The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
38
|
sequence length |
226
|
structure length |
206
|
Chain Sequence |
SKEYGVTIGESRIIYPLDAAGVMVSVKNTQDYPVLIQSRIYDENKEPFVVTPPLFRLDAKQQNSLRIAQAGGVFPRDKESLKWLCVKGIPPKDPDKDVGVFVQFAINNCIKLLVRPNELKGTPIQFAENLSWKVDGGKLIAENPSPFYMNIGELTFGGKSIPSHYIPPKSTWAFDLPKGLAGARNVSWRIINDQGGLDRLYSKNVT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Chaperone, structural protein
|
source organism |
Yersinia pestis
|
publication title |
Structure and Biogenesis of the Capsular F1 Antigen from Yersinia pestis. Preserved Folding Energy Drives Fiber Formation
pubmed doi rcsb |
molecule keywords |
Chaperone protein Caf1M
|
total genus |
38
|
structure length |
206
|
sequence length |
226
|
ec nomenclature | |
pdb deposition date | 2003-04-28 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00345 | PapD_N | Pili and flagellar-assembly chaperone, PapD N-terminal domain |
A | PF02753 | PapD_C | Pili assembly chaperone PapD, C-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins | ||
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins |