5IH 3BISA 2IAMD 4FXGA 3TM6A 5B8CC 3BAEH 3LSOA 3A67H 4PRBB 1UZ8B 4OI7A 3HC0A 3O2VH 3QYCA 5JORB 5C92A 1ZANL 3N1QC 3S36H 5FUCE 1EX0A 4PBVC 4QYOB 2NY2B 2Z35A 5JUEH 1MHPH 3PGCB 5GGQH 3QA3A 3QDME 5CJXC 4YX2H 3BH9B 1YQVL 4KHXH 4GXUM 1B2WL 1JGUL 1KN4H 2ESVD 3MRPA 3G5YB 3I9GL 4JO2L 4OZIE 4WENB 3T4AB 2WBJB 1CT8B 1P7QB 1DQTA 3PHSA 1T22A 3MCKB 1BP3B 2A73B 4P23C 1IBGL 4JRYA 1GGYA 3TBTA 6CGTA 5LXGL 4Z9KB 4DVRH 4UT7H 4XNMA 4R4FH 3SCMB 4YHKH 3NFNB 3VGFA 5HHMD 3V6OA 4HWZA 4ZNCD 3MUY1 1YECH 1T03H 2FL5A 3SDXE 2KQMA 3S35X 4PJ7E 2YXFA 1NLBL 2MFNA 4LSUL 2PR4H 3LHPL 1Z5LB 1QTYT 5LQBH 1YEIH 1U8LB 5IFHL 3QEQA 4JG1L 4UOJA 5D6DC 2PXYD 1JN6A 4ZO7A 4OLUH 1QR1A 3EFDL 2DLGA 5CSBA 1U9KA 3RFZC 3F65A 2D0HA 1YMMD 2DKMA 1TCMA 1UA6L 1X9QA 5FKAB 3DX9A 3H6JA 3BEWB 4JCLA 3VFWA 4DKFH 4UT9L 1NKOA 1QRNA 3EO1A 3BWUC 3AAZA 3RZCA 1D5XA 4PJ5E 1IAMA 1UWGL 1IILE 4R96B 4G6FD 3HCVB 2V9QA 3QUZD 4C59B 4FABH 1J1OL 3BP7A 3L3GA 4L4TD 5B8CA 2H2PD 3CH1B 1JV5A 3QIUD 1TJIL 3FQUA 3LQAL 4OZFA 1S7XA 1VDGA 1J1XH 3FB6B 5JLZA 2DMKA 4D0CA 4G80B 2F5AL 2BRRH 3H9YA 2FBJL 2CLVB 5I1HH 1IJ9A 2A9MH 1A3LH 3IETA 3I6KB 2X4QA 1NCWL 2UUDK 4NQCA 5AAMA 2Z9TA 4LLYB 4MHHG 1EEUA 4Z95L 5I6XC 4S1SH 3GBLA 1GPOL 1AFVH 5FM4A 5DHXB 3RJQB 1MFCH 3HC3H 2ARJB 3KXFA 3CFDA 1IAKA 5MERB 1CDUA 3ZL4H 1SEBB 3SE9L 4U7SA 2DMCA 4V1DD 3VFTB 3M1BA 4XPFL 1M05A 2BSTB 4P59H 5GRXG 1D9KB 4LVNC 4M1CC 1LMKA 4JZJC 3LIZL 3DX6B 1R3KA 5JHLH 1LVEA 5FCUL 2X4RA 1G7QA 1MVFA 1NGQL 3UYRH 1I1FB 2IBZX 2WANA 1FH5L 4XHJD 1LP9B 4OCWH 3EOTH 3ZYJA 3BMVA 3RWDB 1FZKB 4W6XB 4KJWC 5F9WB 4QXTB 2IH1A 1J05B 4JO3L 4GRWF 4Y89A 3QUXC 2QADB 1IRAY 3VG9B 1R5IA 3BE1H 4JHBA 2EDBA 2VZTA 1OL0A 1SJEA 2LU3A 4L9LC 2E7HA 1VFMA 1BOGA 1IAIH 2V5TA 5MEPB 3FB7A 5KZCD 1RJLB 3LKPB 5K9QG 1R5VB 2ED9A 4F57H 4XC1H 1VGEL 3MRNB 1MHCA 1W0WB 5I66A 4MNGE 3HZKA 3P0VH 4EI5C 3BSZL 3GMMA 4L3ED 4F9LA 1S7SA 4JFDD 3K8KA 4XPBL 5KSVA 3C8KB 1R3JB 3K7UA 5ID1B 5JHLL 1J5OL 1NGXA 4OCXL 1GGCL 5D8JL 1MHHA 1HQ4A 3ECBB 4EN3B 4LKCB 1KELL 1P84K 1U8OB 3M1BB 4WY7H 1O7SA 2GCYB 3EO9H 2XG4A 3QJFB 3T1FA 4NYLA 2WIMA 4IIQA 3S5LA 1A22B 5J12C 5DD6A 1RU9L 2QQNL 4YGVB 1AHWB 4J4PA 1UM6L 5KSBB 4I2XA 1PLGL 3MC0A 2Z31D 5IVNA 3HUJF 3LRHA 1RMFH 2DS4A 3VD5A 1KCLA 4R2GD 3CFEA 2P5EA 1KCUL 5GPRA 1OF2B 4LKXB 5E0QA 3LSOB 4MLIA 3S88H 3MJGX 1G7HB 1RZFH 3VRIB 1S7QA 3VFGL 1MFDH 4KDWA 4X6CF 3FQRB 5JIIA 3CXDH 3NABH 2W65B 4YQXL 3OQ3B 4OGAC 4YR6A 5DGRA 2D7NA 1M7DA 1T0MB 2CDEB 5JW4R 2Q86A 1P9MA 1RZJH 5DEFA 43C9B 1A6AB 5E8OB 3QUML 5KW9L 1KELH 4KVCL 5JIKA 5DD3H 4ONGH 1ERNA 3OKEA 1ZS8A 3T0ED 4HKJB 5H37H 3O6KH 4AT6A 2B4CL 3BWAB 3O11B 5JW5B 1DJSA 2GJ6A 1FFNB 3GI9L 4L9LB 5ERWB 5I0ZA 5DC9B 2BSSB 1P53A 4N0FB 2FECI 4ZFOA 4OT1L 3F7PC 2D31A 3KYKL 2OL3L 3B9AA 5C0FB 5DJCB 3MZTA 5DZNA 5E2UH 4F9LC 1AGDA 1TZGL 3TV3H 2A1WH 5EOCH 3FMGL 2AJ3A 4MAYA 1MRCL 3LQZA 5BCAA 5I1CH 1Q1JL 5EU5A 1CQKA 2AV7B 2RAMA 4JFYA 4D0DA 4WJ5A 3HMWH 1ZHKB 3SJVD 5HI4C 5KVFL 3VRJA 4YC2B 5DMJB 3S6CA 4WW1B 2ICEA 3VH8B 4YBQD 1QNZH 4IIQC 5EA0H 4P99A 1GGUA 2W07A 4NJAH 4HZAA 5KVEH 1MIEH 1HQRA 5AAWA 4MXQD 4HWNA 1KLFA 3QEGH 1FN4B 3PABA 4XCNB 4KH2A 1HCVA 3JV6B 4LCWB 4JN2B 2R8SL 3OJVC 4Q0XH 3W0WE 3RVXD 1GGIL 2BVEA 3ARBD 4TSCH 1TCRA 3CDCA 1OLLA 3HNVL 2IBZY 5HDQL 5J6HA 4WUKH 4X4XA 5ELIA 3HC4H 1CIUA 2WWMC 2Y6SC 3J7HA 4LPYA 1U8HA 1MIEL 3AY4A 4QRRD 4YHZH 4P5TC 2E9JA 3TO4D 1NBYB 5CIPA 3RL2B 1NMCC 4IHOA 1A3LL 3ILQC 4X6DB 1TPXB 4U2ZA 1GCFA 1QSEE 5DQDL 3LQAC 4DQOH 4B7IA 4DK6A 3E3QE 1BX2A 4PJXF 3GDBA 4RMWA 1OQOA 3GZKA 4BFIA 2XZQL 4IEFB 4LFHG 4FNLL 4NWUL 5D6CA 1MRCH 2F8XC 2V2TB 2JJWA 3CFJA 4E42A 1NFKA 3MXVH 4ISVB 1A7QH 2COQA 2F9BT 3IU4L 2FO4B 3NCEB 5I16B 3X11B 5M94B 2R1XA 4K2UL 1I8MB 3VFNB 3GGWB 1H9VA 3MJ7B 5GIRB 1ETZA 4M8VA 1F4YL 1I7UA 5GS3A 4LVEA 3VD9A 4M3KB 5C07E 1FHGA 2C4FU 4P3WA 4RCAA 1RIHH 1VSCA 2X4PA 4AG4L 1NAMH 1L9MA 1EEQA 3C08L 3GEWB 3WNNA 3FQWA 4NRZA 1NCBL 4MNQE 5DFTA 2C3XA 1PG7H 4H0IA 4TULL 5GGVL 4YQXH 5DYOB 2KUTA 2O5XL 2WBJC 1I8IB 2PW1B 3K4DA 1I9IL 5B4MC 5JXEC 4ZTPL 1MWAA 1U0QA 3MOAL 1RIVH 4BH7A 1KTKE 4HUXB 3L7EB 2QR0A 3PWPB 3V6BR 4KJPC 1FFPB 5FFLA 3KHOA 3KR3L 1I4FA 1FCCA 1EFXB 2FEEL 4QRQB 4LDLB 3GMOB 5EZLB 2HFGH 3D2UB 4UV4H 4PY7A 4A6YL 5KN5A 4XNZC 5E2TL 4Y4FA 1U93A 3JWDL 3F58H 2HFFA 1E4XL 1OARH 2EKSB 1X5AA 3V6ZA 1R3IL 1HHKB 2DQTH 2YPKB 1MHHB 1G7IA 2BXZA 2Z93B 5HGGS 1KPRB 4P4KB 4P5TA 2VE6A 3O3AA 5DMIL 4DEPB 1QPPA 1MSPA 5AYUH 1YPZB 1PSKL 4E42B 3K2UL 1QKZL 4NQXB 3TBVB 4C4KO 5JQ6H 4XWOC 4FQXA 5SWZD 4JM4H 4NFBA 2JJUA 5MEQB 1IM9D 1KJ3L 5GGUB 3WSQL 2AK4E 2XWBA 3MRDA 3SOBH 1IGML 3PNWA 3FCTA 3MLWH 1PEWA 1E4XH 5ISZD 4HV8A 1UZ8A 1N6UA 3GSUA 1MCPH 4CU8A 1QFOA 2FX9H 1T4KA 1CCZA 4WO4A 2XWTB 2XTJC 4X98B 5JR1H 4ZUUA 4GAGL 4PJIA 2H32H 5HPMB 5F1NA 2CRZA 5ESVB 4TVPH 4OFDA 2OTUA 1JL8A 3NFPB 3HE6D 2FHCA 5FYKU 5EUOF 2L4OA 1CYGA 3W5MA 2QQQA 4N90D 3X14A 3UTTA 3HI1A 4PJDE 3O2WL 2CK0H 2FX9L 4PV8A 1P2CB 1KPVA 1R5WB 3O8XC 5B39B 2FB4L 2J88H 2JK5A 5IQ7L 1MQ8A 3RWIA 2EIBA 5IIEB 1RK0B 2CGRL 4YNYB 2VITB 5DK0B 2GITA 1HH6B 1U92B 3QUYC 4JFZH 1NC4D 3V4VL 1Z5LA 3C6SB 4Y16B 4XNYH 3E6HA 3TH4T 3M17B 3UTQA 3ZKNC 4R90L 2HT2D 4LBEA 2OMBA 5IWLC 5D7JB 2CKNA 1TTFA 4F7CA 3MRGB 2YSSB 1B3JA 3K3QA 4ZO6A 5T3XD 1M7IB 1BD2D 3ARWA 4X9IA 1I7RB 3QUZB 4QRUB 1LEKB 3R1GH 4LLVB 3DGGA 5DUML 3VXOB 3EUUA 5TH2A 3ZTNH 3C09B 3LPGA 4M7ZC 3MRKB 1CLZH 1XGRB 1NC2A 4ODHL 2PW2B 2BFVL 1YNKL 3MTRA 1A1OB 4ODUB 1DBBH 4HXAL 1SYVA 3L95B 3HUJA 1RVFH 3ZLQC 4RNRA 4UBDD 1R3LB 5FHBL 2NY4D 1MCRA 4Y1AA 2E9IA 1GSMA 3JTTA 3GJEA 9CGTA 5GGVY 5IW6B 3C5JA 3OAUH 2WBJD 4JFZL 2XRAL 4LL9A 2AEPL 2YMXH 3GSWB 4Y1AD 5D1QB 1U2HA 4KKLC 5C0AD 3OXSB 2VKWA 1BF8A 3B9EA 3GMPB 1X6LA 1MWAL 5DQJA 1G7LA 4EVNA 3W39B 3HFMH 1EHNA 3FAWA 3SCMD 4PG2C 1Q9LB 4FQ1L 4ZFFB 3TZVD 3SDDC 5INCB 2ZSVB 3C6SA 4KK8C 4HAFA 4DVBA 3KS0J 3VGHA 3LB6D 4WIQA 5I8CA 2FEEI 5D7SL 5JPNB 2HH0H 3IFOA 1TZHA 2F74B 2IGFH 4UT6H 1ZLSL 5JNYB 4PRPB 4X4YB 4JRYE 3R4DA 4GAJH 1CICB 5I16A 2R69L 1MCOH 1S5IH 3DJ9A 4HLZG 2QQLH 3O41A 3HZMB 1X44A 2DJ4A 1HINH 2J12B 4OQTA 4F7MB 1ZHLA 5DA0B 3GO1H 2HG5A 3VWKD 3ZDXF 2X40A 3RDTB 1U91A 3AM8A 2GK0A 2QBWA 4ELMB 4YDKH 2XOTA 5LVEA 4NNPH 2DYPD 3L3OA 4LOUD 1YN6A 2EDOA 4ONGL 5IB5B 1N59A 4KWUA 4JFDB 3QDJB 5DC0A 1T5WA 4X9GA 1K4DA 5CJOH 4V1DA 3MRBA 1FGVL 1KLGA 4Q6IA 5EOQL 4IRJB 1GZPA 4KUZH 4FQLL 4BH7B 4HWEH 4M1DL 3WNMA 5HVHB 3U0PA 5GS2D 3MUZ1 3C8KA 3IJYA 2DLFL 5EBMB 3RHWK 2P8MB 2Z8WC 2Q8BL 3JWNC 5H35A 3INUH 3ARFC 2UWEB 4A2MA 3SKOB 1S7XB 4WHYH 2CDGA 4HHAB 3EYSH 1FVEB 4P4RB 3ZDYE 3W81A 2ADFL 1FRGH 1K2DA 3QG6A 5JO5A 4PG9A 4GKOA 1Y6KR 5KSAC 1I3GH 1TQBC 5C7XH 4G8IB 5I18H 3I3DA 5DRWA 4HAGA 4M7LL 1T7ZA 3STLB 3BQUD 2DM3A 3HZMA 4ZUTB 3U0TB 3B9DA 1P4LA 4LVOC 1UYWH 1NCDH 1LK3H 3HRPA 5F3BB 1A2YA 2B1HL 3D25A 3LKQB 3GBNH 5HHNA 1QBAA 3DMMB 1RV6X 2WM0A 4JPKL 4R7DB 1S8DB 2BSRA 2O5ZL 1KYOJ 4GW5A 5BS0E 3Q5TA 2KDGA 4MJ5B 5BQ7B 5KZCB 4PV9B 2GT9B 2ZUYA 1U8QA 3FQUB 3RPIA 4MJ2A 1ZS8B 2VDOH 5F7DA 3RY6C 3VFVA 5AZEL 4OQTH 4A6YH 3VXSD 3S98A 2BVOA 1BECA 4D8PB 1P2CA 3BYYA 1JNLH 4X8XA 1F13A 5EIQA 4AH2B 5JXAH 3DSFH 4B0MM 1F11B 4K8RD 3F62A 5IJKA 2HTLD 1SQ2N 4KUCF 2CDGB 1OP3H 3VMOA 4QGYA 1OAKL 3VE0B 4LLQA 4OAWB 4OD1H 2VXUL 3MRQA 1MCWW 3ZKSD 1EGJH 4CVZB 1DQML 5JDSA 4O5LL 2B4CC 3RX5A 4M7LH 5CGMA 5C0AA 1RZKC 4EXPX 3L3JB 4N9GA 5HDLA 5BOZG 1FYTB 1JF6A 4N9OB 2GJ6D 4F8QA 1MJ7H 1YEFH 1JPGB 2VDLH 3QCVL 4MWFB 4X7EC 4GXVH 2BRQA 1I7TB 4F7TB 1KB9J 5D7LE 1U3ZA 2FO1A 1L7IH 4HQQH 3JV6A 4LCWA 1WAAA 1D6VL 1YA5A 5I1LA 1LP9E 1S9VB 4OI9A 2RQ8A 2ZUSA 5MEOA 2B20A 4OFPA 4QHUB 4X7SH 3WFEL 4CDHA 3U48A 5JOFA 2GYSA 4GXVL 1T20B 1YNTB 3IYLW 3OHXB 2OJEB 4HIEA 3RTQC 1CICC 4KKBC 4KPHH 3RY6A 5HHPB 1FNEA 1GXEA 1KIQB 4ZFFA 1XIWD 5SWSA 4Z76A 4XBEL 3MLSH 5T3XH 5JZ7D 3MUJA 2YUVA 5CLWA 3ZL4L 3PWVA 1OF2A 1F58L 1V7NH 4LKXA 1NLBH 4LSUH 2QKIA 4JFQA 3V6FA 1HYSC 2YPVL 4AMKH 1BM3H 2X4QB 5DTFA 1FC1A 3QDGB 1YYLL 4HFWB 2L7UA 4U6XA 3UTSD 4XNXH 3WUWA 3T04D 3S3PA 4R3SB 1LHZA 2XY1A 4YHKL 1CD1A 4EIGB 1J0IA 3HZVA 4HDIB 3BRGC 5DLMH 1OAYL 2VLJB 4KVNL 4P46B 5SWQA 1DL7H 4D3CH 4PRNB 3VWJD 4PJXB 3UPRA 3BXNB 4L3EA 1G6RA 3JVGA 1KULA 4LLMB 2QSCH 1G7QB 3DLQR 4WTWA 3BO8B 1A1MB 4GRLA 1D7FA 3QCUL 5FA4B 2R0KL 4M9OA 3OKEB 1QSEA 2BSED 4HH9B 1N4XL 5F71A 4WGWB 4Y19A 4UILH 1TVHB 3FFDB 4M7JH 3N1PC 5C0CE 3TO4B 3HB3D 5F9JB 2VOTA 1YEJH 3X3FH 2NY0C 3BRDA 5F88B 2HTLC 2J5LB 2UWEA 5DWUH 2DLIA 2DBLH 2PYEB 3C2AH 3LB6C 2VLJE 3I2CL 3LD8B 3SGJA 5EU7C 3V0VA 5DJ6B 3WJJC 3OKDB 5GSVB 4Z77A 3D39E 2AK4B 3CMOH 4KY1H 3P11L 4QGTA 3G9AB 4GKSB 4J6RL 5CKAA 5J9PB 2DB8A 5J3HC 4BSJA 5EUKA 2Y23A 1P84J 5LXGH 2DQIH 3QZWA 5J1TC 4I8DA 1TJIH 3X12A 1B88A 1YJDH 2P5WE 4Y5VB 1DVFC 3JTSA 3HE6B 3WXWL 2R0KH 3UDWA 1FSKB 4ZUUB 4PUBH 4PJIB 1FGVH 2OI9B 1E4XI 1F6LL 2WP3T 1SYSA 4QRRE 4FZEL 1JYVA 5CSZA 3C9NB 1KXTB 5EOCJ 2HVKB 2V2WA 1C08B 2P7TA 4U7KA 3NIGE 3NOIA 4EDXB 4H1LG 3EYQC 5I1JH 4PJBA 3EFDH 4HWBA 4Z8FL 1T2JA 2F53E 1TLKA 1B0GB 2MHAB 3JBG7 4LSTH 5I76A 5L8LB 4MNHB 1TZIA 4TVPL 4U1KA 2FZ3A 3RVTD 4YWGH 5HHQB 4HEPG 1E27B 2PYFB 5C3LD 4OI8A 1CQYA 4YDJA 4NWTL 3D0LB 3HA0A 3BN9D 3L3HB 4JANA 4Y19E 5CJBA 5D7JD 4TNVK 2P24B 5KG9B 5I15L 2IGFL 4MB5A 3B2UC 4F58H 3D69A 5E8NB 3VD7A 1U3HA 5DDHB 2BY2A 3BIKB 3QAZB 1MF2H 1TETH 1AO7D 3GHEH 3I6GA 5C0CD 4K94C 2X4TB 4Y88A 2NY1C 1UQSA 3ZKQD 3HB3C 4Z7WB 5ACLA 1KBGH 2IAMA 3IJSA 3FHQA 1A6ZB 4WHYG 4MJIE 3QA3B 5EDXA 5DHVH 3TIDB 4R0LB 3GB7B 2XTJD 2MSPA 3HAEA 2PO6D 1S5HB 4YDIL 5TFSL 4JRXA 5B3JE 3DUHA 1XZ0A 3CFIC 1HILB 4G6AD 1CU4L 3SDXB 4Y4HA 3GHEL 1HSBB 5D1QD 1CGVA 3VWJC 1FAKT 3CFCH 4M5ZL 1FCGA 3UDWC 5IKCB 4YH6A 5E9DD 2BSSA 4WU5B 5GS0C 2NY3D 4EDWH 2D2OA 2ED8A 4ODHH 1W0VA 5JA8B 3BI9X 1ADQH 2EDKA 4DAGL 2IQAB 1DR9A 4NUJA 4R26H 5F7FA 4NZJA 5HHQA 15C8L 1E4JA 1W8OA 2IFFH 3IDYB 2X5PA 4IDLA 3KAAA 4YBLB 2UZXB 1FLTX 2F8OA 4XCCH 1K8IB 5FYKH 5I1IH 1QVOA 3O4LB 2G75A 2HMID 4R4BB 3EYOB 3QPXH 1H5BA 2PF6A 7FABH 2OR9H 5I75C 1QD0A 3TC9A 5E2VL 3MREB 4P9HL 5EOTB 3OJMB 5A3ID 4XAWH 4X5LA 4JRYD 2PXYA 4ZFGL 1TPXC 5T33H 1BMGA 1AQDB 4K2UH 1NJ9B 2DM7A 1I1AA 5JHDA 3OXRB 4XP9H 3B2UD 3ARDB 2DIBA 3HHRB 5K59E 1IKFH 4UIMA 4JN1L 1OVZA 3GKZA 4ZUVB 2AJZB 3RGVB 1BFVL 4QHMB 1YZZA 2DQUH 2IAMC 4G9FD 4HZLB 1MI5A 4Y5YC 1PYWA 2X1XR 1A7RL 5BO1L 3GKWH 1H8OA 2YSSA 3RIAF 1P7HL 4L9DA 2CLRB 4XGZA 2OL3B 1CFSA 4ZAKD 1RU9H 2AGJL 2H41A 4MJID 4LLYA 5DR5H 4JPVH 3V52H 3MOQA 5FOBA 3QIBB 4WDIB 1F97A 1CGWA 4Y4HC 3Q48A 4WUUA 1K3ZA 1SVZA 5BJTA 1HSAB 4GRMA 5F1OB 2VWEC 3C60A 4XVTH 4GUPA 2X6MA 3WL9B 2R4SL 3GSNA 1FNHA 3G08B 4K8RL 1DQMH 3DTXB 1CR9H 4YHPB 2H2SC 5C0BB 3F5WB 4PJAA 1WCQA 3GMMB 5GSVA 1QLRB 4FXGB 1W72B 1ZSDB 2HJFA 1C7SA 4WFED 5HI3D 4N1EA 3W2DH 5GGTH 1ONQA 4ODUA 1HZHL 4X6EB 5FO7B 1NGZA 1RUKL 3QEHB 1U8MB 2AXGB 2NZ9D 2MCG1 3UTSE 3H7BA 4AM0B 1Q9OA 1T1YA 1OP5H 3DGGB 4QCIA 2W9DH 3C2SA 3VXOA 4LAQH 2GSIA 4CNIA 2ZSWB 2R29H 2H3NA 3VXSB 5FYKE 4PJDB 1CDGA 3AVEA 3QDJD 5EZIH 4RMRA 1U8QB 1MUJB 3QIBA 1IQWH 4LHUA 3UO1H 3I3EA 3TT3H 3OPZL 1G7PA 2FJFA 3CK0L 3KWWB 4Y5YA 2BY0A 3BZEA 4ELMA 1UM5L 3V6ZB 4E41A 5F9AC 4LHUD 5LAXA 1PY9A 3FO0L 2AJUH 2C1OB 4JLRA 1JGVL 3CX2A 1YPZA 1NUDA 3FQTA 1EZVX 2X7LB 2EDRA 2Q86B 3O6LH 4ODTL 1GOHA 4FQQA 3CX5K 2A9ML 2CQVA 2XACC 4X5WA 3RNQA 2EXYC 2AI0H 5D7SH 3D69B 5E8NA 4PYHA 3NH7H 4UT6L 4HXBL 3TWCL 1MPAL 3OR6A 3AS1A 2GJ6B 4ZTOL 2EH8L 2RBLA 3JXAA 3REVB 1AGFB 4L8CB 2Q8BH 3LOWA 1DQLH 3HLAB 2EC9U 2CRYA 3B3IA 1EBPA 4YAQB 2HT4D 5CIPH 2GK2A 4O4YL 1JZ8A 4WEBL 3HCVA 3GIZL 3Q3GA 4FFYH 3V0WL 2OQJB 4MD4A 3DMMD 2XZAH 2GAZA 4LEOA 1U8PA 4KK6D 2IAND 5HHME 1XMWA 2DQDL 3CJJA 3ILPB 1AI1H 3O11A 2DM4A 4LVHB 4L1DA 5J06A 2BJMH 2Z31C 5DJ8A 1RVFL 2IPKA 2Z91A 3B6SB 4W4OA 1JGDB 1WZ1L 4QHKJ 5JW4M 1QBMH 1IAIL 5AG9A 1EHLL 1MHCB 4MAYB 3QEQE 4MMXC 1FN4A 3PABB 4Y8DC 3RZCC 1N6QL 4DAGH 1TQCC 5AZ2L 4Z18A 4Q9BA 2CK2A 3MV7B 2A9NL 2F54A 3RU8L 3MRGA 4LFHD 4JFXA 3VH8A 3Q6GL 4AENB 4X4MA 2P5WA 3V6FB 1I7RA 4XI5C 5EH1A 2YEZB 3MOAH 5E6ZA 1SBSL 3D85A 4R7NB 5D7KE 3LN5B 1I3UA 3T1FB 1VFBB 1H3TA 1HH9A 4GG6B 4PUBL 4XCYA 4LLQB 3HNTH 4ZS6C 1X5HA 5E00A 2J8UB 3SGEI 3ZHKA 2CGRH 1V05A 1JGLL 4QRSA 5F7HA 4Q97A 4E0RB 1ZHNB 2I26N 1KN2L 3NIDF 1UC6A 1T3FB 3OZ9L 4JQXA 5EORL 4BZ1L 3DV6A 4MA8L 4HIJA 1C5BL 1S7UB 5F8RC 1P6FA 3DVGB 3D6GA 3LZFH 3WFBL 1N7ML 2WUBL 4K8RC 3GSVB 4OIAA 4D8PA 1BQHB 4FFWD 4WFEE 2ZNXA 3QISA 2FO4A 4R26L 2R29L 1YEGL 4XPHH 2VLRA 5EBWB 5HY9B 3ROOB 3U4EB 1OW0C 5TE4H 1MFDL 4X8JB 3P4LA 3O6FC 5DEFB 1PAMA 3TO4A 4RA0C 4NO5A 4HK3J 4DFHA 3RX8A 4CN1A 1MWAH 1AKJA 4OGAD 1Q9KA 4G9DA 1FFNA 4L9LA 4CMMA 2VDQL 4M48L 1QFUL 3QNYB 2W92A 1EHAA 5B38A 3WSQH 1I9JL 2WINB 5EG6C 5E5RB 3KLHC 2DRUA 5TJWK 4BZ2L 3L7FB 5FV1L 3LQMA 3LIZH 2B1AH 3B9KC 4NN6C 5FO9B 5IV2B 3SE4C 4KK5C 1YUHB 1PGRB 4C57C 5DJAA 25C8H 3OTTA 1AXIB 1RIUH 2J8UA 3GK8L 1CBVL 5KN5B 1S9XA 1XT5A 1U8IB 2AK1H 1NDMB 5C2BL 4UOW0 2EYTA 4Z5RA 3S3SA 4O4YH 2VE6B 3O3AB 4OLEA 5DQ9A 3CFBB 3GIZH 4JPVL 2OR7A 4WEBH 1FPTH 5TQ0H 5HHVH 1GZPB 4QNPF 4YDVB 2PTTB 4GAGH 4WV1B 5GGUA 2AV7A 3GJFH 4ZG1A 5T1MA 4BELD 1LEGB 3P4NB 1HOCB 3QWOB 1YPZF 1KIRA 2BVYA 3UJJH 12E8L 1KIQA 1TVBB 4OCLC 4I48A 5F3BA 2FSEB 1LO0L 1CIDA 2R56H 3MV9B 4KK8D 4KI1A 5D2NA 3HS0B 4OD3H 3QXUA 1KCSL 3U0WH 4NCC2 1DE4B 4M43L 1E27A 5GRUL 5CP7B 3B83A 2JCCB 3MLYH 3RWEA 3ARFB 4D9QE 4NC1E 1KB5A 3O6FA 3NFSL 3RKDD 3RP1A 1R0AL 3FFCD 3FO0H 1JWSA 5C2UB 4FQQB 4WGVB 4X5WB 1P9MC 3MBXH 6FABL 5BZDA 1U3HB 5DDHA 5IHZA 2BVUA 2LFGA 1CFQB 1EMTL 3HI6H 4PV8B 5HI5D 1OARL 1EHXA 3JWDH 3WHXA 7CGTA 2A74A 3QHTC 4YDKL 3PL6C 3QIWD 4D0BB 1LDPL 4DQOL 2ZWLT 4UTBL 5IBLD 2AEWA 2PTUA 2VITA 1G9ML 2EEDA 3IS0X 3BDYL 2YN3A 3PXHA 4IRSA 4PBWD 2XXCB 2WWKT 1T04A 2ATKB 3IXTB 5FM5O 4Z7VA 1HKLH 2GT9A 4NKMA 1FBIH 3CSYB 5K9KB 3Q6FA 2YK1L 5IVXB 2DKSA 3M45A 4Y2DB 2YC1A 5GRJL 2DD8L 1QSFB 4Z7QE 4RGMB 1U8HB 4I3RH 4OZ4A 3QI9B 4U1MB 1XF2A 2Q87A 3BKML 5L8KB 2A6DA 4GMTL 4I0KA 1JHLH 5T3ZH 2ZCKH 43CAA 1BQHG 5H8DA 4HLZH 3QDHA 1CXKA 5SV4A 4HKXB 1TVHA 1TNMA 3DX8A 3FFDA 5ESAA 5EZJA 3FONA 5A1AA 2EIZA 3TF7C 3JV4B 1S9KC 3MRLB 4YZFF 4ZTOH 4ZPTB 2XZQH 4PJ7A 2HTKC 3BJLA 5JW5A 4I0PB 1VPOH 2BX5A 3KR3H 3IAQA 4YLQT 3STBA 3QUYB 5JIPA 4Y5XC 4JZOB 1KLUB 3CZFA 2YPVH 2AP2A 1OTSD 3GMPA 2V9RA 3D85B 4JAMB 2EDTA 2AVGA 5E9DA 1XGPA 1I1AB 1LDPH 5JHDB 4O2CB 4Z7UB 3S34L 3BPOC 3FOMB 3OR7B 3BDXA 4IDJL 3MJ8A 1LO5A 3WUWG 4Z0BL 4OLZL 2PO6B 2YBRB 4D9RE 3I85A 5EZOH 5IMMA 3S36X 1KG0B 5E7BA 3H9SB 1WZLA 3CUPB 1BQHA 2ICES 3THML 4NQXA 4PRHA 1GOFA 3T77B 4JFQB 2P44B 1J8HB 4IRSC 4JPWH 5L2KB 3E2HC 5HYJE 4GMSL 4I3RL 4OD2B 4NHCH 3L3DB 4QRPA 3TH3T 1ZGLM 4KV5E 4XCNA 3HAEB 2AXFB 4Y0GA 5C07A 4JRXB 3D2UA 3TESA 3LAFA 5BJTB 1VADA 3KPLA 12E8H 2HFGL 3QQ9C 1FG2A 2ZKHL 3W11D 1NQBA 4P49A 1FYTE 3NTCH 3C5SB 4P3CH 4XNQB 4IMKC 3S34H 5D2LF 3VFMA 3WN5C 2BDNL 3DI3B 3MRBB 1BZ7B 3BIAX 2CUHA 5MEQA 3CXHJ 4LQFH 5ITFB 2NYYC 2P1YA 3BO8A 3DUSA 3O3UN 5IG7B 2C4XA 3V0AC 4NN7B 2Q8AL 3HAEH 3PGFH 4TOYL 3EDDA 5HHOE 4GLRI 5FYJD 1WICA 5B39A 1Z9SA 2BVTA 4S0TD 4WV1C 1J5OH 1M05B 2BSTA 3QEHA 4W6WB 1Q72L 2NY7L 2RFXB 4JVPA 3RVVD 3SKOA 5H94A 3ARVA 2VTFA 4YNYA 1INEH 5SWZA 2H1PH 5FM5M 3BZDA 5J57B 4RX4D 3B4NA 5HDOA 5I8EA 1CGXA 2XN9E 3A0OA 3MREA 3D1MC 5JW3H 5I0DA 3LKRB 4RBPH 1VESA 4PRAA 5I19H 4WHTB 4FXKB 1GHFL 2E6QA 4XP4L 3SDYL 1E4WH 4LBEB 1CGUA 2XA8L 4D2NA 4LHUB 3QH3B 4ZFZB 5JXAL 2EDFA 4KAQH 1MEXH 3PP3H 1K8IA 3ZE0E 2R1WB 3SCMC 1DLFH 3DXAD 1U41A 3KWWA 4Y5YB 2F19H 3MLXH 1KNOA 2Q1EA 2R0LL 4WEMB 4NRZB 3H9ZA 5CGTA 1C16A 4Y5VA 2AJYL 4HJGA 3FFCA 1R5VA 5FM8A 2IQAA 1H3PH 4WO4C 4YXKL 3OKMA 1MQKH 1ED3A 1D5ZA 3GSWA 4LF3A 3VGGA 5GGSA 4B50A 4YZFE 1OT1A 1T22B 1X5ZA 3GBMH 1RIUL 3GK8H 3X17A 3IKCA 4M8QB 4KVCH 2QQKL 2WV3A 5I17A 2J4WL 4NRYB 3EZ8A 3TBWA 4PY7B 5CHNB 4N0YH 5E95B 2D0FA 3ZE2F 3TVMD 5IMLB 2MHAA 4JO1H 4UU9A 2KL6A 5I8CB 2F53A 5EU6E 1F11A 3UAJD 4P5TB 1D3CA 3FN0H 5LG1A 2P5EE 3GIVA 5JNYA 4P2OB 5D2NE 5I71C 4JM2C 4MSWA 4ELKA 2HN7B 1VGKB 3P40A 1E0OB 2LQRA 3MLRH 5HHMB 3UPCA 2V2WB 1ZVHA 1FNGA 4DTGL 4N5UA 1QRNE 4YDLC 1OGTB 3QDMD 4NO2A 1BGXH 3CFEB 2ERJB 4Z0XA 3PQYD 5GRYA 1RAMA 2AJSL 5GGTL 3EJJX 3BZFA 4NN6B 1HZHH 2V2XB 1U8NB 3WO3B 2ZNWA 5B3NA 4AIOA 2NLJB 1UWGH 4CGTA 2NY5H 1A47A 2B7DT 2AXGA 2NY6B 4N8VG 3EAKA 5ICXA 5IBTL 2BC4A 2LV4A 1R0AH 1U58B 2XPGB 3WNOA 5ETUB 3STZB 4R0LC 4XHJC 5IGXH 4FG6D 4JO1L 4LSSL 3V7AE 3PDOA 1ZA6B 3U0PB 5T1LB 4M1CD 5CBEA 4PJIE 5L2KE 3I6KA 4PS4L 2HT3D 2QSQA 3WFZA 4PJGE 1KPUA 4F58L 1INQA 4U6TA 1LE5A 3BPNB 4HHAA 3EFFB 4K3EH 1NANH 2JB5H 3BP4B 4JKPH 3P9WB 1CLYH 1ZAGA 4U1NA 4JREC 4TQEH 5MERA 4IM8A 2D7PA 5GZOC 4YWGL 1L4IA 2GK0B 1CTNA 2BP3A 1XGQA 3KLDA 2ZUQB 5DQDH 2ICWI 1WEJL 5EU6A 3VXMA 4PB9H 2EXWD 1EGJA 4R2GC 3LQAH 4J12A 4OCWL 4H5SA 1YQ2A 4M61A 4FTVB 2FWOB 1HQRB 5DI8A 1IGJB 3N1FC 2XRAH 1S8DA 2BSRB 2XZZA 4PPTA 1A1NB 4TSCL 3GMQA 2FJFB 2NXYB 2ZUWA 4FS0A 1J0YA 2R1YB 2NZ9C 3C6LD 4ODXA 5FF6A 1RIHL 1DBAH 4U6HB 3V4PH 2HRPH 1WIPA 5CINL 5D7IF 2YPLE 4U1GB 4XCFL 3MYJA 1U3JA 5E2JA 1B9ZA 4OIBA 4OZGF 3SGDH 4XVJL 3V79C 2VLMD 4PLKC 2HKFL 4ZTPH 5BVJA 4I5BA 4Q6IC 2CUIA 1N5AA 4NZRH 2MQ3A 1JRHI 5CEYB 3QUKB 4JO4L 4RWYH 1Q9LA 4K9EH 4XH2B 1ORQB 5TDNB 4HUMB 4LIQL 3ARDA 1ACZA 3U46A 1CU4H 4EN3A 1JTPA 5C09D 4RAVA 3QPQC 1E6OL 2BVPA 4ZSOB 3ET9F 1RZGA 4XP9L 1PLGH 1QACA 1JWUA 1N0XL 3BPNC 4EN3D 5C6TL 4JDVB 2ESVE 2PCPB 3RUGA 1T6WA 5HYSB 2NR6D 3OKDA 1A6TB 4ODVH 4Z77B 2NNAA 1BIIA 1INEL 3MV11 3TPUB 3O3DA 1JPGA 3MFFB 5DJZA 3RWGB 3ZKMC 4EQ2A 1RULL 4XCEA 3ULUE 3QWOA 2EXWC 2H32B 4LCUA 4GSDH 1OAYH 5J89A 3KPRA 5DLML 4U1SA 2X05A 3A6CL 3UO1L 1OAXH 1Q8MA 3DBXB 1NGZB 4R2GB 5E99L 1IL1B 4F7EA 5J12B 4G8GA 2XT1B 5I1DA 1JRHH 5E2WL 1KJ2L 2PW1A 5T5FL 2UY7A 4PREB 4Q6YA 4OIIH 1SYSB 2WAHA 3CGTA 3AREA 4XNUH 4YHZL 1A7NH 4NQSB 1BWWA 4G6JL 2FBJH 1Q9WB 3GKWL 2I5YH 4LLUA 3WUZA 4LU5H 4C56D 2ILLA 1F5WA 4PJIF 1MLBB 1WWCA 2PUQT 3A6OA 2H6PB 1PKOA 2DQJH 3P4OA 4HUVB 1VB9A 4LASH 4U1KB 2A1WL 4IOIA 5I71B 4HK0A 4JKPL 1JPST 1RUPL 3CX5J 1A02N 1E4KC 3LN5A 2VDNH 3ROLB 1MNUL 1I9JH 2H3NB