1P5UA

X-ray structure of the ternary caf1m:caf1:caf1 chaperone:subunit:subunit complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
226
structure length
206
Chain Sequence
b'SKEYGVTIGESRIIYPLDAAGVMVSVKNTQDYPVLIQSRIYDENKEPFVVTPPLFRLDAKQQNSLRIAQAGGVFPRDKESLKWLCVKGIPPKDPDKDVGVFVQFAINNCIKLLVRPNELKGTPIQFAENLSWKVDGGKLIAENPSPFYMNIGELTFGGKSIPSHYIPPKSTWAFDLPKGLAGARNVSWRIINDQGGLDRLYSKNVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein Caf1M
molecule tags Chaperone, structural protein
source organism Yersinia pestis
publication title Structure and Biogenesis of the Capsular F1 Antigen from Yersinia pestis. Preserved Folding Energy Drives Fiber Formation
pubmed doi rcsb
total genus 38
structure length 206
sequence length 226
ec nomenclature
pdb deposition date 2003-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p5uA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p5uA02
1CFTB 4LCWD 3TN0A 3SO3B 1WBYA 2M1KA 3CFIC 3GSWB 4OM0H 5B8CB 4M02A 4XNMA 2FATH 4G6MH 4QT5A 5LBSH 2R0LL 3TBYB 3MJ9L 1YNKH 1RURH 4ELMA 1FIGL 2VZ1A 3I9GL 4ZUUB 3DX6B 4OFYD 1W8NA 4Q0XL 1ZA6B 4XPAL 4R7DA 1V7NL 4Y1AB 4ELME 4XP5L 3WLWD 2IJ0C 5DF0A 2YSSB 4FN0A 3O6FC 5DHYA 4WTZG 3NFPA 4F7TA 4L4TE 4PJ7B 3UDWA 3G5VA 3VH8B 2WIIB 4P5MB 3I6KB 1FFOB 1QG3A 4OZIA 1CI5A 4N9GA 2V9RA 3V6OC 5J4MA 3K8KA 1HQ4B 1O0VA 3U0PA 4I18B 4XXDB 1UWEL 4Q9RL 5HVWA 4HUUA 1CLCA 2KBGA 3VXRD 4NSKB 3RRQA 4WRLA 3AB0B 1EFXD 3RZWA 2GFBB 1QR4A 4R26H 5EPMA 4HUKB 5L2KB 3MRGA 2FCBA 2QSQA 1G0DA 2HVJA 4GS7B 1II4E 5EWIH 4GRLB 4ZNEA 4OJFL 2IAMB 4OQ1A 5CZXC 5E7FA 1YDPA 1NCBH 3VG0H 4GSDL 3C5ZC 1RPQA 3RA7H 4PJFB 1KTKE 1I3GH 1UCBH 1XGPA 5TQ0H 1A5FH 3CMGA 4E5XB 3GMRB 4Y5VC 3RWFB 1D6EA 1OVZA 1U8QA 1OM3L 1T1ZA 1W0WA 1G9NC 3SQBA 1UWGH 1S7TA 4XVTL 4CUCA 4YDLB 3KR3L 4TVSa 2Y1VA 4DK3A 2Y07L 3NCBB 4L29A 4Z78A 5FECB 1XGUB 3X11A 2BDNH 4Y4HB 3LH2H 3ZT5A 1E6JH 1VPOH 5INDB 1FYTD 5C9KA 3OZ9L 3EO0B 1SEBB 3VXTA 5EC2A 3GSQB 3AFLA 1I8KA 4OLXL 3OKKB 4LDLB 1MEXL 1B88A 1FZKB 3MNWB 5C8JB 4X6CA 3VD5A 4EQ2A 4CDHA 5KTEL 1RUMH 3CVHA 3DV4B 5FUZH 1N6QH 5DMKA 1F3RB 3GJFB 2X9YA 1JI1A 4K3JL 1U8IB 1EXUA 3IFLH 5I19L 3INUL 4Z77A 5C3LD 3SDCC 2E7CA 4OM1L 4WFFD 4D3CL 1CL7I 5J6GB 5KANI 4ZFOB 4NJ9H 3MLWL 3REVA 5E70A 3SDXF 1WIPA 3M1BA 4ONGL 5KSUB 5I76B 4Q9RH 4MNQE 4QXTA 3DXAE 3O6MH 2IF7A 4ZXBD 5L8KB 4ODSL 4MNHA 5CAYB 4KQ4H 4Z5RA 1JWSB 2Z92B 1MFDH 3CXHJ 3C6SA 3MLUL 2DQCL 1DJSA 2NY6B 4UV4H 1CZ8L 3RWGA 1JNLH 4P2RE 3HZYA 4EEEA 4YHLH 1A2YB 4TNVF 2BSED 1E4WL 3BPNC 5GGRA 1NCBL 3VG0L 5C0EB 4MD4A 1OTUC 3R1GL 1AGBB 5ANMB 1FNEA 3RX7A 1NUDA 4PRIE 4LRIC 3D3VE 5I75C 1U3ZA 2OSLB 3GIVA 2EDNA 1YUHA 4M7LT 2OI9C 4MQSB 1CLYH 2ESVE 4MD0B 4KRPD 1JK8A 3PHQA 4PJHE 1MNUL 1UYWL 4CBPA 5DD5H 3PHOB 2A6IA 3V6ZB 1WWAX 3BH9B 1G7JB 4H5SA 4POYA 3VJ6B 4EUPB 4O58L 4OTXL 4HWNA 1RZJC 2KL6A 5CGYD 4AH2B 2AABL 4M1CC 1WAAF 3B9KB 3MLYL 5KTEH 4ODWA 1QR1A 5FUZL 1N6QL 1N64H 4ONHB 1XR8B 3OG6B 2E27L 5AUMA 4JY5H 5JIKA 5SWSD 5T5NF 5C08B 3IFLL 4DW2H 3IVKA 2C3VA 1CK0L 5FGBA 3MNVA 3G6JF 5FM5O 3EYSL 4JVUA 3RPIA 4YAQA 1ZT1B 4MB5A 4PLKC 3VXSA 1A7RH 4MX7B 4R97C 1KCKA 1FRGL 1HHGA 2AXFA 1AHWC 5DTFA 1J8KA 1DQLH 3QUZC 1FNGB 3P9MA 4LKCB 4M1DH 2VN7A 4I2XA 3MGTB 4PJEA 4KJQD 3U2SB 4NKDA 2W65B 1KT2A 1OB1B 5CJBA 1KLUB 3MFGB 1NLBH 1BZQK 1KJMA 5CP7A 3VFOB 2F53E 1DQML 1VGEH 4WI5A 5GGUA 3TNMA 3B83A 2GUOA 3GM8A 2CO6B 5GJSL 4LLVA 5A40E 1PEZA 4RGNB 2EH8H 1B2WH 4O02L 4JFFE 4WDIA 2W9DL 5GGSY 3UCRA 3C60D 1J1PH 3CLEH 1J0KA 3LKQB 4D9QE 3QNZA 1N0XL 4AEHL 1DLHB 1U95A 4K7FB 5B4MC 3PHOA 5FYLD 3O8XD 1U8IA 4Z7UA 1XGTA 3KYNA 3DX8B 1A7QL 4H1LA 2GT9B 4DGIL 3V0WH 3OKNB 5CSBA 3IS0X 4UB0L 1NAML 4S2SB 1U8JA 1AXSA 3CX2A 3OAZK 2DM7A 1F4AA 2CRZA 1RU9H 4V2BA 1D9KC 3BHBB 4DKFL 4KJQC 1J9CT 5IMKB 4NWTL 1BQLL 1HQRA 1JPFA 3JWDL 4XT1C 5M7QA 1DQDH 3RZCC 4KI5E 3NGBB 3BGFB 2OP4L 4M6NL 1AH1A 3SN6N 3ARFB 4FFYL 5DR5H 1MI5A 2HFFB 1C12B 2PETA 5ESVB 3P4LA 4YEEA 1DANU 4M1DL 5DURB 4NT6B 4ETQB 5E6ZA 1I7ZA 4JFZH 5DRNA 1WLHA 1T3FA 1YQVL 4J4PC 3RGVC 4X7FC 5E7BA 1IC4H 3L3HB 1IMHC 15C8L 3KYMA 2HWZH 5B8CA 3BRGC 4LLMB 5GRUL 4KV5E 4X98B 1MHCA 5E8NB 5HHOE 1D5BA 2DWDB 3EOTH 2EDTA 5J11C 4MAYD 4ZUSA 5CJOH 1H3WM 4MYWB 5D2LB 4NKOA 1IQDB 2R69H 1N3NA 1KB5A 3QXAA 1YEDA 1ZHNB 3MOBH 2PYED 1F58H 1JPTH 1NGZA 1XR8A 5T33L 5D1ZD 1TJGH 8FABA 5EO0B 3P4OB 4KJWC 1DR9A 1X7QA 1NGQL 4JPIB 3SKOA 4LGSB 4AH2A 1G7LB 5C0CE 3JWOH 3Q0HA 5ACZA 1QRND 2NY4B 4FRWA 1J8HD 1AQDB 1QRKA 5H37G 4G8EA 1NCUA 1JZ6A 5IB4A 1MJ8L 2H1PH 3BKYL 5HSFA 1Z9OA 4LVHC 2ATPA 2ZOLA 3UO1H 4NWTH 1WSST 4X4ZA 3BKJH 2PR4H 2QQLL 4UTBH 4XCFL 2X4PB 4QHKI 4HEPG 1FN4B 3VGFA 2OP4H 2Z93A 4M6NH 5JOPE 4ZSOE 5MEPA 3C5JA 1K4DA 5KW9L 5HHMB 2F58L 1HINH 3ARXA 1X5GA 1IC5L 4OFIA 2VQTA 4NJAL 2IFFH 3GMPB 2AXHA 3TN0C 3I2CL 1I8IA 1OAXL 5CBAA 1UB5A 4NUJB 1A6AA 1A1NA 3QEQE 1IC4L 4BUHA 5HYSG 4F9LA 4HCRA 3W2DL 2JJTC 4MCZB 1Q0YL 3HI6L 3BH9A 1YEJL 5FOBB 1AKJD 1LP9E 4OLVL 4NO0B 4QHKJ 2HA1A 1HDMB 1C1EL 5CIPH 3ARGD 3WO4B 2K1MA 2DM4A 3U79A 5F3HA 1YMHB 2NY5H 3D85B 4IOFC 3LKSB 5AAWA 3SE8H 2VE6A 4HXBL 2HLFC 4JY4A 1TZGL 5BS0A 1IGML 3D87B 4LVNC 1ZXQA 3DV4A 1UADC 4OZHB 2FH6A 2DI9A 4LFHG 4PJAE 2P42B 4MHHG 4NDMA 4M6MH 2Z31B 1QSFB 2FIRT 1HIML 3D9AL 5ICZA 4N0YH 4GW5A 5CBEB 4OZGF 3MV8E 3QO1A 4HWZB 5CILH 5DMYA 4L3EB 2EXWC 2ZSWA 1ZGLA 3S4SG 3BKMH 4Z76B 2G5RA 1TJIL 1N5YL 4XNZC 1BEYL 4WCYL 3BZ4A 3HB3D 1KIUA 1BMGA 3LN5A 3SCMD 2WW8A 4U1SA 3WHE0 4MD5B 5C07A 2K3TA 5C0BE 1T5WB 5JZ7C 1MRCL 4G43B 3DURB 4M1GH 5MHSD 4N5EC 2BNQB 1BP3B 2A6JB 4Y4FD 1S9WB 1PG7X 3QA3B 4NGHL 2Y06H 4MDJA 5I8CB 1KYOK 1BZ9A 3C8KA 2FBJH 3GHEH 4Y16D 3DIFA 3W2DH 1MLBB 1J0HA 1QYGL 2HN7B 2OTWB 3A6OA 4NM8L 4XMPL 1J0YA 4GAYA 4WWKA 4L29B 4U6XA 5J6HB 3B5HA 3FL7A 5D7IB 4G8GE 1IL1B 1PKQB 5FM4A 5FKAB 5EUOA 5L7XH 4ZYKA 4P4KC 1MY5A 4Y19E 5LGKA 4HX1A 5EBLA 4NQXA 2HTKD 4TRPH 2WP3T 5HGAB 3LVEA 5I76A 5EU7C 2JB6B 2ZCHH 4JKLA 3UJTH 4IDJH 3IDJA 1S7QB 1KN4H 2CLZB 4BQBA 5FYLE 4K9EL 5IVXA 5ITBH 1U8PB 2FO1A 2Z93B 3H42L 1AE6L 1FSKC 3D39D 4OM1H 5HVHC 1CDHA 1IGJA 2Y6SD 4J3UA 4H0GA 5D93B 2O5YH 5HJ3A 4LMQE 4DGVL 5DRWA 2P7TB 4XBPA 1D5MB 4PLJC 2PYEB 2A0LC 3UXFA 1HYSD 2DYPA 1INQB 2YXMA 2EEAA 3WEXA 4LLQB 4QLRA 4GKZB 4V2CB 5TF1H 1JRHH 3P0VH 4C4KO 5M94B 4H1LG 3MC0A 4AMKL 5E6IC 1NDMB 1GIGL 4HF5L 5I1JH 5F72S 1ZT4B 3QI9B 2EDKA 5T5NG 2GI7A 3T0ED 3SCMA 4BJLA 1MWAA 4LBEA 5ESQB 2FIKA 4RFEA 3WN5A 4KUCD 1YJDL 4BZ2L 3CDYA 3EIFA 1T20B 3QNYB 5DHVA 4MVBC 1EGJH 2ITDA 1IFHH 3NFSL 2HTLC 3WFBL 4PGBA 1X5FA 1A22B 2NLJA 3VXPB 5LXGL 1UYWH 1GOGA 2Z4QB 3KNBB 1E6OL 1PEWA 3CUPA 4NQTA 3DTXA 3FCTA 1ADQL 3N1PC 4XWOC 3FB7B 3O8XB 2MCG1 2R1YB 2P5EE 3KLAA 4P9ML 1FNSH 3EJJX 3OKMB 4JRXE 1A3LH 1ES0A 1LE9A 4PJHA 3MJ9A 2D03L 4B41A 1CFNB 2ZUUA 4YE4H 3ZDYE 5ACLA 4EDXA 5KG9B 1OSPH 3EYUH 2IG2H 2DQUL 4FXGA 1TVBA 2CXGA 3VH8A 3O6KL 4OUUA 4PJ8A 3OAUL 4HIJB 3QO1B 1RJLB 4HWZA 3F7YB 3QIUD 4M7KL 4WY7H 2N7AA 5F1NA 5FM5M 3E6HA 1G7QB 1JRHI 1V3LA 2O5XH 4EIGB 4XZUB 4JJ5B 1U8JB 2X9WA 4X80H 5D1XA 3GMPA 3N0PB 3OR6B 4KJPC 2FJFA 1HOCB 3OHXB 4MNQB 4LGRB 1TJHL 2R4RL 4GKZA 4OLWL 3T3PE 4W4NA 3NCJL 5GJTL 3FB6A 5I1EH 2CKBA 4JB9L 4NN7C 1DEEB 4PG2A 4I1NB 4Z0BL 2DM3A 3KGRA 3G6AB 4TTDD 2AEPL 3LKRA 4MZ2A 3U46B 5IB1B 3TH3T 4O02H 4MA1C 1HH6B 5GS0C 1MQ8A 3D69B 3RAJH 2CKNA 4X4XB 2AJXH 3WL9A 1TMCB 3S8WA 2ZPKH 2DLTA 3IU3B 5CJ5A 4X6CF 5E6YA 5CCKL 2R2HB 1S7VB 4HW6A 2D03H 2PYEA 5E8PA 4I0PD 1MWAL 4WUKH 4BKLB 1OARH 4QRQB 4Y88A 1MI5E 5FB8A 3BH8B 5DQDL 1VHPA 4BH8A 1KG0B 3MO1A 4HIHB 4FNLL 1OSPL 4PJDF 4NSKA 3GB7B 3ORJA 1ZLUH 5ADPH 3VDBA 3BPCB 2QHRL 5IW1A 4KROD 3C60B 3D39E 3ECBA 4YJZL 3P11L 2I07A 1YECL 3GMLA 1YPZB 3NTCL 3RVWD 5HD8C 2OR9H 1FH5L 4J3SA 4XXDA 4FFZH 1VFUA 4XRCA 4KRPC 5ACZB 2BHZA 3QH3B 1W0YT 4L8CB 4X7CC 2J8HA 5L88H 5CSZB 3GRWL 4LLUB 4OGZA 4TTDC 1FL5A 4NT6A 3GKZA 1T20A 3MMEA 4OGYH 1G7HB 4J4PA 2FIKB 4RFEB 3U4EA 1TVHA 1F4YH 1AGCA 1RZFL 4YPJA 4RMTA 3DX7A 2W1NA 3MROA 2V5TA 3P0YH 4YFDB 1G6RH 5F1OB 4R96A 4Y4HC 4ZNCD 4HLZG 5KAQG 1N59B 2VLJD 3LKOB 3REWB 1K4CB 4FQ1L 5E8EA 5JLZA 3FQWA 1YC7A 4P2OA 4NHCL 4L4TB 1KBGL 4N0UA 4EI6B 5SWZB 3MV9A 3IGAA 1N8ZB 1FV1A 3X3GL 1C7TA 1ACYH 1XR9B 3IFOA 1XF5B 4K2UH 3MRFB 1XF2B 2V2XB 3WIHA 2DL2A 3QUYD 4F58L 1QO3A 1LEKB 2OQJA 3VD7A 4GS7C 5AAMA 2VISB 5FA4B 3OAYK 1C5CL 2VZOA 3GBMH 3OJ2C 3U0PB 2EDRA 5JOPD 1JF5A 3G5YA 1IVLA 1CBVH 3DV6B 3MLYH 1FNHA 5FA3B 2GK2A 1FJ1B 2NW2A 4MNGA 3N1QC 12E8L 4CMHC 1MLCB 4QXTB 4HUMB 4YX2H 5B21A 4MA3B 5BVPL 1F6AA 1JNNH 3WXWH 3GJFH 1D5ZA 5I8OH 1IKNC 4TUOB 2R0WH 4FQXD 3THML 4APQD 5CBAB 1FH5H 3ZKND 3LY6A 3C6LA 4WO4A 3QXVA 1MFAH 4EUPH 1T1WA 1JFQH 3GSOA 1U8KA 5CIPB 3BISA 5EO9A 2XICA 4BZ1L 3DO3A 3RWHB 5D7JD 1QP1A 1KLGB 4YH6A 2NX5A 4PB0H 3D18B 1NL0L 4ZTPH 5TE4H 3EZJB 5IMLA 1R24B 3QEQD 1FHGA 2V9QA 5FYJE 2JJTA 4I4WA 4M00A 4YHML 2NY3C 2ZJSH 3WFEH 3MXVL 3PWUB 5IVXF 3GSXB 3KPTA 1Q0YH 2PCPB 4HXAH 1ZV5A 4B53A 5C07B 3IU4L 5JO5A 3LKOA 3QIWD 5D96C 3ARBC 3O4LB 3MJ8B 5CEZL 4EBQH 5I66A 4YLQT 2G60L 2X1PA 3QUMH 1RZJL 5CJQH 2H41A 5ICXB 5GS0H 4WHCA 4OD2B 4HG4J 4Y7MA 2GAZB 4JN1H 5E2WL 4H20H 4AENA 4OFDA 3WHE1 4JM4H 5KSBB 4XMKL 5DQJB 4YDKH 5LWYH 5DWUH 1T6VN 3GSUB 3WDJA 1QSFA 5D71H 2XPGB 2ZG3A 4A2LA 2N56A 2NX5D 2I07B 4Y5XC 3KLHC 2C1PB 1A6VL 5CILL 3O3DA 3AM8C 3QFDB 4LNRA 2DS4A 2BHYA 3BE1L 3LSOB 4BH8B 4QOKB 1KCUH 3SDCB 4F7EA 3RWCA 1XH3A 3ARED 4EN3D 3T3ME 1HHIA 4GJTB 3U0WL 3PL6D 4XHJC 2M2DA 5DUBB 3VFRB 3EJYD 2C4XA 4OZGE 1ZMYA 3DGGA 3O8XC 2X2YA 3DMMA 1DBMH 4Z7WA 3EJZC 4HKJA 2PO6B 1GGBH 3MA9H 4NGHH 4ZUVA 4HFUH 1NGPH 1CE1L 3QRFM 4M48L 2AJUH 1QBBA 4PP1C 5F89B 5GRYA 1CFSB 4KPHL 1WZ1H 2GYSA 2MCPH 4ZFFB 2Z8SA 4PRHB 4U0QB 2EXWD 4UI2A 4AEHH 4LHUD 2EDBA 1FFNB 3V0VA 4OV5B 4TUJB 1DBBL 3HLAA 1NC2D 4Y0GA 2QQNL 2ADGA 2JJVA 1T1YB 2FZ3B 1W72H 4NZJA 4WHTA 3WNOA 5B38B 3V5KB 5F9JA 1JPSL 3NVQA 5C8JA 4YBLB 4EZMA 4X7TB 2VDPL 4IDJL 1KCRH 1D5ZB 4RRPA 1HXMB 4EKXA 5FGBC 4JZJA 4Y16B 4P4KB 2A73B 4YHKL 3SKOB 4NUGH 5DEGB 3IETB 1LO3H 3P9LA 4XP4H 5I17B 4Z7QF 4AIZA 3JBG7 4D2NA 3SKMA 3SO3C 4U1MB 2YUZA 3L3IB 4N5UA 4N8VG 5DMGC 4ZUUA 1CD8A 2BOCA 3RNQA 4P49A 5E8DH 1BD2B 4OLYL 5LG1A 5F9DC 1ZLSL 1KT2B 4BFBD 4OIAA 2VXSL 3PWUA 3WFHA 4NQEB 4YDIH 1OGAB 5I8EA 4FHBD 5B38G 4NFDA 4I4WB 1MCWW 1GGYA 1FL3B 3MJ7B 4JFFB 5DK2B 5BRZA 4N1HB 5IQ9B 2OCFD 5C0GB 4L4JA 1T2XA 4Y4HA 3C9NA 5F7YC 2HJLB 3TBVB 3HC3L 4YHOL 3ELAT 1NJ9A 5H8DA 2ITDB 4JDVA 1NAKH 2GAZA 4V1DD 2WLYA 1YY8A 2Q8AL 4HGWA 4IIQA 2Y9RT 2KH2B 4Y1AD 1RULH 3QIBC 4XPBH 4AENB 2EYTB 1EHNA 1DE4A 4JRYD 4OCRH 1FAIL 25C8L 2P45B 5BJTB 4NP4H 1FJ1A 2FGWL 3C60C 3EYQC 5JW3L 3ZDXE 4G8IB 3FTGB 4Y5VA 5I1LA 3BHBA 3PQYD 4HGKC 3RWCB 1I8LA 3ET9F 3LCYA 3MOAH 5IB1A 3U46A 3TZVB 2ARWA 2GFBA 4FG6C 2X4UB 4KI1A 4H25B 4ZOAA 1AFVH 2JJUA 2NR6D 1ZT7A 3ETBF 5I1DA 2WANA 2JJWA 2C3VB 4GXVH 4L3CA 5C0FA 3AREA 4EN3A 4JPKH 4E0RB 4WY7L 5DMJB 2R2HA 4WHDA 3FOMA 4X6BA 2YPLB 4A6YL 3IB4A 4N90E 3W39B 1QBAA 4E41E 3HC0B 4WI7A 3DARA 3DUUB 2J8UF 4IRSD 3VXQB 1IE5A 3PQYA 3OR7B 3MLTA 2BMKB 2CKBL 2EICA 4Y2DB 3OBAA 5F6HJ 1J7VR 3PNWA 4FQ2L 1IARB 3DX7B 3MROB 3QQ3A 3ZKSD 4QXWA 1RZKH 4X0KA 2OJZH 1X4YA 5DA4A 5GIRB 3MBXH 5DO2C 3FT2A 3O3AA 2RFXA 2DBLH 3CSYB 2PTTA 3U7AA 2LTQB 3GIVB 1JZ5A 4FQCL 3T2QA 3DO7A 2N1KA 4GFTB 2XTJB 2AEPH 3RY4A 3OG4B 2ESVD 1WIUA 4OM0L 5KOMC 5E9DA 5FO8A 3V5DB 4JO3H 3VMNA 3MXWL 5D9SB 5CD5D 3QEQA 4WWID 1OGAD 1VERA 3MRDA 2EZ0C 5F6HI 3PWJB 4JFEA 5HHOA 5IBLD 5F3HB 1S7VA 5KAQF 1E28B 5D2NA 3ZYIA 1PKOA 1FBIH 3MREA 4N5ED 3GBNH 3CAFA 3QZWG 2IBBA 5ETUA 2CH8A 4G6AC 3SKJL 43CAA 1RUQH 4K71C 4ZPTA 4AY0A 2DQHL 5HGAA 3RWJB 3VU2A 3BYTA 1MLCA 3NOIA 4WV1A 1G6RB 4NQCA 5T1MB 4XVUD 4LLDA 2QHRH 2P1YA 3MBEB 3QUZA 3E8UL 1UM6H 3NA9L 3SE3C 2FSEA 1G7JA 5BV7B 4FFZL 4PRNB 1CDCA 1VB9A 2HJLA 5LCVL 2Y06L 4NZUL 1BVZA 2CLRA 4UINH 3GSVB 4N8VA 5F7DA 3S35X 3P0VL 4ZPVA 5DJAB 3FQXA 4UT7L 4DZ8B 1HSAB 1M4KA 5F70A 3MUGB 3SGKC 2EDWA 1N7MH 4G43A 5CD5C 1B4RA 3AAZA 3ZE2F 3LB6C 5DVOA 5DK0A 3T65A 2WBKA 2H2PD 5J57B 1MWAB 4PBXA 2ZCKL 4ONHA 1FVEA 1HWGB 4G9FB 3QQ9D 5A2LH 2B4CL 3RGVB 1TENA 1Z2KA 4PJ7A 2GK0B 3RHWF 3D3VB 3U7WH 3OKLA 2BDNL 1U58B 4P2QD 2DIBA 2FJGA 4RISL 1WZMA 3QDGD 4PRBA 4P23C 1YPZF 2AERT 1NANI 4P5TB 4CJ1A 3MRHA 1AKJB 4LHUA 5DRWB 3FFCE 4JZNA 5J12C 4XB7A 4PJDB 3FN3A 4GRMB 4XC1H 2BOCB 5SWZD 5MP6L 1RIUL 2J4WL 1A4KB 3MPCA 1KLGA 4YPGA 3MRPA 1IC7H 1JRHL 2HTLD 2AK1H 3ARBD 4NQCB 3DOSA 5I8OL 5JW4R 3E8UH 3DMMD 1LDPH 4ODTH 4ZTOL 3GSOB 4M9OA 4X5XB 2LAGB 3RTQD 5GZND 1KB5L 3QUMB 4U1JA 3SJVA 4RFNC 3NIDE 1I3VA 1QFOA 4X80L 5EBLB 1NBYA 4HFWB 5E2TH 1YPZE 3RHWK 3DHJA 5CUSL 3QT2A 2AGJL 2Y5TA 4PJ8C 3QWOB 4M93B 3C87A 4GAYB 1K6QL 4BQ8A 1BECA 4Y1AE 2F5AH 5HHOD 4LCUA 3BZFA 2VISA 3J7HA 4HKZA 2Z4QA 4U7SA 1OF2B 4G7VL 3LZFL 4LCCC 1LILA 1YEIH 3CVHB 3QHFH 2B4CH 3WS3B 5IMMA 1KEMH 4W81A 1F4WL 4BQ6A 1TPXC 3DVNB 4HUWB 2YUWA 3STBA 3DX9A 5E9DE 3G5ZB 2E6JA 3D3VA 4WIQA 1EHAA 2FHFA 1U8MA 4ZXBA 4NKQB 1FE8H 2AP2A 5EUKB 3O2DL 1I8MB 1MAML 1OD7A 2RR3A 3ILQD 1I8LC 5JMOC 5F3BA 3KLHD 3JV5A 3C6LD 3RVXD 5L2KE 2VC2H 2BCKA 1F8TL 4J1UB 1C7SA 3SGDH 2HKHL 5DUML 2CMRH 1RZGB 5J9PB 1CYGA 3AGVA 5T3XH 1LO4L 3QIUA 1INQA 5E2JA 1T4KA 3RBGA 3HZMB 1OP9A 3VFGL 2Z91B 3U0WH 1PLGL 4NKMB 1S7WA 1LDPL 4JVPA 5DVKA 4U05A 5C0BD 1JHLL 1OLLA 3MUY1 3DTXB 1DQJA 1L4IA 2J8UB 4APQA 1HHHA 1S9YB 1W72B 3BUYB 5DFVD 4F9LC 2Y23A 4FFWC 3SCMC 4ODUB 3QEUA 2SEBB 4F57L 3TGXA 4F7CA 5DHVB 1F4YL 3TA3B 3RNQB 1P84K 3KPOB 2OZ4H 3FONA 1BQUA 1CLYL 3FO2A 4XAWH 1HCVA 3JZ7A 5KSBA 3IFPA 1CGXA 5HY9B 4FOMA 5DD3H 2PW2B 3ILQC 4DWHA 4U2ZA 3QUXA 5KVFH 5KN5A 3ARRA 5EUOB 4OUUB 4PJ8B 5FHAH 1XAUA 3EOBB 2Z8VC 4RAHA 4OBRA 2AABH 3TNNA 3DBXB 4Y5YC 2VDLL 1A6TB 3C9NB 4JCLA 3TBVA 5A3IC 1MF2L 3WN5C 1QFWH 3L3OA 1J1PL 4CMHB 1FO0L 2FNBA 5DQDH 4HCRL 1QA9B 5ITFB 2J1KA 1YEGL 2BK8A 1NGWB 1A21A 3FAWA 3GJEB 4KC3B 3LRSB 5DLMH 1WTLA 3V79C 1G9NH 4NBZB 4ODVL 2B5IB 3MRBB 1L9MA 5HGDB 5ICYA 1KB9K 1J11A 3I6LD 2E8ZA 1PG7L 4YGVB 4R26L 2KDGA 2BY2A 3BDYH 3OX8B 4P46C 3LIZH 4OAWA 4FQJL 4X7SH 1JNJA 4HHAB 5I73B 4PGCB 1P4BH 3O2VL 5L2JB 1MELA 2H3NA 4RGOH 3ALWA 1R5VB 4KDTC 1YY8B 2W92A 1IZJA 3T65B 4LOUC 5SWQB 3V6FA 1UACH 2VXTH 3QZWA 2XRAH 4NHCH 1T1YA 1WEJL 1N6UA 4JFOB 4OZGB 5BS0D 4M6AA 2NR6C 2IALA 2VE6B 3KR3H 5HHVH 1FV1B 1J1XL 1QLFB 3T8XB 1LEKA 1EHLL 3W11C 3BN3B 3GB7A 3N9GH 1NAMA 1NC2A 1KYOJ 2X4UA 3V95A 3B2VL 1FL6B 1MAKA 5C0CD 3NZHL 4DFIA 2I25N 4PG2C 4RAVB 1M1SA 2VDLH 3WIHL 2B4CC 1HN1A 4MSWB 3VRLE 3CZFA 3QJFA 4BFEA 1N0LA 3MV7B 3AS1A 2FX7L 4LQ1A 3L5WA 5CEXA 5ACMA 4NQVB 1GGUA 2HT2D 5D7JC 3O6LH 3OF6A 5ALCH 4LHQB 1T1XB 3LD8B 4LNVA 2VJXA 3MZGB 3PJSA 3HFMH 3JWDH 1U8MB 4ZXBB 4XWOD 1BZ7B 1YNTA 5IMKA 5A2KH 1PX4A 1IM9B 3SQOH 4PY7A 2XKNB 1S9XB 3B3IB 4ONGH 3S88L 1QNZL 4UV7H 5KS9F 3CU7A 5DJ8B 2NY2B 3ARUA 3WLBB 4WGVB 4XBPB 2PXYD 3HCVA 4KRLB 5JR1L 4P99A 3VWKC 5IVZA 2PF6A 3BN9D 2E9WA 3P9MB 4LKCA 2LU3A 2GTZB 5CKGA 3TYFA 7FABH 4XX1E 2V7HA 3PWLB 1JZ4A 5FV1L 4O2EB 2D9CA 1BBJB 4EVNA 1QFWM 4O4YH 2F8VA 5KW9H 2XRAL 1J5OL 3WHXA 3UX9B 4P3CH 4YEFA 2Q8BH 1FCGA 4GRWE 1H5BC 2LU7A 1MNUH 4HV8A 3BP4A 4X6FB 1ZVSA 1ZA3A 3LEVL 3O45A 4HC1H 4LCCA 3OKDB 1HQRB 3MUGA 5HHNB 3KYKL 2IH3A 3BW9A 4P5KB 4P2YA 4MVBD 3KS0H 3D3VD 1I1AA 3BOVA 3C09B 2NW3B 4XXCA 5FA4A 1LO5B 2DI8A 3ZT7A 5BV7H 4RAVA 3QIWA 1A6VH 3QDMA 2FZ3A 2AJVL 4IHOA 5DJ2A 2PXYA 2OL3A 3WNLA 1JPST 4PRNA 3UZQA 1A7PH 5E4IA 1U3HD 1RZIB 1BJMA 3QRGL 3HMXH 4NYLB 3T0VA 4X4YB 4QHNB 4YHKH 3EYSH 4DKEL 4I5BB 2YD8A 1KPRA 4M8VA 1BX2A 1FG9C 4KUZL 5FO7A 1UG9A 5KZCD 1CGYA 3VFPA 1K85A 1TITA 4X4ME 4X8XA 3JWOC 5E99H 4XZUA 1MIMH 4LBEB 2ZUQB 5CP3A 2LQRA 4UIKL 5E2VH 2IC2A 4NZUH 4UINL 3K1KC 1I8IB 1IEAA 4YIQB 2MKWA 2QADD 5TDNB 2MHAA 4YDIL 4OB5H 4UT9H 1OWRM 4HULB 4NZRL 3V5DA 4OI8A 1JF1A 1WISA 1MHCB 4GXUN 5E8NA 4OLVH 4ZFZA 3B2UD 4ZFOA 4BA8A 4B5EA 2AV7B 2EKJA 3HC3H 5DDHB 5KSBE 1F6FB 5JW5A 4PBWD 1L9NA 1RI8A 3BSZH 4WGWB 1WCQA 4PJBA 1CFSA 3SOBH 4JY4B 4J3OC 2QQQA 1NFDA 3PABB 5E8PB 4L4VB 1E27B 5I1GL 4KJYB 4QY8A 2YK1L 1S9XA 3B3IA 4WI6A 1JHKL 1JUFA 3BW9B 3V6BR 4UB0H 5DEGA 1JJUA 3D9AH 5HHQB 4O2CA 4DCQA 2ZSWB 4M62H 3DETC 5DJCB 1KTRL 1Q0XL 1JYXA 3HN3A 1JTTA 1MREH 4PYHA 1IC1A 4JQIH 5FGSA 1XH3B 4WCYH 2NY0C 2P5WA 4KI5C 1IQWL 4URTB 4BUGA 4PG9A 1M7XA 4V1DA 1JK8B 3RKPA 4PJEB 3U2SA 2EIZB 2CR6A 2X4RB 3RWEB 4JG1H 4AM0B 1I9JH 5FGCB 1HKLL 3RTQC 2X5PA 2VLJE 4CVXB 1JV5A 3NN8A 2J8UA 4G5ZL 3L7EB 4IOIB 3KHOA 4QYOA 2A6JA 2YMXL 1LP9B 3FQWB 5E4EB 1U9KA 5F89A 3ZKNC 1FVEB 1FP5A 3BI9X 4DJMA 1MHHB 4XMPH 5EBGA 5TDNA 3WLWC 4HMDA 1P4LA 3KJ6H 3G6JA 3BDBA 3PNWB 5IG7A 2V5YA 2EE3A 2ED8A 3OB0K 4TNWK 2A9NL 3VDCA 5L7XL 4EUPA 2AQ2A 1A6WH 3U7YL 3DVGB 4MWFB 4OFYA 4D9RE 3TO2A 1NJ9B 2D7MA 5JIIA 4FA8A 2WINA 5IIEB 5HHPB 3L5IA 3L5WB 4LCYA 4QXUH 1OSZA 1NEUA 4HIXL 3RIAK 5J3HC 4F15C 5DTFB 5B4MD 5ITBL 3BPCA 4JRYE 4NQEA 4P57A 5E1HB 1DLFL 4BQ9A 3N85H 4I18C 3FQRB 4YBHA 1FNSL 3QCTH 3AU1A 4L8DB 3EOAB 1F8TH 1EO7A 4YUEH 1I1YB 3DXAD 3PQYE 1J10A 3UYPA 1LVEA 5DGQA 5AZ2H 1UEYA 1NGYB 1WBZA 3RWJA 4EOWH 1PYWB 1ZS8A 1S78C 3UTOA 4FQIL 4Z7VE 5C9JA 2BERA 5I16A 3RUGB 4JRWA 3BQUA 2DKSA 2H3NB 4FFVC 3VFOA 1QLRB 1WZKA 1HINL 4JN2B 2LTQC 4G5ZH 1WAAA 3K0WA 3MQIA 3D39B 3QBTB 4HUXB 4Z7WF 1MFBH 4F7CB 3QIBB 4PYGA 4YGVA 4HK3J 1AXTH 5KSAB 5J3HD 3VRIA 1B90A 5T5FH 3DECA 1DN0A 5DURD 4ZO8A 1AP2B 5FXCH 2EKSA 3SE3A 2E7BA 3FOLA 1WFUA 3HZVB 1QA9A 5ITFA 4Z78B 1NC4B 1MVFA 3NMEA 2GTWB 3BXNA 4P9MH 2BZDA 2P5EA 3Q2CA 5D93C 2B5IC 3GGWB 3FTGA 4G8IA 2CUMA 4HIXH 5C09A 5F71A 1QFPA 2ZZUT 4N0FA 2VDNH 5BW7A 4RIRA 4JQXA 2XTLA 4HT1H 4HCRH 4JPVH 2G9HB 3EGSB 2Z9TA 1KPRB 3CNKA 4YGAB 2JJSA 4GRLA 5IFJB 4PJ5A 2HT3C 3QO0A 5D1ZB 3LOWA 1NMBL 3BKML 2ERJC 2O5XL 2G5BA 1RZKC 5AZEH 4FG6D 5HYIA 4I48A 32C2A 4ODSH 5ADPL 2APTA 3ARQA 5D7JB 4JVWA 1CT8A 3PGDA 1H3UA 4NHUA 3RL1B 4YXHH 1Z3GH 1QBLL 4R4ND 1D6VL 1E4XH 4X6DA 5IMOA 2HRPH 5EU4A 2E7LA 2QADC 2LV4A 1IGCL 3WE6A 3FHAA 4WV1C 3NIGE 2W91A 4Z8FL 5EN2B 1FFOA 1Y6MR 2JB5L 1IGYA 3V52H 2X89A 4ZUVB 2HMID 1H8NA 4NPYB 1QFUH 4TNWF 4NQXB 1AXTL 3RDTD 5KJRL 1FO0B 3IDMA 3BAEL 5DRXB 3NFNB 4FZEL 1TNNA 2BVEA 5IVXE 43C9A 2FATL 3JV4A 4D8PB 2WWKO 3P4OA 1AD0A 1EHLH 2R15A 3G9AB 1KELL 4LSVH 1AP2A 2X4QA 1FIGH 3UTPE 4WW2C 2IFGA 2P43B 2GTWA 1YEIL 2V17H 3VFSB 1MWAH 5D2NC 5KVGL 2XQYK 5EUOE 3MO1B 4HIHA 4MAYB 2E27H 5FB8B 3H42H 4PRDB 3U4BL 2Z0BA 1H3PL 5D7IF 3QDGE 2EIDA 1QSZA 3K7UA 2AK1L 1MAMH 1T3FB 1T2QL 5IHZB 4AIZB 2QL1A 3F7YA 4UOJA 5C9JB 4K94L 3KPLB 4P2OD 4NZTH 1HCFX 3MODH 5FOBA 1ZHBA 5TQ2H 4YFEA 3IXTA 3LPGA 4JN2A 1O5DT 5E2TL 2VLJA 3PUCA 4JAMB 4O51A 1BREA 1JWSA 4OGYL 4OZ4A 1NBYB 3LQAL 3RWFA 4ZO7A 5T3ZH 4RWYL 5F9WC 1RHHA 2AXGB 3DVFA 3OJDA 3SDAA 3UMTA 1GIGH 2BVUA 1A3RH 4OZHF 4UTAL 5DMGD 1N5AB 1UM5H 2XI9A 2EDHA 3CCHA 3QDMD 5T1KD 3RPKA 2YC1B 4JKMA 1VEMA 3RBSA 4AEIH 1I1AD 5CGYC 5SX5H 1MJUL 2EO1A 4KDVA 4M1CD 3VXTB 4GRLD 1BFOA 4U1NA 4LCYB 2OZ4L 2QBWA 2ED7A 3BVNB 1WC7B 2Y7QA 5GGQH 3UDWC 3NPSC 1XF4B 5EUOF 3W5MA 1KELH 3K81A 3LKQA 1CD9B 2EDOA 1L0XA 3BMVA 4LVHB 1U0QA 2AQ3A 3HE6B 6FABL 1QRNE 4IRSA 2HTKC 3DGCR 4AK1A 5GS0L 1IZKA 1FVDB 4TVPH 12E8H 4K3JH 5DHVH 5DS8A 4ZAKD 3CVHH 3GHBL 4MXWL 2CD0A 5BOZG 2MJWA 4NJ9L 3ECBB 4JFDB 1OB1A 4M7KH 2BY0A 4NC1E 3P77A 1CL7L 4FFYH 1S9YA 1RIVL 2X6MA 4DN4H 4CVUA 1DQJB 2Q20A 1MRFL 5INCB 4EI6A 4U1KB 5MERA 2CUIA 4LSQL 1FDLL 3OF6D 5D70L 2XNAB 2NY3B 5EDXA 2YD2A 5C7XH 1QTYT 4WO4D 2HWZL 2ED9A 2NY1D 1R5VA 3SHSA 3R0MA 1IAIM 4ZUTA 4NPYA 1OGAE 2DQIL 4AEEA 3ULVE 3TA3A 5HHVL 1E4KA 3TIEB 1MCDA 2MCPL 4YHPB 1CD0A 4BELD 1FC1A 5BRZD 5T33H 1RZIA 4LQFH 3AS2A 4PREA 4YDKL 1WK0A 2E6PA 1OAZL 4G42A 3G9VA 4RFNB 1RUKH 4H26B 4KRPB 1T1WB 4F33A 1VFBA 4MD5A 2VDML 4PJHF 1ROWA 3MRHB 1RIHH 2FX7H 1CE6B 4TUKL 2EYSB 4YWGL 3T0BA 1UH3A 4MQ7B 1X5XA 1ND0A 1UC6A 5BO1H 1NCDL 1PZ5A 1KJVA 3SGJA 3UO1L 1U91A 3GI8L 2D31A 3HUJF 3LDBB 5A2IH 4QTIH 3O2VH 4G9FD 1NUGA 3C6LC 4G6KL 3RVXC 3ZL4H 4XP4L 4YR6B 3IFPB 3VFTA 4Y2OA 5IW6B 2XTJC 5L2JA 1HNFA 4YK4C 4ZODA 5CP7B 5L88L 5KVEH 1HKLH 3S4SA 4L8DA 1MRFH 5MEOA 5DK0B 2QHLA 4CJ0A 1WEJH 3V9FA 3RWIA 5GZOC 3PDOA 5MERB 2WLZA 5IB5B 2OSLA 1QSEA 4HPYL 2NLJB 4XPGL 3VXPA 1BVKB 4DKAA 2BVOA 1WJ3A 2FLRT 4ZFFA 1QQDA 1HEZA 3GJFA 4QRPB 1MJJB 3DLQR 1YEHL 1OTSD 2Y4SA 4K9EC 3MLRL 5EZIL 4FABL 1CF8H 5IUSA 3EO9L 1AQDA 2BNRA 3ZSSA 4IDLA 4GO6B 2R4SH 3HPJB 1ZLVK 1A1MA 1BQHG 2C3HA 4W6WB 1HKFA 1W0WB 3SQOL 3CXDH 1CDUA 1DLFH 2EDYA 3B6SA 2C3WA 3CMOL 5F9OH 5J13C 1IAIH 5CJXC 1HILB 4QRUB 1T6WA 3KJ4C 1OP3H 3LRHA 1S9VB 2IPKA 5DC4B 2PXYB 4I48B 5FYKU 5AZ2L 4Y89A 1HI6B 1WFOA 2VDRL 5GRZA 1FZKA 3MNWA 4U1IA 4DKEH 2F8XC 3O0RH 3TJHC 1CT8B 3AS3A 3PGDB 4PTTA 2C1OA 1KTDB 4QTHA 5BRZB 3FB6B 3PF2A 3RVVD 1A9BB 2X9XA 3L3GB 5L0QC 5MEQA 4HUXA 4BZYA 4P4KD 1F45A 3HZKB 4PRHE 2C5DC 1F4XH 5C07D 3TCXA 4RBPK 4ZUTB 1PAMA 2HKFH 1KULA 5CLWA 1FO0A 3GM0A 3QHTC 1O7SA 4MS8D 5J1SC 2Q8AH 3BIAX 5JXED 3PJSB 5D7SL 3PGCB 3V4VH 3K2UL 2DQGH 3D48R 1G9MH 2XWJB 5CEZH 2EDQA 5DI8A 3KHQA 4HQQL 3NCCB 4NQED 1KACB 1KGCD 2FX8H 2BX5A 2VO5A 4PV8B 3TFKD 3X17A 4FQCH 2D9QB 1VFBB 1Y6NR 1LMKA 4OF8A 5C0RL 2WBJD 5CS7A 5C2BH 2JJSC 4KKNA 5I1GH 3QUYC 4KGJA 4OKVB 5EBMB 4QOKD 3TZVA 1U3HB 3ARGC 1J05A 3U36B 3RVVC 2ICEA 2HAZA 2X4OA 1AE6H 1NANH 3QG7H 5A3ID 5B3JF 2HT3D 2G2RB 5C6TL 3RTQA 4YBQD 2Q6WA 4F80A 2O5YL 4XP1L 1BFVH 3EW3B 1ZGLB 4JRYB 2CK0H 3DNKA 1GSMA 1RUQL 2I60L 3REWA 1EIBA 4EUPG 1U91B 3FJTA 3B5TA 1H9VA 4YIQA 3CFKB 3TNMB 5IEKB 4JDZA 4Y4FB 5A2FA 4XAKE 3VE0B 3T0EA 1WQVT 2XXCB 3PQYB 1QBLH 3MNZA 4WWKB 3NA9H 5I6XC 4OZHA 3F7PC 4U6HB 4IMKC 4TSBL 2XZQH 4XP9H 1IGTB 3EYFA 1XGTB 3DXAA 2WUBL 2E6QA 2ARJA 4OV6F 4R6UA 2BC4B 4JGMA 1X3DA 1KN2H 1PQZA 4FP8H 4FZEH 5HHMD 3V4VL 3VFNB 4MJ5B 3ZKXB 3S97C 2QSVA 3X14A 1KG0A 1DBBH 4RFOL 1WBXB 1Q9OA 4XXCC 3QYCA 4CGTA 3WDIA 5DQJA 2ICWI 3UTPD 2XA8L 1A6TA 2XQBL 5I6XB 5CZVH 4WWKC 5DC9B 2QQKL 3LEYL 4HXBH 4NO5B 5ISZE 1A3LL 3KPLA 3E3QC 4JGJA 3LN4A 1LP9F 5E0QA 2LFGA 1IM3B 3MREB 2A0LD 2ZG2A 3FT4B 1LK3H 2YUVA 5TPWH 3K3QA 2GSIB 2Q86A 4HJGA 4RISH 1PY4A 5I19H 3KWWA 4OKVA 4NOBA 3H0TA 4M4PA 3FN0H 3LRSA 4L3CB 5EA0H 3IXAB 4G7YH 3BPOC 3BWAB 4X4MA 2XYCA 3QDJA 3KPSE 5KANG 5D7KE 1U3HC 5C0CB 1BEYH 3NAAH 1BGXL 2NX5B 2GIYA 4HKBB 2CLRB 1MFDL 4KY1L 4XVSL 1SJHB 4M61A 5F7EH 3VXMB 3PGCA 2PTUA 4RGND 43C9B 3QHZL 4Q58C 4YHNB 1UQSB 1TETH 3NFPB 2DQJH 2MTPA 4YFLF 3CK0L 3KPQB 3I50L 2YRLA 5DJXB 3R06B 3PGFL 2VLKA 1G7PB 2VABA 3OAZH 5IBUB 3MCKA 4X99A 1A47A 3O11B 4F7PB 3CC5A 5ETUB 1NBZA 4HBQA 4WI9A 4WNQB 2NY4D 5GGQL 5JZ7D 4NRZB 5FV2A 2R0LH 4OCRL 3U36A 2GSGB 3AC0A 2X4PA 4NRXB 1M71B 3QEQB 5EBMA 4K7PH 3SDDC 1ZSDA 4D0CB 3F7VA 3KLAB 3S7GA 2APBA 4U31A 2C1PA 3GI9H 4G8EB 5DJ8A 5C92A 4KRNA 1N64L 3IRPX 1F4WH 5DZLA 3L3DB 4LLYB 3NPSB 1XZ0B 4HZLB 4M7ZC 4YFLI 3IF1A 2UZXB 3KLDA 2WZPD 3QWQB 1N6VA 3MZTA 5HYSA 1S7TB 4GG6E 3IKCA 1MJ7H 4LEXH 4Y5XB 5IR1B 1FQ9C 5SX4H 3CLFL 3ZYZA 4UU9B 2YPKA 3NAAL 1JWMA 2HFGH 4WJ5B 1BFTA 3MV8B 2OR7A 2J8OA 2L0DA 4WHYG 2EO9A 2CXKA 2ITCA 5F1IB 1MQKH 4W4OC 4WFGE 1D6VH 1E4XL 1TQCB 3FO9B 5C0AB 4HS3B 4KK8C 1K6QH 4XI5C 1JPGB 4K8RC 1RQ5A 4ONOA 4LRNL 5IWLA 3BZFB 4ODXB 5C1MB 2X70A 4HUVA 3BO8B 1L0QA 5E6IB 3ARBB 5HHNA 1KBGH 1F2XK 5AD0B 5C0BB 4UT6H 3UTTB 4DVBB 1ACYL 3QJHA 4XP5H 1K9TA 2LU4A 1BJ1H 4D9QD 2ZSVB 1DUZA 1I7RB 4OT1H 4MNHB 3OKDA 3RGHA 3FFCB 3GSNL 2G9HA 1IM3A 4KK9C 2RGSA 1M7DB 4GOSA 1F13A 4K7PL 4R0LC 2D31B 1TVBB 5DUBA 1RUKL 3LS4L 2VC2L 2R29H 3IDUA 1NKRA 4XCEB 3F12B 3A0OA 1AGDB 5CGTA 7CGTA 2XZCH 4FZ8H 3GSVA 3U4BH 2A83B 3OKYA 2R1XA 2YPVL 2Z91A 3SDAC 1YEGH 4MXQD 4S1DD 4HAGA 1OTSC 2P5WB 2R0WL 3VI4F 4ZO9A 5I8CA 4QTIL 5IQ7H 5AWNH 4M7ZB 2XN9E 2W9EH 1A14H 1JFQL 2X1OA 1MOEA 1MFEL 3MODL 4QO1A 2Q87A 4Z8FH 3RL2B 4IS6A 1XGUA 5T1KA 4UQ2B 3IDXH 4ZS6C 3RVUD 3VFUA 4BQCA 3OWEA 1VDGA 1RVFH 2DD8L 5HDQH 4FMKA 2BNRB 4RMSA 4FXKA 4PJGE 1RMFL 4XPHH 4OQTH 1H3GA 1NFDB 5EN2A 1UVQB 3ZHLA 3LH2L 1MCEA 2AK4B 3FQTA 3K46A 3GSXA 1MCIA 4Y16A 4ZAKC 1YEKH 1TCRB 4H0IA 4OCNC 5TH2B 2P48B 4JHWL 3T3PF 5BMFL 4EJ1C 2EYSA 3QCUL 4NFCA 4MX7A 4P5TD 3UTSB 2HP4A 1GCFA 1FZOB 1K8IB 1GZQA 5A16B 2MPAL 4JO4H 4ZG1A 1MHPL 4WU5B 3ZHKA 4S11A 1NGQH 2ZPKL 4QHMB 3PIQB 5F1SA 2VLME 4MCYB 4ZDHB 4X0KB 4YR6A 3VFTB 3ZDZE 5T3ZE 3EFFA 4HJ0C 2HH0L 4LLDB 1G9NL 5F7WC 2CPCA 4J1UA 1W0VA 3PP3H 4I2XE 1MVUB 3VGBA 3CVHL 3GHBH 3VCLA 3WN5B 2WQRA 2VLRE 2R56L 1AGCB 1G7MB 4OFPA 5L6YH 4C58B 3LEXB 2VAAB 3PABA 1HHJA 3O0RL 5AWNL 1A4JA 3PHQB 2G75B 3VFRA 2KQMA 4FS0A 4QT5B 4Z7UB 5FK9A 1MY7A 2X70B 1GGBL 2WBJC 3TA3C 2LVEA 1S5HA 2BHUA 2VXVL 3V7MA 1TDQA 4KKLC 3VRLF 2UUDK 2R39A 4G3YL 3E6FB 4EXKA 4PJAA 4J3WA 5F8RC 1EVTC 3IFNL 4DOHE 3RGVA 2QR0A 2DQGL 3JV0A 2V2WB 4CMMB 4LIQL 1U58A 2J5LC 4KTDH 1CU4L 1I3RB 2ENYA 3BPNB 3QDGB 4R97B 3CH8A 4DCQB 2BCKB 4OIBA 1TCMA 1MCRA 5DK3A 2NXYC 2NY6C 1IGMH 1LP9A 3H9HB 1J0ZA 5C2BL 1HHIB 1FE8L 4IIQC 4X7TA 1OAUH 1C5CH 5I30L 2ESVB 3W9DB 3GJEA 3HG1B 4S1SH 4HH9A 3KXFA 1S7XA 2B1AL 1JGLH 2F5BL 1ZHLA 4XP1H 5D8JH 1GL4B 1A7PL 5BZWA 1R3KA 2DLHA 5F21B 4C56B 1SEBA 1S5IL 2BRRL 1UEMA 2ARJB 3L3KA 1RZ7H 4LSUL 4R90L 1WZLA 4NO2A 2RQ8A 5L6YL 1L7IH 5TDPB 1A64A 3TCLB 2F8OA 5T3XD 1N5AA 2Y5TB 1HHJB 2H45A 2RIKA 3KLSA 2ZNXA 3O3UN 1VENA 3SDDB 4X7EC 5HY9A 1QOKA 1P2CB 4TSBH 5GJSH 1GC1H 1MIML 4L8SA 4Z7WB 2HFTA 5DJXA 2JELH 4JFEB 1B2WL 1RJLA 4KTYA 2JKXA 3K4ZA 2DKUA 2DQFA 5F9JB 3BVNA 1IBGL 1DN2A 3H3PL 1J0JA 1Q38A 3LEVH 5J56B 2HJFB 4PRAB 5JW4Q 3OXSB 1RULL 2MQ3A 5FHAL 2ZUTA 2BFVH 3VG9B 2E5EA 2VL5A 1FN4A 2OQJB 1CF8L 3GNML 25C8H 4LP4A 4U3CA 3BSZL 3QDMB 4LHUB 1G84A 2VXQH 5F7NC 1U42A 4UDUB 2VLKD 1GOFA 4HMEA 1UKQA 4IMLB 5IB4B 5DMIH 3R4DA 4GMSL 1MI5D 2AI0L 4JJ5A 2GSIA 4HZAA 5CFHA 3CFJB 1I9IL 4U1LA 2YK1H 5JPNB 4LVNB 4G6KH 5J1AB 4D0DA 2I27N 1F90L 4L4VD 1W0VB 4MA7H 4JHZA 4F8QA 2MQ0A 1MCKA 1KPUA 3FRUB 4DGYH 1OHQA 1RSFA 1VKXB 5L8LB 2GUOB 2JCCA 3VWJD 3UPCA 2DMKA 5TF0A 4N9OB 3VXOB 4P3WA 1JBJA 1IGYB 4QHUB 5D2LA 4ZS6D 3E6FA 2IADB 3U9PH 3HNVL 2HN7A 2OTWA 4X6CB 3CDGB 1XF5A 15C8H 1DN0B 5KSAD 4ZAKB 4LCIH 5H35B 3CX5J 3MA7A 3T0XA 4KK6D 4LCUB 2UYLA 3ARGA 3C60A 4DVRL 1JF1B 4N68A 1CLOH 1IAKA 4L4TA 2W0FA 4Z7VB 4D9RD 2NTFB 4WTZA 3S98A 1UCTA 1AKJA 4QXGL 3VXRA 1JWMB 1YJDH 4N0CC 2CRYA 4KPHH 9CGTA 2Z31D 3PP4L 5HI5C 1DVFA 1YEJH 3BP6A 2OJEA 3T1FB 4FQQB 3Q6GL 5EH1A 2IGFH 5EZOH 1CG9A 4GQ9H 1EO5A 4DZBA 2AAVA 1JE6A 5F96H 3WE6B 3FN9A 5FA3A 5J1TC 4I0PC 1H15B 4GRWF 4APQB 5HHOB 2YA1A 4C56A 1NUNB 5DFTA 3CFEA 4UOW1 5ERWB 1G0XA 1S78D 3F5WA 4PG9B 2UWEE 2B0SH 2FDBP 3MRCA 3D18A 4N0YL 1Q9WB 1A3QA 3BQUC 3KYMB 4R0LB 3OAUH 3HI1B 1DLHA 5GISH 1WCBA 1T03L 1BFVL 3H8NA 5CZXD 1JZ8A 3FRUA 1TJIH 4DEPB 1N5YH 3CSYA 5JDJA 3BGMA 3C5ZD 4HBCL 3VXSE 5SWQA 1ZE3C 4X99B 3H3KA 4M3JA 3I2CH 4P46D 2HFGL 4ZNEE 4MJIA 1JVKA 2WM0A 2IH1B 2JTDA 1DBKH 3G6DL 2OL3H 3W9EA 3G6JB 3HI6H 1NCWL 2ID5A 5HTSA 3QAZC 4X6EA 4OF6A 3OQ3B 2NY7H 4Z0XA 3WYRA 4LRNH 4BSWB 5D9SA 2B2XH 3HZKA 2R2BB 4JFDD 2YRZA 5IJVB 3UTZB 2N7BA 4XBGB 4X5WB 2NY5L 1U8OA 3QQ4B 2R0ZH 4RMWA 2ZCKH 1D5MA 1VFAA 4PRAA 2F53D 4YO0A 5IGXH 3ZTJH 4M6ML 1KB9J 5CHNA 3SDCD 1IRAY 3B9KC 5H2BB 1P53A 1QPXA 5TE6L 3QCTL 4XP6L 1ZLWH 1G7QA 5DJCA 3U9UA 3DMMB 3ARDA 4KKBD 3O3AB 5BRZE 3QXDB 5KZCB 2NY0B 4WENB 1RK1A 1NGYA 3LQAC 5DD1L 5FGCE 1RIUH 2J4WH 4E42A 5JOEA 5ICXA 1A8JH 4HKJB 4C83B 1JTOA 2M8XA 3D0VA 1A6UL 3HMWL 5AYUH 5B39A 4GW1B 4R3SB 3NZ8B 1V8HA 2CIIA 3JWDC 3OJVC 4K94C 1T03H 4KMTL 2XNAA 1U41A 2NY4C 1WT5C 4G6JH 4XP9L 2W9EL 1IAKB 3ARBA 3VWKD 4HBCH 4KROB 2X4NB 4NWUH 3S9DB 2W60A 2BC4A 1FFNA 3V0VB 5TF1L 3H9SB 5HYQB 3T09A 4JR9H 4GG8A 4FP8L 1LEIB 4LSSH 3QHZH 5BCAA 2D7TL 4HUNB 5IVOA 5GS3A 5GSVA 5MHSE 1HXYB 1MPAL 4I3RH 2DQEL 2YD4A 3GSUA 1UCBL 5TQ0L 2ZOKA 4RCAA 2XQBH 5BV7C 1JZ3A 2RCSH 1FVDA 1FZMB 1PW3A 5KS9B 4NO5A 3MRJB 1DUYA 4RIRB 3IYLW 5JW4N 1QUNA 4JO3L 4L3EA 1I1RA 1PD6A 2XZAH 3PWPE 5ID1B 3KPRB 5KVMC 3MRPB 4WFFE 2V7HB 3PWLA 3DVNA 4ZPVB 5DJAA 4DZ8A 2ICEB 4JQVC 3MRGB 5EA0L 2J12B 4ZMAT 5EO1A 3MJ7A 5HVHB 2EIZA 2X4RA 1CBVL 4UUJA 4RMUA 4JZNB 3BP7B 2G5BB 1DEEA 5E00B 5IQ9A 1D5IH 1F97A 2XY1A 4KKAC 4QRUA 5LGHL 2N4IA 2VAJA 3F6LA 5CGMA 1YC8A 4LF3B 3N06B 2DN7A 3UC0H 3HMWH 3WXWL 3TIEA 5DJ6A 3I3EA 3MLVH 3O2WL 1PLGH 5DJDA 2G75A 1EX0A 4XWGL 3H7BA 4JO2L 3L3JA 1W2KT 2NY6D 4CU6A 3C08H 3C8DA 1DQQB 4FQXB 5E1AB 4GRLC 4HS6A 3P9LB 3UBXI 4BZ2H 5A1AA 4JR9L 4QF1A 2FEEL 35C8H 3LQMA 3GZKA 3QEUB 2YPLE 3ALXA 2B7DT 3C8HA 3MRFA 3MXVH 4X8JB 1VFAB 3OB8A 2XWTA 4PJCA 2ENSA 4NM4H 4XBGA 4F33B 4KTDL 1XIWC 3UJJL 4JEGB 4MLIA 1I75A 5GHWL 1G7IB 3LHPL 4P46B 5CJQL 3WLBA 5CJ8A 3UYRL 2O5ZH 4MA8H 5EU7E 2DQFB 4GMTL 4YE4L 1NMAL 3WKML 3QIUB 4J6RH 4NRZA 4H0HB 1I4FB 2VZUA 4GAGH 5C08A 3NACL 4KI5F 2D0GA 1KGCE 4YNYB 5DQ9B 5DVNA 1H8OA 4X9IA 5DWUL 1X5KA 4O58H 2FL5A 3TO4C 1UQSA 3ZDZF 1FPTH 4MCZA 3LKNA 4U7KA 3WSQH 3HR5B 5D1XC 3GUTB 3L3DA 3SDDA 1F3DH 3ALPA 5K9OA 3EHBD 4KQ4L 4LVOB 5E5MB 4K3GA 1WFNA 4FQIH 5LKNA 1S5IH 2BRRH 2ICWA 4BYHA 4JRXB 4M61B 3HE7D 3BIKB 3K8MA 4NKDB 3X3FH 4GG8B 1UM5L 4HDIA 4GBXA 4ODXA 3QIUC 1IKNA 3FFDB 4ZAKA 3KNBA 3QUKA 1JGVH 1FYTA 3OXSA 5CD3A 1J8HA 1H5BA 1IGTA 1SEQL 3EYFB 2YC1A 3P30L 4D9LL 3TNNB 2DI7A 2EIEA 3MV8A 4EQ3A 3FB8B 3QZWB 3O11A 3U48A 35C8L 1JGEA 2R8SH 3WKNA 1NC4D 4LSPH 2VZ3A 5CINL 2NXZB 3FFCA 4X83A 5C7XL 5FYKE 2HT4D 5IBUG 1EO8H 4LAJH 1OQXA 3IDJB 4M93C 3I9GH 2EE2A 1YYML 4OTXH 3VWKB 2DTML 3VW3H 4N0UE 2BJML 2ERJB 4DOHB 4Z7NE 5D2NB 3DV6A 5I74B 3MOQA 3T08A 5EOTA 2BOBB 3CFDA 4ZO6A 3JWNC 1EERB 3EUUA 5E00A 1H3XA 3VDAA 4MJ4A 4I3SL 2FWOA 1OAZH 3SKNB 2Y36L 1T7XA 4W68A 4N1EA 3QCVL 4W6YB 2FJFB 2CIIB 2YKLL 3S5LG 4OCXH 4NUGL 4PY7B 4J3TA 1YNLH 1KIQB 2I5YL 1FRGH 5C0AE 5IVNA 3KPSD 4R4FL 5BO1L 5E8EB 5JLZB 1U92A 3MYJB 3MYZA 4WJ5A 2R23B 3WCYA 5FOJA 1T83A 3D39A 3RU8H 1TZIA 5E8DL 4LSQH 2AXGA 5D2LE 1MIEL 3FO2B 1Q94B 5J11B 1VADB 2AEIT 4TPRH 5IG7B 3GMMB 2JCCE 3R8QA 4FQ1H 4FXGB 5DZOA 2NTFA 4WW2F 4QHLA 2FD6L 3O8XA 3REVB 4MZ3A 2DJ4A 3X3GH 4ENED 1P7KA 3ULUD 4K3EH 4K71B 5D72H 3DYPA 4G42B 4ETQA 4DN3H 3Q6GH 3BH8A 5EU5A 4WUUD 5MENA 2F53A 4PREB 3HZYB 3WFCH 2AJSH 3MBEA 5IB2A 2V17L 3ESUF 4DQOH 1RUML 3W0WE 5KOVC 5E08H 4BFIA 2AJVH 5JNYA 4H20L 5IK3B 2GJZA 3VFUB 5BQ7A 3V0AC 4LVOC 4P2QE 1KUMA 4GT7A 3ZDYF 5ESQA 1KJVB 2PO6D 2YD1A 3MX0A 1A6AB 1U8QB 3RWDB 3JWOL 1EEZB 4ZDHA 4S1SL 4NYLA 3SO5A 2ICCA 4R0LA 1MFAL 4J8RB 2Y25A 1YNLL 1TTGA 3V6ZA 1IEHA 1CGVA 1CWVA 1EXUB 1GGIH 2J88L 4NCC2 4UQ2A 1KCUL 1JWUA 4LLAA 4P2CG 4U1HA 2EKSB 4CN6A 1H5BB 5GGVY 4PUBH 1EFQA 1V5JA 4LEOB 3TYFB 1IAMA 3VGHA 3MV9B 4Z7VF 4HDIB 3JTTA 2FB4H 2YPLD 4XPGH 4ZD3H 4K7PX 1N4XH 4YHZL 1P7HL 4BSWA 3CFBB 3CSPA 3JXAA 3UTSE 1MCPL 4FQLH 3JV4B 4D8PA 3IDIB 1KTLA 4XBEL 2NY7L 1MJUH 3IDGB 4WTXA 2VABB 4CKVX 3BN9C 4NJAH 4PJ5B 4A2MA 3WIIL 3ZKMD 4X5XA 4J12A 1J1XH 3H3PH 4ODWB 4F37F 1OGTB 5E2WH 4KV5F 5D7SH 1OW0C 3KPNB 5JTWA 1I7RA 3HPJA 3TM6A 2WWMC 4HZLA 4I2XB 4Z95L 3VFWA 5IP4A 3A6BH 1P7QD 1Q9WA 5IHUL 3BUTA 4ACPA 3AREB 4EN3B 1YPZA 1KJ2B 1Z9MA 1NFKA 3OSKA 3SE8L 2ZUQC 1XCQA 3I3DA 2C4FT 1B0GA 1FFPB 3P4NB 3SKJH 5C0DB 1KNOA 1T4KB 4LCWB 2V9TA 1RUPH 1EEUA 3IGAB 1LK2A 5JHLH 1QNZH 1ZKAA 1LGVA 5AYUL 3K8LA 3VD3A 1D7FA 3QEHB 4PJ9B 3U1SH 4OCLC 1C16B 4UU9A 3ULUL 2O26U 3GMMA 1KJ2L 4PD4K 5E4EC 5JPMA 1P2CA 1GAFH 2BVTA 3P4MA 1P69B 1DFBH 3AREC 3O4LA 4QRPE 4EN3C 5LQBH 4PJ8D 1NDGB 5CMAA 4XHJD 4NZDA 5B38A 4S0SD 4OCYH 1IGFL 5GS0D 2VKWA 2VDOH 2WK2A 3BPLB 4OD1L 1M71A 4Q74A 1JIBA 5CKAA 1B0RA 3TT3L 4PV8A 2DAVA 4O2FA 4JO1H 3T2OA 4EXPX 1GH7A 1A0QH 1KN2L 1I9RH 4HD9A 1U8HB 1FORH 4HUUB 2VDPH 1P5UA 4XCEA 4G8FB 3T4AB 3RZCA 2V7NB 1SY6L 3RY6C 4C83A 4HC1A 3RWDA 3ZTNH 4PGCA 5E03A 4GAJH 2BNRD 2Q1EA 3TIDA 1VACA 5T3ZD 5IFAL 4LK4A 3CJJA 5HHQA 3RKDD 3LEYH 4F9PC 5JNYB 1A02N 5FYLL 2I60H 3I6LE 1I1YA 3HMXL 4K9EH 3ZMRA 5C6WH 4Z7WE 3QXTA 5EBWB 4IRZL 2A74B 3HMXA 2QSCH 4JHAL 1A9BA 5EOCJ 3K4DA 4ODTL 1BVKA 5I9QB 2P8PB 3JTSA 4KAQL 4XNQB 2AEWA 3A6CH 3FFDA 4FQPA 4OGXL 1I85C 5FUOH 2W0LA 2PTTB 1MFBL 1NAKL 1FAKT 5DSCA 5EOCL 4XVSH 1D9KD 4N0RA 2UZIL 3G04B 3WJLC 3L7FB 3QDME 2OJZL 1G9MC 4KKCC 5D5MF 5AYQA 2VDOL 2FX9H 3LN9A 3S3SA 3RFZC 4CAGA 2B2XL 4Q6IB 1M6OB 1I9EA 5BZDB 5T1MA 5EZIH 5JIHA 5I71B 2PW1A 3WUWG 5D1QC 2Q6WB 4OCMC 2FH8A 3NCYP 4BFIB 4XPFH 5DZNA 5HGDA 5INCA 4MA8L 3TO4A 3SGJC 2YXFA 3ARVA 5ESAA 4N8VB 3K4AA 3TN0D 4CW1B 2KZWA 2ICWB 3ZE0E 4GKSA 5KS9E 5ENWA 3QFJA 3ULVC 3T8XA 4PJ9C 3SE9H 3LEXA 5ELIA 3GI9L 3NIDF 3KPRE 3EAKA 2WV3A 1TCRA 2DQHH 1AGBA 2VL4A 5ANMA 5IW6A 4OFKA 3EHBC 1LO4H 3VCLB 1T5WA 1G7LA 5GRJL 4KK5C 4B0MM 4JFHE 5ANME 4UIMA 4QWWD 2C7UB 2FO4A 4D0BB 2YEZB 4KY1H 4PRIB 4IOFD 5HI3D 3BP6B 5T3XE 5GZNC 2HRPL 3H9ZA 4PY8I 3W9EB 4R2GD 4Y4KC 4B50A 4GSDH 4NDMB 4Z77B 3UBXG 4W70A 5DYOB 1CXKA 1B4JL 1A9EB 4AL8L 2OXGA 1SJEA 4JFFD 1CIDA 2MQCA 1IT9H 1TTFA 2NQCA 1P6FA 1U8OB 1LO2L 1RJYA 1CGWA 2OTUA 3D0LB 4KK9D 5GGSB 4NBYB 1EEQA 2OL3B 4I3RL 4ZS7L 2R2BA 3WJJC 1U3JA 1AHWA 2FR4A 3E1F1 1AD0B 1ODAA 5KVFL 2I9LA 3STZA 2D7NA 4P5TA 4PJGB 5D1ZA 5EOTB 1PY9A 1H15A 2YN3A 3OGCA 4P4RA 3EDJA 2YWYA 3OKOB 4Q97A 3NA4A 2D0FA 2FECI 1FO0H 2RHEA 2VYRE 1FL5B 1NCNA 1WBZB 2YPLA 5DA0B 1ZGLM 1O7VA 1UB5B 4NUJA 2NX5E 4I5BA 5FO9B 4LLQA 4I0PB 4APQC 3N50A 3RI5F 3U83A 4C59B 3H7LA 3OPZL 2VLKE 3T0DA 3I84A 5KVDH 2A6IB 2BY1A 4UMGA 5L9DH 4HIIB 5EU6E 3O6ML 3HZVA 5IT2H 3L3GA 3ZE2E 1HEZB 1ETZB 5ILTL 3HUJE 3L7EA 3MLZL 4MDJB 2DQCH 1N8ZA 1TJHH 3ZTJG 5EZJB 4ALAH 3BZEA 1CR9L 2ITCB 5F1IA 1N7ML 2NNAA 1MPAH 1GHFL 3EGSA 3I6KA 1DE4B 5F97E 3D2UB 3IDXL 1T22B 4XCNA 4AL8H 4DK6A 1YMMD 5IFJA 2L4OA 4GLRH 2FD6H 4QCIA 1DQQA 1HZHH 2HFEB 4FQXA 3QJHB 4YZFE 3L7FA 2PN5A 3VWJB 3MRMB 5EZLB 2GJZB 3EYQD 1KSRA 4LPTA 3KAAA 3ARZA 5J12B 1J12A 3CFJA 2HMIC 4QHNA 2C1OB 4UOW0 4X6DB 5E8OA 5H2BA 3UJJH 4U1IB 2AJSL 3JVGC 2R29L 3QFJB 3TC9A 4UBDC 2ZCHL 1Y18A 3BYYA 5EO9B 1D9KB 3UBXA 1NMAH 1XCQB 1S9VA 2IPKB 4XC1L 3O6LL 5ALCL 4FTVB 5BVJA 4PS4H 3B9VA 4XGZB 2GITA 4WEMB 2E3VA 1IC7L 1RHHB 3FN0L 2GJJA 5DS8B 4Y4FA 3VFWB 4GBXC 4GUPB 1UWEH 4JANB 1URLA 4Z9KB 1CTOA 5KVDL 4KKBC 2XG4A 1RIVH 3QUXB 3B43A 5ILTH 3SCMB 1Z9SA 5I66B 4XH2B 4JREC 3UTTA 5EFIA 2AGJH 2WWMD 2R56H 1ES0B 4MJIB 1LE9B 4S2SA 3FMGH 3BIBX 5E5RB 1YEFL 1PQZB 2YD5A 2COQA 4IJ3B 4OZIF 3EO1A 1FCCA 3WEXB 3RA7L 1BBDL 4NRXA 4FQLL 2Y6SC 2ILLA 4NQCE 1YEKL 4PR5A 3TO4D 1R3IH 3PWPB 3QG6B 2IQ9H 2FJHA 3RUGE 4JFQB 2FEDC 2NXZC 1KENL 2DJSA 1U8KB 4JQXC 5C09E 4KQ3H 3TLRA 2Y07H 1T66D 1BOGB 5MI0C 4NNYA 2MPAH 2GY7B 4HC1L 2ADIA 4JFEE 5HBBA 4YHPA 3FRPG 3FT4A 5FO9A 4DTGH 2NPLX 3MLTB 1FZJB 1OOAA 4RGMB 1J1OH 1MF2H 1VACB 4GG6F 2X4TA 3TWCH 3QEHA 4PJ9A 1HE7A 3VGAB 1QHOA 4TUKH 3QULA 4DKFH 1JMZA 4QRTB 4TULH 4U1KA 4IOIA 4QYOB 4TVPE 4MDIB 2C3GA 2H2SD 3T4YB 1CDGA 4IRSC 4KK5D 4OZFB 3VFGH 3HKFA 2AJYH 3VH8G 5KSVB 3TBTB 4O2EA 2VRAA 4XMLH 3BZEB 5MI0B 4X5LA 4XNYL 5HI4C 3TH4T 4QNPE 4NQDA 5EU6D 1U95B 5FHBL 2P8PA 4OLUL 1WWCA 1S5HB 3VXSD 1T21B 5INDA 1SJEB 5T3ZL 4Q6IC 1TPXB 4LKXA 1KIRB 5IHLB 3NCJH 1L7TH 5EG6C 4R8WL 1ITCA 2VUOA 4HV8B 2F19H 1S7SA 1QBML 4POZD 2CR3A 1SJXA 4HXAL 4P23A 1G1CA 4ONFH 4WW2A 3CDCA 2AKRB 3EOTL 1G6RA 2QR0B 4OUOA 2G60H 4HFUL 2VXUL 5F3BB 4RAUB 3V2AR 4QEGA 1CDYA 4PJIE 5GRXG 2YN5A 4KQ3L 5I1CH 1XF1A 5DD5L 2R4SL 1YMMA 5HXMA 1JPTL 4PGEB 3RZCB 1T04B 4HSQA 4P5TC 1BOGA 2HG5B 5J89A 4MAYA 1EAPB 1DBAL 1E4XI 1UXWB 1JHKH 4JLRB 4PLKD 6FABH 1S7WB 2QQNH 4PRPE 2AXJA 5EBWA 1SBBA 2R2EB 4F9PA 2VLRB 4WUKL 4GW4B 3HHRB 5IJKC 4JFYA 4R4FH 2ZUSA 5D7KD 1R3HA 4WI4A 3QIWC 3QULB 1MREL 3K74B 3BWUC 2I26N 2BNQE 1KEGH 2EEDA 2QQLH 4UTBL 1WT5A 2OR9L 1L7IL 5DD6B 5EFIB 5I1IH 4LL9A 2F54E 4RX4A 3ISWA 4TSAL 1FIEA 4PJGF 4P9HC 2UVEA 5CZKA 1HYSC 4OF3A 4RX4D 1LO0L 4M7LL 3D2UA 1TQBC 3F7VB 3VFVA 3F6IA 2AW2A 1NGPL 3FB8A 1OP5H 7FABL 5HYJA 3VFSA 1LEIA 3C2AL 2R0KL 1FNFA 2DYPD 3B8SA 2I24N 5D2NE 4P2QA 3ZKXC 1CD1A 5EULV 5IKCB 4L3ED 4X8JA 3TYGH 5I1DB 2WBJA 4L9DA 4CN1A 1LQSR 1N2RB 3P73A 3QUXD 4XTRC 3KXFB 1MCQA 2IPTH 4M6OH 1QHPA 3QCUH 3QO0B 2X1XR 1T89C 4U3XA 1N26A 2CJUH 2HJKB 1RZGA 3L5HA 1NCTA 1U2CA 2K7QA 3H9HA 5GSRA 3EJZD 4E42B 1KCRL 4KHTL 4OAWB 5BQ7B 1FYTE 3ARTA 4E41B 5TDPA 2CRMA 3FB5A 1T80A 4GUPA 4YNYA 1MCOH 4U1LB 5IHZA 3KYOB 3QG7L 1A1OA 2PKDA 4PJXE 1YEEH 2BY3A 1J05B 4HGWB 4IIQB 4JKWA 1BVLB 3CH1B 5EIQA 1U6AH 3FO0H 5JW3H 1ZHLB 3L9RB 1I1FA 1JNNL 3PWNB 3S36L 5DVMA 1JWUB 5AG9A 3NIFF 4CU7A 3DUHA 4U33A 3SEPA 1DANT 5IMLB 2P8LB 1YN7B 4PTUA 5DR5L 4TSCL 3KPRA 1GRWA 5C0IA 3LB6D 3DUSB 2WIIA 4P5MA 2VXVH 1CLOL 4PGDB 1NL0H 4ZTPL 2EH7H 5TE4L 1SYSA 3ARWA 2X10A 1SY6A 5E5UB 5HYFA 3H6JA 4U6VH 4JFZL 5F1KC 3WFEL 1I1CA 1AO7D 1S7SB 1ZA6A 3PDGA 1TQCC 4MSWA 1ZLUK 3MGOB 2EYRB 4ZUWA 3FKUS 3G08B 4ERSL 1CGTA 3OX8A 4G80A 4G6ML 1DSFL 3QWRA 3A6BL 4PRID 2JK5B 5CJOL 4YDVB 2WSKA 1K5NB 1RZJH 4MQTB 1NBVH 1RURL 4PJGA 2P5ED 4P3DB 4GW4A 5FYJD 4PFEA 1ERNA 3GSWA 3S96A 1PBYA 1B0GB 1FFPA 4MS8C 5HJ3B 1QSVA 1TJGL 5M95B 1ZK9A 4HIIA 1I7UB 2VDNL 2Y72A 5D1XB 5DJ0B 5JXAH 4AQ1B 3HC4H 2XKSA 5F9OL 1C5DB 1CFTA 1IAIL 3FB5B 5IFAH 1MCJA 2HLAA 2F74B 5ALBH 4E9LA 3TVMD 3P4MB 1JHTA 3CD4A 5J13B 2W59A 1EUTA 2NY1B 2VDRH 3BD5A 1MCWM 3QJFB 3LMJH 3U82B 4JM2F 1P5VA 3DX6A 5JHDA 1V3MA 3OKMA 4PJ5E 2AJ3A 2AS5M 1JGEB 3VFNA 4JHAH 1I9JL 4HF5H 4I9WE 5DXWA 4XVJH 5TE7H 1F02I 4OGXH 4UQ3A 2JELL 1X5IA 3CUPB 5DC0A 1CE1H 4XNQA 3IJSA 1EV2E 2NZ9D 1UJTA 1H8SA 1J18A 1EJ6A 5ISZA 1NFIA 4PP1D 3TJHD 4DFHA 4KVNH 1R3JB 4LPVA 4PJDA 4MNGE 5IBTL 2GJ6D 1KFAH 3QIWB 1KJ3H 5CWSA 5CLTA 5TJWK 4W4OA 4PJDE 2V2TA 3MXWH 5I1LB 5GGVL 3ZTNL 1G7MA 3GNMH 2FJGB 4WHYH 1NBVL 4DUWA 4IRJD 5I8KH 4WI8A 4M62L 2UWEB 2H32A 5I17A 5D7LE 3CVIH 4JCMA 3RL2A 3EYVA 1BX2B 3QH3A 5FCUL 3BGMB 1K4DB 2OBGA 5FDYA 1ND0B 3ARFC 2BSSA 1XEDA 3PG2A 2O93L 4HS8H 4LU5L 2D2OA 4NNYB 1A4KA 5DJ0A 3WO3B 2DQUH 1A6UH 2H2PC 3KPPB 4LSDA 4GBXD 3CXHK 4RGNC 3EOYG 5BS0B 2XZZA 4K8RD 2CK0L 3V7AG 2DLIA 5CD3B 3ARGB 3WIFB 3VXUE 1SQ2N 4LSRL 3L5JA 5LGJB 2VH5L 3S37L 1T66C 1RFDH 4NQCD 4X5WA 5DFVC 1INDL 3IU3A 3MRNA 4O9HH 5L0QB 2WINB 5IIEA 3ZLQC 3P9WB 4Q9CA 1KCSH 1EEYB 3MGOA 4J3XA 5GS1C 4YQXL 2UZYB 4XX1G 4N0FB 2AJ3B 4Z7UF 3WS6C 3GMNA 3F58L 4ODBD 2VB5A 3G5ZA 2R1WB 4Y8AA 3BZ4B 4RMRA 1BBDH 3IDGA 3MUZ1 4L9LA 2IQ9L 2QJDA 4I13B 3ARDB 1ZVYA 4OGAC 4K7PY 1F4HA 4YDJA 3FOMB 1RUAL 1LO2H 3Q5OA 4WEBL 3RAJL 1UT9A 1XZ0A 3WDHA 4OZFH 2DIJA 5LBSL 4PRDA 4TVPD 1ZHKB 1EGJA 1T5XB 4GKSB 1WTGT 3N85L 3T04D 4N8CL 5F96L 3LZFH 4CW1A 5IF0B 3WFHB 2JE8A 3ZO0A 3CX5K 1SM3H 1KJ2A 5EO1B 3MOAL 2Z35A 4J8RA 2CDEA 1ZOXA 1ZTXL 4ZFZB 4QRTA 3AVEA 2XFXA 3FRPA 4LIQE 4XH2A 4LU5H 2J8UE 2C4FU 4N0UB 5GRWA 1HWHB 4PB9L 5BJTA 2YEZA 4PRIA 2EXYC 1R3LB 2W07A 3RY6A 3QNYA 4UIMB 4GKNA 1NCCH 1VADA 1QLEL 2AJYL 4BSVA 4A6YH 5D1QB 3H7BB 3WV0A 3KPQA 3TT1H 2V2WA 1MCFA 4AT6A 3C08L 1INDH 4NO3A 1F3JA 4OGAD 4QRPD 1ZEAH 3T2NL 2OK0H 2W0FB 4YXHL 3B8YA 3GSNB 4JREB 3STLA 4Z7VA 1BM3L 1RJYB 3D0LA 5TGBA 1QSFD 1HHKA 2H8PB 3C5SA 5MEND 4YDVA 3TH2T 1R6VA 3UAJC 1ZT7B 1A9EA 4V1DB 2NZIA 4NM4L 4HH9B 4HJ0D 2P47B 4JDTH 2DMBA 3MJGX 2XV6B 3MRQA 2V5MA 4XVTH 2HFEA 5DGRA 2ZWLT 5LXGH 1KPUB 2HLFD 4YC2B 5SWSA 1YJDC 3LN4B 3OL2A 5C70A 1M7DA 3VD4A 5JPNA 1P1ZB 4EDWL 1YYMH 5DJDB 2DTMH 1A7QH 5DQ9A 4MGXA 3MUHL 3V0WL 1LK2B 1KTDA 4QTHB 3OPZH 5EU4B 4G8GB 2KKQA 2HVJB 4NQDB 3BKCH 4GH7B 1PKQA 3WNNA 5IT2L 1BAFH 2X4NA 1D9KA 3UBXB 3TBYA 3INUH 1JYVA 4PJAF 4ZUSB 5SX4I 3KPPA 3N1FC 1EFXB 2YR3A 4KKAD 1UB6B 3W0WB 1Q72L 3GRWA 1RJZB 5IFHL 4UAOB 4G6JL 4NZTL 2D3VA 2NYYD 1JYWA 2FYYB 1PVHA 2YA2A 4H88L 4WV1B 1YZZA 5DYOA 4K23L 4Z0XB 4PRPA 3BPLC 1E4KC 5CJXA 4XCCH 4AT6B 3L1OL 4XAKD 3QXWA 4X7SL 3QUZB 3M17A 1HZHL 5E94A 3VXUA 3KPSB 3MV7A 4YHLL 1N3NB 2LE9A 4P59L 4ZOBA 1YEFH 3G04A 1KC5H 3X14B 2FGZA 1U8HA 1T1XA 3R1GH 5DEFA 3QUYA 1RD6A 5FF6A 2VWEE 1HH9B 2P8MA 1AIFA 1NAMB 1TQBB 4U49A 1A7NL 3SE4A 3MLRH 3MV9E 3VI3E 2ORBL 5C2UB 1NEZA 3MLXH 3VI3F 4YK4B 3GKWL 3S5LA 1JNHB 2IPTL 3MRCB 3V4PL 2BXYA 2IANB 4MD4B 3O3DB 3NCYS 3FZUD 4QHUA 1T5XA 1X9QA 2ZCLL 4DTGL 3T0EB 5J0BA 2R2CA 2Q7YB 1ORSB 3DROA 1IM9A 3WIHH 4HPOH 1J1OL 4J4PD 1K5NA 5FYKL 2IBZY 1C16A 3AMKA 4G9DB 4JFPB 1RK0A 1NGXA 2IBGA 1D5XB 4KTEL 4L1DA 1MVUA 3MYJA 1KPVB 3SDDD 4HS6B 2YPVH 3Q5YA 3QPXL 3P11H 3CZFB 2CK2A 3HA0A 5HGBA 1OAKH 3KPMB 4RGMC 4MD0A 5DMKB 2RBLA 4OLEA 3OXRB 4JFXA 2IPUK 4C54A 4OLUH 1GC1L 2H9GB 1LEGA 3EZ8A 4HKZB 1EUUA 4TUJA 2F54B 4UILH 4AG4L 3RIFK 4UDTA 5CEZD 1RZFH 5DFWH 1GGCH 1P7KB 5F6IC 3MJ6A 5D70H 3QDJB 1SJVA 3G5XB 3QDHA 3EJYC 1ZVSB 5D72L 1DQMH 1VGEL 5KS9A 3O9WA 2PYFA 5F7UA 4JY6A 2OZ4A 3QQNA 1M7IB 4OQTA 3V6OE 5ID1A 2ORBH 1A1OB 1BZ7A 1YNTB 2EH8L 5BMFH 3Q3GB 1INEL 4KHXH 1Z0MA 3VFPB 1NMCC 3HG1D 5F9WB 4F15B 2CQVA 2E9IA 4NIKB 3P40A 3EDKA 4GAGL 4M3KB 4LQFL 3BUYA 3TBSB 4QRSA 2YBRA 3L3KB 2D0HA 4MMZC 1I9IH 1KXVC 5D7JA 3KPOA 1X6NA 3LKRB 5DJYB 5I2IA 1UB6A 5ABDE 3Q1SH 3O6FD 1XF2A 4HUVB 1CGSL 3GO1L 1FYTB 5JR1H 4YX2L 1FG2A 2MWCA 2NW3A 1BQLH 4W6XB 3TPUA 4MAYC 2JCCB 4N8PA 4LAQH 2FEEI 4OLYH 4HWBA 1ONQB 3PDOB 2ADFL 5JHLL 1NBZB 3GBLA 1QBMH 3QUYB 3OTTA 4LRIA 5FF6B 1AGEA 3Q6FA 1PG7W 1AD9A 5E99L 2DMCA 4HEME 3RIAF 2VITB 1T0PB 4QY8B 3DX9B 4XNUL 1KXQE 2ATKB 4F57H 5IB2B 1GAFL 2VZSA 1KTLB 3PWJA 1RV6X 2VSDA 4HG4K 4CADB 2XN9B 3UZEA 5FO7B 3D5OF 2A6DA 4PJBB 2NW2B 1QYGH 4S1RL 5D7LA 3PP4H 4M8QA 2VIRB 1W72A 1BHGA 1JGUL 4LLYA 3L95A 3RZCD 3EBAA 4LSTL 2IGFL 3X13A 2QKIB 2BP3A 3HB3C 3QNXA 4WUUA 4RMVA 4HK3N 1UXWA 4JLRA 1S7XB 5GQBA 3A67H 2RJMA 1RIHL 1Q9LA 2GW5A 4UNUA 1JI2A 1I9RL 5KBNC 1F58L 1KV3A 1RU9L 3LS5H 3S35H 1RJCA 4H8WC 4JGUA 2P46B 1NCDH 5E1AA 5FCUH 5SWZE 2VLJB 3AXLA 1L6XA 3BP5B 3LV3B 1TZIB 1DBJH 2Q76B 4IMKA 4PRPD 1QKZH 4YBLC 2NCMA 3BPOB 3JUZA 3WNKA 3E3QE 4R7NA 4DGVH 3HI1A 5E56A 2O61B 2DDQH 5JO5B 2CDEB 2BXZA 3MRDB 3BKJL 3MLSH 1KIRA 5F7FA 4IRZH 3T77A 1CICD 1T04A 4NFBA 1CD1B 4TSCH 3MCLH 2KPNA 3SDCA 1UACL 2VXTL 4P48A 1CDIA 4LARH 5I1HL 2DBLL 1OAYL 4I77L 1Q9KB 2W9LA 4P2RD 4WO4B 3ULUF 2UZIH 3ULUE 3QDGA 4ISVB 3TBSA 1NPUA 1C12A 4I3GA 3CFKA 5IV2B 4PLJD 1OWWA 5DD6A