1P4IH

Crystal structure of scfv against peptide gcn4
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
112
structure length
112
Chain Sequence
DVQLQESGPGLVAPSQSLSITCTVSGFSLTDYGVNWVRQSPGKGLEWLGVIWGDGITDYNSALKSRLSVTKDNSKSQVFLKMNSLQSGDSARYYCVTGLFDYWGQGTTLTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Directed in Vitro Evolution and Crystallographic Analysis of a Peptide-binding Single Chain Antibody Fragment (scFv) with Low Picomolar Affinity.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords ANTIBODY VARIABLE LIGHT CHAIN
total genus 22
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2003-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p4iH00
3TBTA 2EO9A 4Y4FB 5AZEL 2VABB 2GHWB 4Z7QF 5I9QC 4D9QE 1RUQH 2IMMA 5CGMA 3GI8H 3HAEH 3P9WB 5DD1H 1WZ1L 1PKOA 2MWCA 1NBYA 4QTHA 2AVGA 4FRWA 4U4BA 3H3KA 2DM4A 5B3JE 3RDTB 1MFDH 2BVQB 1RJZA 4TULL 4W4OC 3WNKA 3MV7E 5I8EA 3AUVA 2NZIA 3NA4A 4QNPE 3R4DA 4I1NB 4L9LC 2DWEB 4JB9L 5J6HA 5E5RB 4QRQB 3IDYB 5ESQB 5AYUL 2AP2A 3LD8B 3VRLE 3VD9A 1GPOH 2VNCA 2EXYC 1SQ2N 5C0AB 3TBVB 2V2WA 5JHLL 4Z18A 2MTPA 4P46D 1PGRB 1CLZH 3W9EB 4LBEA 3WUWG 1AD0B 3RZCA 1WBXB 2G5BB 5D7KE 2GJ6A 4ZXBB 5GSRB 1FZJB 4RGNE 4M5ZH 4M6OH 2YXMA 3MRRB 4KPHH 5EN2A 3LKSB 1FIGL 3WSQL 1FH5H 3KPOB 3HZKA 3OSKA 4HFUH 4XI5C 1NSNH 4BELD 1NFDE 4C56E 2Q8BH 1CFNB 1TVBB 4LCWD 5DYOA 5JOFB 5A3IC 2FB4L 3WUZA 4HDIB 3TVMC 4N0UA 5INCA 3U2SB 2J4WL 1E4WH 2XG5A 5F1IA 1HCVA 4JO4H 3MLWH 1YY8B 5DI8B 2DLGA 4KRMB 2KL6A 4LPVA 2LV4A 3ARFB 1LK2A 3VMNA 3WMSA 1TPXC 1OAUH 5FECB 5HDOA 1ADQA 3LS4L 2XTJD 4L29B 3VFGH 4RDQG 1U95B 2EZ0D 2JTDA 1UKQA 3M07A 2EIDA 4J6RH 2F74A 5EORH 3V52H 4YHKH 4LCUA 3QRFM 4Z6AT 3OJDA 3CCHA 3GSNH 1ZA6B 2Z35A 1TETL 4A6YA 3HUJB 4O51A 3CFBB 3KJ6H 4JPWL 3C6LC 3STBA 2ITDA 1ND0B 2PYED 2Z93B 5I75C 3IFOB 3G6DH 2EICA 5KAQG 4U1IA 3U9UA 4KJPD 3GI9H 3S36X 4XVUC 3MV9B 1CXEA 1LO2H 1KPRB 5D9SB 4HUVA 4PRHB 1S5IL 1ZEAH 1FORL 3IJHA 4FABL 3BZEA 2BVPB 5DJYA 5MENE 1UH2A 1JZ5A 2P5WE 4PGJA 1UC6A 3X3GL 1CFTA 4JREC 3HMXA 5MEOA 3ARGA 1OWWA 1A5FL 4YXKL 4ZAKB 5A2JH 1KGCD 5H2BB 5D7IF 1MCPH 4FNLH 2APVA 5FHBH 1TNMA 1YEJL 1MCPL 4FNLL 3LN9A 4HT1L 4P3WA 4XHJC 3PWVB 4XP9L 4G80B 2ZUQC 1CK0H 3GMMA 5KG9B 4P23A 4F8TA 1S7QB 1YMHB 2PXYB 3I02A 1YMME 4M9OA 2VERN 1I8MB 1YEFH 1UVQA 3QFJA 3DVGA 2P5WA 4YDLB 4G3YH 4YDJB 4YHLL 2NY7H 2BJMH 1JNLL 3BMWA 1FVDB 3DX7A 4UNUA 4ZUTB 1JGVH 1UACL 3GI9L 4X6CA 1MHPL 1ACYL 1MHPH 3JUYA 1HE7A 4F57H 2APTA 1ZEAL 5FGBA 4XP6H 3BQUD 1BAFH 5J9PB 5IFJA 1Y18B 4JFOA 3C5ZD 5IIEB 4H0HB 3MLSL 4J7RA 4A2MA 3MLSH 1RY7B 1RZJH 3B4NA 3O3DB 25C8H 3TN0A 1FAIL 2FEEI 4MQXD 1IKNC 3VXTA 2YD3A 3GSRA 3S5LG 1Y0LB 4WV1C 3WIFB 4MVBD 2WBKA 3P11H 2JB5H 2IJ0C 5IBTH 4AMKH 3KYKL 4X7SL 2R0WL 1G6RL 3DV6B 3OMZA 5E4EB 3FO2B 4FFYH 4BKLB 4M8VA 3QDJB 1KYOJ 4G43A 1WC7A 4HGWA 4PGCA 2AV7A 2BX5A 4NQSB 2X7LB 3L3IB 4LHUB 4PJHF 1FZMA 5SWQA 4Y7MA 4ZYKB 1T6VN 4KKAC 2Y6SC 2J5LC 4F2MA 4DVRL 1U8QB 4JFDD 3FT4B 4PRIE 2WLZA 5DRNB 1VENA 1CWVA 4F7PA 2UWEB 4JGJA 4PJ9B 4UOW0 3SPVA 3MNZA 3FOLB 3WFCH 4B41A 3LKPA 3MR9B 3GSVA 1T7XA 2R15A 4ZUVA 4HWBA 1KIPA 2VDNH 4LDOB 4G43B 2VLRB 4GBXD 5DD5H 5E03A 3MLYL 3KPSA 4GRLD 5IT2L 3V95A 1BQHA 4FTVB 5D4QA 4OCXL 5E8PA 3RVUD 3S8WA 1H9VA 4WU5A 4OGYL 1N64H 5D6CA 4F37K 3KYKH 4X7SH 1BP3B 4YX2L 2VZOA 4WU7B 1SY6A 1EJ6A 2X4RA 5HHPB 2HWZH 1EXUA 3ALXA 3H42L 3QQ3B 5E6IA 1E28B 3QO0B 5DRXA 5EO0A 1CD1A 3OHXA 5CSBA 1HHJA 3HAEA 4OB5H 1A6ZB 4AG4L 4KROD 4Q58C 1NFIB 1N6QH 5A3ID 4B50A 1MCDA 3A6BL 3JSSA 1EUUA 3VW3L 4J3SA 4R0LA 4Z76B 4HF5L 4ZUSB 1A6PA 2DOCA 4XVSH 4F7PB 2BSTA 1KC5L 1KJ2L 3TO4D 2AXFA 4X6DA 4D9QD 1FG2B 1D5XA 1I7TA 2RIKA 2H9GA 2FECI 1NAMH 3B6SA 3C09C 2B7DT 1G9EA 2Y06L 4NZTH 2AV7B 1PY9A 4GAJH 1ZHKA 2BY3A 1TIUA 1FZMB 5DC0A 5BZDA 5SWQB 1XZ0A 4YDKH 3N1GC 2BERA 2V7NB 2IWGA 1RJLB 5E94A 4UB0H 4S10A 2R0ZL 3DHMA 1S9VB 4I9WE 3QFDB 2CRMA 1IMHC 5DVKA 2DQTL 3SJVB 5IF0B 1KGCE 2PCPB 3F6LA 1FGVH 1CYGA 2GUOB 4XCCL 2V9RA 2DM7A 1VFAA 4C56A 5IHUL 3F7VB 4JAMA 4Q6IA 1O0VA 4Y4KB 3DTXA 5DTFA 2BVTA 3S34H 2BOCA 3C5JB 5TE4H 3S36L 1MI5D 3WFDL 4HIXH 1I3RB 1G6RH 3TNNB 4HSQA 2VWEC 4X6CB 4NHCH 1ONQA 4XMKL 1ND0A 1CD0A 4JDVB 4MSWA 4NHCL 4XMKH 3RWJA 4C55A 3QUZB 1KCSL 2AJXL 3HA0A 3HKFA 4N5EC 2UWEF 1FQ9C 1Z3GL 2ZUUA 1MWAB 3H0TA 2WINB 5GHWL 5EU7E 2P48B 3LV3B 4ZXBC 5FKPA 2P24A 5JXED 5IM7B 4K2UH 2GFBA 4JY6A 4X83A 4WO4C 3QFJD 5ENWA 5IG7B 2G5RA 1YNKH 4OF6A 1Q9KA 4GT7A 1JPFA 5DJDA 4R3SA 3ZE0F 4ZPTB 1FVEA 3UDWA 1NMBL 5FO9A 3ELAT 3ARFA 5E08L 4I77H 1OGAD 3TEUA 3RBSA 1HEZB 3WFEL 4PJGE 7CGTA 5C08A 5CJOH 1R3HB 5KSBE 4U1JB 3S96B 3WE6A 5ISZD 5IVXE 4U6VH 4LF3A 1M7DB 3VD3A 3QA3A 3MNWA 2Y23A 2XWBB 3G04A 3KPRD 4PJIA 2DB8A 5SWZD 4DKAA 3OKEB 5I8CB 3O6LL 4GQ9L 4RRPA 5DJDB 3VFSA 3VXRD 3ALWA 4J3XA 4PRPE 1PD6A 2DI8A 5D2LE 4ZUTA 1BD2D 1RULH 2VR5A 4XNYL 3U7WH 1WEJH 5I2IB 4OQTA 4BZ2H 1MH5B 2WINA 1INDH 2EIBA 5B3JF 4N0YL 2QSTA 3S5LA 4CVUA 1YYMH 4X9GA 4D94A 2HKHH 1XFPA 4FZEL 1T5WB 4R7DA 4TVSa 1JPFB 1FGNL 4H1LA 3SGDI 4F57L 5L88H 1W0VB 1MRDH 4NQEB 1J1OL 4AQOA 1IQDA 5GGVL 5J12B 3TVMB 3WO4C 3LEXB 2DD8L 5KVGL 1SMAA 2Y5TA 5F88A 1I85A 1IFHL 1X5LA 3SKMA 2WP3O 3L95B 3P40A 1N4XH 4NQDE 4M3JA 2AJZB 5FM5O 1RK0A 5FYKU 2VSDA 1BVLB 2EDFA 1K3ZA 2VAJA 3GUTA 3N85L 4PP2B 1AXTH 3TIEB 1HHKA 1TQBC 5CGTA 1EHAA 4M62H 3BP7B 1H5BB 4HWNA 1S9KC 5D1QD 1IKNA 3B9KA 3QWOA 4PV8B 3MMEA 1FFOA 2VAAB 3CD4A 4DEPB 2RHEA 4APQA 4E0RA 4EUPH 2OQJB 2V7NA 3GRWH 1CLZL 4L8SA 5F1NB 2L7JA 3CXDL 5D7JC 4CVZB 4UT7H 3BT2H 5IW6A 4XPGL 4QLRA 5BS0A 1IC4H 4X6FA 3V6ZA 1UJ3B 5C08B 3HNTL 3F7QA 3QI9C 1LQSR 4HFUL 5B4MD 3LQZA 3WLWC 1MCFA 1RI8A 3JXAA 4C83B 3TIEA 1QLFA 5SX5K 1DBBL 3E6HB 4G7YL 4G7VL 2HFGL 5E9DD 3EAKA 2C3XA 4EIGB 1KJ2B 5ICXA 4OM0L 1DEDA 2GT9A 1GJIA 1OAQH 3QEHA 5DD1L 1NBYB 5HPOA 3L95A 3GB7A 3HS0A 4GMTL 3TZVB 5SX5H 4KJWC 2MKWA 1KJ3L 2ICEA 3OAYK 3CH1B 1U9KA 2F5BH 4J23A 4LSUL 3IDIB 4MJ5B 4XNMB 3REWA 4WI9A 1KLUB 1A6VH 3BI9X 5K9OB 3SDAB 2Z8SA 4W81A 4MD4B 4L5FL 1LE9B 2EXWC 2CLRB 2CO6B 4R7DB 4XP9H 2OLDA 3MXVL 1AD0A 4OZGA 2VXVL 1T20A 5DVMA 1Y6MR 3VXSD 3MLTB 4M61B 4PBXA 1XF5B 3K1DA 4KTEH 2KBGA 4P23D 3GMNB 4F58H 1IC1A 4XH2A 1EA9C 4HK0B 1J1PL 2LVCA 2G2RB 2VXTH 3D0VB 5GGRB 1QVOB 2D7TL 2R39A 5E70A 5JPMB 2HMIC 5BVJB 4TQEH 5C07E 2CIIB 3GBLA 1ZA3B 4G5ZL 5HHQA 3GKWL 1S7SA 1XF4A 2Y9RT 3IFLH 4Q6IB 4LVHC 1N64L 3MODL 1BJMA 1YPZE 4OJFH 4Q0XL 4PJAB 1D7FA 3T65B 5DJXB 1XT5A 4HKBA 3T3PE 1A4KB 2IANA 3BPOC 2BK8A 2RAMA 4NJ9L 2AJSH 1NCNA 1ORQA 1Q9WA 4FFWC 3RU8L 5EU6D 5F70A 4N0FB 4FHBD 3EOTH 1T21B 2NR6C 2Y4SA 3IDMB 4P3CH 3MXWH 1KB5B 2FX8L 3D2UB 5C2BH 3W5NA 2IQAA 4OLXH 5DGRA 4Z7VA 1QFPA 1QRND 3MYJA 3O11B 2AXJA 2ADGB 4YHKL 3KNBB 1I4FB 3UYRL 3HUJF 1NPUA 2Q87A 1LDPL 5KSVA 1MCEA 4WHTA 2R2HA 3VI3E 3OAYH 2WBJB 5F9JA 1T0MB 3EO1B 4S2SB 4WWKD 1V3JA 4B7LA 4M43H 2BRQA 4OUUA 3ZDYF 2QADC 3INUL 1GRWA 3INUH 2JJVA 4RFOH 4XP4H 2AK1H 2XKNB 2ICEB 1R3LA 4UOJA 3LAFA 2ENSA 4X4YB 2H6PA 3RWFA 1NMBH 2FB4H 4P57B 1F8TL 1WGOA 1AKJB 4K07A 4KRPB 3KDMB 1RK1A 4U3HA 3AMKA 4XPFL 1HOCA 1CFTB 2MQ0A 1AHWB 2H26B 1L0YA 1CR9L 4PJIF 3G5VA 4DEPC 5DUBA 5DURD 3HC0B 4MA3B 4HX1B 3UEZA 3NFNB 4ZG1A 1BZ7B 5HD8D 5TQ0L 3HE6A 5E8EB 5HHMD 4TSAH 1A47A 2VKXA 2FH6A 4N8CL 2GSGB 3O4LD 2CGRH 1NBQA 4L4VD 3RVVC 2R1WB 3IDGA 4Q6YA 1KENH 4MHHG 3MRMA 3OPZL 5IOPB 3JV4A 1JNNL 4P5MB 3JWOC 5CSGA 5GRVK 1NLBH 2AK4B 3FCTB 3EO0A 4ZTPH 4M7KL 3WFHB 3LVEA 3PNWB 5I1KH 5C70A 5DA0B 4X98B 1GGCL 1BIIB 4UU9A 4MNGA 5D1QA 1WIOA 1F6LL 4X4ME 5HHOE 4JFOB 1MJJB 4EI5A 4OV5A 1C7TA 2VN4A 4XC1L 2PF6A 4XP1L 1YEIL 5BW7C 1ED3B 1QTYT 5CGYC 1TQBB 3VXRE 2RCSL 43CAA 3V0VA 2F8OA 3OB0H 1Y0LA 5DSCB 2HTLC 5L7XH 4MXQC 2R69H 3LEVH 4NWUH 1OAQL 4ODTL 4RWYH 5D6CB 1BZ9B 4NN5C 2I07A 1HXYA 4LEXL 3NPSB 1QSFA 4WFED 5FUCC 5CAYB 4NQSA 5JORB 4Y19E 2H6PB 1WC7B 5D1ZD 4MZ2A 1H3UA 1IM3B 4P57A 4POZC 1G6VK 4QGYA 4PBWD 3RZWA 3VXSE 4G6JL 3QXUA 1LGVA 1CIUA 3NCEB 2NYYC 5JPMA 4QHMA 2MMXA 5BRZD 1QPPA 1Z5LA 5B38G 3KPPB 1RUAH 3O45B 2MHAA 5IESL 4JY5H 4WFHE 3FQTB 1OARL 2QL1A 4M7JH 4LHUG 4HJJL 1LO3H 4DCQB 3QDJD 3R1GH 1NC2A 1QD0A 2RJMA 2ZCKH 1G7PB 3OGCA 4EUPG 3HZMB 3BP6A 1V3MA 3PWJA 1P4BH 1D5BB 3FO0H 1K6QH 4ODSH 5CBAB 2K3TA 4NQVB 1VFBA 1HSBB 4G9DA 2P43B 3W9DB 2AEQH 3BW9B 4ONHB 3RY6A 1JYVA 4ENED 4NSKB 3H9SB 1S5IH 4DN3H 5HI4C 5JPNA 2X44D 1QFWL 3G5YB 3X12B 3CZFA 1HHKB 5GS1B 4NDMB 3KHOA 5MEQB 1X5KA 1TCMA 4JKPL 1UXWA 4D9LL 1AH1A 3VXQB 2DI9A 3QDGE 3K4AA 1DE4A 3GIZH 3WDHA 3P9MA 5IOPA 4EVNB 4X6BB 3OJDB 1T22A 3BN9C 1A7NL 2J6EH 1CXKA 3FO9B 5LGHL 3H7BB 4WI6A 3MV8D 3ROOA 2VLME 3WEXA 4NN6C 1YEEL 4PRIA 5TF0A 3U7AA 1A4JB 4DN4L 1D6EB 4HK3N 2IG2L 4OCWL 5TGBA 1ES0A 4ISVA 4QHLA 2F58L 1OSZA 2X2YA 4FQHB 2QQLL 3IJHB 3S98A 2VDNL 4NRZA 3O2VL 3AMLA 4QYOA 5EO1A 4I48B 2Z93A 1TITA 2H1PL 5I1AB 1NDMB 1NGYB 3BZ4B 1Z5LB 3SKUD 3WXWH 1FO0A 1U8JB 3NIGE 1KLGB 1IGCL 4M9PA 3VE0B 4TNVK 1NJ9A 1AIFB 3G6JA 5C0EB 1N3NB 2BRRL 2X4QA 4LRIC 2Y7QB 1V5JA 3GJEA 2X10A 1XH3B 3MUY1 2IBZY 9CGTA 3WIIH 1IAOB 5IR1B 2O61B 3GMLB 4AMKL 1F4YH 3EJZC 4JVUA 5ESVB 5FV1L 4NWTH 3F8UB 1DP0A 1A0QL 4QKXB 4JN2A 4BH8B 1DN0B 2ILLA 3OL2A 3ZDXF 1QFUL 4NN6B 3EIFA 1CL7I 5E7FA 5JPNB 1TJHH 1U8NA 2VQTA 5SX4I 3QUMA 1P1ZA 4PJ7B 2J12B 5LCVL 1P69B 1OAZH 4CVWA 3MLVL 3SN6N 5LBSH 5DJCA 2QBWA 2AEPL 2NY3B 3EJYD 2NY5H 3QYCA 1LO4L 4RX4D 1ZXQA 3PWUB 5INDB 2LE9A 5I8EB 3GBNH 4WTWA 4XWGH 4TUJA 4CVXB 3A6CH 4J12A 3GMPB 3DYPA 4WVRA 3Q6FB 4TSCH 1X5YA 3J8F7 3MRCB 5GSRA 1GCFA 2EC8A 5F7WC 5T1KA 1S5HB 3VRIA 1HH6A 1NGYA 1Q72L 3T77A 4O2FA 4QRTA 1TENA 5JW5A 1FNFA 2KQNA 4ESKA 2DQEH 5HYJE 2AEIT 5CZVH 5LVEA 4J1UB 3GI8L 3RWJB 3BD4A 3QZWA 1OWRM 2NNAA 4HT1H 2FBJL 2FX7L 1FO0L 1W2KT 2YD8A 4I18C 1KELH 2NXYD 4Q9QH 2BOBB 5F6IC 1X5IA 4QHUB 1RJZB 4ZXBD 5C0JA 3BEWB 3U0TB 5TDOA 1MAKA 4QF1A 2E7LC 3MJ8A 2IGFL 3QUYD 3SPVB 4WDIB 4I13B 5GGTA 1VGEL 4DVRH 2EDWA 4N90E 4PV9A 3VRJA 3SOBH 12E8H 2NY7L 2DN7A 3D3VA 5EOCL 5EG6C 2J8OA 4E41B 4K9EC 4NNPH 2VLLA 1WBXA 5DXWA 5C0EA 4IJ3B 1B2WH 1R24A 4NZUL 1M4KA 5EOCJ 5F7FA 4MCZB 2YPLD 5ANME 1VB9A 4Z0BL 3QPXL 5J6HB 5AG8A 4PJ5A 3ZHDA 4X6DE 1O7SA 1QSFB 3MCKA 1OL0A 3EZJB 5EU6A 2V5RA 5I71C 2I26N 1A64A 2GSIA 3D3VE 1P1ZB 4M6MH 2YEZB 2HAZA 3JV6A 3RNKA 2YWYA 2X1XR 1YEDB 3BPLC 3IDGB 1PSKL 3EHBC 5D7SH 2P5EB 4KRNA 3HE7C 2Y25A 5FO7A 1G9NC 3EFDL 4CNIB 4YFDB 4EIZC 3ARPA 1U92B 4P2QD 2GI7A 3SO5A 3GKZA 5C09A 4W4OA 2Q76A 2JJTA 3DSFL 3JVGC 4P5TA 3FRUA 1BZQK 3BIBX 1FFRA 1U8MA 2IPTL 4J6RL 3NACL 3C2SA 1A0QH 5HPMA 1GL4B 1OAYH 2DQHH 3MV8A 2NXYC 1WZLA 4HHAA 4QXGL 2X40A 2DRUA 4BFIB 1ONQB 4XCFL 4W6XB 1A3LL 2MJWA 1CGVA 3UMTA 3DI3B 1F4XH 4TTGA 4LVNB 5BQ7A 3DECA 3O9WA 3ZKSD 4PJGF 4UIKL 2AQ3A 4X7TB 3V4VL 1SHMA 4EXPX 3NA9H 1AXSA 1OAKL 3DSNA 3TC9A 4AIZB 1Z9SA 3T04D 3HZVA 3C5JA 1XCQB 3OR7A 1J05A 3SE4C 4JEGB 1A7RH 4PJEB 3HR5A 2DQIL 5IJKA 3BQUA 4KTYA 1RJLA 3VXME 4NO3A 4KZEL 3RDTD 4TULH 4WI2A 1X5ZA 2B1AL 2DLHA 3QDJE 1H3PL 5E9DB 3ZTJH 4WW2A 4DK3A 2C7UA 2QSCL 4PRDA 5GISL 1JYWA 4PG9B 3RWHB 3IXAA 4NC1E 1EO7A 1J8KA 4DW2L 4G6AC 4DN4H 1D6VH 3GIVA 1VPOH 3ZKQD 4MA8L 1CLCA 3MOBH 1UCBL 1MJ8L 1QLFB 2VQ1B 1BFVL 4P2RA 1J11A 3IS0X 3W2DH 1AE6L 3P9LA 4WWKA 4XBPB 3VFOB 5GS0C 5J0BA 1F3RB 4DOHE 1EZVX 4AH2B 1T2QH 3UTPD 5T1DH 1YMMD 3V9FA 4F7CA 4DKEL 2DYPA 5JUEH 1FJ1B 3P30L 3X3GH 5D72L 2DKSA 3EOAA 2RCSH 1K8DB 2A2QT 2X4OB 4HMEA 4LRNL 1MVUB 3FRUB 3DHJA 1FL3A 5DK2A 5FUCE 2X41A 4BM7A 3TBWB 1RZ7L 1GYAA 4UINL 1MREL 1EFXB 3FO1B 5EUOB 3QIUC 2QTEA 5E2TH 3UTSE 5GPRA 3MLUL 3GJFK 2EDKA 4DGYL 1Q8MA 2AJ3A 2WBJA 1AP2A 3BRGC 1BBJB 3L3OA 5DQJA 3AM8C 3GMRB 1JWUB 1FVDA 2MNUA 1PG7X 1AI1L 1K8DA 2BVEA 1WBYB 2WWKO 3QHZH 4FZ8H 2OK0L 4DTGH 3BKYL 5DQ9A 5ILTH 3I2CH 5FF6B 4U1HB 3WFCL 1JV5A 2EIEA 5IV2A 4Y4HC 4PB9H 3ZE1F 5ITBL 4JGMA 4OSUH 4JJ5A 1BIIA 1DR9A 4CNIA 5I8KH 4IRZH 4PRNA 1NCWL 4C54A 5C6WH 2DDQL 3SCMB 4GXUN 4DFHA 4XPBL 1YPZA 1NBZB 4MNQB 4Z0XB 4JN1L 3L1OL 5E2VH 4AL8L 3V5DA 2HJLA 3P0YH 4HGMA 2F54B 2J4WH 5HGHB 1WSST 3OXRB 1AR1C 5IBTL 5CSZB 5DEFA 4H8WC 1WZ1H 2WQ8A 2GTZB 3KS0H 3VGHA 1GGIH 2R2HB 3P4OB 5D7LB 4NGHL 2DJ4A 3D85B 3VFUA 4JM4H 5DJCB 4PRID 5ECJE 4DK6A 5GGVY 4GXVL 3UYOD 3QUZC 2P47B 2YR3A 2XN9E 5JHDA 4RAHA 3AXLA 3HS0B 12E8L 3RWEB 4ODWA 3TCLB 2HJKA 1YUHB 1KNOB 1B0RB 5I6XB 3P4NB 1ULVA 2DQCL 3GJFA 3WS3A 4RFNB 5F1OB 4RGNC 3CIQA 1UM4L 4M1GL 3REWB 1EFXD 2GK0A 5DD0L 1OARH 3BP7A 4GAYB 1OLLA 4NUGH 5GRVL 3MJ9L 4GW5A 5IB1A 3SDCD 1RU9H 1LO5B 3EKCA 1E4KC 1TPXB 2C3WA 2IH1A 1D5IH 1MSPA 5AZ2L 3KR3H 3VCLA 5IMLB 4G7VH 1DBBH 4P59H 3OXSA 4FQ2H 2ADIB 5IB2B 5HDLA 5TF1H 2R29H 2R0ZH 4LHJB 4KVNL 4NQUA 2ATPB 4KI5E 4OGXH 3VWKB 4BZ1L 1DSFH 4EI6B 1QNZH 4C83A 4LKCA 4CMMB 1LILA 2UWEA 4JLRA 3RIAF 4TSBL 3SDAA 2FWOB 1M1SA 5KSUB 4FQXA 4JFYA 5D1XC 2E27H 4MAYD 5C3TA 4MXWL 4JFFB 5HYIA 1I9EA 1M7IA 5GZNC 3VFVA 2VDMH 2JF1A 1FN4A 3MA7A 1V7NH 2BHZA 5D5ME 5E00A 4AY0A 5BMFH 3GMQA 2Z31C 4MXVF 4I3GA 2DQGH 2W60B 2DIJA 5EFIA 3TFKC 1CBVL 5I6XC 3UJIL 3O6FB 4IMKA 1MF2L 5D7IE 3LQMA 2X9WA 3S3SA 2EDRA 2VABA 4OM1H 4M03A 4TOYL 3RDTC 5DO2C 2BVYA 2NY5C 2V17H 4FZ8L 3IKCB 4MNGE 4OIBA 5C0NC 3KPSE 1TNNA 5B21A 2VZ3A 2BFVL 3GO1L 2IQ9L 3HG1B 5D1QC 1WBZA 4HK0A 2ID5A 5FCSH 4WJ5A 3WNOA 2ATPA 3LDBC 3U4EB 1SYSB 2QV2A 2P45B 4EDXA 4U6VL 2EE2A 3FB7B 2R2CA 1KTDB 2EH8L 2B4CH 4XVJL 4CADA 4OZIA 1IEAA 5FO9B 1UZ6E 3RWGA 1T1WB 4FQJL 5M95B 3MRRA 3ALPA 1GAFL 3DJ9A 5KVDL 4HKXA 2VYRE 4H26A 4K8RC 5ISZE 3VD7A 3HZKB 5EB9A 2QHRL 2EEDA 4ZDHB 4XPTH 3S96A 3WE6B 1CLYH 4WJ5B 5EH1A 3VG0H 4LGPB 1K8IB 5TH2A 4WRLA 1TXKA 3RY4A 1J5OL 3VGBA 1FH5L 1SYSA 2NY0C 3PQYA 4KK8C 2NY6D 4QT5B 4Y1AB 1TJIL 3LRHA 2V17L 4X8JB 3QEGH 3I84A 2PR4L 4WENB 1JHTB 5JLZB 3SEPA 3RDTA 1AY1H 1BD2E 3JV5A 5SWZB 4Z7UB 3DARA 4OZGF 3ZT5A 4DKEH 3CC5A 2V9QA 4LL9A 1C5CH 1KJVA 4HUXA 4LCCA 5C09D 1CF8H 4HFWA 3BESR 3RA7L 4HG4J 1JNJA 2Z31A 3MRHB 5FYJL 5ALBL 3DUHA 2A83A 3O6KH 5E00B 5FUZL 4LSRL 4MD0A 4HUWB 1I9IL 1EDQA 4YNYB 2P5ED 4K8RL 2FL5A 2HLAB 4ZMAT 1MHHA 1S9XB 5I1DA 3SDAC 5LKNA 2AV1B 4GKSB 4KJYB 4F7MA 3UAJC 2I9TA 3O9WD 4YBLC 1EAPB 2VTFA 3CNKA 4LARH 2QR0B 5IKCB 2HT3D 3VWJA 4PLOB 2ADIA 3MQIA 2UZIH 4YHYC 3X3FL 3PHQA 2YBRA 3IDJA 3RQ3A 3U36A 3UJIH 4OLWH 3PWPE 5JNYA 2EXWD 3QRGH 3ULVC 1W72L 4K3EH 4Z0BH 3RPIA 5J6GA 1P7KB 3I9GL 1A7OL 5L6YL 1NUFA 3PV6A 2Y06H 4MS8D 2C1OB 3X11B 1ZTXL 3BH8B 4DCQA 1ZVYA 1KTDA 5GJTH 1JWMB 1MRCL 3AY4C 3JZ7A 3WHXA 3RKDC 1M71A 2PTUA 2H45A 4QY8A 5A2KH 3QUML 5J13C 1W0WB 1QZ1A 2VXQL 4EOWH 5JHDB 4GG6B 4FFYL 3GSWB 3BH9B 4OZHA 4PJ5D 3TESA 3DVIA 4HXAL 3LPWA 3WJJC 1IE5A 1U6AH 1OLZA 4LU5L 3SDDA 2R0LH 2QSVA 4MQTB 5DMKB 1G7MA 4N0FA 1I1CA 1OSPH 3SQOH 2XTJB 5KW9L 1DE4B 5IJKC 1INDL 1NC2D 2BDNH 3HPLA 1KPUA 2NY2D 1U2CA 1A4KA 2XKSA 1M7XA 1VFMA 4QRSA 3HB3D 3RTQD 5CP7B 4HPOL 5F3HB 3T3ME 4DGIH 3SJVA 4HIHB 5JZ7C 4UUJB 1B0WA 1T7WA 3A0OA 5IROA 5D1XD 4U1NB 1C16A 4FQQA 1HSAB 3ULUH 1G9MH 1UWEL 3O9WC 5DD5L 1OTUD 2HVJA 1ZS8B 4ZS7H 3ZDZF 5EBLB 4Y16D 4JG0H 4EBQH 4QRPB 5IT2H 5IEKB 1MRCH 5D2NA 3O4LE 2FEDD 4JQXA 4ODUA 3TJEH 3HZMA 4NJAH 4PJAA 1P7QB 5C9KA 3WUWA 1UXSB 2JB5L 3WFEH 4O2EB 3Q48A 1I1FB 4APQC 2CO7B 1U93B 4HZLA 4HW6A 1A2YA 5F7EL 4YHML 5EOTB 2CUMA 4OBRA 1WFUA 2PTTB 3WKML 5DO2D 2V2XB 4Z7VB 4UMGA 3MV7B 4QT5A 4Y1AA 5BV7B 1IVLA 3G6JE 1NUDA 7FABL 1FRGH 4X0KA 3WDJA 2VLKE 5DJZA 2PN5A 3K2UL 4GW5B 1YEEH 1U8MB 5IMKA 1D6VL 4WWID 5CZXD 4HF5H 3QG7L 1M71B 1AHWA 3QEHB 2I25N 4XC3L 5GGRY 3E6FB 2DIAA 1HKLH 1ZHNA 3O4LA 1WFTA 3BH8A 3DXAB 3G6DL 2QQLH 3C8KB 5CMAA 1MCCA 3Q0HA 3FFDB 3BDXA 4XP5H 5ID1B 4LSQL 4M7LT 1UGNA 1T7YA 1U42A 2EDNA 1EEQA 1JTPA 2ZNXA 3BYYA 2IALB 4Y19D 4AH2A 2P8LA 1G6RA 5MEPB 1JTOA 4JDZA 1HIMH 5EU6E 4OUUB 1VESA 3L5JA 2XIDA 4LLYA 1IGMH 2VH5H 3MLTA 4M61A 5TDNB 5BRZE 5BS0D 4JO3L 4PJEE 4JM2C 4JPKL 1OAUL 2B0SL 3BPNB 4E42B 2B0SH 4XCEB 4WIQA 4O9HH 1A7NH 5ANMA 1K4CA 1HQ4A 4UNTA 1WWCA 5ACLA 3A6BH 1CK0L 3LN5A 2UZXB 2VXVH 2QHRH 3DMMD 4X9IA 2VDOH 3QHTC 1C16B 2YN3A 1MY7A 1N59A 2HFEB 4Y5XA 1CDHA 3DRTB 4P23B 2AXGA 2VN7A 4KUZH 4J4PA 4MA3A 4LKXB 3P0GB 1JGEB 5F9OL 2Y5TB 5HHME 2I5YH 2E9IA 2W9EL 5GGUB 2OX5A 2OTUA 1EUTA 3VXSA 4L4VE 3MRNB 3AREA 4MJIE 5EA0L 2A74A 4NO5B 4NIKB 3ROLA 1BAFL 5FKAA 2GTWB 4JZNB 1BVZA 4ZO9A 4P3DA 3UTQB 3T0DA 5H94A 3CDCA 1EEYB 3GSNB 1KUMA 2K7PA 5LQBH 3MV8E 1SJHB 1NH6A 4YC2B 5LGKA 1YEGL 2JJTC 3CVHA 4BH7B 3LHPL 4OD3L 3M8OL 4L9LA 1NGZA 1VADA 3D2UD 4NKMA 2X1QA 4NGHH 3VRJB 3PWNB 2ARWA 4YK4C 5A2IH 1DUYA 4X4YA 2I9LB 3QDJA 2GJZA 1NMCB 1DQTA 1RZFL 2FATH 2FGWL 2Q20A 1ZLVK 3SE8H 1CL7L 3AU1B 2Q86B 4WWKB 4XBPA 1F4HA 2W0PA 1B6UA 3OPZH 5T1LA 1J5OH 2KH2B 4OF7A 2CDFA 1D3CA 4ALAL 3I50H 1ORQB 1Q9WB 3VA2C 5LWYH 4KHXL 4Z77B 2ESVD 4CDHA 3K8KA 4YHOH 1MLBA 2XICA 5F7NC 4WI5A 2BNUB 3SO3C 5DJYB 1KOAA 5E8DH 1W72H 4K3EL 4Z7OF 4V1DB 4KMTL 3MBXH 1HI6B 1Q0YL 3G04B 3ARTA 4NFCA 3KYMA 4OCSL 2QQKL 3U1SH 1KCUL 3DBXB 5ICZB 2O26U 1NAKL 1SBBA 4M00A 2R4SL 4MNQA 4CW1A 1PJ9A 3CDFA 2IPUK 4AENB 2HMID 4JDTL 4MAUL 4MMXC 2XQYG 2VIRA 1YDPA 4I48A 5JMOC 5D7SL 3TT1L 4Y4FA 3VDAA 5EZJA 1Q9KB 4O4YL 5KSUA 3MNVA 1QHPA 3ROLB 3K2MC 4QYOB 2FCBA 5ID0A 2EE6A 1WBYA 2G2RA 3D0VA 2VDQL 4G8IB 5L2KA 5AYUH 7FABH 3ZSSA 2DLEA 4H1LB 4GS7C 1U8HB 3KWWB 3WEXB 2FEDC 5FM8A 3DGGB 2NNAB 5DJ0A 3FN0L 4U1JA 1QSEE 1T03H 1T1XA 3QZWG 3PHOB 2DWEA 3VXUE 2AK4E 3RL1B 2COQA 1T04A 4G9FA 1GGCH 3FRPG 3L3KB 1JPST 1LO5A 4LSVH 1NGWB 2NXZC 2HTKD 1OQOA 1KTKE 3OKEA 4UZGA 2Q8BL 2JJSA 3S35H 1BVLA 1QLEH 5BV7C 4XPBH 1MUJB 2ITCB 1VEOA 1VADB 4WO4A 4D2NA 1F4WL 3NCJL 3G5YA 1VDGA 2A9NL 1XR9B 4GG8A 2QKIB 1Q9LB 4PJCF 4P2CG 2C9AA 3O2DH 4HPYL 2DQUH 3FB8A 3LKRB 1HINH 4PLKD 5BXFA 2NY1C 4JFFA 4PV8A 2V2WB 3TA3C 3ARRA 4RDQF 3GM0A 4PRBA 1A9BA 1WISA 4UTAL 4O2CB 1OSPL 3WO4B 4OLEA 3NH7L 2OMNA 1CICD 2EC9T 3MFFA 1XGRB 4DGYH 3O6FA 2ZUYA 3ZYOA 1F2XK 2MCPL 1HH9A 4EKXA 3PHOA 5DT1H 1EEYA 4H20H 4M1DH 1T4KB 4LLAA 1S3KH 4MQXC 4ODVH 3IJYB 3B5TA 4IIQB 1XR8A 4JFQA 1CD8A 2OSLB 4TQEL 1BQSA 2XQBL 1EH9A 3LSOB 1IC7H 1MHEB 1Z9LA 3TNNA 2EDQA 1B0GA 1IM9B 3EDDA 4Y2DD 4ZXBA 5L6YH 3IDYC 5CEZH 3KXFA 1XF3B 2VDKL 5C0CA 5T3ZE 1CDGA 4HIEB 5DJ0B 1Z2KA 4AYFA 4CMHC 3FQTA 1A7QH 3LN5B 5ESAA 4WW1B 1KSRA 4O9HL 2AJVH 1RMFH 1HHGB 5IFHL 3UTOA 2ED8A 2I27N 2YUXA 3IXTB 4NQVA 2HTLD 4WHDA 5KVDH 3IJSB 3P73A 3V5DB 4OLUL 1CGUA 3VFSB 4MA1B 3UYRH 1IC5L 2FO1A 3FOMB 2UUDK 1I8IB 1KB5H 2XZAH 2C3VB 2IAMB 3WN5A 3MROB 3RWIA 1MWAA 1S7TB 3BIKB 3MCLL 4RX4A 3SQOL 4A2LA 4AQ1B 1S8DB 3RY6C 3HR6A 1K5NB 4HGKC 4AEIL 1C5DA 2OP4H 1QLRA 1U92A 2AKRA 4TTDD 1A02N 1PFCA 4RISL 4ETQA 1XGTA 1X5JA 4PJAF 3PDDA 1P2CA 4BQ8A 1PLGL 1Y6KR 4QTIL 4PUBH 5CSZA 4UI2A 3TP4A 1NGPL 5HY9A 3PGCA 3OJVC 1FE8L 1QLEL 1P6AB 2YUVA 4WV1B 1IGIL 3S37L 3B3IA 1IGIH 3CFCL 3G9VA 5IFJB 3QQ4A 4Y5XC 4PP1D 1BWWA 3FL7A 1NFIA 2AGJL 4RAUA 4KMQA 2MHAB 4YO0A 1OT1A 1ZHBA 4X99A 1O5DT 1Q9OA 5C07A 2JCCA 3QCTH 2YS4A 3ZL4H 1S78C 3IU3A 4J8RB 2DBJA 4E9LA 5DK3A 1NMAH 3Q3GB 1LP9F 1I7TB 1PG7L 3G6AB 3VD4A 1PQZA 3D3VD 4B53A 4NO3B 4MA1C 2FLBT 5B39A 2VDQH 1IT9L 2X70A 2BNRD 4PG2C 5I16B 1ZSDA 1CTOA 4KQ3L 1MIEH 1YJDL 3PWVA 3NOIA 1S7UB 1RFDL 1TQCC 3RPIB 3T2PA 5L9DH 5DRNA 1DQDL 1ZV5A 5JNYB 5EU4B 4QRRB 3FQRA 3IDNA 1F3DH 4FQPA 3L3DB 4NQEE 1JGDA 4U1NA 2SEBB 4PJ8C 1T66C 3MGTB 5FXCH 3S37X 3DTXB 5DTFB 2CR3A 3TN0D 1SJVA 1E0OB 3HRPA 2R4SH 3DX7B 5JDJA 3D18A 2OL3H 4ZD3L 1RJYB 3OR7B 4HHAB 3MLZH 3BIKA 1RSFA 3QR2A 3IVKB 2JB6A 4TTDC 4UILH 5I19H 1KPRA 2NXYB 1AGBA 3HLAB 3E0GA 2B2XH 4OF8A 4XCNB 1BLNA 2D2OA 2DI7A 3SKOB 2GY5A 3W39B 2CK0L 5ABDE 4AZ8A 5EU4A 2AJVL 1I7ZB 1CFVL 4TUOB 1CG9A 1NUNB 1P2CB 1GSMA 1E4XL 4M62L 3WJJA 3EYFA 3DUUA 5ACZB 1A7BA 1IT9H 1KPUB 2H2SD 2AKRB 3QIWB 2BC4A 1ZA6A 1F58L 1LE9A 3ARYA 1JGUH 1OAYL 1ERNA 1KC5H 3QB7C 2GJ6E 1CU4L 3HI6H 4FQCL 3IVKA 3KXFB 1NQBA 4HZAA 4KQ4L 3ZO0A 3CPLB 5D2LA 3WHE0 5B8CA 3O3UN 5TPWL 1DEEB 1A1OB 2RGSA 3O8XA 4CRPA 4OUOA 2XWTA 4P59L 2GITA 4XAWH 3I6LE 1BREA 4TVPH 4H0GA 1T3FB 5HI3C 4XP6L 2BMKA 1RZKL 4TSCL 3O2DL 1B4RA 2BSSB 2V2TA 1KEML 5ADPH 5CCKH 1G7MB 1P9MC 1Y18A 1GHFL 4U3CA 2CXKA 1A7QL 4NQCE 2VE6B 3N06B 2UYLA 1U95A 2H2PD 3RVUC 3HB3C 1RUMH 4OV5B 2D7QA 5EZIL 4L4TE 1EVUA 3J7HA 4I18A 2JIXA 3GSNL 4KHTH 5C0AE 3DV6A 3JV0A 1MJUH 3HUJA 3OAUH 1I85C 5F6HI 5I1DB 2G75A 1OD7A 2OCFD 4RGNB 4Y89A 2A6DB 4H26B 4X5XB 4U1MB 3D18B 5FCUL 1BFTA 4LOUD 4XB8A 2XWJB 4DOHB 5HHOB 3VXQA 1AO7D 4JQIH 1EBAA 4PJIE 2Z31D 1CDJA 2CH8A 4MX7B 3CMOH 4UQ3B 3T2QA 1LP9A 1XEDA 3O3AB 1YMMA 3O3EA 4QXTA 1OAXH 3MRLA 4XPAH 1AXIB 5L8JB 1BEYL 2J8UE 1AGCA 2H26A 1KLFA 3KLSA 5F97E 1KIRB 1MRFL 2VE6A 1Q1JH 1L0QA 3L6FB 5IQ7L 5E2TL 1VA9A 1A6WL 1U8OA 4EEEA 4EXKA 5EUOE 1I1YA 1IC5H 3MCG1 3RWFB 3BP4B 4OLUH 2R4RL 3MRIA 1FDLH 3O2WH 1FZKA 4QTHB 3JWOH 2XZQH 5MP6H 2A0LD 4GRLC 1AI1H 3L5WA 1S7WB 1QSVA 4NNXA 3IFPA 1NDMA 1RHHB 4Z95H 1MJ7H 2HLFD 2R0KL 3CSBA 3MA7B 5GGQL 2GT9B 1G7HA 2X1PA 5IB1B 1U3HD 2GTWA 3BT2L 4JZNA 4HULB 4URTB 3VGAB 1UM5H 3MNWB 3SDXA 3QUYC 3WL9B 4NKOA 5C0DB 2VC2L 1XF2A 4JFDA 5D7JA 5GIRB 4M4RA 3QCUL 4R8WL 1OTSC 5AYQA 1PY4A 4AIXA 1B0RA 1DDHB 1UJ3A 3K0WA 1S7RB 4WCYL 2NMSA 4N0CC 1A4JA 4JRYE 4R96A 2NY1B 5E2UH 2BNQA 3S3PA 4JANB 3F58H 1OVZA 4L4JA 1ZE3C 3QWQB 4PGDA 4LIQE 5ACMA 3K3QA 1XIWC 4KI1A 2CKBL 3U0PB 5DR5L 4WTZA 3PP3K 4IOFC 4LVOB 4X5XA 1WWAX 4UTAH 5J3HC 2VDRL 2IADA 4XBEL 5CINL 4JFEB 4MNHB 3GSUA 4UV4H 4JFEE 3B8SA 43C9A 1VSCA 3CXDH 4XMPL 3OKLB 5D2NE 1PKQB 3L3GB 3BZFA 3SE9H 5I1CL 3JTSB 4PJHE 1YN7A 3BXNA 2X9YA 4XWGL 3D39B 4L3ED 2B1HL 3QXAB 2W0FA 4MAYB 5C0IB 2R9HD 3TO2B 2AEQL 3LD8C 3WL9A 4KI5D 4QOKE 1TZHA 2ZUVA 4M5YH 4Z7WB 5JO5A 2EXYD 2VZUA 3MO1A 1YEKH 3NAAL 3V5KB 3SDAD 3MRGB 5DJ8B 4NQCD 5FYLH 3ULVH 2FR4A 4DWHA 4I4WB 3BGFC 4WY7H 1PZ5B 3QUKB 4HEME 1Q0XL 4BQ9A 4G6JH 5FHBL 1ADQL 3HI5L 2W0FB 5E6IC 2X4SA 3Q1SH 4XBEH 1EMTH 3P4LA 3CPLA 4LNVA 5E4IA 1FC2D 4Z0XA 2YUZA 1CGSH 1I3GH 5FKPB 2DF3A 3OBAA 3N1FC 4PJ7E 4LMQI 2VJXA 3F7VA 3QG7H 4HQQL 3VXUB 1AFVH 3C87A 3MYJB 3O11A 3DIFB 5GGSB 5DDHA 4HG4K 4FQ1H 4ZO8A 1G6RB 2E7MA 1IEBA 2FZ3A 2D7TH 4IRSD 4K7PL 3MLYH 4ZPTA 5D71L 2LAGB 3D85A 3VFUB 4I3SH 2GEEA 3ESVF 4OGAD 4D0BB 1JHLH 4ODHH 4KH2A 2J8HA 4Q2ZA 1WWWX 2LAAA 4E5XB 3T0EB 3G5ZB 1WFOA 1E4WL 1C5CL 1RUKH 4WFGE 4I2XE 4IDLA 3LV3A 1RZ8A 4ZOBA 4U6HB 4JY6B 2LU3A 3TPUB 1SEBB 5EC2B 3MOAL 4P9MH 1BGXL 2YMXL 4PJBE 3QEQA 5D70L 3U6RA 4PJBB 1H15B 4JDZB 2J88H 2YPKA 5I1JH 2R2BB 3QWRA 5I1JL 3UO1H 2E6PA 4ZAKD 3TA3A 2JE8A 4N8VG 5FM4A 3G5VB 1UA6H 1LHZA 3N85H 2OYPA 3VFMA 1H0DB 4HZLB 4RNRA 2YC1A 3KG5A 4TUKH 2R4RH 3PWJB 1KJ2H 5CUSL 1GZPB 2YRLA 1RZKC 4KMLB 2Q6WB 1OGAB 4LLUA 2IAMC 1N0LA 1OGAE 1U3ZA 4LARL 1IZJA 3U48A 5GS3A 2X7LA 3AC0A 1P5UA 3BN9D 4EN3A 4C59B 3VFWB 3T8XB 4X4XA 3UZEA 3V4UL 3FQWA 1P7KA 4OFYA 4GAGL 2AQ1A 4P2OD 5IHZB 1QBLH 2ZCHH 4ZUWA 1FV1A 1TZIA 2YPLB 4H88L 3NCYS 4PUBL 3BGAA 4Q0XH 1HIML 5CP7A 4BUHA 1ZHNB 3O4LB 1EJOL 1OHQA 2VISB 1ZGLA 3MSPA 1DQQA 4NT6A 3RA7H 1G0DA 3CVHL 3M45A 2ADGA 1CDBA 3VDBA 3KLHC 3IXAB 1NDGA 3O6KL 4HJ0C 3VXNA 5F96L 4XNUL 4WUUD 1U0QA 1S9XA 1D9KC 3RTQB 5BQ7B 5C0GA 3LOWA 3ZL4L 5JW3L 3D1MC 2CMRH 2HN7B 1HHHA 3CX5J 3MZGB 3GGWB 2B20A 4NKMB 5CD3B 1UQSB 4NBZB 5DVNA 1FPTH 1UXSA 2V5MA 3C9NA 3PQYE 2NCMA 3QEGL 4ALAH 4FFVD 3VWJD 3TT3H 5GZOC 3T0EA 4F9PA 3SY0A 4DZ8B 2VLKA 4HJJH 2HT2D 5CIPB 3RIFF 4HKJA 1BD2A 3CUPA 2HVJB 3V8CA 4YH6A 3TFKD 3B2VH 4F3FB 1UM5L 5I73C 2IAMD 3QEQB 4WWKC 1V7ML 4I0CC 3SDCB 5I73B 1L7IL 3I85A 4G7YH 1EPFA 3EJYC 5I1GL 3X14B 5KSBB 1S9WB 1FSKC 4K23L 2OL3L 3JUZA 4QRTB 3WO3B 4OZ4A 2GCYB 3E6FA 2ATKB 4U31A 4M7LL 3C9NB 3QAZB 2OM5A 4S1RL 4EUPA 3WLBA 4LEXH 3FKUS 4HUKB 1SEQH 4C57C 5KS9F 3HE6C 1PQZB 3QCVL 5T3XH 3RVXC 3RVWC 2R9HC 3HZYB 4WNQA 4NZDA 3NGBB 5C0BE 4MQ7A 1A7PH 5LGHH 2YSSA 3WIFA 1X5XA 4G9FD 3R06A 4XTRD 3IKKA 3F5WA 2OS7A 4JRXA 1YQ2A 4Q2ZB 5FEBA 1MJUL 4EQ3A 4XPTL 4BK5A 1P84K 4WGWB 5I66A 4LPUA 1K4DB 4NM8H 1GZQA 4PJ9D 5EBGA 5FA3A 2V9TA 2ORBH 3MFGB 5GGTL 5KSVB 4UDTB 3B2VL 1JPTH 3I6LD 5DZOA 4QRPA 4NRYB 4PJXB 2GAZB 4KKBC 1AQKH 2NY4C 3HNVL 4EBQL 1F4WH 4QXWA 3BP5A 2OMBA 4OZGB 3KJ4B 4GRMA 1F90L 4OZGE 1CLOH 4O02L 4GKZB 2AXHA 3KS0J 4ORGB 4L8SC 1VACA 4BH8A 2ITDB 1MFAH 3QUXB 4S0SD 5GS1C 5H35B 5JHDE 5FYJE 5ETUA 3CDYA 1GGTA 2X4NA 4JM2B 4K7PX 2XA8L 1DBML 2ZKHH 3MC0A 1F6FB 4HIXL 3BHBB 5E1HB 5EN2B 3QG6B 3UTSA 2E7LA 3MXWL 3C8HA 3PGFH 3G6JB 5DZLA 4M48H 4IDJL 2CGRL 5JLZA 4WW2F 3MLUH 1B90A 2B5IC 1WUNT 3PIQA 3DX9B 4KUCF 1CBVH 4XH2B 5KVFH 3ARGB 3IAQA 4OTXH 3AVEA 5D1XB 3O0RL 5IB2A 5DRZB 5IBLC 1QOKA 3BWAB 5M94B 2NR6D 2A74B 3CX5K 5J12C 4OF5A 4ODBD 4P46A 1AQDA 2UV3A 4L3EE 3IGAA 4NRXA 3IJYA 1PLGH 2VLJD 5JR1H 3OV6A 1IILE 4Y5YA 4EI5D 5HTSA 4JZJA 5EBWB 3DMMB 3QAZC 1F3JA 5JIPA 1N6UA 4JPVL 4HIJB 1T0PB 2B2XL 2QJDA 4B5EA 1JNHB 2HJFA 4L1HA 2PYFB 5I1AA 2QR0A 4CN1A 1QSED 3DOSA 3DX6B 3TBVA 3BWAA 5DHVA 1QYGL 5LGJA 4MDIB 3HCVA 3B83A 3BPCA 1IEBB 5GS1A 1GZQB 1WF5A 3GMOB 1EK3A 1RZFH 5E6ZA 2KKQA 4K94H 3I6KB 3O2WL 5H8DA 3VDCA 4NCDA 2EYTB 1INQB 3CLFH 2CDFB 3PIQB 4OQTL 4IMLA 4MJID 3LQAH 4HIJA 3BKYH 2BMKB 3DXAE 2P5WD 4AEHL 4HJ0D 1QRKA 3OKNA 2GJZB 2DIBA 5B8CC 3QI9A 1N3NA 3QUXA 5HJ3B 4G6AD 4P46B 1YYLL 5ETUB 4QHNB 5D93B 1R24B 4ERSH 2Y07L 5MI0B 5J89A 4PY8J 4P4KB 3CFKA 4PGZA 5EFIB 1IAII 3DX8A 4HV8A 1W8NA 1YPZF 2D4DA 3U46A 2J88L 4LFHG 1PG7W 5CD5D 4R26H 5CKGA 1QA9B 3ET9F 1MJJA 5HI5C 5CWSB 1ZMYA 1EFXA 3FO1A 5I66B 1FHGA 3NFSH 4TNWK 3U4BH 3MV9A 5D7LD 1FNLA 3MBEB 4PJDB 4IRSA 3HE7A 2Z0BA 3QZWB 1WCBB 5K9KB 3UC0L 3VXMA 1JFQL 3RKDD 1V7NL 3N1QC 2FBOJ 2RFXA 4H25A 2VSCA 3GSUB 1AE6H 1VGKB 4Y4KD 5J56B 4M1CC 1HDMB 3MV11 4RBPK 1K2DA 2A9MH 4X6EB 3PP4L 4XPGH 4HFWB 4YUEL 4RGOL 2BP3A 1C08B 2ZCKL 4RIRB 5GXBB 2XN9D 3L3JA 3QH3A 5CJXA 2KZWA 5E7BA 4PRHE 2DKMA 3QUZD 1OY3B 4O2CA 5F71A 1Z0MA 4RRPG 5T3ZL 1F02I 4YBLB 4FQHA 3VFPA 4DGVL 4OCXH 1B88A 2J2ZA 3DVNA 2FD6H 5JXAH 5DHXB 4LHUD 5I1GH 1TVHA 5MERB 2HKFL 1YEHH 1NEZG 2YK1L 1MVFA 1CE6B 4KWUA 5BVPH 2AJ3B 5I8OH 5JZ7D 3RVTD 4WY7L 4U1SB 1D5BA 2XXMB 5FGCE 3AREB 3PWLA 4IBLT 5FGCB 3SGJC 3ZDZE 5HYEA 4R3SB 3RRQA 5F7DB 4WHYG 3C8KA 5MEND 3SY0B 1CS6A 4XGZB 3QPQD 3KPPA 1FPTL 1H3GA 4BSWA 1JPSH 1BQHB 5E8PB 3VRLF 1KFAH 2E8YA 5HDQL 3P4NA 2J7LA 4OLZH 1KB9K 4KY1H 4XVSL 1J8HE 5TGBB 1ITCA 2C1OA 2XKUA 2JCCF 4Y5VA 5D1ZA 5DFWH 3TO4B 5DT1L 5C0AA 5AG9A 2NY0B 2EH7L 2VDLH 1VFBB 2H9GB 1FLRL 3QNXA 3CGTA 4V1DE 5E6IB 5DLML 2Q7YB 2FJGA 2VL5B 1AC6A 2IH1B 4W6WB 2HFGH 4FS0A 3EYSL 3CFEA 5DEFB 4QOKB 4ZD3H 4P2RB 2N4IA 4Z7WE 5DK0B 2J8UF 4Z8FH 4K3JL 2DTML 3ZYIA 1S7TA 1UXWB 1JMZA 2F54E 2NW3A 2ZJSL 4IOFD 1IGJB 3EFDH 3LKQA 3TJHD 3U7YH 4L8CA 4YHPB 2ARJB 2XRAH 1SEQL 2XRAL 3EYQD 1DLFL 1YUHA 4PTTB 1U8IB 1RMFL 3PGFL 4XAKD 5E95B 1N7MH 3WKNA 5E1AA 1CXFA 3L9RA 4UUJA 5C6TL 3BUYA 3QJFA 2F5AH 3BE1H 3WN5B 4JHBA 3VFMB 2DLTA 3DVFA 4G9FE 2Q6WA 3RGHA 4FFWD 2NTFB 3QWRD 1S7XA 5AAWA 1RIUH 1SYVB 4ELME 1F97A 5BCAA 3WD5L 2ADJA 1RQ5A 3HNVH 2F8VA 3QO0A 2NX5D 4ETQB 2E9WA 2YPVL 5FYJD 1U93A 2EE3A 3FAXA 3MLRH 3LCYA 4M5YL 1BMGA 3SGDH 3HAEB 5E08H 1MAMH 1DUZA 5LXGL 5HHPA 1XF5A 1S7UA 2H1PH 3BHBA 4PJGB 5HHVL 2ZJSH 4KUCD 1P4LB 1QFWM 3UTZA 4FXKA 25C8L 1JE6A 5KSAD 4NO0A 1AGDB 5TE4L 4LEOA 1MRFH 4WI3A 2R2EB 5IMKB 3ECBB 4MD5A 1ZAGA 2F15A 3LQZB 2BNQE 4CU8A 2YD5A 3V0WH 1DVFD 4RMUA 4HAGA 4ZUVB 4NNYA 2FLRT 3V6OE 4Y0GA 2VUYA 1IGTA 5FO7B 1U36A 1QO3A 2ICWA 4UAOB 4XCYA 2MPAL 3BQUB 3V8OA 3PQYD 4RMTA 1JHKH 4PRPD 3ARVA 3ARGC 1XCTB 3B3IB 2BJML 1P7QA 1CVRA 1EERB 4N0YH 5IKCA 5EOCH 4JKKA 1WBZB 5DMYA 5FCUH 1A3RL 5DRWA 1HXMA 5ACZA 3LPFA 3GHEL 1DL7L 1XGPB 2OJZH 3DURA 3QIBC 1JUFB 2FDBP 3MGTA 5SWZE 4Y2DB 3QDMA 5D93C 1RUKL 1R3JA 3VXPA 1I1AD 2HT4D 3FQXA 2BCKA 1U8IA 1U2HA 1FFOB 4X6DF 3T0XA 3FO2A 4LCCB 2C3VA 4Q7DA 3NA9L 5GQBA 3N1PC 2HTKC 3PWPD 2F8XC 1QFWI 3P0YL 2P5EA 1LK3H 2Y72A 4HXBH 1TTGA 5CEXA 1U91A 4QHUA 5GGRA 1JPGB 4L8DA 4BSVB 5JXEA 1IQWL 3G6AA 3HC4L 4YGAB 4LKCB 4CMMA 1JL8A 5J1SC 5T5FH 4DUXA 3CLEL 1AO7E 4HX1A 1EAPA 3HMWH 3IAGC 3BFOA 1YEDA 1OB1B 5MI0C 3VE0A 1I8LC 3EYOA 5HYFA 4DZBA 2VAAA 1GC1H 3WHE1 2CD0A 5IK3B 5I1EL 4XC3H 2D7PA 4NQXB 3FT2B 32C2B 2EIZB 4L1DA 1R5VA 2P44B 4H88H 1T5XA 3D69B 4NZTL 4Y2OA 3HE6D 3O6ML 5GRJL 5IMOA 1UKTA 1FVCB 1V8HA 4UOW1 4PJIB 1JZ2A 2DLFH 3HMXL 1OSZB 3DGCR 2ERJC 4WCYH 3P9LB 3R8QA 3BIAX 5F1IB 3SBWC 1P4IH 5F88B 4N0UB 3HE7B 3WDIA 5HYJB 1S8DA 1A8JH 5J11B 3VJ6A 1YNLL 1FO0H 4Q9QL 1BF8A 3MFFB 2Q86A 3AU1A 4F7MB 5FECA 4KU1A 4P5TC 4YHNA 3G5ZA 5BS0B 1ETZA 1UWGL 4KXZH 3ZKND 3WIIL 3GMPA 3N50A 2B4CC 1ZS8A 4JB9H 1NJ9B 4KKBD 1F3DJ 4I4WA 4EJ1C 2A6JB 2D0HA 4WI7A 5GJSH 4LCYA 4RIRA 2GJ6D 2DL2A 3QXVA 4LBEB 5KN5A 1A3QA 2IANB 4ZPVA 4WHYH 4Y5YC 3EYOB 5F7LB 1IARB 3EO9H 4HPOH 2MCPH 3R1GL 4YUEH 3RL2B 1BX2B 1KJVB 3LEXA 1QQDA 3QUXC 4GSDL 3MRIB 3IDXH 3MLVH 3OG4B 4LSTH 2GQHA 3RX5A 3PHSA 1U8OB 2Z92B 3C5ZB 4X7TA 3T4AB 1JHLL 4ODHL 3MREB 3WD5H 4JLRB 4I3SL 4XXDB 4MJ5A 2CLVB 2FWOA 1U91B 4FQXB 4HD9A 4D9RD 3AAZB 2PO6A 2AJUH 5EULV 4ODTH 4YQXL 1YY8A 4LSSL 4E0RB 3MRLB 1T20B 2ED7A 2H8PA 1S7WA 3B9KC 5TE7H 1GOGA 1R3IL 3SDXE 4I0KA 2L4OA 4BSWB 3B9AA 2IBZX 4Y8AA 5DS8B 5IMLA 1R0AL 2ZOKB 4JHWH 1MY5A 4H5SA 1ETZB 4YDVA 4W70A 1T5XB 4GW1B 4P99A 1DEEA 2FHCA 1VFAB 4JY4B 2A77H 2APXA 5KOMC 3FT2A 4JANA 4DQOH 1WCQA 4L4TB 3BOVA 3BO8B 2WSKA 4GUPB 4JZJC 1T7ZA 3ARBA 4CW1B 2F5AL 4QRUB 3ILPB 1IAKB 1S7RA 4ZQKA 1QEWA 3T0BA 5AD0A 4QWWD 3ZKNC 4MA7H 2W0LA 3QO1A 1XR9A 4KHXH 1FNEB 2XNAB 1X44A 3RAJH 5ID1A 1QSZA 4XVTH 5FOBA 3HAEG 4CGTA 1MEXL 3MRKB 1JN6B 5KS9E 1OGTA 4JFHE 2EDJA 2W07A 3EOBB 5J8OA 1MFAL 2DL9A 2WUBL 2GIYA 2D03L 2X1OA 4JZJB 5EBWA 4N5UA 1E6JL 2AXGB 4C58B 1T1XB 2P46B 4OIAA 2C3GA 4KV5F 4S1RH 4BK4A 5CBEB 2J6EL 4FFZL 5HYSB 1NGZB 4H5SB 5C0RL 5K33A 4NO5A 2VUOA 4QHKI 4JFDB 3QCTL 5EZOH 4OFIA 4OD1L 2EKSB 3OX8B 2CK0H 1EHXA 4CN4A 3D39D 1KN2L 5IG7A 1RPQA 1MQKL 3V0VB 1XCQA 2FO4A 1EFQA 5F1KC 4K94C 5LWYL 1U8KB 1TJIH 4ZUUA 1U3HA 4ODUB 5L2JB 4CL7A 3KPNA 3TT3L 3KHQA 5I2IA 3THMH 3R0MA 3MJ7B 3X13B 4X98A 5IEHA 2H41A 4G8FA 4HS3A 4LCWE 5I1CH 3H7LA 3HLAA 4UU9B 4NQDA 2PETA 4XCNA 3MRDA 3VXRB 4JRYD 1YPZB 2BNQD 1LMKA 3KPQA 3GSRB 3MZTA 1A5FH 1VFOA 4MHHI 2YK1H 4XNUH 4L3CB 4XNQB 1D9KB 2YHGA 3U4BL 2PUQT 4RCAA 2D7OA 4X9BA 2D9CA 1EXUB 2OXGA 3QQ3A 4NYLB 4MLSA 2AW2A 3MRPB 2L0DA 3LEYH 3LKOB 2MQCA 2J6EA 4JR9L 4OGAC 3JTTA 3D0LA 3MRQB 4ZO6A 5I1LA 4NO2A 1NDGB 32C2A 3T4YA 2DQCH 1T2JA 2AEPH 2ZWLT 2IALA 4FMFA 5DSCA 2YZ8A 4R0LB 4Z76A 1AIFA 3MPCA 2OTPA 3EHBD 1TETH 3C5SB 4U05A 1X4YA 4U7KA 4LAJH 3JWDL 3N0PB 4N5ED 4WEBL 1FNAA 3IXTA 2RB8A 1V05A 3F7YB 4IS6B 3QIUB 2HT3C 2YRZA 5D6DC 3P2TA 4LVHB 5DUMH 4EN3C 2PW2A 1IAMA 1WAAA 4L8DB 3PHQB 3WBDA 2HKFH 2H32A 1JIBA 1GGYA 5F7UA 4HS6A 4M1CD 1MFBL 5MERA 1I4FA 1ES0B 4ISVB 5I74C 5HHXH 4TSBH 4JO4L 4XMLL 1LEKA 4MD4A 4Y5XB 4XAKE 3SKJH 1RZIA 3ZDYE 2YPKB 2JK5B 4WFHD 1EO8L 1CD1B 1YN7B 3BXNB 5F93C 3PUCA 4CUCA 4X80H 5C08D 4PTTA 4LPCA 2X89D 1I1FA 4YAQA 1GPOL 3UTTB 4FQJH 4IS6A 3CXHK 5F3HA 2VXUL 4Z7NF 3ILQD 4XCEA 3TBWA 3BUYB 4U6HA 4HEPG 3OKMB 1DVFA 3HC3L 4LAQH 4LCCC 4F80A 1MCSA 1D9KD 4HS6B 2XZQL 5MP6L 3BPNC 4KQ4H 1RZGB 5E8DL 4JRXD 2HN7A 4QHKJ 4OKVB 3GJFH 1P84J 5IGXH 4GRWE 1NCTA 2FJGB 1I7UA 5CD3A 1OM3L 4G6MH 1JGVL 3TIDB 3QNXB 6CGTA 3SDYL 5DHYA 2IQ9H 5DUML 4IIQC 5FYKE 1MI5A 3ZKMD 1YY9D 1DBAH 2HFFB 1FNGB 3W39A 3RVVD 4C56D 35C8L 4IRZL 4S1DD 4YPGA 3DETC 5JUEL 2P8PA 5C0CB 2CDEA 4POYA 4XI5D 4KI5F 3X11A 5E56A 1MCWW 1TVBA 4XX1E 1UJTA 4JFFE 5C2BL 2YD6A 1KIQB 1N5AA 4FP8L 4TVPE 1OCWH 3NZHH 1L0XA 2YPLA 2PO6D 3DX8B 3N9GH 4HV8B 3DXAA 4Y2DC 2I60H 5FUOH 4PY7B 1UB6A 1ZWIA 5F9DC 1T1YB 3MO1B 4JR9H 3OKMA 15C8L 2YZ1A 1EGJH 3VXOB 1R5WA 2P8PB 5HJ3A 4UIMA 3F7PC 1MLCB 3F65A 3X3FH 1WCBA 2CLZA 2OP4L 3OF6D 3SGEI 5I18H 4F2MB 1J0IA 1MHHB 3PP4H 1NCCL 1W0VA 4NQEA 3LPGA 3KPTA 1NCCH 2ADJB 3BAEL 1W8OA 4TUOA 2FGZA 3RZCB 5CEZL 2V7HA 4CVZA 1FBIH 3LKPB 3MR9A 4ELKA 5T3ZH 2XKNA 4NN7C 1X5FA 4NCC2 5GRWA 3L1OH 5E2VL 1XGYL 3MROA 4K9EH 4YXKH 4LSRH 4L4TA 2MFNA 2NTSP 5F89A 2WWMC 4YNYA 2R56H 2BSED 3LIZL 1OT2A 4KROB 1YNTB 2DQJL 3T1FA 4J3UA 1VGKA 2CMRL 1XGTB 3SE8L 3WLWD 2UZYB 2M2DA 2FATL 2FGWH 4GKNB 5MEOB 1C5BL 2FIKB 3OKDB 1KB9J 5GSVB 2Q3ZA 3JV6B 3QUMB 2DS4A 4D8PA 3W2DL 4MVBC 3RI5F 4F7TA 3I2CL 5FAAA 3HC3H 1A9EB 3W0WD 1U3JA 2PO6C 2F74B 1T80A 2QKIA 4N9GB 4EI5C 1E4KA 3GMMB 1FGNH 4KPHL 5KG9A 5L9DL 3HNTH 5ESVA 5I8KL 3ULUL 1FZOA 2ZOLB 2D4FA 1XH3A 4X6EA 5FHAL 2EYRA 3V4VH 3ZYJA 3PG2A 1J7VR 1EO5A 1VEMA 4TVPL 3W9EA 2Z35B 1VACB 1IAIL 5ALCH 4HIIB 1DANT 3BP4A 4N90D 3L7EA 5AUMB 5IBUG 4WO4B 3KPOA 3O6LH 4GQ9H 5F7EH 4NQDD 2BVPA 1ZOXA 3JVGA 3ARGD 4N9GA 1ZT1B 3C5ZC 2WM0A 1LNUA 1U6AL 4NRYA 1OTTD 4PJ8D 2FSEA 1PG7H 2JCCE 1UZ8A 4ZOAA 5T1LD 3D85D 3FT3B 4KJPC 4OLVL 1CQKA 3L3KA 1TMCB 3UPCA 1LP9B 1X4ZA 2NY6B 4Y1AD 4OLZL 3DMMA 5KTEL 3BKMH 4TRPL 3ZSTA 3I3DA 5D7JB 5IB5A 1NLDL 1R3KA 4HS8H 2I9LA 4ZFGH 3SE9L 5KVFL 1FFNA 1OW0A 4RISH 4OSUL 4RSVA 4LSVL 3VGFA 4R9HA 5K9KA 1BLNB 3K4DA 2HVKA 5D2LF 4JM2D 2EDYA 2BVQA 1QKZL 1WAAF 3O2VH 2P24B 1ZA3A 5F89B 4RAVA 2KDGA 2BNRB 4P9HL 2AJUL 3QFJE 5T33L 3OZ9L 1INQA 1QACA 3V0AC 2FYYA 4P23C 3DMMC 5L8KB 3BN3B 4KZEH 4HXAH 4PTUB 5L2KB 4O4YH 5CCKL 4O5LL 3CFJB 3BZDA 1JV5B 2Y36H 3WFDH 4JGUA 1OP5K 4UIMB 2GUOA 4GW1A 3W81A 3ZKMC 3T09A 5I0DA 3IFNL 3FB6A 5CD5C 3PL6C 3QQNA 4GS7B 2F53A 2F9BT 4QXGH 4TUKL 5KN5B 3RUGB 4BFBD 5BRZA 4HWEL 4KTEL 2W1NA 1N5YL 3AY4A 3KXFE 3QULA 5DC9B 3WIHL 5EU5A 1FL5A 3CJJA 5ANMB 2C4XA 2EDLA 3NABL 5B8CB 4Y16B 4U1MA 3WJLA 3V4PH 1DL7H 1D5MB 3MUJA 3MREA 4X8XA 1NKOA 5KVEH 1HK6A 4YFLF 1YEIH 5F9AC 1AHWC 4H1LH 3O81A 5TDNA 2AAVA 2CKBA 3OR6A 3L5IA 4OZHF 4WTZG 1RIHH 1JNHA 3GJFB 3VU2A 1RZJL 3C08L 4LLVA 1TQCB 3S34L 3UPAA 4PS4H 2DQEL 5EC1B 3F12B 4UBDC 1NCAL 3D25A 2BCKB 3UBXI 5C0RH 2E8ZA 4NZRL 4FXGB 5F6IB 1RZGA 1P9MA 1LEIB 4U6XA 2VLKB 3SCMC 2DQFA 2ZSWA 2CKBH 1JF1A 2MCG1 1QFUH 4ZFOL 4YHPA 2VWEE 5FYKD 4HWEH 5CZKA 1LD9B 4XB7A 4G3YL 3W0WE 3VMOA 3QQ9D 1EEUA 3FZUC 5D96C 1IM3A 2XZCL 1NAML 1Y6NR 5ILTL 2R8SL 1A3RH 1C1EH 5I75B 3MLXL 3TYGH 4LDLB 3UDWC 4PJEA 4G8GA 4NKIL 3MRJB 4PJBA 2DQTH 2VDKH 1KXTB 3UCRA 3SDXF 1FG2A 2ZG3A 3BP6B 4JPVH 2O5YH 5K9JL 3DX9A 1FAIH 2A9NH 2J8UB 2YRPA 4MNQD 1W72B 2EH8H 4PPTA 1BHGA 1OQXA 3TLRA 1FVCA 5CILH 5LAXB 1G0XA 5IEKA 2X05A 4YX2H 1J0JA 3RKPA 3GK8L 3KLAA 1KCSH 3NCYP 5JW4N 2NXZB 3QQ4B 1N8ZB 3DV4B 1L6ZA 1R5IB 1L9NA 5IJVA 1IGYA 3P3YA 3JV4B 4DUVA 3H8NA 1C7SA 2XXCB 4RMRA 5IW3A 4EZMA 2VDRH 5I1LB 1JNLH 5KW9H 3EOAB 3VXMD 1YYML 3TN0B 1GGBL 4KK5C 3VA6A 4YWGL 4M6NH 3SHSA 1RVFL 3KJ6L 2CDGB 3ROOB 1QRNA 3ES6A 5DRXB 1NGXA 3I6GB 2V5SA 3B5GA 4LCWB 3GZKA 1ED3A 2QQKH 1ZLWH 1U8LA 1Q0YH 5E1AB 2VLRE 2GJJA 5HHNA 1G0YR 4UV7L 1TVHB 1ORSB 4JDTH 2BHUA 4O00A 1OGAA 1DVFC 5MEQA 1A21A 5IM7A 2R0WH 5AAMA 4FQIL 1JF1B 3NIGF 8CGTA 4CU7A 1NGWA 2ZUXA 5F9WC 3IETA 4PGDB 1QBBA 5IBLD 1PZ5A 4UT9L 1PYWB 4WFEE 4KKNA 3QXWA 3I6GA 3LKOA 2HT4C 3CK0L 4P5KA 3TBYA 5J9PA 1C8PA 1DBKH 4OFPA 1N7ML 2RR3A 3KPNB 5ESAB 2NLJA 1EEZA 4RBPH 2VXUH 2XFXA 3BDYL 3ECBA 3ULVF 3I50L 5EU3B 1DQLL 3LKNA 4Z7WA 5JO5B 3BH9A 4PD4J 4GW4A 4G8GB 4M6OL 4M7JL 4HQQH 1EAJA 3NPZB 4P5TB 4PJCA 5JOFA 3O6FD 1AXSB 1FJ1A 4LLWA 2XZCH 1QA9A 5D6DA 3K4ZA 1LWRA 4ZTOH 1HZHL 2W9EH 2C4FU 2V5YA 1VEPA 1URLA 1CFSA 3EYSH 1HCFX 2ERJB 1CQYA 5E8OB 1BPVA 4Z8FL 3NIDE 4XVTL 1OPGH 1F8TH 4G6FB 4IRJD 4PY8I 4O58L 1IAIM 3NMEA 3V5KA 4XCCH 2CQVA 4XPAL 5KS9A 3MRKA 2W65B 3LS4H 3PGCB 3MGOA 2NY2C 1TDQA 4LCWA 4RGND 2APFA 2EO1A 5J6GB 4KRPD 1KTLA 1G7HB 4DQOL 5HYJA 5ISZB 1CIDA 1H3VA 1U58B 4RFEA 4WI8A 3WCYA 4M8QB 4QEGA 5BOZG 4KGJA 4IOIA 1C12A 3JWDC 2MPAH 4R2GD 1CFNA 4DGIL 2N7BA 2AJYH 2NW3B 4Y1AE 1HILA 3IDIA 3UJJH 2BNRA 4Q9RL 4IIQA 4JFQB 3HZVB 4NPYA 3PWPB 2OK0H 3EOBA 3FB7A 4NUJA 3VFRA 1M7IB 3MLXH 1F13A 1IEAB 2OJZL 2FR4B 1UYWH 4ODXA 4K3DL 5SWZA 1LVEA 2IFFH 4ZAKA 2VO5A 3OWEA 5TJWK 2JK5A 5HHVH 3O6FC 4K55A 3U7YL 4GG6F 2D3VA 4JO2L 3QQ9C 3AM8A 5IVXB 5I1HL 1I1YB 5TH2B 5E2UL 4MX7A 3U79A 2Q1EA 4YHIA 1FLTX 1RK1B 4LSDA 3VFGL 1WZKA 2GK2A 3Q1SL 1J9CT 5KBNC 1DBJH 3PV6B 5ADOH 1DQJB 4FQXC 5D1XA 1IKFL 3MACH 3RWCB 5D5MB 5CJ5A 4N1HB 1RULL 2V2TB 3ARWA 1NFDF 4DAGL 1NEZB 3CK0H 4Y16A 3ULUE 4HLZH 1ZLUH 1CE1L 2Q3AA 1JRHI 1CE1H 5C0ND 4XZUB 4BYHA 3RGVC 1JNNH 4D0DA 3PGDB 3U0PA 4ODVL 3KVQA 4M7KH 1HQ4B 2WIMA 4YHOL 2GY7B 2A38A 4AEHH 4X9FA 4ELMB 1G9NH 1JUFA 4FXLA 1MAJA 2VLRD 1TZGL 3L5XH 4PJBF 3DI2B 4PB9L 5I8CA 3HG1E 3SDDB 1S78D 1YYLH 3I9GH 3D9AL 4QTIH 1NCWH 4JM2F 5JTWA 3WXWL 1PEZA 2Y07H 2MKLC 2X1WL 3IT8D 3KYOB 3QEQD 3S88L 1CR9H 3RNKB 1I1AA 3UX9B 3PL6B 1ZK9A 3R8BB 3NCBB 5C0DA 3EYVB 3ARBC 3PGDA 4P2OC 5DA4A 3C6SB 5IW1B 1DLHA 2IAND 1T3FA 3FMGH 4CN6A 2YD9A 2DQIH 2IC2A 4JM4L 2EDXA 2VB5A 2XA8H 2Z8VC 2ZKHL 3KPMA 3JBG7 4WDIA 4WHCA 5IVZA 5MHSD 1S7SB 5IFAL 1T1ZB 5T5FL 2WP3T 4I5BB 1MWAH 2DWDB 2VDML 4WUKH 1RJYA 5HXMA 3VI4F 3BPOB 2ZOKA 2VLLB 2YUWA 3L3HA 1FC1A 5LBSL 5GSVA 5KSBA 5IVXA 5DJAB 2VZVA 5JIKA 3P4MA 4C4KO 3LZFL 4U7SA 2F53D 4BZYA 3FQRB 4YEFA 2IADB 3H9HA 5D2NC 1JPTL 3MTRA 2Z92A 3IU4H 5IGXL 1J87A 2YPLE 1BJ1J 4KDTA 1A1MA 4D0CB 1XAUA 3FHAA 4FQ2L 5DQDH 4QWWC 5E8NB 2AS5M 4NJAL 5T1DL 4JN1H 2WBWB 4NC1C 5JXAL 1YEGH 2JB6B 5HVHB 4XZUA 5FB8B 4LLMB 1MH5A 3NAAH 2Q8AH 3F5WB 1BX2A 2O5ZH 1MI5E 1PZUB 2R56L 2P7TA 2ADFL 1MI5B 3NIFE 2HP4A 4EI5B 1FN4B 3OXSB 3QEUA 1KNOA 1XGPA 3HRZB 1JF5A 5HBBA 3GHBH 1PX4A 4TNWF 3AROA 5CGYD 1FFPA 5EO9B 1UENA 1CDCA 4PGEA 1KBGL 3VGGA 5IFHH 4KZDL 3NH7H 4OLXL 2GAZA 1JTTA 1A9EA 1OCWL 3NZHL 5GISH 1D5XB 1YC8A 2AERT 5HI4D 1BZ9A 3V0WL 4OT1H 5IB5B 3AS3A 5DD3L 2VLKD 2HH0H 4KRLB 5DJ6B 4GKOA 4ORGA 4JPWH 5C2UB 1HYSC 3SBWA 2EEAA 4AJ0A 4FQCH 5HVFB 4Q74A 5HHMB 3EGSA 2VDLL 3IU4L 3UAJD 3PABA 3HE6B 5E8EA 4MJIB 5CP3A 3BSZL 3MJGX 5IP4A 3EBAA 1DUYB 5EIQA 1NFDB 4GAJL 3UROR 3S6CA 4MCYA 5CKAA 3RX7A 1MCHA 1QSEA 1OAKH 4MD5B 1K3IA 1RHHA 1CLOL 4O02H 2ICCA 2WMPA 2HFEA 1X5GA 5D7JD 4GBXB 3QISA 4GKZA 4L4TD 2NY3D 1F11A 3STLB 4FG6D 2NLJB 3F7YA 3RX8A 5ISZA 2ZUSA 4JDVA 4MSWB 3ZE1E 5GS2H 1GIGL 1MCIA 3LKNB 4CU6A 5BS0E 3MJ7A 1E27A 4JKLA 4NFDA 3L3DA 2GSGA 3FMGL 4JFHD 2YD4A 3IDJB 3BDBA 5FYKH 2AJXH 5TQ2H 1NUGA 4OT1L 5BJTB 4K7PY 2NXZD 5IFAH 2E6JA 3QNZA 1JWUA 5C0FA 4OTXL 3WUWB 4H20L 4HKBB 4JCLA 3MJ9A 4GSDH 3FHQA 3L3OB 5DQJB 1F3JB 3FQXB 5E8OA 1FNSL 4PY7A 5GGSY 5AWNL 1NCBL 3UTTA 3H7BA 2NY5L 3QFDA 4GRMB 3SKOA 4ODWB 3TCLA 3S35L 3FQUB 2A9ML 2XWJA 4X4MA 5HHOA 4UIKH 2JIXD 1G9NL 3D39E 4XAWL 2CIIA 1UYWL 2PYEB 1MCBA 4FN0A 3RJQB 1NCUA 3T8XA 4BSJA 5IBUB 2B5IB 1X9QA 4XPFH 4U1GB 5HVGB 5I30H 2XTJC 5J06A 5A16A 3O3DA 3CC5B 3HPJA 1SM3L 1JGDB 4D0BA 2V7HB 4S11A 4R26L 3E1F1 1QVOA 4FP8H 5JQHC 1QR4A 3ARFD 4YR6A 3GSQA 2DBLH 4JFDE 4MJ6B 1Z3GH 3KLAB 3QI9D 2IGFH 1E4XI 1AGBB 4DAGH 4HMDA 3VD5A 1YMHA 2PXYA 5KOVC 1WIPA 3GNMH 4ZS6D 5SV3A 2F53E 4KKLD 2OTWA 4JFXA 4KI5C 4BZ2L 1QSEB 1P5VA 4HWZA 2ZPKL 1AR1D 3FN0H 3QHZL 1GGBH 1JBJA 1HHHB 1Q94B 1GC1L 3ARBD 4WNQB 4MB3A 4ZFZA 3SE3A 1H0DA 4RNRB 4N8PA 2A6IA 5ICYB 4P5TD 4GH7B 4KJWD 1WWBX 1P4BL 4NC2B 5FKAB 1NGPH 5H2BA 1E6OH 1RIHL 4EN3B 4WHTB 4JO2H 4HC1L 5FIEA 2X4UA 2X5PA 3OXRA 1WT5C 1MCJA 1UWXH 3HG1A 3GBML 1QYGH 3ZHKA 4L3EA 4TPRH 2ADFH 3QXTA 3Q6FA 3MOAH 2DMKA 2ESVE 1HYSD 4YXLH 2ESVB 1EO8H 1R0AH 4GXVH 3L3JB 3IETB 2DYPD 3KYNB 4KAQL 1FFNB 3FQUA 4YLQT 1OD9A 1KFAL 3DUSA 3ME0A 3T0VA 2R8SH 3WS6C 3C5SA 3DGGA 4UNVA 5DUBB 1KV3A 3ZMRA 5GRUH 2BSTB 5C07D 1UG9A 3FT3A 5E8NA 4IJ3C 5ITBH 5L88L 5DFVD 3S4SA 1A9BB 1ITBB 4LSTL 2HRPH 3C09B 5GRJH 1OM3H 5A43C 4NYLA 2Q7YA 3GSWA 4LASL 2WUCH 3QULB 1QBLL 3VWKA 1IC7L 1G9MC 2H3NA 2H2SC 4QO1A 4PREB 4Y5VC 1U8HA 3KWWA 4K8RD 4OF0A 5E99L 4AK1A 5DUPL 1CGYA 1MFCH 2BSRB 1JGLH 4TUJB 4HPYH 4CDGC 3NZ8B 5K93A 3SKJL 1IQWH 1JJUA 3VXUD 1HN1A 3X17A 8FABB 5EZJB 4X5WA 1T1WA 3GHBL 4IRSC 4MLIA 4Y4HB 4OZIB 3VI3F 1A1NB 3SOBL 4Z7QE 1ADQH 3HI5H 5IW6B 1NMCC 1FRGL 2BZDA 3BDYH 5I0ZA 3EGSB 3NGBC 5KTEH 3RP1A 3PABB 1I9JH 2VDOL 4HWBH 5SX4H 4PJ7A 4GG8B 2ICWI 4U2YA 5ICZA 1N5YH 4KK9C 3TN0C 3UJJL 1UJ3C 1J8HA 5BO1H 5ESQA 3ESUF 3T2NL 2O93L 4WEMB 3P0VH 3TYFB 2EYSB 4BUGA 4HLZG 4XP5L 4YDKL 1F5WA 3THML 4K7FB 4RMWA 4F7TB 5IHBA 5EU5B 4IMKC 2DM3A 2Z31B 5D72H 2XTLA 5JW5B 4NP4H 4R2GC 1AQDB 5IB3B 2D03H 2NX5E 1D5ZB 2DQFB 1GH7A 1FP5A 2B1AH 1N4XL 1QP1A 5D7KD 2EIZA 5IQ7H 4IM8A 4M4PA 5C0JB 5CLWA 1L9MA 4FFZH 3MBEC 5I17A 3ORJA 5F6HJ 4Z5RB 1OF2A 4G6FD 4IRJB 1DQLH 2F19L 1NC2B 5EC1A 3RNQA 4MS8C 2ZUQB 1WEJL 1K9TA 4KUZL 5CUSH 3CLFL 1G7QA 3LRSB 3MCLH 1Q9LA 1C5BH 3PQYB 5BO1L 4R97B 4PR5B 3UBXA 1MNUH 4OZFH 5E94B 5C7XL 4NUJB 3VFRB 2BY0A 3M17B 3F6IA 3I02B 1UEMA 4X6BA 3PV7A 3RY5A 3B2UD 3GKWH 3PWPA 3RAJL 2RBLA 3D48R 2EYSA 1MAML 4P46C 4QF1B 2ZOLA 4C56B 3QEQE 5SWSB 4P2RE 1KCUH 2G75B 1SMOA 5I30L 1AQKL 1KJMA 3WNMA 1BVKB 2IPKB 3BZFB 4D8PB 2XPGA 1ZVHA 4HIIA 4F37F 3IDUA 5CJQH 3VXUA 3LHPH 4OD3H 2G5BA 3SKNA 1PEWA 1U8LB 3P11L 3PL6A 4ORZC 1J86A 1U58A 4LDEB 3QUZA 1JZ7A 5MHSE 1DBJL 5IB4A 2LU4A 4WW2C 2AV1A 4GKSA 4N8CH 3U9PH 5DWUH 3H6JA 3QSKB 4G8EB 3K80A 4XXDA 4B7IA 4EI6A 1I3UA 1G7PA 3OGCB 1CL7H 4DW2H 2C3HA 2Z4QB 3OKOB 3WFHA 4WU7A 4PLNC 1QRNE 4LPTA 4G6KL 15C8H 3R06B 4MQSB 4OCYH 5KZCD 4D0DB 4E41E 4M7ZC 2XPGB 1X3DA 3MMEB 1LO4H 2YA0A 4I0PD 4QGTA 2DLIA 5I1EH 3FTGA 4HUMB 5DJZB 5DURB 3QUYA 2Z91A 1HSAA 2EE9A 3MRFA 3M1BB 1MCRA 3SE3C 2HVKB 4HIHA 5HVWA 2VMFA 3TBTB 3CVHB 3MOQA 4BH7A 4KMTH 4NO0B 3BEWA 3U0TA 3P0VL 4EVNA 1L7IH 4PJCE 5AZEH 1MLBB 1HXYB 4L3EB 2A0LC 4PJCB 3X14A 3NCCB 3SKMB 3CFCH 4UDUB 4TYUA 3D87B 5DI8A 4MJ6A 3GBMH 4P5KB 3TBYB 1T2XA 2VL5A 2W9DL 3GM8A 3MV7D 4G8IA 1WTGT 5MEPA 1NFKA 5TE7L 5SWSD 4RMQA 1BGXH 2YMXH 5C8JA 1G7LA 1T1ZA 2W0KA 2ZUWA 4POUB 1R5VB 3HFMH 3HZYA 4CVXA 2M1KA 1MQKH 3R0NA 1WJ3A 2FX9H 5JDSB 4JAMB 2N56A 2NZ9C 4M48L 3BGMA 2VQUA 4OZFG 3MYZA 3MGAA 4HMCA 2V6HA 1OB1A 2DJSA 2GJ6B 3W0WB 2YD1A 5EOQH 3L3IA 1J0ZA 4OCWH 3G5XA 1KTLB 1MFNA 3IDXL 3RHWK 3BUTA 2BXZA 2OZ4A