1P4IH

Crystal structure of scfv against peptide gcn4
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
112
structure length
112
Chain Sequence
b'DVQLQESGPGLVAPSQSLSITCTVSGFSLTDYGVNWVRQSPGKGLEWLGVIWGDGITDYNSALKSRLSVTKDNSKSQVFLKMNSLQSGDSARYYCVTGLFDYWGQGTTLTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY VARIABLE LIGHT CHAIN
publication title Directed in Vitro Evolution and Crystallographic Analysis of a Peptide-binding Single Chain Antibody Fragment (scFv) with Low Picomolar Affinity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 22
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2003-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p4iH00
2V5YA 4L4TB 3RJQB 4J2XA 3OXSB 2VLRE 3NFNB 4P23D 3DMMC 1IQWL 2E7BA 3PGFL 3HZKA 1I9JL 2EDXA 1HINH 1OHQA 1CDIA 3U0WH 4FZ8H 1CFNB 3INUH 2BVUA 1SBSH 4JFPB 5EU3A 5TJWK 1JYXA 2HP4A 2VDLL 5ICYA 4WHTB 4Z78A 5JORA 1TTUA 1MCHA 4YZFF 2I9LA 4P5TB 5HD8C 4G9FD 3PDOA 3IS1X 4NOFA 3ROOB 4X7DC 2I26N 1BWWA 1MELA 2CJUH 4CU8A 4X98A 3LCYA 4GBXD 2DAVA 5IVNA 2WBWB 3UEZA 3HAEB 2B39A 4KQ4H 5CP3A 4KPHL 4TYUA 4HXAL 3WNNA 2XQYG 3H3PH 3C5SB 5JW3H 4PJDE 4TPRL 3M8OL 1QFWH 4H8WC 4WW2F 4WU7A 1ODAA 4OI9A 5GZND 4KU1A 4X5WA 4IHOB 3IKKA 5B39A 5F7MC 1IM3B 1LDPH 4PB0H 1QD0A 3MRCB 3VFMB 4TQEL 4QXTB 4Q9QL 4GAYA 2OK0L 4HCRH 3RTQC 3CLEL 1NANH 4G6FB 4D94A 3O3BB 4UZGA 3VMOA 5KSBE 4JPKL 1MCEA 1FC1A 4GJTB 5J8OA 3O2WH 2EKSB 3UZEA 5FA4B 3KPMB 3JBG7 4HFUH 2R69L 3KJ6L 3I9GL 1Z0MA 4UQ2A 5IR1A 4NUJA 2AK1H 5T1DH 2GIYA 2CLZA 1GL4B 3O3DA 3TV3H 1D9KD 4OZ4B 3F7PC 3IFNL 2FHBA 1AO7E 4AENB 3U4AA 1I1YA 4I18B 1JZ2A 3ZKQD 3HZMB 1YYML 2B5IC 2JELL 5ESVB 5BZDB 2NY0B 4XPBL 5KSVB 1DQLH 3L5XL 2L4OA 1RK0A 5LXGL 4MNQD 3RAJH 3KXFE 5F6IC 3QG6A 4KKBC 2NY1D 4K94C 4Y4KA 4BH8B 2NZ9D 5D8JL 3B9DA 1GIGL 5HYJD 3PQYA 3FT4A 5AZEL 3FQXA 2M26A 3MLWL 5EIIB 4P2OC 1NUGA 2E7HA 1G1YA 4PTTA 3HE6A 4K3HA 4P46C 3RJDA 4GG8A 5IHBA 2CRIA 4CBPA 3ECBA 3PWLB 3QIBA 1OGAE 4XPTH 2APFA 4V1DB 2D31B 4I13B 4Q58C 3OF6A 1CU4H 3FB7B 1T0MA 4KZEL 1HDMA 3QXDB 3RA7L 3WXWL 5B8CC 5K9JH 4YAQA 3TO2B 4HKJB 2E9JA 1A0QH 12E8H 3MV9E 1KTKE 1PG7H 3SDAA 4HIJA 1I1FB 2B20A 2FX9L 1PYWA 1G7IA 4H1LA 1VFAA 3LIZH 4MA1B 5CD3A 1EHLL 4P2QD 4P9ML 3H9SE 1VGKA 3EYQD 4KUZH 3FO1A 3GI9H 5K9KB 5MEOB 4JY4B 2E27H 1A5FL 4DK6A 1BEYH 4I2XB 4GRWF 3RVTD 4OF6A 4I1NB 3Q2CA 2ESVD 1BFOB 2FO4A 4DOHE 1JN6A 5D1QA 4MMXC 2ENSA 3DSFL 1NAMB 3NCYP 4PY8J 1L7IL 5D5ME 3IDYB 3QEGL 3JV5A 4UOW0 2PTUA 2EDJA 1KCSH 3IS0X 1FBIL 4RWYL 2FX7H 5JIKA 1JV5A 3HC3L 4PRBA 1F4HA 4BFIA 5J6HB 3IAQA 4PGEA 2FSEA 5ALCH 43C9B 5FCSH 5C0AE 5JZ7D 3MCKA 1FNHA 1PDKA 5DVOA 4NN5B 4WDIB 4M61A 5FGRA 4F7EA 4LHJB 4ELKA 2DIAA 4ETYA 3F58L 3CMOH 4NNYA 4YHNA 2VO5A 3RWEA 3UYRH 3EYFA 5B3JE 2R15A 3QEUB 3N9GH 3L5WB 3D3VE 4JKLA 5HI3D 3MFGB 3ULVL 5CINL 2OR9L 3BE1L 3E6FA 1B6DA 2AEPH 1ZT7B 4PJEB 3UXFA 2JJTC 4RDQG 1XF5A 1ZVSB 3ZKND 4JKWA 3SGDI 5CEXA 5I74C 1FGNL 4I0PC 3GHEL 5HYIA 3WNMA 3FRPG 1JF1B 2W60B 4YDKH 3EYVA 3X17A 1SJHB 2AJZA 4XVTH 3FB5B 2OTUA 4G8GA 3HPLB 4HK0B 4DGIL 3W5MA 3B5TA 1R24A 1WC7A 5I8EA 1W0WB 4LIQE 1BM3H 1YEGL 3HRPA 2DLHA 4JQIL 3S97C 2NTFB 3ZL4H 4UMGA 3PV6A 3G5ZB 1ETZA 1YEHL 4YHPB 1J05B 4NYLB 3G6DH 4U1HB 1BMGA 3BPCB 4OLUH 3OXRA 4GQPH 1G9EA 3NH7L 5F7DB 3QUXD 5EOCL 3FMGL 4HPYH 2JK5A 3OKKB 3O3AB 3ARVA 1U8KA 5DK2B 1JMZA 1NQBA 5IMOA 2HJKB 3GZKA 1DVFB 2MSPA 1OM3L 4X80H 3IF1A 3GJEA 3P9WB 3ZHKA 1YC8A 1UZ6E 4AY0A 3VWKC 5TDOA 4OD1H 2ORBL 1U6AH 2YSSB 3EYUL 4ZFOA 1UCTA 5EBWB 4PJ8D 4RBPK 5FKPB 3STLA 5FF6A 3KPRA 5DQDL 2H3NB 4M7JH 5EWIH 3U30C 2F54B 5JXED 2XTJC 3FOLB 1KB5A 2OJZH 4WW1B 5FYLL 3C5ZA 4NSKB 4NO2A 4IJ3B 4J6RH 3QPQC 2XKNB 1NGXB 4KV5E 4E0RB 1XZ0A 3UPAA 4FG6C 5K93A 2BNRA 1AGCA 4ODXA 5DR5H 2XG5A 3GMMA 3D0LB 4AEEA 4P3DA 4YDLB 1F00I 3OAYK 4S0TD 1Y0LA 2IAND 3NAAL 5IHLB 3MCG1 1DLFH 1G9NL 3IETB 5SX5H 1R6VA 5T3XL 5I66A 5ELIA 5FHBL 4JRYB 1YNTA 3UMTA 3FQUA 1IQWH 3PGFH 1XGRA 4XMPL 1I9JH 5F1NA 2OJEA 4HBQA 2FECI 1OAUL 3JXAA 2BVPB 4C55A 1QSFD 2QJDA 4ZO9A 4C59B 2FBOJ 3QJFA 2PYFB 1U92B 5I8OL 1JWUA 2PTTB 1M7IB 3N06B 2DQHL 4XCEB 5ISZD 2WBJD 3O6FC 5E2JA 4QHUB 2GW5A 2FJFB 3F12B 3D2UB 3WS3A 5F3BA 1TQCB 4TTGA 3SKMA 3MUY1 4P5KB 3IVKA 1N26A 4L8BB 4KPHH 3OR6B 5CKGA 5LG1A 4XNYH 4HXAH 3DGGB 3GM0A 2ILLA 1VERA 4OFPA 4ZTPL 4TPRH 1A7QL 3HHRB 3M8OH 5I75C 1FH5H 4U1GB 4PD4J 3DECA 1NFDB 5I1GH 2OCFD 1URLA 4Y5XC 3LPFA 5JPNB 5T1MA 3RWJA 3V6OC 3O6KL 4TQEH 5EUKA 4Q9QH 2OK0H 4N9OB 2PYEA 2R56L 4MXQC 2F74B 3VD3A 2BCKA 3CLEH 4L5FL 1G1CA 3P0YL 3NFPA 3ES6B 4LEOB 3KLHD 2MPAH 2EDEA 3KJ6H 3I9GH 4YO0A 2XFXB 2HTKC 4HPOL 4O58L 3LKRB 3TH3T 2XWBA 5GQBA 1ZANL 1ZSDA 1R3KB 3IFNH 4GAFB 2VZOA 4R97B 2IF7A 3E3QE 5DJ2A 5ALBL 3GMRB 3QUZD 4IRZL 1YYMH 3GSWB 5FIEA 3VXUA 1AXSB 3O9WC 4XPBH 5FGCB 1FJ1A 3MBXL 3L5XH 1MWAA 1WSST 2PW2B 4X0KA 1N2RA 3TNMA 5LXGH 1GZPA 5F96L 1ES0A 1E4KC 1HQRB 2PCPB 3QHTC 1I8IA 5D1ZC 5I71C 3PWNB 5DJ6B 2ZCKL 2BNQB 2XA8L 4HLZG 5D8JH 2HH0L 1GIGH 4YBQC 3NIFE 3O6LL 5AZEH 5DJCA 3MLWH 4RAHA 1P7QD 5CJBA 3MV8A 5IT2L 3C9NB 1J1PL 5I8KL 1J0JA 1BQHG 4HK3J 1T1WB 2WWMC 4P4RB 5J9PA 3DX8B 2F8OA 4HH9B 4QT5B 4U49A 5FYKD 4JG0L 1ROWA 1RZ7L 3MRMB 4M93B 4EOWL 3VXRD 4KZEH 3TZVB 3RA7H 3WXWH 4KVNL 2XWJB 1QACA 4P5TC 3GO1L 5JHDB 1G0YR 2FX9H 1O7VA 1JWSA 4UT6L 2VJXA 4N90D 2D9CA 4WJ5A 2CLRB 1ZWIA 4P9MH 4G7VL 3DX7B 5BW7C 1G6VK 1RJCA 2UWEF 4QYOB 4JFEA 5CBEB 3GHBL 3MO1B 3X3GL 3EJZC 4U1KB 3TEUA 1A5FH 1KCUL 3GSRB 1ZGLP 3C60B 3GSUB 1DR9A 2YZ8A 3BJ91 3KPSE 1SYVA 1WISA 3IDGA 1XCQB 2PO6A 4KVCL 1KJMB 1RI8A 3A67L 1WBXB 3DSFH 2GAZB 1CXFA 3GMNA 5E7FA 3L3JA 1L7IH 5HYJE 4G9DA 5GRXG 4O2CA 4PJ5D 1IAKA 2MNUA 4UT7L 4ZAKD 5FUCE 3S7GA 1FBIH 4RWYH 1X5KA 4P2RD 2VAAB 4QRSA 1F90L 5EZJB 3T4YB 2WUCL 5TDPB 2H2PD 3HC3H 4NQEA 2J2ZA 1XGPA 3MOBL 2WLZA 3B8YA 2OL3B 3GMQB 4GRWB 3IDIA 4IOIA 4POZD 2DYPA 3CPLA 3O81A 4XNZB 2P4AB 1IQDB 5DFVC 3RY4A 1BAFL 2XT1B 3VXNA 3F58H 3EDFA 5B38B 4MB5A 4WWKD 5C71A 3ULVH 3I6GA 1DN2A 5CINH 2OR9H 4I18C 4AQOA 1A7OL 5C0CD 3BE1H 2GFBB 5TQ0L 5HGHA 2DMCA 4BZ2L 4XVJL 1XF2B 4JRWA 3SDCB 4R7NB 2NY0C 2JCCA 3EDDA 2BX5A 4YIQA 3QNZB 4K55A 3MR9A 1I3RB 5GGRY 2ESVE 1FDLL 3BEWB 1FGNH 2KL6A 3GHEH 4JO1L 3TIEB 2HJFA 1X5HA 8FABB 3RY5A 3V6FA 1QUNA 2DICA 4NQCD 5CHNA 1BX2B 2DMBA 1JFQL 1KB9J 4NRYB 1D5MB 1T1XB 3KHOA 3QP3A 4NDMB 1P1ZA 3H9YA 4HKBA 4F7TA 4GKNA 1OTTC 2NXYC 3OKEA 1BWMA 5T5NF 2EEAA 1P2CB 3CX5K 3ZTNL 1B0RA 4F7PB 4DGIH 3A6BL 3RL2B 5E7BA 3L3IB 4NQDD 5JMOC 1YEGH 2PTVA 2DIBA 4JQIH 3HZVA 4MJIA 2DJ4A 3WCYA 5L2JA 4HFWB 3B2UC 4LLWA 4H5SA 1YEHH 4OIAA 4GS7B 1M7DA 3PXHA 3G5XB 3DUUA 4X6CA 3BIAX 5EOCH 3FMGH 1FFPA 1KBGL 3FCTB 3H0TA 3HUJA 1HHKA 1A7PL 1E6OL 5E8PA 4MA1C 1OM3H 4NBXB 4FQJL 4PJ9B 1EFXD 1HEZB 1BFVL 4U6YB 1G7HB 4Y8DC 5CMAA 4ZNCD 1CXEA 1SEQL 4Q9RL 4MHHI 5DGRA 3WFZA 1N0LA 2V9TA 4XX1E 2ORBH 3EYUH 1J8HA 3B9AA 4PD4K 1Z5LA 4FTVB 4YXLL 2FEEL 5DQDH 3F6LA 4Y4FB 5IB4B 5KS9B 3MX0A 2DL9A 3SCMD 2ZG2A 5FYLH 2R2EA 2VLRA 4TUJB 3QO0B 3IDYC 2Z4QB 4ZDHA 2P8LA 3FN0L 1F6LL 2BSTA 1UB6A 2DN7A 3GSNL 1D7FA 3WIFB 1W72L 1CR9L 3WKNA 2FRGP 1S8DA 4YNYA 3NAAH 3EOBA 1T2QL 4FS0A 5D7JD 1G9NH 4OZFB 4FQQA 3RVWC 5T1LA 4BUHA 3ULUD 5I1DB 5T3XH 5FHBH 3TO4D 4LNRA 5E94B 3IDMA 4TOYL 5CEZE 1PQZB 4XMPH 2NZIA 1HYSC 3B4NA 2VZ1A 3WJLA 1XGUB 3U36A 3UAJC 1OAUH 1G7QA 3LKQA 3RWGA 4AM0B 4LGSB 2DJSA 2V5RA 3GMPA 4PJDA 2VXSL 3U2SB 1OCWL 5I8OH 3FO0L 1BBJA 2ZCLL 4RQQB 3RWDA 1E28B 5E6ID 5HY9A 1DE4A 4U33A 2DQHH 2WINB 2EEDA 5SWQB 1B2WL 2P48B 3C5JA 1X7QB 3BGFC 3P4OB 4HIIB 1QLEL 3QEQD 2MQ0A 3QIUA 3V8CA 5BS0D 2W91A 4NO3B 1QFWI 1IKNA 1BBDL 1S5HA 4EZMA 4WIQA 3EO0B 1MIML 5DJ8A 3FO2B 4AH2A 35C8L 1GJIA 4PR5B 3BSZL 5HBBA 3S9DB 2D0HA 1ZA6B 4ZTPH 5KSBA 2IC2A 1A7QH 3ARGB 3NCBB 3BIKA 5F88B 3G04B 2E6PA 4X7TB 3ARXA 1IAII 3CFDA 1LK2A 4PJHB 2IANE 5BCAA 5B3NA 1FV1B 5H94A 2Q6WA 4WW2A 2A6DA 1KULA 5KJRL 3O6KH 1AO7A 2R1XA 4PREB 1OAQL 4EUPB 2R56H 1B9ZA 1IGTA 4KK6D 3RWIB 4A2MA 4L5FH 4V2BA 4X5LA 1S5IL 3MRLB 5I16B 3WUWA 3WLWD 4CJ1A 3GSWA 1DQQA 1QSFE 3KXFA 3VG9B 15C8L 5F8RC 3V95A 3VXTA 3PP4L 3L7FB 5IEKB 1JJUA 2C3GA 4M7KL 2BJML 4O58H 5LBSL 1UXSB 5E1AA 3WIHA 1ZANH 2ITCB 1KXVC 4PJFE 4P9HC 5ISZE 4NHCL 2A0LD 4WTZG 5ALBH 4D9RD 1XF1A 3IKCB 3OR7B 5KSUB 4IRZH 2VDML 2X1QA 4BQCA 4DVBA 1KJ3L 3TWCL 3MBXH 3WHE0 3HR5B 2KQMA 5F96H 4IJ3C 1OGAA 4XMLL 2C3VB 4W4OC 2DKMA 1RHHA 3L95B 3HAEG 2ZCKH 3MREA 3ROLA 1L6ZA 5JO5A 2MMXA 3I50L 4YDLC 2X41A 4G80A 3BWAA 2XA8H 1K8DB 5IM7B 1KJVA 4MQSB 2DQTL 2HH0H 4H8WL 5DSCA 3MV9A 4JY6B 3NN8B 3O6LH 3OKNB 1H8NA 2P8MA 4DKDC 4KTYA 5IW1B 5KANI 5IT2H 3H9SA 4HUVA 1J1PH 5I8KH 4DKEL 1ORQA 1GZQB 1FNEA 5SX4I 2ZG3A 1NJ9A 3VRIA 2IH1A 1JNNL 2HMIC 1YEDB 5IHUL 3NZ8A 4JG0H 1RZ7H 3CFBA 3G6JE 4EOWH 2P8PA 1FFRA 1T7XA 1T4KA 1S9VA 2R2HA 1WF5A 4JGMA 4L3ED 4WEBL 3O2VL 2ICEA 1NMAL 4LK4A 1YDPA 5D7IE 4UT6H 1BOGB 3MCLL 5D5MA 3WO4B 3EBAA 3DVNB 1KPVA 2W65B 4NC1C 4G7VH 4CN6A 3TN0D 2CDFA 3GHBH 1TQCC 5FYKL 4HUKB 4CVZA 4P57B 3X3GH 1KCUH 4LHUB 5C0AA 5CZVL 4HX1B 4DEPB 3TBSB 5LGJB 3T1FB 1X4XA 1A64A 5C0IB 3PWUA 3ZLQC 4KVCH 3A67H 3TNNA 5SWZB 2FO1A 1U8IB 3DIFA 1GVIA 3FONB 3BP7A 1DBAL 3C6LA 3B43A 5C6PB 1RZJH 4K94L 1BPVA 3HRZA 4QRRD 3CVHA 4UT7H 1E4XL 4WRLA 4TNVF 1P4LB 4LVHB 2WUCH 2UWEB 5D2LF 4UU9A 4OI8A 3D3VA 3LS4L 3MOBH 2ADGB 5JHLL 1CXHA 4POUB 3OX8A 5TE6L 2HWZH 1GH7A 3PL6B 3BOVA 1BAFH 1OT1A 4L4VB 1I85C 4KGJA 5MEPA 2AV1A 5D93B 1ZT1A 4NKDA 4LLAA 1H9VA 4W6YB 1KCKA 1FO0A 4ONGL 4KHXL 3SJVD 1G6RB 2Q86A 1QPXA 2P24B 32C2B 4WCYL 4N90E 4X5XB 1N64L 3T8XB 4R97C 3BGMB 4DFIA 2VQTA 2FJGB 5J12B 1A7OH 3HB3D 1A4KA 4XVJH 4NKQB 3W5NA 3MUGB 5IP4A 1KNOA 2FIRT 3SQOL 4Y19D 4J3TA 1FDLH 2CH8A 5EC2A 3ZKMC 4W4NA 2WMPA 1OLLA 4LAQL 4JO1H 4MNHB 4X4YA 4HC1A 5IQ9A 5EG6C 1JFQH 3PP3K 1EJ6A 1P6AB 2E7LC 2YUXA 3DI3B 3PJSB 4PJ5E 4I77L 1NGQL 4I48A 3RUGF 4CNIA 5IV2A 4NKOA 1X5AA 5JOEA 3ZTNH 2KDGA 4FFZH 1U3HB 2GJZA 3A6BH 2O26U 5JOPE 3PWJB 3SN6N 3SDXF 5EO0B 5I2IB 5ADOL 2F5AL 4ORZC 2DQJL 1F6AB 2G75B 3MNWA 4M93C 1HE7A 3HLAB 2EC8A 5TPWL 1F4WL 1BD2D 1KBGH 4B50A 1U95A 5E5MB 1U93B 4XP4L 4APQB 1YY8B 4WO4D 1A7PH 1E6OH 4FFYL 5HHQA 5CBAB 4HV8B 1QR4A 2OYPA 3SGEI 3FFCB 2AERT 4FQJH 4N5EC 1BFVH 2E5EA 3GK8L 4OD3L 5DRZB 1SEQH 3S6CA 4Q9RH 2R4RL 1K85A 4MNGE 1MVUB 3C60C 4J12A 5J1AA 4FOMA 1NBQA 4Y5YB 4YXLH 1I9IL 4L9LA 4XGZB 3K2UL 3J8F7 4IRJB 5A2JH 4UDTA 5LQBL 3CGTA 4L29B 1EO7A 1A7NL 2Z8VC 3TH2T 1P7HL 5CD5C 4GKSB 3BD3A 1AGDA 4ZFFB 5HGDB 3U6RA 1TJHH 1X9QA 4HUMB 4F37F 1B88A 4K2UL 5ABDE 3K8KA 2VLJD 3GSNH 1FYTB 1Q9KA 5D7KD 2GK0B 1FORL 3LN5B 5BV7B 5DRXA 4OUUB 3OKLA 1CR9H 3QEHB 2GJ6B 3DYPA 1T89A 1P84K 1T2QH 5DO2D 5B4MD 4G5ZL 3AB0C 4XNZC 3SY0A 4FQCL 5EUOE 4Y5VA 4TOYH 1LEKA 3CK0L 1SJEA 3WHE1 3MRPA 1XIWC 3WE6A 2CIKB 3HE7C 4FXGB 2EXWC 5EZLB 3ETBF 1QLRA 1INDL 1FFOB 2R23B 1IEAA 4U2YA 4NT6A 2VXSH 1OCWH 4OM0H 3FO0H 3SDCC 2C3WA 5BRZE 1ZA6A 1B2WH 5IW3A 2HFEA 4HAGA 3DRTB 3X13B 4R0LC 1QLEH 2AXFA 3T1WA 1LD9A 4YJZL 2CMRL 2E9WA 3L3HB 1BBDH 4GSDL 3VFNA 3FTGA 1MIMH 5HHVL 5C1MB 35C8H 4QHKI 1KN2L 4R8WL 2B7DT 4UILL 5C0GB 4EN3B 3I75A 1H3GA 5CZXD 3BZFA 4ZUUA 3D9AL 5KG9B 4XBGB 5CGTA 1U8NA 4KTEH 1E4WL 2MHAA 3GDBA 5IWLA 2C4FU 4RAVA 5KW9L 5KJRH 4HKXB 3ULUE 4NM4L 4Q6IB 1OAQH 4HIHB 3H7BA 3DX6A 3VGDA 3KLDA 2EC9T 2W0FA 1S5IH 3SDYH 4GAGL 3AREA 4GRLA 3SGJA 5IROA 3H9HA 2CRZA 1EK3A 3MROA 5FYJD 5FB8A 1QA9A 15C8H 3TJEL 3OV6A 1DBKL 2VIRA 1JP5A 4M7KH 2BJMH 4K7FA 5LBSH 5DMJB 2Q7YA 2JIXB 3HG1B 1GHFL 4JJ5A 4LNVA 4NHCH 5BS0E 3P77A 4XCNB 2VDMH 2EXYD 1UB5B 1KJ3H 4Y4FC 3BHBB 1A3RL 2CD0A 3TWCH 2VUYA 1Y6MR 2AXJA 1PEZA 4XMLH 4HD9A 3HCVB 4LRIA 2GK2A 4ZYKA 2R1YA 3I50H 4PP2A 3QH3B 5F44A 1HNGA 2XPGA 4JDZB 4DCQB 2DQTH 4H8WH 4OSUL 1U8PB 1U8MA 2D7MA 2G9HB 5MHSD 5MERA 4UUJB 4PTUB 3DRQA 1HSBB 1D9KA 3Q0HA 3T65B 4XC3H 2ICCA 2DJUA 2CUHA 3BRDA 2Y6SC 4DKEH 2NLJA 1K9TA 1QP1A 4MVBC 1KEGL 5TF0A 3RKDD 5DVNA 1JNNH 4X7FC 1B4RA 2MTPA 5IHUH 3U48A 5ADPL 3QA3B 4FQXC 1HSAA 1TVHA 2CKBA 3KPSA 4WFEE 3MRIB 4O2FA 4WEBH 3O2VH 5IFJB 3RY6A 3RVVD 4JO3H 2BFVL 1AIFA 1H3PL 3TBSA 1AGFB 1NMAH 2GITA 2IALB 3DX9A 3PWVA 3V0VA 3MCLH 5FOBA 5HYJA 3RVUC 1EHNA 5DT1L 2MCPL 3SKNB 2NXZB 4D9RE 1WQVT 3ZE1F 3BQUC 3VJ6B 1F13A 3QWRD 4MD4B 3ARFA 2HT2D 2QR0A 1T04A 3QQ9C 4EDWL 3ORJA 2ZOLB 3EOAA 1YEEH 3GBNL 3V5HB 1T1YA 3Q5OA 4YPJA 1DL7L 4CADA 1X5IA 3ARGC 1UJTA 5C0EB 1I1RA 5IUSA 3ARDD 5F93C 1DBAH 1JUFB 1S9YB 4K94H 1LEGB 1P6FA 2IADB 1CDUA 1MJUL 1UQSB 2ZKHL 4D0DB 1IC7L 4KTDH 3LRSB 1T20B 5HYSB 4HMEA 3WL9B 3CXHJ 1MUJA 3E2HB 5HHOE 4XB7A 3U4EB 3LS4H 2EZ0C 3MMEA 1AI1L 2PKDA 2FL5A 4LPUA 5DRWB 5J13B 4EEEA 4LARL 3RIFF 4I9WE 4UT9L 5JHLH 3P4MB 3D85D 3F7VA 2XY2A 5TE6H 1A1OA 3WNLA 3RGVD 5IVXE 3RIAF 4LU5H 2ESVA 4S1RL 5KZCB 4QOKE 4JHZA 3BZ4B 3MRBA 3VG9C 4FQLL 3LKPB 3OG6B 2IFFL 3VH8G 1S7RA 4AIOA 3KPPA 4ONGH 2Z9TA 4YHIB 4KHXH 4KRLB 4U1LB 2I60L 5HDLA 4WCYH 1N64H 4RMQA 5DTFA 1UXWB 5F6HI 5D2LB 3R0MA 4JQXC 2WW8A 1I9RH 1MJ8L 4U1SA 2MJWA 2IBBA 3WFHA 3T0DA 5D1XD 5IFHL 3SQOH 1MF2L 5CS7A 5C8JB 3MLPA 3EYOA 3CCHB 2ZUQB 1IVLA 2OZ4L 1OP5K 4YPGA 2BY1A 2EYSB 1ONQB 4LAQH 3ULVF 3FRUB 4HLZH 1CFQA 5EIQA 3P9LB 4P3CL 4MGXA 4ZO7A 3UYOD 5I2IA 3OKOA 4Z7VF 3RDTD 1EVTC 2QKIB 3OKMB 1CFTB 4PGCA 1NGQH 4Q6YA 1KPRB 3FFDA 1ZHLA 4ORGA 4QXGL 5EOQL 5H35A 5M94B 1B3JA 4NKMB 4G42B 5GS0D 2J88L 5DLML 5ADOH 2F5AH 3KNBB 3QUKB 5JTWA 4E42B 5D7LE 3PF2A 5CJQL 3MLTA 4Y89A 4OFVA 2EIDA 2R29H 5TPWH 1F4WH 4LSVL 4RIRA 2KQNA 1CT8B 2Y72A 1XH3B 4GRMB 1DTUA 4XP4H 4U6VL 4ZXBD 4YXKL 3SJVE 4FFYH 3RUGB 4HJJL 4K9EC 4JRXB 1R3IL 4B7IA 1MCDA 1YEFL 4TUKL 5F7UA 5IJVB 2PXYD 4JHAL 1V7NL 3GK8H 4OFIA 4OD3H 3U0TB 3U83A 5BVJA 3MRGA 3SDXB 4QCIB 3WEXB 3CDYA 2L7UA 5IW6A 3KDMA 3OZ9L 3SDDA 1T3FA 3PUCA 3MOQA 3R4DA 1I9IH 3DO7A 1C08A 1FVDB 2E6QA 3K2UH 1QVOB 4WU5A 1NGZA 5LQBH 3O3EA 3S3SA 1A7NH 2A74A 4KC3B 5D70L 4RWHA 1P7KB 3MJGX 3LDBC 2QSCL 1BHGA 4NBYB 2FWOA 2X4PA 3SDAC 3AS2A 3CH8A 3QAZB 3PDDA 4K2UH 1OP9A 4LVHC 4HAFA 4XBPA 2Z93B 1FORH 1UJ3A 1JBJA 4KI5F 3QWQB 2V7HA 4OGAD 1EHXA 2HT4D 4LLMA 4X6DE 4KK5D 5E8EB 3TCLB 1EA9C 4G5ZH 4OV6F 3QUMH 5C07D 2BK8A 3ARRA 5C0RL 1HH9B 1AKJD 3PL6C 4OT1L 1ADQL 5DJ0A 5AAWA 3IXAA 3BKYL 4FQCH 1PKOA 2Y36L 1CGSL 5ETUA 3R06A 3DYOA 3P4NB 2EKJA 2IGFL 3CK0H 5D93C 1IAOB 4MA3A 2I07A 2P42B 2YPKB 1RHFA 2LQRA 2FYYA 3TYFB 4PRHD 1INDH 2DL2A 3VXSD 4XTRC 3MOAL 3K1KC 4BFGA 2HYMA 3I85A 3GEWB 1FG9C 4C56E 3BYTA 4OZIB 4JFXA 4MQXC 5AUMA 3KAAA 4NC2B 4KRPB 2IPTL 1YJDC 3JTSA 2PN5A 2W9DL 3CDGB 2QQLL 5EA0L 1G7MA 2F8VA 2IANA 3MLSL 4KK8D 3W39B 5L6YL 3OAYH 5F1OB 1AQDA 1S9XA 4GSDH 3B2VL 3ARBA 1UA6L 2G5BB 4Y4HB 1L0XA 5F97E 5HHVH 3BP6B 4JANA 3MRRB 4N9GB 5C0NC 1KN2H 4R8WH 4HS6A 4X83A 1QBLL 5CSBA 4PJXF 4Q6IA 4UILH 1J0ZA 1U3HC 2VLJE 5D7KE 4PLKD 1QSFA 5BVPL 2V7NB 2YPLB 3X12A 3D9AH 1T7ZA 5T3XE 2VZTA 2RB8A 1E4WH 2J6EL 2R2CA 3CFCL 4N0UE 5GSRA 4TNWF 1CGXA 4CDGC 2MFNA 3QI9D 1CD1A 1KIRA 4PJFA 5ISZA 2WBJA 4YE4H 1AXIB 3DOSA 3ARQA 1U91B 3KPOA 3VXQB 2YBRB 2ZUXA 2OMBA 4LKXA 4LPWA 5IIEB 1D6EA 3MRFA 4APQC 5IFAL 1T6VN 5EU6B 2X44D 4GAGH 4D9QD 1BVZA 3SKUD 1MJ7L 4MLSA 3T0VA 3TJEH 1MAKA 4QNPF 2XXMB 4OF8A 1F02I 4GAJH 1NC4B 4Y2DA 1F3RB 4G6KL 1UYWL 3EAKA 3MLXL 3HMXA 3WFEL 4HWUA 2RIKA 1GHFH 2R9HD 4QY8A 5K9QI 4Y5YC 4EI5B 4BFEA 3C6SA 1W8NA 5I73B 1WBZB 4JFYB 5J57B 1SMOA 4X99A 5TDNA 4KJQC 5BO1L 1B90A 1D5ZB 2IAMA 3VFTB 3SE9L 2X7LA 1A3RH 2YD2A 3JWNC 3VGHA 4U0RB 5BOZG 1HXYA 2WK2A 5FYJL 3KWWB 4JDTL 6CGTA 5DD0L 1ED3A 2IQAA 1CLOL 3CUPB 1SY6L 4MDJB 4IDJL 3VXMB 4MJ5A 1ITBB 5CCKL 1C1EL 3G6JA 1Q94A 5BV7C 5DD6A 3CFKA 4X4XA 2ZJSH 4WEMB 1I1AA 3LPWA 4OSUH 4WI5A 1EH9A 5C08D 2EE9A 2H8PA 4L1DA 1Z9SA 5D7IA 1BZ9B 1J1XL 4LDLB 3SBWC 2OLDA 4WUUD 5DD5H 1U8QA 2V2WB 4HF5L 4PV8B 3QUZA 3DROB 1KEGH 2ZSWB 5HPMA 5H8DA 1I3VA 1JNHA 3WMSA 1HHHA 5FYKU 4NO5A 3VJ6A 3MJ7A 3W0WD 4J4PC 3O8XB 3QULA 4PLJC 2JE8A 2J5LB 4HZLB 1RVFL 2BFVH 1GC1L 1H3PH 1IC5L 1A6TB 1UWGL 3O6MH 1IM9D 3AC0A 1UH2A 1VEPA 5DT1H 1ACYL 3MFFB 4NUGL 4P9HL 2M2DA 3FO9B 1P7QA 1WGOA 1PX4A 3VI3F 1E6JL 5KVGL 2EDOA 4R7DB 1WBYB 4EDWH 3GBNH 4M1GL 4NZUL 1HILA 2WWKO 5DDHB 1DL7H 4ZQKA 1Q9LA 3CC5B 4J8RB 3UCRA 5EBLA 4JFOA 3IXTA 1GGCH 5C9JA 3C2AL 1J86A 1AD9B 2DI9A 3HN3A 2EDDA 4ODUA 1MJUH 4U1MA 5ACZB 4IRSD 4MAYA 1FVCB 1IC7H 2DWEB 5INDA 1BFSA 5JNYB 3IJHB 5I1HL 1N6UA 1T1ZB 2VN4A 4LARH 43CAA 2ICWB 2A6JA 1EZVX 4ZFGL 2OM5A 4CDHA 1B0GA 5D2NB 4D8PB 4S1RH 5BQ7A 4JZJA 4PJIE 3VFPB 5BXFB 4FFWC 3EZJB 4HHAA 1OF2A 3VXPB 1NDGA 4NQVA 2NR6D 1U0QA 2IFFH 4Z7OF 1GYAA 3QUYB 2I60H 2EECA 4PJ5A 3SE4C 3KYOB 5J3HD 4GH7B 3T3PF 2NY3B 1YUHB 1MJ8H 4KDTA 1WK0A 5DD1L 3U7WL 4S1DC 1OTSD 3TVMA 1MF2H 5IFHH 4BQBA 3BW9A 2OZ4H 3HAEH 4H0IA 1XGQA 4HUWB 4LF3B 1EEQA 2XRAL 1TENA 2W0KA 4TUOA 4P3CH 2IH3A 3WFBL 5DXWA 4PJAE 3P73B 1GSMA 1ZOXA 5LAXA 1V05A 4UV4L 1HKLL 3IU3A 1JI2A 1MHHB 2O5YL 4QXGH 5EOQH 1BVLB 1WAAF 4WWKA 2NW3A 3JVGC 4QRPE 2IBZX 4FQ1L 2E7CA 2J88H 2E6JA 5DLMH 4C4KO 4PLNC 1S7QB 2QADD 5E00B 4HSQA 4MNGA 5CJQH 4MSWA 3QZWA 4YDJB 2XN9B 4LSVH 4PG9A 3JV4A 5GRVK 4Z7VB 3HKFA 1QRNE 1IKFL 2YRLA 4U6VH 3GUTA 4HJJH 4XVUC 3I3EA 1R3IH 4CU6A 1YEFH 4TUKH 1K5NB 5CJXC 5DMKA 4JHAH 1V7NH 3KS0J 2FEEI 4G8FB 4NQXB 4OCXL 4N0FB 4WI9A 2DQCL 3RNQA 2HVJA 3OZ9H 5KVEH 4KMQA 4NQSA 4K8RD 3CZFB 5HYSA 1NBYB 1JRHL 2DD8L 2PR4L 4WHYG 4U3XA 1EGJL 5EUOA 3VFUA 3DETC 2H1PL 4QGTA 3UDWC 2VQ1A 5CSGA 1I7UA 5GJSH 1GGIL 3CFJB 4XNUH 3IB4A 3E2HC 1EFXA 1MAJA 4Y4KD 1A4JA 5J13C 2B1AL 4LLYB 4OV5B 5IMMA 1CFSA 3MGTA 4OCYL 2YHGA 5E8OA 3L5HA 1Q8MA 5BRZA 5C0RH 3QWOB 5JUEL 4OT1H 1ADQH 4JZNA 3BKYH 5A2IH 2Y36H 2PO6C 1CGSH 1FIGL 3G6AA 3MRHB 3HNVL 3HE6D 4XXCA 2IGFH 4Q74A 3SCMA 4XP9L 3GSXB 3QIBD 5DHVH 5IK3B 3BXNB 2HLFD 1LMKA 3B5GA 3ARPA 5HHNB 2AKRB 2C3HA 1DANT 5F89A 5IB2A 3MOAH 1NBZA 4PGDB 1ZLWK 1Z0NA 4PRIB 1FLTX 2FIKA 4MQTB 1I75A 5EO1A 2IPTH 2VXUL 5T5NG 2ZUQC 2W9DH 2QQLH 4G8EB 3MLSH 1V7ML 1T5WB 5L6YH 4UTAL 2A83A 3BD4A 3OGOE 3TO4A 3KPQA 1EERB 1OGTA 1NH6A 2GT9B 1UA6H 3B2VH 4QRTA 4M8QA 4N8VA 4YFLF 4RRPA 3HI5L 1R3HB 1QBLH 4LCCA 5A16A 1UKQA 2HTLD 4HIEA 1RJYB 2EDKA 5D1QD 5BVPH 5FO8B 4OZGE 2J8HA 2PW1B 4JGJA 3CDFA 4W6XB 2J6EH 2EDFA 5E6IA 5C07E 1QQDA 4NBZB 3BPLB 5M95B 3RBGA 4Z7NE 5BS0A 3TBTB 2D4FA 3QNXA 2AAVA 2W9EL 5FO7B 5DF0A 2XV6B 5IFAH 5EFIB 2AK4E 4P23B 1HI6A 4PJXB 3EHBD 3GSQA 3LSOA 2ZOKA 3FAXA 4Y16A 2DB8A 4TVSa 1MJ7H 4DUVA 2HG5A 3B3IB 3VXSE 3GMLA 1MOEA 1QEWB 3GMOA 3GM8A 1RZGA 1MI5E 4G43A 5T3ZD 4BKLA 1QNZL 4DZ8A 3D25B 4G9FB 3TJHC 4G6KH 3MLXH 3WFEH 5FM8A 4P3WA 1C5DA 3REWB 3RWCA 1YEKL 5BO1H 5DZNA 3SE9H 4M1CD 4XRCA 4GBXB 2P43B 5FYJH 3REVA 4JDTH 3TF7C 5DD0H 3LN4A 3PHQA 3MGAA 2GCYA 2AXGA 4XNQB 5E8NA 5F1IA 3W11D 3QAZC 1CLOH 3NIGE 4IDJH 1BJ1J 2M1KA 5CCKH 1FIEA 3VWJA 5D9SA 3UTSD 4XAKE 4K07A 4QWWC 1QG3A 5GRUL 3DI2B 4AG4L 3T0EB 3BH9A 4FA8A 1ZHBB 5HYQA 3I6KA 1J1XH 4UOJA 4DUXA 3JV6B 4G8GD 4H25B 1RJLB 3EDEA 4QRUA 4HF5H 2AP2A 4U1NB 4LASL 1EEZB 1FSKB 1EAJA 5C09B 1CIUA 4NCDA 2ZUUA 3AAZA 3QFJD 5A2LH 1XF3A 4P2CG 4ZUVA 4P4KA 5E03A 1FZJA 1K2DB 2EIZB 4CMMA 1INQB 5IB3B 4YR6B 1T2JA 2VXQL 4ONHB 3ISWA 1RVFH 3F7YB 2A77L 1GC1H 2G2RA 1IC5H 1YN6A 4KRPC 1UWGH 3DVGB 4WI3A 4WFFE 4QRQA 1HHIB 4NUGH 5JW4R 1H0DB 2WUBL 4P9HH 4R3SA 5ICZB 4JPWL 1E6JH 1BFTA 5HHOA 5KVGH 2AEIT 1S7SA 4NP4L 4Y4HC 2ZPKL 3I6LE 5D1ZD 1A1MB 4LPVA 3IJHA 1I7RA 5IVXA 3MBEA 2Y4SA 4MNQB 3FJTA 3C2AH 4QOKA 2JJVA 1FVEB 1IGML 4QF1B 4I0KA 1VENA 1DUZA 1T7VA 1JGVL 1I7TB 5C08E 3C5ZD 4NPYB 5DYOA 4L1HA 2LAGB 1CYGA 2NW2B 3QIUC 2BNRD 3TN0A 3WDHA 5I1HH 2ZNWA 2J8UE 4Q2ZB 3RL1A 3U7YH 3TFKD 1PKQB 3ALPA 1W0YT 3UTQB 4W6WB 5DUPL 3BDBA 1BIHA 4YDVB 4ZFGH 4OCLC 5C2UB 2P5WE 1JWMA 4BSWB 4P48A 1RZ8A 3WFDH 1MCBA 5ILTL 3W0WE 2Q1EA 5C0BE 4S2SB 1A9BA 3WBDA 4X8XA 4ZTOH 4LLUB 4ZNEE 1ZA3A 4RNRA 3NVQA 3WYRA 3WN5A 2O61A 4EI5C 2EH7L 1FL5A 5I73C 2QEJA 2H26B 4P2QB 4HKZB 4LDEB 5DD1H 3T2PA 3U7WH 4U0RC 2HJLA 2LU3A 1MFEL 3AS3A 3QDJB 4ODSL 5MENE 1K8IB 4KROD 4JM2F 3MRKA 4DFHA 2FJHA 4MCYB 4ONFL 1PBYA 2XRAH 1R5VB 4WV1A 5D7LA 5F7NC 3HI6L 3S5LA 2FEDC 3WFBH 1CXIA 1R3LB 3E8UL 4F33B 3F65A 4UV4H 1NDMB 1EZVY 1HKLH 3SJVA 3VE0B 5L2KE 2O5YH 5IVZA 5D6CB 5DZOA 5KTEL 2X70A 4FQ1H 4GKZA 3WHXB 9CGTA 5EBMB 1WWCA 2VDQH 2VAJA 1YMHA 1MFDL 1NMCB 2I27N 3MLUL 2WZPD 1G7LB 1QTYT 3DV6A 4BH7B 1IJ9A 3B9KA 1PX3A 4N0FA 3O8XC 1S3KL 2PYED 3ZDZE 1IKFH 2VL5B 3TP4A 2VZSA 4PRNA 4PYHA 5GGRB 3BVNA 2BMKA 3S96B 3S3JA 1A2YB 2R4SL 5JA8B 3PP3H 2ID5A 3HS0A 4Z95H 5KN5B 5JOFB 5TE4L 1JF6A 2IPUK 4JZOA 3SKOA 4EDXB 4TRPL 4Z8FL 4OCXH 3KLAA 3QQ3A 2DQCH 2QHLA 4E41B 2BSRB 4JAMA 1RUAL 4X6DA 1Z9LA 1YPZE 4TTDD 2Q8BL 5TH2B 1JRHH 2DD8H 4MX7B 3D1MC 2PR4H 2NY6C 3MSPA 4QEGA 4RGMC 1EGJH 2CDGB 2Z31A 2IBZY 3VXUD 2P49B 5GS2H 2H1PH 1V5JA 1BOYA 4F57L 1T21A 4WO4A 1BGXL 4TVPE 1YQVL 1GGIH 1IAIM 4YGVA 1M05B 1AR2A 5ICXB 4GXUN 2NQCA 2QL1A 4MYWB 3GSXA 4DGVL 2B1AH 1O0VA 2YC1A 1O7SA 4OCYH 4C56A 3GNMH 4RCAA 3SHSA 1KENL 4V2CB 5EO9B 2A1WL 5D2NC 5JUEH 4LSTL 1R5WB 4E5XA 4Z7QE 4OAWA 3MV8D 1WZ1L 3HNVH 5EC1B 5BZWA 1EX0A 1JHKL 2BSED 3QUXB 5DMGC 4GG6E 1OAZL 4XP9H 3O4LE 2HLAA 1ND0A 1XR9A 3QUYC 3QIWB 1ZHKA 4PJBE 1HXMB 3BP5B 2NY3C 1OWRM 2VLJA 3JWDL 3QCVL 5LKNA 2VXUH 3MA7A 1H3XA 3S98A 3QDGB 4N0UA 1V7MH 5IOPB 1RUKL 3O2DA 4UTAH 4GW4B 3LKOB 5GGVY 1W72B 3IDXL 4FFVC 4LRNL 4PJ8B 1CL7H 5C6TL 1HHGA 2W1NA 3P9MB 5ANME 1NAKL 1F2XK 3E0GA 3EO1B 3S4SA 3OKDB 2NYYD 5C7XL 4WNQA 4KKAC 2VH5L 3HI5H 2C1OB 4XH2A 3FB6B 1NC2B 1LE9B 1WVZA 5F7KC 4X8JB 3RIFK 2NTSP 5I19L 1J0KA 3D18A 1FN4B 1QSEB 3RIAK 3ARTA 1G7PB 5J0BA 1N6QL 4F3FB 4OZHE 3LEYL 4BUGA 4PGJA 3RHWK 2CDEA 1OAKL 1SYSB 4FHBD 2BRRL 4NQED 1HYRC 3ULSA 2BY0A 1IGFL 1JPFB 3PWPB 2Q3AA 2A73A 3V0WL 2FGWH 2XI9A 2AJUL 1QRKA 1S7UA 2GHWB 4PS4L 4C83A 5A2FA 3K7UA 4LDOB 4U6HB 5FYJU 4K3JL 1WZMA 5E8DL 2ENYA 2ZSVB 1QNZH 3M1BB 1IC4L 2DRUA 1D5XB 1YJDL 5I1AA 1YEKH 2Q3ZA 1JHTB 2XTJE 4XHJC 3MJ8A 3OGCA 3D69B 5F7HA 5DQ9A 3L3DB 5MEQA 2Z92A 4MDIA 1VACA 5BMFL 4RX4D 2AJSL 3C08L 4BJLA 1CE1L 1VADB 4XVSL 2J7LA 5T3ZL 4YHYC 4B53A 3AGVA 1PY9A 5K9OA 1LE5A 5FDWA 3STZA 2NNAA 3A6CL 1OQOA 3FQNA 4JJHA 5FO9A 2WWKT 5GRUH 4OGXL 4AG4H 2APTA 3PNWA 1CE6B 4U31A 2XOTA 4ETQA 4LLDA 4NNXA 1V3MA 5FA3A 5J89A 2VNCA 2GTZA 4IS6A 4LASH 2BP3A 4MJID 1YY9C 3VRJB 3FT3B 1QBMH 1FZMA 3T04D 1DVFD 3RZCA 1U8LB 3VFOB 3RI5K 1VFBB 1YMMB 5I0DA 1NGYA 4F7CB 1NGWB 1H3WM 4KI5C 2VXQH 1T66D 3QG7L 3EO9L 2CIIB 3GIVA 4J1UB 2A77H 3AM8C 3WNKA 1KPUA 2X4SB 4PBXA 3V6ZB 2VB5A 2F54D 1YECL 2WUBH 3FKUS 4PJGE 2BXYA 1FZOB 1WFTA 4JPWH 1BZ7A 3CH1A 4LBEA 4NP4H 1U36A 3LEXB 3MNZB 2ZPKH 4JFDB 3L9RA 5HHMB 4PJ7E 1J8HD 3N1PC 4RA3A 4UDUB 5EZIL 1JPST 5DJYB 5DMYA 5DEGB 4D0CB 1S7WA 5EU5A 4C57C 4PJIA 4JDVA 3UTSE 4EVNB 1C7SA 1IGMH 3CFEB 4YQXH 4MCZB 1JGVH 3IAGC 1FZKB 5BV7L 5C0JB 1S78D 3IDJA 3BMWA 3V6OE 1LNUB 3L7EA 1K4CA 5HDQH 3WUWG 4M7LT 4ELME 2NY4C 2D7QA 5ERWB 2L0DA 3BPLC 2GSGA 3TBYA 4JRYD 3X14A 2X4OA 1RK1B 3IJYA 3JWOC 4ZFOL 5IB1A 3MRQB 1CS6A 1MRCL 5ACMA 2QLVB 3CFIC 3SGKC 1I8MA 2H32A 1F4XL 3QWRA 4JREB 4ZUWA 1RZIB 2DWDB 5EN2B 5DUPH 3QFJE 1U3JA 4Z5RB 1DBML 4P23C 4L8DB 1TXKA 1KB5L 3RNKB 4H26A 3ZDYE 5ILTH 5T1LD 5I76B 4YHML 4N0CD 3D39B 1T0PB 1N8ZB 3LQZA 3VXRB 1HQ4A 3S88L 4HG4K 2YOCA 4U1IB 4ODTL 4DAGL 1U58B 3KPTA 3FOMA 4K7PH 4BZ1L 4PJAA 2V2TA 3EJYD 5DGQA 3D2UD 2EH7H 5IWLC 1HOCB 3MV7B 1WCBB 2H41A 5J6GA 5ESQB 4QRPA 5FKAA 3NTCL 1MFEH 4ODSH 4GBXC 2YXFA 4QTHA 4ZD3L 4J3UA 4HWZA 4LEXL 4ONFH 1LVEA 4MD5B 4F80A 3RX7A 5AD0B 3HI6H 1GCFA 5IROC 3QNYB 3U46A 3RWHB 4KK9D 1I4FB 3E8UH 4PV9B 1QRNA 2V2XA 4ZPTB 3BWUC 4EQ2A 4FXKB 5GZNC 5AWNL 4L4TE 1OPGL 5KTEH 4ZAKB 5CIPA 2DQFA 4P2RB 1CGYA 2OR7A 5DMIL 3MNVB 1A21A 4I3RL 5B8CB 4XI5D 5I15L 4JM2B 4ZSOB 2BVQA 1U42A 2P45B 2A6IA 1VCAA 4NWTL 2RQ8A 1MFDH 5ENWA 3MLUH 1LP9F 2YZ1A 3EOYG 4LRIC 1AO7D 1S3KH 3O41A 2DQUL 4NZRL 1OP5H 4NHUB 3WXVL 3PGCA 5H2BA 3KLSA 4D0BA 2AJXH 2GUOA 5M7QA 1F42A 2R4SH 2IQ9L 3MV11 4U3CA 1D9KC 4M48L 5TE4H 4TRPH 2N7AA 3UTTB 2VZUA 5C0CB 4Z8FH 5K33A 3DWTA 1CF8L 1RUAH 3IFOA 4HJGB 3OJDA 2DQEL 1BQHB 4KJYA 2UYLB 3D0VB 2EO9A 4NQTA 5I17A 1VKXA 2WIIB 2Q8BH 3O45B 2B2XL 5DJDB 2FR4A 2BNQD 3DURA 3J7HA 2EIEA 5E2TH 2NY1C 4NQCB 3RY6C 4F57H 1T7YA 3NOIA 3OB0K 2R2BA 2NZ9C 4UIMB 5C0FB 1BGXH 4JCLA 1YQVH 5HJ3A 1OGAD 2I5YL 2BNUB 1LK3L 5T1KB 1LEIA 1SVZA 1EEYA 1EAPB 3T77A 3OHXB 4B5EA 4OQTL 5DS8B 4DGVH 4NQDB 3VFSA 1KENH 3GJFA 5F9JA 1JPGA 2GI7A 2A1WH 1MRDL 1CGWA 1WTGT 3TZVD 1UWEL 3BH8A 5L7XL 1MWAL 3MXWL 3G5YA 1UC6A 3LRGA 1JHKH 1N5AA 1MFBL 1OAZH 3GSNA 1RIUL 4RAUA 4GFTB 4Y1AB 4GW4A 1KIPB 2YMXL 5BJTB 1A6VL 3JWDH 3MRNA 3ILPA 3QCVH 1NSNL 3ZYZA 3Q5TA 4OZGA 4NIKB 1SJXA 3FT2A 3EYQC 5DA4A 4LLVA 5DUBA 4UQ3B 2SEBB 3FN9A 1RUKH 3ILQC 4PRPB 1N4XL 3RVTC 5C07A 1AKJA 5K59E 3IDXH 4LRNH 1DFBL 4HMCA 5C6TH 1NAKH 3T4AB 5E6YA 5C7XH 1MH5B 1LDSA 3W82A 3DBXA 2VH5H 3C8KB 5F8QC 2EDYA 2RJMA 2AK4A 4GMSL 1FL3A 2GKIA 3KYMA 5I19H 3VA6A 3VXSA 1A6AA 3QFDA 1I8LA 2LVCA 1EPFA 4DK3A 3C6LD 4V1DE 1MI5A 1N6QH 1X5LA 2C4XA 4DJMA 3LEYH 5L88H 5JZ7C 1OAKH 4O2EB 2BRRH 1ZXQA 4JKPL 5D7JB 5JW5A 3D3VD 1TLKA 1NEZB 1IGFH 3D87B 2Q87A 3V0WH 4I4WA 2VERN 3V5DA 5EPMB 2HFFA 1TPXB 2AJUH 5DK0B 1U8JB 4PS4H 3HFML 1KLUA 1IEBB 2JJSC 4Z7WF 4F2MB 3WIIL 5HI3C 5E8DH 4I2XE 3U30B 2P44B 4JO2L 4WHYH 1IC4H 1JK8A 1YN7A 4BK4A 1FE8L 1QFUL 1YJDH 3ZKNC 3PXJA 5GJTL 1G7JB 4OJFL 1F58L 3QEQB 4UI2A 2P46B 3DMMA 5BMFH 2AJSH 3C08H 1CN4A 3ZHLA 1CE1H 4XVSH 3VW3L 1CICB 3SPVB 4YFEA 1FFQA 4JR9L 5IF0B 2H2SD 2OQJB 2H6PB 1Q9OB 5DQJA 4NRZB 3VCLA 1F11A 4I8DA 1KTLA 4XHQA 2A6KA 3A6CH 4RMSA 4AEIL 4OGXH 1CDBA 1VFBA 3Q3GA 1BQUA 5D6DA 4Z0XB 3K46A 2Y5TA 4F15B 5DJXB 2BVOA 3RX8A 1R0AH 4XWGL 1IC1A 3SO5A 5KVFL 1FFNA 1KACB 3QUXC 3KYKL 3H7LA 2FHCA 3BO8A 2KUTA 3ESUF 1B6UA 5EOTB 3QIWC 4PJ9D 4MXWL 1FL6B 4X6FB 4HS3A 4PJEE 4JLRA 5IHZB 1KTDB 2D2OA 1UJ3C 3VFRB 1MCNA 3QG7H 3EO9H 3QO1B 4S10A 5I8CA 1I8KA 4PP1D 4EI6B 3MJ9L 2LFGA 2X6MA 3IJSB 5C08A 3VGFA 1YEIL 2Z8RA 3B9EA 2N4IA 3TC9A 3RTQA 4PJ8C 3U0PB 3EFDL 3LKNB 2J8UA 5JXEC 2ITDB 5EZIH 4BQ6A 1MJJB 1JGDA 1L0YA 1T5XA 1TZIA 4IMLA 4Y5XB 4DQOL 4XCYB 2FH8A 2P5WA 3B5HA 4AIZB 1O5DT 5CWSA 1ZEAL 3FB8B 3W0WA 3GGWA 1N5YH 1XCTA 4K7PX 4Z5RA 5C0BA 3NIDF 3C8DA 1KEML 3KPNA 5BV7H 3LB6D 4JVUA 4PUBL 5CEYB 4ZNEA 25C8L 4MA8L 1A7RL 4HS8L 5JMRA 2ADIB 4R4BA 5T33L 4QHNA 1QO3A 2DOCA 3FHQA 4ZUTB 1MRCH 1BJMA 5E9DB 1F4XH 3KVQA 2EYTB 1X5GA 4BSJA 5EU7C 2VLLB 1DBMH 5MENA 4GT7A 3I02B 3OG4B 1A6UL 1NCNA 4ZUSB 1BVKA 1T22A 3LN9A 2HN7A 2D03H 1C12A 1KB5H 4XZUB 4BFBD 1ORSB 2XNAB 4YHMH 4BK5A 3L3OB 1DP0A 5ID1A 3S88H 1OTUD 4R96B 5E4IA 3O9WB 4L3EB 4ODTH 4DAGH 4KRMB 4HT1L 4BZ1H 4ZPVB 3BZDA 3UBXG 3HPJA 1HHJB 4GUPA 4IRSA 4ZS6D 3PABA 4P2OA 2F54E 2EDRA 1JCKA 5L2KA 2WBJC 4P46A 1KXQE 1U8OB 4AEFA 1OB1B 3NTCH 3FZUD 3O3UN 4ZD3H 5E99L 1MHEA 4LEXH 5GSVB 4DKFL 1B4JL 2D0GA 5HHPB 3CAFA 4MJ4A 2AJVL 1MHPL 1TZHB 2YA2A 2X4RA 5SV4A 4IMKA 4ODWA 2VITA 3S37L 4KKNA 3KGRA 5I1LB 5AWNH 1RJZB 2CK2A 2EZ0D 1WJ3A 1OPGH 4JRYE 4HWEL 1ZS8A 3BT2L 4GW5B 3UJIL 3MRDA 5DMIH 4I3RH 1AHWA 3UO1L 1KYOJ 5I15H 1MLCA 1QR1B 1P5VA 3QXAA 4LOUD 3FQRA 4NWTH 2KH2B 1TJIL 2YD9A 3WLBB 4LCWB 1NFDF 1HCVA 1YPZA 2VABB 3KLHC 3V9FA 4HXBL 2I9TA 4A6YB 2BOBB 4YHZL 2DQUH 4NZRH 3WXVH 4JM4L 5ITFA 2K7PA 4OCSL 3VU2A 4IOFD 1H3UA 3E6HB 1VA9A 1KG0B 3ARED 4PGBB 4GRLD 4F9LC 2XZQL 3TA3B 2IQ9H 4XP5L 1Y18A 2ATKB 3FQTB 4M48H 3VGAB 3QUZC 3EZ8A 3EJJX 1CF8H 4BSVB 4X4ZA 2ADFL 3ZE0F 2DQEH 3VG0L 4DZBB 4Y19B 4JHBA 4YZFE 1LP9B 1MQ8A 2DLGA 1VGEL 5ESAB 2B2XH 4PJCF 5F3HB 1M71A 1IGJB 1RU9L 5EU4B 5CILL 1NFDE 1JZ4A 1SBBA 4GW1B 1DQJA 4YH6A 3GIZL 5HVHB 4GG6A 4UV7L 3O4LA 4NCC2 2BZDA 3HI1B 4DTGL 2OP4L 2I5YH 3MYJA 1D5BA 1X4YA 2H45A 5IMLA 1LK3H 1Z9MA 4PBWD 3WIHL 4PJBA 1YZZA 2RBLA 4LCYB 2R39A 3ZTJG 4OQTH 1W2KT 1RY7B 3MA9L 4JREC 4X6BB 4JPIA 1K4DB 2VWEC 2ADJB 1MRDH 3B6SB 4I0PA 1UWEH 2UVFA 5L7XH 1OQXA 5DI8A 1MWAH 3K0WA 3KJ4B 3MXWH 3S35L 5L0QB 1X4ZA 1BQLL 3MGOB 5ANMA 1MFBH 2VISB 1BD2B 1M7XA 2OMNA 3K4DA 3LHPL 1RIUH 1FG2A 1A22B 4G3YL 1KT2A 2BC4B 3MACL 2YMXH 1A6VH 3KPSD 3EDJA 1I7ZB 5FGCE 1AJ7L 1CL7I 1NSNH 2Y7QB 3QUMA 4LHUD 3HC0A 3LKSA 4QHKJ 3BESR 2NXYB 1AP2B 4OZHA 4LFHD 1N4XH 5SWZD 3LH2L 3AU1A 5DJAA 2BNQE 1DFBH 2C7UB 4FQHB 1PZ5A 3Q5YA 2H9GA 3ARFD 1HZHL 3L3KA 3HZYB 1AC6A 4NRXA 2ARJA 1MLBA 4XX1G 5C86A 4GMSH 5DEFB 4LQFL 4ZAKC 2DTSA 2VDKL 4WHDA 1U3YA 4L3CA 1F3JA 3KHQA 4F7MB 2H2PC 4RZCA 3U9UA 2G60L 3VWKA 5E95B 5CSZB 5DHVB 4JM2C 3O0RL 2NX5E 4PPTA 3STBA 1RIVH 3FQWB 2CRMA 4L4VD 3OAZH 4ISVB 2VL4A 3MRJA 1ZLWH 2AV7A 4POZC 2J8OA 4JKPH 5JHDE 2LAAA 1QLFB 5I1KL 3UTZA 4RFEB 4CVXA 4F8QA 3GKWL 3WIIH 3L6FB 1RUQL 3CVHL 3D48R 3N1FC 4HGKC 4U1JB 4WWKC 2UZIH 4NO0A 2Y1VA 4JO2H 5JPMB 4NJAL 3LV3B 3QQ4B 3JTTA 1X5ZA 3U82B 1FE8H 1QFUH 4OLVL 2AS5M 1E27A 4WTXA 4AT6A 3S36L 2LU4A 4OJFH 3F62A 1CG9B 4NM8L 4LLQB 1CTNA 4XCCL 1EHAA 1IGYA 1N59A 4IIQA 5I1CH 3VW3H 1P5UA 1NBVL 4Z7WB 1FO0L 3O11B 4JR9H 4Z77A 4O9HL 1KJ2A 1NCDL 4GRWE 1DEEB 1YNKL 4R4FL 1DDHA 3LZFL 2BSSA 4AEIH 2DMKA 1AY1L 4MD0B 4U05A 5JIIA 3C09B 4P59L 1XGYL 3O6FA 3V5KA 2YR3A 5IEHA 3C2SA 2X4NB 2JB6A 1S7TB 4DGYL 4XWGH 4U7MA 4PJGA 5KVFH 4KXZH 1FNGB 3KYKH 4HC1L 2P5EB 4HWBA 3V4UL 2CLVB 4MXWH 4PJ7A 1S7VB 5FXCH 5JLZB 3BGFB 1KIQB 1J0HA 3L3GA 1A1NB 3UTSA 4LVNC 5I1EL 5HGBA 3S3PA 3MJ9H 4RISL 2X4TA 3F8UB 1JPTL 4MB3A 1BIIA 3GB7B 3TIDA 3V6OA 4ELMA 4IRJD 5DHYB 4URTB 5DRNB 3M07A 3BDXA 5FUZH 1S7XB 3EFDH 2F53B 4XXCC 3PHOA 5HGAA 3SCMC 5HHXH 1CD8A 2VE6A 3QFJA 4LGPB 3SDDD 4DQOH 3AROA 3WS6A 3K81A 1HH6B 1WCQA 1ZEAH 2GJ6D 3G5VB 2FHFA 2Z35A 2P7TB 4JEGB 5KS9F 3H3BC 1KEMH 4ZUSA 1DN0A 5B22A 4MJ6A 4J3WA 2FZ3A 5CEZD 4PUBH 3DJ9A 3GKZA 3MJ6A 25C8H 4MA8H 5E6ZA 1A7RH 4HS8H 4XNMA 4ZFZA 5T33H 2JB5L 1R3JA 5D7JC 4R96A 2XWTB 1BLNA 1IBGL 4ZS7L 3ULUC 4LHQB 3TO4C 1ZT4A 4Q9CA 1TPXC 2X4UA 3QDMB 4ALAL 5DURD 3DXAB 1A6UH 3VXOB 4WWID 2R0KL 1S9WA 5D1ZA 4L8SB 5C0DB 3W9DB 4KY1L 5GS3A 3BZEA 1H5BA 1ZHNA 1OVZA 1XF4B 4O51B 1D5IH 4FTVE 4HT1H 2FLBT 4JFQB 1JPSL 2GTWA 3RPIA 2VLME 5E6IC 1JF5A 5KS9E 4R9HA 3CXDL 4G6ML 4L4TA 1L7TL 4OKDA 2FR4B 4AYFA 4QTIH 5DJZB 3BP4B 3OXSA 3NFNA 1ZGLM 4M9OA 3N1GC 3AY4C 5E99H 4U6TA 3VFVB 4EN3D 4M7LL 1CFNA 1B4JH 4JFPA 3R8BB 4DKFH 1QSZA 1CICC 4WTZA 4WHTA 4LCIL 3IDNB 3KS0H 4P5TA 2AJVH 1WT5C 4MXVF 1MHPH 1OSZB 3TBVB 4PRAB 3ROOA 5GGSB 3S37H 1EXUB 3ARBD 3ARDB 2DBJA 2APVA 3DUSB 4ODBD 4HUUB 1H8SA 5BW7A 4UBDD 4F15C 4HWEH 3BT2H 1YEJL 3MZTA 5CP7B 4P49A 2OZ4A 2VDLH 3UO1H 1KELL 3HAEA 1CGVA 4JG1L 5IVOA 3JWOL 2D7TL 1KG0A 3N0PB 4KK6C 5FECB 1YQ2A 3VI4F 5SV3A 1TJIH 1DSFL 4X9IA 1AR1D 1F2QA 3D85B 4PJHF 2NMSA 5GS1B 3C5SA 1FCCA 5AYUL 3RGVB 3WLWC 4HXBH 3IFLL 4YHZH 3KYNB 2VMFA 4JM4H 4OCSH 2OTWB 2JIXD 3HG1D 4IHOA 2R1WB 1V8HA 2YEZB 2FECL 1IM3A 3MRCA 4RMTA 4M5YL 2RFXB 2OTPA 2XZQH 2DM3A 4UTBL 3VFMA 4XP5H 4QXTA 2A0LC 1WICA 4OKVB 5LVEA 4CAGA 4JY5L 4JPVL 4Y2DD 2VLKB 3O3BA 2ADFH 3VG0H 5D1XB 2OXGA 1VGEH 2WQ8A 1E0OB 2EKSA 1RU9H 5FA4A 5DVKA 3KPMA 5CILH 4WUKL 2IAMD 4PJHE 2ERJB 1W0VB 3GIZH 3CX2A 5SWSB 1UZ8B 4OZ4A 4UV7H 3RDTB 3ZMRA 5FK9B 4DTGH 2OP4H 4AENA 1JGEB 4XXDB 3DHMA 3V6BR 4I18A 5JIPA 3HZMA 4JPKH 3WIHH 2DQDL 5GGQL 5ESVA 5BZDA 5KSVA 5GRWA 1F3DH 2R69H 3MA9H 5ITBL 5JDSB 1VEOA 1I1AD 3ZDXF 1XT5A 2HVKB 3K8MA 1OAYL 2GSIB 4PJCB 2E9BA 4UOW1 1NUNB 3S35H 4ODHL 1UKSA 4BH8A 3HNSL 1G84A 1GAFL 2JELH 3LHPH 1P53A 4LKCB 4XPAL 5C3LD 2NXZD 3BIBX 5LGKA 4G3YH 4ZXBB 4LVEA 4PIRF 3MACH 5EIIA 1AD0B 1CTOA 2PXYB 1AJ7H 3TN0C 1PG7X 1M4KA 3PWLA 3ZHDA 1I3GL 5KSAB 4V1DA 2UZYB 2D31A 2C1PB 3PIQB 3FB7A 3LH2H 5J7CC 4D3CL 3QXDA 4JN2B 1R5IB 4QHLB 3TO2A 1XAUA 5GIRB 3R8QA 4HKJA 4GLRH 4HUXB 1ZGLB 1HZHH 2CKBL 1I1FA 3UTPE 1DANU 1H15B 3VH8B 4X9BA 3WN5C 3IFPB 4IEFB 4LQFH 3GSVB 1MCQA 1BQSA 2NX5B 2HT3D 2VDKH 3TBWB 4U6XB 5K9KA 5MEOA 4M8VA 5MP6L 4JY4A 2G60H 3VA2C 4I2XA 5TGBB 4H20L 3AXLB 3O0RH 5KZCD 3I84A 1BFOA 4MAYD 3RVXD 1BJ1H 1EHLH 3T08A 4WV1C 1NAMA 1DUYB 3QQ4A 1UM4L 1INEL 2BOCB 3U4BL 4KZDL 2ED7A 4HDIB 5C6WH 5I1KH 2OSLB 3DTXB 1KLFA 2ED8A 3GKWH 4WEUD 3TA3C 1RPQA 2DIJA 3OJ2C 1RUQH 3CVHH 5J6HA 43C9A 1EUUA 3VGAC 1VEMA 4PRHB 3UPRB 3AMKA 3HB3C 4NJAH 4P5MB 3ARUA 3DLQR 1IZJA 3Q6FB 2J3SA 4X7SL 4OLVH 3QEGH 3S36H 5SWZE 4WDIA 4KHTL 2UUDK 4NM8H 4Z76B 3BEVB 5JOPD 2EDBA 4QHMB 3TVMD 1M6OB 5GZOD 4XCCH 5HVHC 4I5BB 4KI1A 2UWEE 3QEUA 4LAJH 3L5WA 1VESA 1NBVH 1FO0H 3AB0B 2IG2L 1IGIL 4XC1L 4PRDB 5ID0B 4O9HH 4HJ0D 1NCDH 1ZT7A 1YNKH 4PJEA 4R4FH 3MLYL 1J0IA 3QJHB 3LZFH 1ZVSA 3BUYB 1AY1H 1IEHA 4M9PA 4P59H 1XGYH 1XIWB 3AVEA 3IAPA 3IGAB 3K2MC 4L4VE 3HE7B 3QI9B 3KJ4C 5IKCB 3I2CL 1JF1A 3TGXA 4DGYH 5L0QC 2W60A 3BISA 2EDWA 3AFLA 4HC1H 4M3KB 4MQ7B 1SJHA 5IBLD 4RX4A 3M45A 2CR6A 4O5LL 3FB5A 3HPLA 4HK0A 4WO4C 2GQHA 5EBGA 4R0LB 1W0WA 1NEZG 4DW2L 4L8CB 2NTFA 4JFFB 3EGSB 3G5ZA 5A3ID 4JO4L 5I1EH 4YHPA 1SEBB 1J05A 4NYLA 4NZTL 4RRPG 1L9MA 4U1HA 4BZYA 2AW2A 3BPCA 4RISH 1JPTH 5I30L 4JGUA 3W9EB 1NGPL 4Y8AA 1A6ZB 5F7DA 3O3AA 3OKKA 1KN4L 5IJKC 3NCJL 4CW1B 4BQ9A 3TH4T 5DK2A 4JFZL 1RMFL 1TCRB 3S34L 3DV4B 2HJKA 2VUOA 1DVFA 1KLGB 3HNTL 3NH7H 1P4IL 1Q9WB 5IB5B 2X4QB 4Z7UB 2YSSA 5IMKB 1XGTB 4X6EB 5EBWA 5FKPA 3PGDB 4YEEA 2QBWA 4QXUL 2JB5H 4NJ9L 2H3NA 3TPUB 5B4MC 1LGVA 5HI4D 2F54A 3IRPX 1IBGH 4WUUB 1TZGL 3FOLA 2HAZA 4WW1A 3ET9F 1C7TA 4NSKA 2QV2A 4ALAH 5I9QB 3FFCE 3CSYB 3EFFB 4M7ZB 5GGUB 2R0KH 2YD1A 4EKXA 2XKNA 1NGXA 5BRZD 4O00A 4W4OA 4E0RA 1IL1B 1PVHA 2D7NA 4NFCA 2ATPB 5CEZL 4KY1H 1A7BA 3D0LA 4K3GA 2NY7L 3KPLB 3DVFA 3GSOB 4LCUB 2EH8L 2QSVA 1Q72L 1CVSC 5AG9A 3SE3C 1A9EB 3VFWB 1OWWA 4G8IB 1JPSH 1PW3A 1T83C 3IETA 3LEVL 5TFSL 1IM9B 1M1SA 1LO3L 1LO5B 4HGWB 1J18A 3CXDH 1JHLL 2XTLA 3LVEA 1L7TH 1U8HB 4G6MH 3R0NA 4JRYA 1DLHB 3X3FL 2ZCHL 2IPKB 1RULL 5INCB 2X40A 4AMKL 3RWFB 1FYTE 4M7LH 1QBAA 2BVPA 3SQBA 4CVWA 1UVQB 1TDQA 4M1DL 4LCIH 3CSGA 3X11B 2YPLD 2GJ6E 1T2XA 2PYFA 1U92A 1TVBB 2PTTA 8CGTA 1A3LL 2DDQL 1M7IA 5CZXC 4XCEA 5IG7B 4ZG1A 5DEZA 2EYRB 3C09C 3HR6A 4QHUA 2FJFA 3F12A 4FQXB 2AJ3B 1YEJH 3D2UA 3LQAC 2OTWA 1KELH 3QQNA 4JG1H 4P5KA 4CL7A 3JWOH 5EU6D 1CDHA 4L8BA 1C16B 3OR6A 1N3NB 5JR1L 4PY7B 1REIA 3DGGA 1MFAL 1AGEB 1ZK9A 3IFLH 3BQUB 5D96B 5KVMC 4X4ME 3NCYS 2FCBA 1UWXK 5I18L 1NFDA 2WLYA 3MZGB 5JPNA 4M5YH 3HZKB 4UTBH 4Y16D 2IMNA 1RUML 4FMFA 3L5JA 4Z9KB 4JCMA 5EU3B 2F74A 7CGTA 2AEWA 4JY5H 5ICYB 4Z78B 5JORB 2KZ1B 2I9LB 2EXYC 3QCTL 5GXBB 1G0DA 3PDOB 3ES6A 4UNVA 4LEOA 3VXMD 1NANI 3S35X 3WDJA 2DM2A 2MWCA 3BRFA 1I85A 2ZUWA 4WUKH 2XFXA 4X98B 3LKRA 5KBNC 2GSIA 4OCRL 1R3KA 3P0YH 4YHLL 2Z8WC 4YWGL 3GMRA 4KKLD 3NBNA 2DQDH 5GGQH 1D6VL 3HMXL 3VWJD 3F7RA 1AXSA 1K3IA 4WFED 1IAIL 1GC1C 5ITBH 4HPOH 2PW2A 1OL0A 4WU7B 1OAYH 2JJWA 3RKDC 4X5WB 1HQRA 2PCPA 2QADB 4L8SC 3O8XD 1GGUA 4KUCD 3PWNA 5B39B 1AE6L 5DJ6A 4H0HB 5GHWL 3HNSH 2BNQA 2E7LA 1GAFH 5CZKA 1NMBL 3HG1E 4GAYB 2AK1L 5T1DL 1BF8A 5GRJL 3RVVC 2DQGL 4P4KD 4M6AA 4LSRL 3C9NA 3EKCA 3S5LG 1J88A 3OB0H 3K74B 2XZAL 5C70A 4CU7A 1T1WA 4P4RA 3DX8A 1I3GH 4HH9A 4DKAA 1UH3A 4QT5A 1CD0A 4UQ2B 2HT2C 4NUJB 5FGBA 5IR1B 3MRMA 1CDYA 2EDLA 2NX5A 2CLZB 4RMWA 1TTFA 4D3CH 3TZVA 3O3DB 5HVGB 1F4AA 5HDBF 2XWJA 3MLVL 3BMVA 1EBAA 5JW4N 5HHOD 1I1YB 5JHDA 3WSQL 3MUHL 4NC0B 2CKBH 1LILA 4RMRA 3U7AA 3ARDC 1EIBA 3ZYIA 4I9WD 3T2QA 2CLRA 2YN3A 4K3DL 4NN7B 1RK0B 3DX7A 4AQ1B 3MBED 1TNMA 4QYOA 5CBEA 3VRLF 4HGMA 5E0QA 3QG6B 1VFOA 1TNNA 2XKSA 3MO1A 4KVNH 4QOKD 5MP6H 4U1KA 3GO1H 5E08L 3GSRA 3C60A 3GSUA 4Y4KB 4H20H 5JQHC 1KB9K 1PG7W 5GS1C 1XCQA 5DD3L 3PQYB 1KJMA 3RGVC 3FT4B 3FQXB 2Q7NA 1WBXA 2GAZA 1UM4H 1EMTL 4S11A 1INEH 1MY5A 5FM5M 3CJJA 4PTTB 3U4BH 2FLRT 3HE6B 4X9GA 4GG8B 2VAAA 3ECBB 5EZJA 3T4YA 5TDPA 2V5SA 3QIBB 2OI9B 2X89A 3WV0A 1HKFA 1T0MB 1HDMB 1TITA 2OL3A 3GMQA 3HTLX 4YAQB 4CGTA 1ZVHA 1BEYL 3LDBB 5D1XC 4X7SH 2XACC 3SDAB 1IQDA 4HIJB 3VGGA 3BN9D 1EO5A 4KHTH 1PYWB 1G7IB 1F90H 1VFAB 5CD3B 4ZOEA 2ZWLT 1VGKB 2ERJC 1OD7A 3FO1B 5B38A 1ZLUK 1JZ7A 3RDTC 3ZTJH 3G9AB 3ALXA 3S8WA 2IG2H 1IGIH 2GFBA 5D7LD 4Z18A 2FO4B 1XF2A 3SDCA 4X7EC 4R7NA 3MLYH 1JN6B 5D1QB 4KXZI 3QNZA 3ULVD 1I3RA 5GS0C 1FNLA 1B0WA 3BEWA 2XN9D 4KJWD 4CN1A 3TIEA 3T0BA 1A6PA 8FABA 3I2CH 2X1XR 1GGYA 1BX2A 4NRYA 1D5MA 1T1XA 4NDMA 4CJ0A 1JV5B 5TQ0H 4PRBB 4BZ2H 4BFIB 4M4PA 4PGEB 2D0FA 2FSEB 1YA5A 4JQVC 5D2LE 1ITCA 4ZXBC 1P2CA 4O5LH 4F7PA 2D7PA 2JCCF 3OTTA 3RL2A 4EBQL 3MCKB 3L3IA 4DW2H 3B9KD 5GGTL 2AEPL 2PXYC 3S4SG 4HFWA 2V6HA 4M61B 4JO4H 2BHUA 2AI0L 2GYSA 1EO8L 4F58L 4NZTH 5KSAC 4F7EB 1N0XL 4ELKB 5I30H 3G5XA 1NGPH 4HQQL 4YHNB 4KKCD 3RWEB 3EYFB 1KN4H 4WENB 3FCTA 1YYLL 3NCJH 2X9WA 3E6FB 4JFZH 2EO1A 3WJJA 1RMFH 3S34H 1XF5B 3WDIA 4PJ9A 3ZT7A 3HNTH 1J10A 1HEZA 4LPCA 4U6YA 1G7HA 5CEXB 1P4IH 2ARJQ 4TN9A 2Z31D 3GJFK 4LL9A 4NKIL 4X6CF 3ZL4L 2MOVA 4OF3A 4OGAC 2HT4C 3EYVB 4FTVA 4KK5C 2O5XL 2EDTA 3HUJF 4N0YL 4OLUL 4QXUH 4NJ9H 4Y4FA 5IB4A 2AJZB 5KS9A 1T0NB 2OTUB 4G8GB 1TZGH 3RUGE 1R24B 1WC7B 5I8EB 4JRXE 4TUJA 3QO0A 3HMWL 3QPXL 4C56D 1N7ML 4HEPG 3WFCL 2Z4QA 3PV6B 1ETZB 1DLHA 3OXRB 3SDXE 3WIFA 5MI0C 2NY7H 2EH8H 1DJSA 1Q72H 4RGNB 3OB8A 5CUSL 1I8LC 2JK5B 1U8KB 4OZFA 3LEVH 1NLDL 5TFSH 1KGCE 3NA4A 1LO3H 5I1DA 3FN0H 5IMOB 5E94A 4KK8C 5IBUB 3X3FH 2ZCHH 1SM3L 4N1HB 1PQZA 3UJJL 5JXAL 1W72H 1A14L 3TESA 5DZLA 1RULH 3IF1B 3GJEB 3VDAA 2BHYA 4OZIF 1XGUA 3MTRA 5T3XD 4AMKH 4AZ8A 3F5WB 5TDOB 4AM0A 1PY4A 4ZFOB 4M1DH 2K1MA 4WI6A 5LJYH 3BKML 1KC5L 4ESKA 3STLB 1I9EA 3U2SA 5KVDL 5FF6B 3KPRB 4JFHD 4MJ2A 4PLKC 2DDQH 4RQQA 1E28A 2X1PA 2WINA 5SWQA 1X7QA 3P4OA 5DFWH 1KB5B 4HIIA 4NO2B 3WO3B 1QYGL 1F97A 3QI9C 2AVGA 4NO3A 4OBSA 1YC7A 3VMPA 1XZ0B 3EO0A 2BNRB 1AGCB 4ODXB 3GMMB 4C58B 5DC9B 5JR1H 3FO2A 4P3DB 3LD8C 2ZCLH 4PJDF 3ULUL 4PR5A 1MFAH 3THML 1Y0LB 3ARGA 4FQPA 5F88A 3G04A 4OZIE 3V7AE 4KJPD 2NY2B 4X7TA 1NCWL 1BF2A 5I66B 5I18H 4PJHA 1FNSL 3KYAA 1PZUB 1FV1A 1YNTB 3FQUB 1XGRB 5F1NB 1RUMH 3BSZH 2OJEB 5D6DC 4PREA 2R9HC 5TE7L 4EUPA 3RWIA 3CIQA 5KSBF 3QCTH 4M6OL 3MRLA 3QJFB 5I16A 1JWUB 1H8OA 4XNYL 2V5MA 4KROB 4TSAL 4Y7MA 5HI5D 4A2LA 2YPLE 4E9LA 5F9WC 1QHOA 1FH5L 3L7FA 5IEKA 4G6AD 3T0ED 5F3BB 3WS3B 1NFKA 1UXSA 2CXGA 4OCRH 2ITCA 3SKMB 5I1GL 4IDLA 3WKML 3IVKB 4YHLH 3ALWA 4YWGH 3IKCA 3OR7A 4JQXA 5KSUA 5FEBA 1D6VH 3HMXH 3LS5L 5C09D 1IAIH 5EU6E 3PP4H 4JVPA 3HR5A 3DGCR 4AJ0A 5I9QC 3GRWA 4M7ZC 4R4ND 1EBPA 2C3VA 1TMCB 4R2GD 2MPAL 3L95A 1AE6H 5T1MB 4ENEC 2V9QA 5GHWH 3RWJB 1K8DA 2HKFL 1UADC 5IM7A 5EUKB 1NMBH 2X42A 4JY6A 2PYEB 3NN8A 3OKNA 5GRJH 2BCKB 4N1EA 1IILE 1UG9A 2AQ2A 3RZCD 2DQGH 5IW1A 4LSRH 3NFPB 3BFOA 3VD5A 1GZQA 2XZAH 4GLRI 3P11L 4YO0B 4S1SL 1YEDA 5DA0B 3VXME 1AGBB 2XWBB 1ZSDB 3U79A 2ZG1A 3MLVH 5DJ2B 1FYHB 3VDCA 3WSQH 3QCUL 5ACLA 4PB9L 1P9MA 3VXUB 5F21B 1BOGA 1UCBL 2IEPA 1FJ1B 1CDGA 3DVNA 2W65A 4K3DH 1MWAB 1NKOA 2FH6A 2ICWI 4YLQT 3LOWA 4X0KB 1N2RB 1MCOL 3TNMB 1GZPB 4IRSC 1ES0B 3EDKA 1UM6L 4P57A 1I8IB 4N0RA 5E08H 2B4CL 3L5IA 4LHUA 2XG4A 1U2HA 4HX1A 3MXVL 5LGJA 3T1FA 2UV3A 5F72S 5E24E 3VD7A 5DD3H 5C0IA 1J11A 1ZTXL 5SWZA 5DJCB 1U8IA 4Q0XL 5D5MF 3UP1A 5D96C 1EMTH 3FONA 3MV8B 5FYKH 5SX4H 2NR6C 4IMKC 1A6WL 4LMQI 1P4LA 5CZVH 4RGOL 1E4JA 2UWEA 5J9PB 1RZKC 3QDJD 5J3HC 2C26A 2ADGA 1RZFL 1AHWC 3MUJA 1XFPA 3ILQD 1OTSC 3PL6A 2GJJA 1E4XH 1C5BL 2AEQL 4L4VA 1JWSB 4WJ5B 1LHZA 1ZWIB 2AQ1A 5CJ5A 5B3JF 4QRPD 4JFEB 1G6RA 2P24A 4QO1A 32C2A 4WFHD 3ZE1E 4X5XA 3T8XA 4OFYA 3BGMA 3T0WA 2FJGA 1G0XA 3ZSSA 5HDOA 1SYVB 3IDGB 2PO6B 3MUGA 2VRAA 3MQIA 5D2NE 1QRND 3RHWF 3GMNB 3L3JB 2QADC 4G9DB 4MNHA 1WWAX 4O2CB 5FM4A 1IAKB 4G7YL 1NCBL 1T03L 4QRSB 4NQEB 4A6YL 3PJSA 1XGPB 5I1IL 1DEDA 1KCLA 1U3HA 3IDIB 4IOIB 1MSPA 4YHKL 4EBQH 3PWJA 2DYPB 3CPLB 4LMQE 2DLTA 5GGTH 4E41D 5C3TA 5EO0A 2AI0H 3DARA 1EO8H 4F58H 3MLZL 3VXNB 1N0XH 1F6AA 2G75A 4I77H 4HQQH 3HLAA 4K8RC 4OLEA 4WGVB 5E5MA 3LPGA 3I6GB 4OLWL 3HC4L 1U93A 1YYLH 4APQA 1YY8A 3GBML 5HGHB 3DUHA 5CBAA 5F70A 4HV8A 2JCCB 2DQJH 3FFCA 3V52L 4NN7C 4YIQB 2MCG1 1T0NA 3MR9B 5CLWA 4ZFFA 5FFLA 1UZ6F 3H42L 2NPLX 5DRZA 3TM6A 2HJFB 4NKIH 4C54A 3V6FB 5CHNB 3ULVE 1MVUA 4FMKA 4Y4KC 5HYEA 4Y5YA 1P1ZB 2O5XH 2XN9E 4HKBB 4N0YH 4GKNB 4F7TB 4XGZA 4Z7VE 3OKEB 4IRJA 3JWDC 4XWOD 1B0RB 4L29A 3PE9A 5DFTA 4GKSA 3HMWH 3QIWD 2KBGA 1RURL 2N56A 1N7MH 3HE6C 3HZVB 3QPXH 4KV5F 2R4RH 4MJIB 3RI5F 3T2NL 1FCGA 3WFCH 5L2JB 1HIML 4LLWB 4H5SB 1FYTA 5FGSA 1KOAA 3QIBC 2GK0A 1M7DB 3LN5A 2OI9C 2HLFC 4OUUA 3DUUB 3QEHA 4X6CB 2MQCA 2GJ6A 5CUSH 1FFPB 3F5WA 1MREL 1CZ8L 3QDGD 2DLIA 3GFUA 3H0TB 1FNFA 4L9DA 3HUJB 1HHKB 3SBWA 1QFPA 1NLDH 3SGEH 5E8PB 4ZO8A 1SM3H 2LTQB 1ACZA 3UJJH 5JXAH 1A14H 4OLXL 5CMAB 4B7LA 1NC2D 2E7MA 1XEDA 2JTDA 2CIKA 4FXGA 5EZLA 1J8HB 1QSED 3V0AC 4J4PA 4NQUA 1FFOA 2R23A 1Z5LB 3BKMH 1KC5H 5KVDH 2N1KA 2HTLC 5D1QC 4X4MA 2YWYA 3DRTA 3X13A 2R2EB 2VLRB 2AK4D 1ZKAA 5CGYD 4ZDHB 1QYGH 3PWPD 2P8LB 5JQ6L 3L3HA 2BSTB 1UB6B 3O2DL 3P0GB 5GRZA 5EH1A 1MI5D 3CX5J 3ULUH 3Q48A 2NY5L 3THMH 5JW4M 4KI5E 4IIQC 1S8DB 1U41A 1UFUA 4YNYB 5C0GA 4EN3A 3EOBB 4KMLB 4PRIE 2EDNA 5FYLE 3EHBC 1WLHA 1NCWH 4FQQB 5T1LB 5KG9A 4XBGA 2CMRH 1SHMA 4LNRB 4YC2B 1FNSH 3IDMB 4F8TA 2CKNA 4MS8D 1JYNA 3HA0A 4HKXA 1MFCL 3QXWA 1OAXL 3U36B 5TE7H 3UTOA 1G7QB 3LKQB 4HIHA 3RWGB 4XAKD 4M6OH 3GMPB 4PJDB 4OF5A 4M1CC 3Q1SL 5DVMA 1PGRB 1BBJB 4H88L 3CZJA 4TSAH 3RWDB 5HY9B 1DE4B 5FDYA 3C5JB 5KW9H 2BXZA 3W11C 1IZKA 1ERNA 4CKVX 3QIUB 4JFHE 4NM4H 5E4EB 3DMMD 4GKOA 2JIXA 3HG1A 3WKMH 1S5HB 2Y07L 1BREA 3SE4A 5DJ8B 4XCNA 4AH2B 5LWYL 5LGHL 1UB5A 5HD8D 3LS5H 3BHBA 1IE5A 5KSBB 3UBXI 2VDOL 2IMMA 3BIKB 3LQAL 4PJXE 5F1SA 1DBKH 4KAQL 2D7OA 1YMMD 3CFDB 1VB9A 4AL8L 4BYHA 1LK2B 3HCVA 4WFFD 1CDJA 5H94B 4HCRA 2Q6WB 1EJOL 3WS6C 3QDHA 3H3KA 4WW2B 2A6DB 3QH3A 4G9FE 4BM7A 3NIFF 2HKFH 3LQMA 4RMUA 4JDZA 4DCQA 1AO7B 2R1XB 2X9XA 1AGBA 3CXHK 4RGNC 1U8PA 2G9HA 1IGTB 4UUJA 4XPGL 4PTUA 1HSBA 2KPNA 3T65A 3I6LD 4OQTA 3JVGA 3WUWB 4FNLL 1DQQB 2Z0BA 3KXFB 4JFDD 5HHMD