1P4PA

Outer surface protein b of b. burgdorferi: crystal structure of the c-terminal fragment
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
140
structure length
140
Chain Sequence
b'SKKLTRSNGTTLEYSQITDADNATKAVETLKNSIKLEGSLVVGKTTVEIKEGTVTLKREIEKDGKVKVFLNDTAGSNKKTGKWEDSTSTLTISADSKKTKDLVFLTDGTITVQQYNTAGTSLEGSASEIKNLSELKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer surface protein B
publication title Structural Investigation of Borrelia burgdorferi OspB, a BactericidalFab Target.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Membrane protein
total genus 35
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2003-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 1p4pA00
2OL6O 2I5ZO 1OSPO 2PI3O 3AUMO 2OY1O 2AF5A 5B10O 1FJ1E 2OL8O 2OYBO 3CKFA 2FKGA 3CKGA 2OY5O 2HKDA 2G8CO 3EC5A 2OL7A 5B11O 2OY8A 5B2AO 1P4PA 5B3MO 2FKJA 2I5VO 2OY7A
chains in the Genus database with same CATH superfamily
3I55E 3G71E 3G4SE 3J7ZG 3CCQE 5DM7E 1YJNE 1VQLE 5MLCH 3CCJE 2PI3O 3AUMO 1YITE 1Q81G 1KQSE 3CCLE 1FJ1E 1KC8G 3DLLE 3CKGA 2ZJPE 2QEXE 1QVGE 3PIPE 2QA4E 3CC4E 5GADG 3I56E 3CD6E 1YJ9E 2OY8A 3G6EE 1VQPE 1P4PA 5GAGG 2I5VO 2OY7A 1JJ2E 5H1SI 5HL7E 2I5ZO 1M90G 1VQ8E 4WFNE 3CCVE 4U67E 2ZJRE 3CF5E 1RJLC 4IOAE 2OY1O 2OL8O 3CKFA 2OY5O 1K9MG 2HKDA 3CMAE 1Q82G 4WFAE 1YIJE 3EC5A 3IG9A 4IO9E 3OW2E 3CCRE 3CC2E 2OL6O 3IGEA 1YI2E 1K73G 5JVGE 3CMEE 3CCSE 1VQNE 3CCUE 1VQOE 4UY8G 4WFBE 1VQ4E 2FKGA 2OTJE 5AN9B 3CC7E 4WCEE 1VQ7E 1Q7YG 1VQ5E 1S72E 2OL7A 1NJIG 1W2BE 2CQLA 2OTLE 3CXCE 1RL6A 1QVFE 1VQ9E 1VQ6E 1VQKE 1OSPO 5GAHG 3PIOE 1K8AG 2ZJQE 3CPWE 2AF5A 5B10O 1M1KG 1YJWE 5JVHE 2OYBO 5GAEG 2G8CO 1YHQE 1VQME 3CCME 1KD1G 1Q86G 5B11O 4IOCE 1N8RG 5B2AO 5B3MO 3CCEE 5DM6E 4WF9E 2FKJA
chains in the Genus database with same CATH topology
2OL6O 2I5ZO 3IGEA 1OSPO 2PI3O 3AUMO 1RJLC 2OY1O 2AF5A 5B10O 1FJ1E 2OL8O 2OYBO 3CKFA 2FKGA 3CKGA 2OY5O 2HKDA 2G8CO 3EC5A 3IG9A 2OL7A 5B11O 2OY8A 5B2AO 1P4PA 5B3MO 2FKJA 2I5VO 2OY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OL6 O;  2I5Z O;  1OSP O;  2PI3 O;  3AUM O;  2OY1 O;  2AF5 A;  5B10 O;  1FJ1 E;  2OL8 O;  2OYB O;  3CKF A;  2FKG A;  3CKG A;  2OY5 O;  2HKD A;  2G8C O;  3EC5 A;  2OL7 A;  5B11 O;  2OY8 A;  5B2A O;  1P4P A;  5B3M O;  2FKJ A;  2I5V O;  2OY7 A; 
#chains in the Genus database with same CATH topology
 3I55 E;  3G71 E;  3G4S E;  3J7Z G;  3CCQ E;  5DM7 E;  1YJN E;  1VQL E;  5MLC H;  3CCJ E;  2PI3 O;  3AUM O;  1YIT E;  1Q81 G;  1KQS E;  3CCL E;  1FJ1 E;  1KC8 G;  3DLL E;  3CKG A;  2ZJP E;  2QEX E;  1QVG E;  3PIP E;  2QA4 E;  3CC4 E;  5GAD G;  3I56 E;  3CD6 E;  1YJ9 E;  2OY8 A;  3G6E E;  1VQP E;  1P4P A;  5GAG G;  2I5V O;  2OY7 A;  1JJ2 E;  5H1S I;  5HL7 E;  2I5Z O;  1M90 G;  1VQ8 E;  4WFN E;  3CCV E;  4U67 E;  2ZJR E;  3CF5 E;  1RJL C;  4IOA E;  2OY1 O;  2OL8 O;  3CKF A;  2OY5 O;  1K9M G;  2HKD A;  3CMA E;  1Q82 G;  4WFA E;  1YIJ E;  3EC5 A;  3IG9 A;  4IO9 E;  3OW2 E;  3CCR E;  3CC2 E;  2OL6 O;  3IGE A;  1YI2 E;  1K73 G;  5JVG E;  3CME E;  3CCS E;  1VQN E;  3CCU E;  1VQO E;  4UY8 G;  4WFB E;  1VQ4 E;  2FKG A;  2OTJ E;  5AN9 B;  3CC7 E;  4WCE E;  1VQ7 E;  1Q7Y G;  1VQ5 E;  1S72 E;  2OL7 A;  1NJI G;  1W2B E;  2CQL A;  2OTL E;  3CXC E;  1RL6 A;  1QVF E;  1VQ9 E;  1VQ6 E;  1VQK E;  1OSP O;  5GAH G;  3PIO E;  1K8A G;  2ZJQ E;  3CPW E;  2AF5 A;  5B10 O;  1M1K G;  1YJW E;  5JVH E;  2OYB O;  5GAE G;  2G8C O;  1YHQ E;  1VQM E;  3CCM E;  1KD1 G;  1Q86 G;  5B11 O;  4IOC E;  1N8R G;  5B2A O;  5B3M O;  3CCE E;  5DM6 E;  4WF9 E;  2FKJ A; 
#chains in the Genus database with same CATH homology
 2OL6 O;  2I5Z O;  3IGE A;  1OSP O;  2PI3 O;  3AUM O;  1RJL C;  2OY1 O;  2AF5 A;  5B10 O;  1FJ1 E;  2OL8 O;  2OYB O;  3CKF A;  2FKG A;  3CKG A;  2OY5 O;  2HKD A;  2G8C O;  3EC5 A;  3IG9 A;  2OL7 A;  5B11 O;  2OY8 A;  5B2A O;  1P4P A;  5B3M O;  2FKJ A;  2I5V O;  2OY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...