1P5EB

The structure of phospho-cdk2/cyclin a in complex with the inhibitor 4,5,6,7-tetrabromobenzotriazole (tbs)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 2
publication title Alternative binding modes of an inhibitor to two different kinases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 97
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1p5eB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1p5eB02
2C5XB 4UN0A 2CJMB 3MI9B 3LQ5B 5L2WB 1PKDB 3O0GD 4YOSA 1GUXA 3RGFB 4CFMB 1XO2A 3QHRB 4BCMB 4EONB 4TTHA 4BCKB 3POMA 2WFYB 2PMIB 5EFQB 4CFVB 3F5XB 1KXUA 4EC9B 2I53A 2UZBB 4Y72B 2C4GB 2UZEB 4F7SB 2WHBB 4BCND 4EOMB 3DDQB 4BCIB 3BHVB 1OIYB 3EJ1B 3EOCB 1JSUB 1OI9B 3MIAB 2F2CA 4EOJB 1C9BA 1H26B 2R7GA 5BNJB 1FINB 2IVXA 4EOLB 4F6UB 3MY5B 4F70B 3K7AM 5HBJB 2BPMB 2IW8B 2C5OB 1H1QB 3DDPB 3BLQB 4BCFB 1G3NC 1AISB 4II5B 2PK2A 1H1PB 4F7NB 1UNLD 1VINA 1UNHD 4OR5B 4CFXB 4NSTB 1JOWA 4BCNB 4EOIB 3H4CA 2UZLB 1VYWB 5CYIB 4EOQB 4G6LB 1O9KB 2V22B 3BLRB 2IW6B 3BHTB 4F6SB 1H4LD 1H1RB 1GY3B 3MY1B 4RODA 5HNBB 2WIHB 2QDJA 2W96A 4CFWB 1W98B 4EOKB 3EIDB 1TFBA 2IW9B 4BCQD 4EOSB 4ELLA 4FX3B 4CFNB 5LQFB 4CXAB 4BCPB 5ICPB 1GH6B 3G33B 2BKZB 5HBHB 2JGZB 4ROEA 4EOOB 2W2HA 2PHGA 1OIUB 1N4MA 2W99A 2WIPB 4YOZA 1E9HB 4EOPB 4OGRB 3TNWB 2CCHB 1D3UB 1GUXB 3TNIB 4F7JB 1H27B 4BCQB 3TN8B 4ELJA 4KRCB 4CFUB 4KRDB 2WXVB 3M03A 1VOLA 4F6WB 2I40B 3DOGB 5IDNB 2W9ZA 4I3ZB 5CEIB 1BU2A 1H28B 1ZP2A 5LMKB 2W9FA 4ROCA 2X1NB 4BCGB 1OL2B 1H1SB 2WEVB 5HQ0B 4EC8B 2C5NB 4CFUD 1F5QB 2CCIB 5HVYB 1H24B 5IF1B 1O9KA 1UNGD 1AD6A 1JKWA 2C6TB 4IMYB 1OL1B 2EUFA 3BLHB 3TNHB 5HBEB 1QMZB 2B9RA 4BCOB 4EORB 1H25B 2UUEB 2C5VB 1OGUB 4BCJB 2WMAB 3BHUB 4BCMD 5FGKB 4CRLB 2G9XB 3QHWB 1URCB 1P5EB 5IDPB 2WMBB 5I5ZB 1JSTB 1OKWB 2UZDB 1OKVB 2WPAB 4YOOA 4BCHB 2PK9B 4YC3B 1FVVB 4F7LB 5ACBA
chains in the Genus database with same CATH superfamily
2C5XB 3MI9B 1UGSB 2WFYB 1KXUA 2UZBB 2C4GB 4BCND 1OIYB 1OI9B 4EOJB 2CZ1B 5BNJB 2IVXA 3HZJA 4EOLB 3MY5B 3K7AM 4FM4B 1ENWA 4AKHA 2IW8B 4BCFB 1H1PB 1UNHD 4BCNB 4Z6YA 4EOIB 1V29B 5IHYA 2UZLB 1VYWB 3QYHB 3QZ9B 4QSHA 2QDJA 2DXBB 1W98B 3EIDB 5EJCA 2BS3A 4BCQD 2BS4A 4FX3B 5LQFB 3VYGB 1GH6B 5HBHB 2PHGA 4AKGA 2DD5B 3TNWB 2CCHB 1UGRB 3DTOA 4BCQB 3TN8B 4KRDB 3M03A 4F6WB 3VKGA 2I40B 3DOGB 4I3ZB 1TD6A 5HQ0B 4CFUD 2DPPB 4ZGDB 1UNGD 1JKWA 4IMYB 5HBEB 1OL1B 4MFEA 3HB9A 2D0QB 2ZPBB 4BCMD 4CRLB 2G9XB 1P5EB 5IDPB 2DD4B 3TW6A 1OKWB 1OKVB 3VYHB 4BCHB 4F7LB 4LOCA 3O0GD 1UGPB 4YOSA 1GUXA 3KHIA 3QWLA 4BCMB 3HO8A 3HBLA 3F5XB 4F7SB 2QFZA 2WHBB 4BCIB 4JX6A 3BHVB 3EJ1B 3EOCB 1C9BA 2ZCFB 1FINB 3DJBA 3WVEB 1AISB 1UNLD 4OR5B 1JOWA 2CZ6B 2PJQA 3BLRB 2ZPHB 1GY3B 2W96A 4CFWB 4CFNB 2KMGA 3DL1A 4NC6A 2BKZB 2JGZB 2W2HA 1OIUB 2WIPB 1UGQB 4OGRB 2DXCB 1GUXB 3TNIB 4ELJA 4KRCB 4HNVA 2W9ZA 5CEIB 1BU2A 2W9FA 4BCGB 4EC8B 2WEVB 3X24B 2AHJB 5IF1B 3BLHB 2EUFA 2B9RA 3QZ5B 3QYGB 2ZPFB 2C5VB 1OGUB 3QHWB 2KR6A 1JSTB 3BG3A 2WPAB 1FKMA 4HL4A 4EOMB 3LQ5B 1PKDB 4OB3B 1AHJB 3RGFB 1XO2A 4TTHA 3TW7A 5DQWA 3POMA 2WJ9A 2G77A 5EFQB 4BY1X 4EC9B 4Y72B 1QLBA 2UZEB 3BG5A 1IREB 3DDQB 4ZGJB 3MIAB 2F2CA 2R7GA 5DQVA 4OB0B 5HBJB 2CZ7B 3BLQB 2PK2A 2ZPIB 4CFXB 4HNTA 3WVDB 3A8OB 4EOQB 4G6LB 2CZ0B 1H4LD 1H1RB 5HNBB 2WIHB 4M6VA 4EOKB 2ZPEB 5ICPB 3G33B 4MIMA 1N4MA 2W99A 1D3UB 3QXEB 1H27B 2ZPGB 1VOLA 2QGSA 5IDNB 4ROCA 1H28B 5LMKB 4ZGEB 3X28B 1H24B 4MFDA 1O9KA 4BY7X 4BCOB 4EORB 1H25B 4BCJB 5FGKB 1URCB 2WMBB 4BBSM 3B57A 2UZDB 4HLQA 4HNUA 4YOOA 3QYEA 1FVVB 2BS2A 4UN0A 2CJMB 5L2WB 3HHTB 4CFMB 3QHRB 4EONB 4BCKB 3A8GB 2QF7A 4CFVB 2PMIB 2QQ8A 2I53A 4AI6A 4BXXX 3BG9A 1JSUB 1H26B 4F6UB 2QDYB 3A8LB 4F70B 2BPMB 4AKIA 2C5OB 4BBRM 1H1QB 3DDPB 3GTMS 1G3NC 4II5B 4F7NB 1VINA 4NSTB 3H4CA 5CYIB 1O9KB 2V22B 3X25B 2IW6B 3BHTB 4F6SB 2IN3A 3A8MB 3MY1B 4RODA 4OB2B 4JX4A 3X26B 1TFBA 2IW9B 4EOSB 4ELLA 4CXAB 4BCPB 3QYBA 4ROEA 4EOOB 2DMEA 4YOZA 3X20B 4EOPB 3PO3S 1E9HB 2CYZB 2LW4A 1E7PA 4F7JB 4JX5A 4CFUB 2WXVB 4OB1B 1ZP2A 2ZZDB 2X1NB 3NDQA 1OL2B 1H1SB 2C5NB 1F5QB 2CCIB 3VKHA 5HVYB 1AD6A 2C6TB 3TNHB 1QMZB 2UUEB 2WMAB 3BHUB 5I5ZB 2PK9B 3A8HB 4YC3B 5ACBA
chains in the Genus database with same CATH topology
2C5XB 4UN0A 2CJMB 3MI9B 3LQ5B 5L2WB 1PKDB 3O0GD 4YOSA 1GUXA 3RGFB 4CFMB 1XO2A 3QHRB 4BCMB 4EONB 4TTHA 4BCKB 3POMA 2WFYB 2PMIB 5EFQB 4CFVB 3F5XB 1KXUA 4EC9B 2I53A 2UZBB 4Y72B 2C4GB 2UZEB 4F7SB 2WHBB 4BCND 4EOMB 3DDQB 4BCIB 3BHVB 1OIYB 3EJ1B 3EOCB 1JSUB 1OI9B 3MIAB 2F2CA 4EOJB 1C9BA 1H26B 2R7GA 5BNJB 1FINB 2IVXA 4EOLB 4F6UB 3MY5B 4F70B 3K7AM 5HBJB 2BPMB 2IW8B 2C5OB 1H1QB 3DDPB 3BLQB 4BCFB 1G3NC 1AISB 4II5B 2PK2A 1H1PB 4F7NB 1UNLD 1VINA 1UNHD 4OR5B 4CFXB 4NSTB 1JOWA 4BCNB 4EOIB 3H4CA 2UZLB 1VYWB 5CYIB 4EOQB 4G6LB 1O9KB 2V22B 3BLRB 2IW6B 3BHTB 4F6SB 1H4LD 1H1RB 1GY3B 3MY1B 4RODA 5HNBB 2WIHB 2QDJA 2W96A 4CFWB 1W98B 4EOKB 3EIDB 1TFBA 2IW9B 4BCQD 4EOSB 4ELLA 4FX3B 4CFNB 5LQFB 4CXAB 4BCPB 5ICPB 1GH6B 3G33B 2BKZB 5HBHB 2JGZB 4ROEA 4EOOB 2W2HA 2PHGA 1OIUB 1N4MA 2W99A 2WIPB 4YOZA 1E9HB 4EOPB 4OGRB 3TNWB 2CCHB 1D3UB 1GUXB 3TNIB 4F7JB 1H27B 4BCQB 3TN8B 4ELJA 4KRCB 4CFUB 4KRDB 2WXVB 3M03A 1VOLA 4F6WB 2I40B 3DOGB 5IDNB 2W9ZA 4I3ZB 5CEIB 1BU2A 1H28B 1ZP2A 5LMKB 2W9FA 4ROCA 2X1NB 4BCGB 1OL2B 1H1SB 2WEVB 5HQ0B 4EC8B 2C5NB 4CFUD 1F5QB 2CCIB 5HVYB 1H24B 5IF1B 1O9KA 1UNGD 1AD6A 1JKWA 2C6TB 4IMYB 1OL1B 2EUFA 3BLHB 3TNHB 5HBEB 1QMZB 2B9RA 4BCOB 4EORB 1H25B 2UUEB 2C5VB 1OGUB 4BCJB 2WMAB 3BHUB 4BCMD 5FGKB 4CRLB 2G9XB 3QHWB 1URCB 1P5EB 5IDPB 2WMBB 5I5ZB 1JSTB 1OKWB 2UZDB 1OKVB 2WPAB 4YOOA 4BCHB 2PK9B 4YC3B 1FVVB 4F7LB 5ACBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5X B;  4UN0 A;  2CJM B;  3MI9 B;  3LQ5 B;  5L2W B;  1PKD B;  3O0G D;  4YOS A;  1GUX A;  3RGF B;  4CFM B;  1XO2 A;  3QHR B;  4BCM B;  4EON B;  4TTH A;  4BCK B;  3POM A;  2WFY B;  2PMI B;  5EFQ B;  4CFV B;  3F5X B;  1KXU A;  4EC9 B;  2I53 A;  2UZB B;  4Y72 B;  2C4G B;  2UZE B;  4F7S B;  2WHB B;  4BCN D;  4EOM B;  3DDQ B;  4BCI B;  3BHV B;  1OIY B;  3EJ1 B;  3EOC B;  1JSU B;  1OI9 B;  3MIA B;  2F2C A;  4EOJ B;  1C9B A;  1H26 B;  2R7G A;  5BNJ B;  1FIN B;  2IVX A;  4EOL B;  4F6U B;  3MY5 B;  4F70 B;  3K7A M;  5HBJ B;  2BPM B;  2IW8 B;  2C5O B;  1H1Q B;  3DDP B;  3BLQ B;  4BCF B;  1G3N C;  1AIS B;  4II5 B;  2PK2 A;  1H1P B;  4F7N B;  1UNL D;  1VIN A;  1UNH D;  4OR5 B;  4CFX B;  4NST B;  1JOW A;  4BCN B;  4EOI B;  3H4C A;  2UZL B;  1VYW B;  5CYI B;  4EOQ B;  4G6L B;  1O9K B;  2V22 B;  3BLR B;  2IW6 B;  3BHT B;  4F6S B;  1H4L D;  1H1R B;  1GY3 B;  3MY1 B;  4ROD A;  5HNB B;  2WIH B;  2QDJ A;  2W96 A;  4CFW B;  1W98 B;  4EOK B;  3EID B;  1TFB A;  2IW9 B;  4BCQ D;  4EOS B;  4ELL A;  4FX3 B;  4CFN B;  5LQF B;  4CXA B;  4BCP B;  5ICP B;  1GH6 B;  3G33 B;  2BKZ B;  5HBH B;  2JGZ B;  4ROE A;  4EOO B;  2W2H A;  2PHG A;  1OIU B;  1N4M A;  2W99 A;  2WIP B;  4YOZ A;  1E9H B;  4EOP B;  4OGR B;  3TNW B;  2CCH B;  1D3U B;  1GUX B;  3TNI B;  4F7J B;  1H27 B;  4BCQ B;  3TN8 B;  4ELJ A;  4KRC B;  4CFU B;  4KRD B;  2WXV B;  3M03 A;  1VOL A;  4F6W B;  2I40 B;  3DOG B;  5IDN B;  2W9Z A;  4I3Z B;  5CEI B;  1BU2 A;  1H28 B;  1ZP2 A;  5LMK B;  2W9F A;  4ROC A;  2X1N B;  4BCG B;  1OL2 B;  1H1S B;  2WEV B;  5HQ0 B;  4EC8 B;  2C5N B;  4CFU D;  1F5Q B;  2CCI B;  5HVY B;  1H24 B;  5IF1 B;  1O9K A;  1UNG D;  1AD6 A;  1JKW A;  2C6T B;  4IMY B;  1OL1 B;  2EUF A;  3BLH B;  3TNH B;  5HBE B;  1QMZ B;  2B9R A;  4BCO B;  4EOR B;  1H25 B;  2UUE B;  2C5V B;  1OGU B;  4BCJ B;  2WMA B;  3BHU B;  4BCM D;  5FGK B;  4CRL B;  2G9X B;  3QHW B;  1URC B;  1P5E B;  5IDP B;  2WMB B;  5I5Z B;  1JST B;  1OKW B;  2UZD B;  1OKV B;  2WPA B;  4YOO A;  4BCH B;  2PK9 B;  4YC3 B;  1FVV B;  4F7L B;  5ACB A; 
#chains in the Genus database with same CATH topology
 2C5X B;  3MI9 B;  1UGS B;  2WFY B;  1KXU A;  2UZB B;  2C4G B;  4BCN D;  1OIY B;  1OI9 B;  4EOJ B;  2CZ1 B;  5BNJ B;  2IVX A;  3HZJ A;  4EOL B;  3MY5 B;  3K7A M;  4FM4 B;  1ENW A;  4AKH A;  2IW8 B;  4BCF B;  1H1P B;  1UNH D;  4BCN B;  4Z6Y A;  4EOI B;  1V29 B;  5IHY A;  2UZL B;  1VYW B;  3QYH B;  3QZ9 B;  4QSH A;  2QDJ A;  2DXB B;  1W98 B;  3EID B;  5EJC A;  2BS3 A;  4BCQ D;  2BS4 A;  4FX3 B;  5LQF B;  3VYG B;  1GH6 B;  5HBH B;  2PHG A;  4AKG A;  2DD5 B;  3TNW B;  2CCH B;  1UGR B;  3DTO A;  4BCQ B;  3TN8 B;  4KRD B;  3M03 A;  4F6W B;  3VKG A;  2I40 B;  3DOG B;  4I3Z B;  1TD6 A;  5HQ0 B;  4CFU D;  2DPP B;  4ZGD B;  1UNG D;  1JKW A;  4IMY B;  5HBE B;  1OL1 B;  4MFE A;  3HB9 A;  2D0Q B;  2ZPB B;  4BCM D;  4CRL B;  2G9X B;  1P5E B;  5IDP B;  2DD4 B;  3TW6 A;  1OKW B;  1OKV B;  3VYH B;  4BCH B;  4F7L B;  4LOC A;  3O0G D;  1UGP B;  4YOS A;  1GUX A;  3KHI A;  3QWL A;  4BCM B;  3HO8 A;  3HBL A;  3F5X B;  4F7S B;  2QFZ A;  2WHB B;  4BCI B;  4JX6 A;  3BHV B;  3EJ1 B;  3EOC B;  1C9B A;  2ZCF B;  1FIN B;  3DJB A;  3WVE B;  1AIS B;  1UNL D;  4OR5 B;  1JOW A;  2CZ6 B;  2PJQ A;  3BLR B;  2ZPH B;  1GY3 B;  2W96 A;  4CFW B;  4CFN B;  2KMG A;  3DL1 A;  4NC6 A;  2BKZ B;  2JGZ B;  2W2H A;  1OIU B;  2WIP B;  1UGQ B;  4OGR B;  2DXC B;  1GUX B;  3TNI B;  4ELJ A;  4KRC B;  4HNV A;  2W9Z A;  5CEI B;  1BU2 A;  2W9F A;  4BCG B;  4EC8 B;  2WEV B;  3X24 B;  2AHJ B;  5IF1 B;  3BLH B;  2EUF A;  2B9R A;  3QZ5 B;  3QYG B;  2ZPF B;  2C5V B;  1OGU B;  3QHW B;  2KR6 A;  1JST B;  3BG3 A;  2WPA B;  1FKM A;  4HL4 A;  4EOM B;  3LQ5 B;  1PKD B;  4OB3 B;  1AHJ B;  3RGF B;  1XO2 A;  4TTH A;  3TW7 A;  5DQW A;  3POM A;  2WJ9 A;  2G77 A;  5EFQ B;  4BY1 X;  4EC9 B;  4Y72 B;  1QLB A;  2UZE B;  3BG5 A;  1IRE B;  3DDQ B;  4ZGJ B;  3MIA B;  2F2C A;  2R7G A;  5DQV A;  4OB0 B;  5HBJ B;  2CZ7 B;  3BLQ B;  2PK2 A;  2ZPI B;  4CFX B;  4HNT A;  3WVD B;  3A8O B;  4EOQ B;  4G6L B;  2CZ0 B;  1H4L D;  1H1R B;  5HNB B;  2WIH B;  4M6V A;  4EOK B;  2ZPE B;  5ICP B;  3G33 B;  4MIM A;  1N4M A;  2W99 A;  1D3U B;  3QXE B;  1H27 B;  2ZPG B;  1VOL A;  2QGS A;  5IDN B;  4ROC A;  1H28 B;  5LMK B;  4ZGE B;  3X28 B;  1H24 B;  4MFD A;  1O9K A;  4BY7 X;  4BCO B;  4EOR B;  1H25 B;  4BCJ B;  5FGK B;  1URC B;  2WMB B;  4BBS M;  3B57 A;  2UZD B;  4HLQ A;  4HNU A;  4YOO A;  3QYE A;  1FVV B;  2BS2 A;  4UN0 A;  2CJM B;  5L2W B;  3HHT B;  4CFM B;  3QHR B;  4EON B;  4BCK B;  3A8G B;  2QF7 A;  4CFV B;  2PMI B;  2QQ8 A;  2I53 A;  4AI6 A;  4BXX X;  3BG9 A;  1JSU B;  1H26 B;  4F6U B;  2QDY B;  3A8L B;  4F70 B;  2BPM B;  4AKI A;  2C5O B;  4BBR M;  1H1Q B;  3DDP B;  3GTM S;  1G3N C;  4II5 B;  4F7N B;  1VIN A;  4NST B;  3H4C A;  5CYI B;  1O9K B;  2V22 B;  3X25 B;  2IW6 B;  3BHT B;  4F6S B;  2IN3 A;  3A8M B;  3MY1 B;  4ROD A;  4OB2 B;  4JX4 A;  3X26 B;  1TFB A;  2IW9 B;  4EOS B;  4ELL A;  4CXA B;  4BCP B;  3QYB A;  4ROE A;  4EOO B;  2DME A;  4YOZ A;  3X20 B;  4EOP B;  3PO3 S;  1E9H B;  2CYZ B;  2LW4 A;  1E7P A;  4F7J B;  4JX5 A;  4CFU B;  2WXV B;  4OB1 B;  1ZP2 A;  2ZZD B;  2X1N B;  3NDQ A;  1OL2 B;  1H1S B;  2C5N B;  1F5Q B;  2CCI B;  3VKH A;  5HVY B;  1AD6 A;  2C6T B;  3TNH B;  1QMZ B;  2UUE B;  2WMA B;  3BHU B;  5I5Z B;  2PK9 B;  3A8H B;  4YC3 B;  5ACB A; 
#chains in the Genus database with same CATH homology
 2C5X B;  4UN0 A;  2CJM B;  3MI9 B;  3LQ5 B;  5L2W B;  1PKD B;  3O0G D;  4YOS A;  1GUX A;  3RGF B;  4CFM B;  1XO2 A;  3QHR B;  4BCM B;  4EON B;  4TTH A;  4BCK B;  3POM A;  2WFY B;  2PMI B;  5EFQ B;  4CFV B;  3F5X B;  1KXU A;  4EC9 B;  2I53 A;  2UZB B;  4Y72 B;  2C4G B;  2UZE B;  4F7S B;  2WHB B;  4BCN D;  4EOM B;  3DDQ B;  4BCI B;  3BHV B;  1OIY B;  3EJ1 B;  3EOC B;  1JSU B;  1OI9 B;  3MIA B;  2F2C A;  4EOJ B;  1C9B A;  1H26 B;  2R7G A;  5BNJ B;  1FIN B;  2IVX A;  4EOL B;  4F6U B;  3MY5 B;  4F70 B;  3K7A M;  5HBJ B;  2BPM B;  2IW8 B;  2C5O B;  1H1Q B;  3DDP B;  3BLQ B;  4BCF B;  1G3N C;  1AIS B;  4II5 B;  2PK2 A;  1H1P B;  4F7N B;  1UNL D;  1VIN A;  1UNH D;  4OR5 B;  4CFX B;  4NST B;  1JOW A;  4BCN B;  4EOI B;  3H4C A;  2UZL B;  1VYW B;  5CYI B;  4EOQ B;  4G6L B;  1O9K B;  2V22 B;  3BLR B;  2IW6 B;  3BHT B;  4F6S B;  1H4L D;  1H1R B;  1GY3 B;  3MY1 B;  4ROD A;  5HNB B;  2WIH B;  2QDJ A;  2W96 A;  4CFW B;  1W98 B;  4EOK B;  3EID B;  1TFB A;  2IW9 B;  4BCQ D;  4EOS B;  4ELL A;  4FX3 B;  4CFN B;  5LQF B;  4CXA B;  4BCP B;  5ICP B;  1GH6 B;  3G33 B;  2BKZ B;  5HBH B;  2JGZ B;  4ROE A;  4EOO B;  2W2H A;  2PHG A;  1OIU B;  1N4M A;  2W99 A;  2WIP B;  4YOZ A;  1E9H B;  4EOP B;  4OGR B;  3TNW B;  2CCH B;  1D3U B;  1GUX B;  3TNI B;  4F7J B;  1H27 B;  4BCQ B;  3TN8 B;  4ELJ A;  4KRC B;  4CFU B;  4KRD B;  2WXV B;  3M03 A;  1VOL A;  4F6W B;  2I40 B;  3DOG B;  5IDN B;  2W9Z A;  4I3Z B;  5CEI B;  1BU2 A;  1H28 B;  1ZP2 A;  5LMK B;  2W9F A;  4ROC A;  2X1N B;  4BCG B;  1OL2 B;  1H1S B;  2WEV B;  5HQ0 B;  4EC8 B;  2C5N B;  4CFU D;  1F5Q B;  2CCI B;  5HVY B;  1H24 B;  5IF1 B;  1O9K A;  1UNG D;  1AD6 A;  1JKW A;  2C6T B;  4IMY B;  1OL1 B;  2EUF A;  3BLH B;  3TNH B;  5HBE B;  1QMZ B;  2B9R A;  4BCO B;  4EOR B;  1H25 B;  2UUE B;  2C5V B;  1OGU B;  4BCJ B;  2WMA B;  3BHU B;  4BCM D;  5FGK B;  4CRL B;  2G9X B;  3QHW B;  1URC B;  1P5E B;  5IDP B;  2WMB B;  5I5Z B;  1JST B;  1OKW B;  2UZD B;  1OKV B;  2WPA B;  4YOO A;  4BCH B;  2PK9 B;  4YC3 B;  1FVV B;  4F7L B;  5ACB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...