1P5UA

X-ray structure of the ternary caf1m:caf1:caf1 chaperone:subunit:subunit complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
226
structure length
206
Chain Sequence
SKEYGVTIGESRIIYPLDAAGVMVSVKNTQDYPVLIQSRIYDENKEPFVVTPPLFRLDAKQQNSLRIAQAGGVFPRDKESLKWLCVKGIPPKDPDKDVGVFVQFAINNCIKLLVRPNELKGTPIQFAENLSWKVDGGKLIAENPSPFYMNIGELTFGGKSIPSHYIPPKSTWAFDLPKGLAGARNVSWRIINDQGGLDRLYSKNVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Biogenesis of the Capsular F1 Antigen from Yersinia pestis. Preserved Folding Energy Drives Fiber Formation
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Chaperone, structural protein
molecule keywords Chaperone protein Caf1M
total genus 38
structure length 206
sequence length 226
ec nomenclature
pdb deposition date 2003-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p5uA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p5uA02
4PD4J 2ZSVB 5CGMA 3VFWB 2QBWA 4KI5C 3KXFE 3BMVA 3WIHA 4LIQH 4BZ2H 1XH3A 5IBLD 2AERT 3HZMB 5D6CA 4ZUTA 1IKFL 3H3PH 1LHZA 2HT4C 3U7AA 1EERB 4P5MA 3IXTA 1RZJL 4ZUTB 4KJYB 2FO1A 2OS7A 4NQSA 3WFDL 5EZLA 4P48A 1ZANH 4WNQB 4ERSH 2RB8A 4IMKC 43C9A 1FN4B 1FRGH 3RPIB 2WNGA 1DCLA 3OKDB 3BEWB 3MRNB 3WV0A 3ZLQC 1BZ9A 4G42B 2V2WB 1OCWL 2X6MA 4KK8D 3N0PB 4PD4K 1CFNB 3QYCA 5DJYA 5CFHA 5FECA 4NGHH 5D7JB 3JZ7A 3AS3A 5E99L 3UTQB 1W72A 5EORH 3RWFB 2WBWB 2J4WL 1MRFL 4NJAL 1OP9A 2I60H 3RL1B 5TPWH 4F7EA 1PD6A 2FX9L 4XI5D 3T0WA 4LHJB 4UU9A 5HGHA 1QZ1A 4QLRA 2NW3A 3G6AA 4ZNCD 4D3CL 1H5BC 2UVEA 1HSAA 4WW1A 3PG2A 4XBEH 2QHRH 5DYOA 5IEHB 2VDLL 3QEGH 4RWYH 5K9KA 1GPOH 4FQQB 2WAHA 2RFXA 3L1OH 4LOUD 4KRPB 5EN2A 4JDZB 1GGUA 3PWJB 2HFFB 4WFEE 4I5BB 2AK4B 4G8GE 4G7VL 3AREA 1Z3GL 3HE7A 4PRBB 2EICA 4TUOB 2IAMA 3LEXA 3MMEB 4K3EH 3L95A 1J1OH 1JGUH 1CFTA 4G9DB 4FFVC 3TVMD 2EO1A 3WN5A 4GG8A 2X4UA 4YXHL 5DMIL 3C2SA 5IFAL 1MLCA 3QNXA 1FP5A 1FGNH 1HSBA 1X5YA 3GJFB 4JFQB 2MQCA 3MRLA 4E41E 3TO4A 2R15A 1FCGA 3D0VA 4Q0XL 1ZGLP 3GHEH 5L2KD 1CVSC 3BP7A 1I1AB 4DAGL 5J1AB 4LCCA 5T1DL 2W60A 2NZ9C 4BSVB 4FFWC 1EFXB 1F58L 2NY4C 5DJ8B 4JFOB 3I6LD 4I0PD 4OLUH 2BX5A 2IBBA 2X70A 3NPZB 4HS3A 3TV3L 4ODUB 2E7MA 1U91A 5TE4H 2ZSWA 4G8GA 2YPLB 5F89A 3O81A 3UTSB 1CG9A 5D2NC 4ZSOE 3PWNB 3IKKA 4FFWD 4K71B 2BOBA 1BAFH 3HAEB 4QHMA 3W9DA 4M48L 3WS3A 4MAUL 5GHWH 2EYRA 2UUDK 4KROD 3ZZ1A 4MJ6B 5C08E 3CFDA 5E6ZA 4L8CB 5DWUH 1ZMYA 3IF1A 5JPMA 5EZOH 2VLRB 1P9MC 3VG0H 3QUXC 3JV0A 3EDFA 1NEUA 1FAKT 1Q8MA 3LQAL 1FYTB 1BWWA 1L7IL 2ZWLT 4NJ9L 1U8NA 4ONHB 5JIPA 2JIXD 1T1YB 1ZLWK 3T77A 3UCRA 2NY0B 3HE7C 4Z0BH 4JY5H 2VLRD 4HS6A 4RGOL 3GSUB 3V0VB 5L9DH 3T1FB 2RIKA 5DUBB 4DKEH 4PJXE 3QHTC 5EIQA 3WJLA 1HKLH 4P5KA 4XNMA 2B5IB 4LMQE 2R2CA 5EU6B 5FA4B 4FTVA 1GSMA 1A4JA 4WUUB 1ZSDA 3UAJC 3BT2H 3PL6B 3STBA 3GSXB 4HXBL 1HSAB 4WW1B 4R2GB 5L6YL 3OL2A 2PYEB 2YUXA 4DGIH 3UDWC 1I3RB 1IGCL 1AHWC 4JREB 2FX8L 2GJ6E 3DARA 5HHPA 1F00I 3EOBB 2GJZB 3DRQA 3PE9A 4PJ9D 4OCYH 4FFYL 2FO4A 3AB0B 1JGDA 4F37K 5CBAA 5ICYA 3KVQA 5A2KH 3BZ4A 5KG9B 4LSSL 3BD4A 3QO1A 2BP3A 2VR4A 4H88L 5DJYB 4IMKA 1QFWH 4ZXBC 4MJIA 4NC0B 1YEJL 2ZCHL 3BEVB 4E5XA 3MXVL 2O61A 3TVMA 1CGSH 1CQKA 3P4LA 4ZDHA 1S7UB 5C0RH 1KB9K 2DL9A 4JM4L 1MI5B 1AP2B 3SE9L 4DUXA 4HPYL 43C9B 1HCVA 3KPSA 4WY7L 5HDOA 2Z92A 1WIOA 5ETUA 25C8H 4TNVK 5IBUB 4YHKH 3QUMH 3VFRB 5GISL 3S4SG 1WFNA 3MLRH 1MUJA 2VLKA 1AGBA 1I4FA 5DC9B 1KGCE 4JKPH 4DAGH 4HWNA 3MFGB 1AGBB 3KPMA 4JKWA 1C5DA 1DL7H 4FNLL 4JQIH 2VXTL 2IQAB 1C8PA 5D5MB 5IF0B 1K8IB 1JPTL 2XWTA 3FO0H 1FC1A 1NGPH 5IIEB 1G6RB 3GFUA 4YJZL 1AXTL 5SV4A 5DJXA 3GMLA 4QRPB 3VH8B 4CU6A 2DYPD 4ORGA 1A47A 3GB7A 3S7GA 2NXZC 4OAWA 3GJFK 3BPCB 3SDAA 3FB7A 4WV1B 5E00A 5I18H 4KDTC 3S34L 1OTTD 4LVEA 4MJIB 3RZWA 3VFVA 1T0PB 3C9NB 3MX0A 1YY9C 1KN4L 1DN0B 5SWZD 1DUYA 1N7ML 2ITDA 4HH9A 1A7RL 3NIFE 1OAYL 5C08B 4MA1B 5D7IF 2JKXA 3MA9H 5DFVC 2DYPA 1T89A 4BFIA 1P4BH 4KHTL 5GRJL 1E28A 2B0SL 2HA1A 4ISVB 4N0CC 1RU9L 3T3PE 1FH5L 1A9EB 1BQLH 4XB8A 1KN2L 3DX7A 3TN0D 4R9HA 1OGTB 5JW5A 4O4YL 5DMKA 4QHKJ 2B1HL 4KUCF 5JOFB 1QBLL 3REVB 1NH6A 2GW5A 1WBXB 3FB6A 1SEBB 1NANH 4RIRA 1MCSA 5E5MA 4PJ7F 3BDBA 4PJEE 3FQWB 3SQOL 1S9WB 4UT9L 5GIRB 4HIHA 1M7DA 4AIXA 4PJGB 2P1YA 3PDOB 2VXQH 5ECJE 4E41B 4OGAD 2FATL 3L3OA 2VR5A 1NAML 1D5IL 1A6WL 1KPVB 4NNXB 5FECB 5K9JL 2YPKA 4KJYA 3P4MA 4U1GB 2HKFH 4IOIA 4OV6F 2DQIH 1G7QA 4MJ6A 4P2YA 3ZTJH 1UFUA 1KLUB 4OFYA 2BNRA 5D7IA 5FGCE 4CMMB 1BOYA 4R4FL 2ZCKL 2ZCKH 5CSGA 4FZEL 1OCWH 2UUDH 1YMME 2VDRH 1FN4A 2XZZA 4FQHA 3Q5YA 1N2RA 4XCYA 3ES6A 1A3RL 2E6JA 3SGEH 4YAQA 3R0MA 4HUNB 1U91B 4LAQL 1F13A 1U8OB 4E42A 4Z8FL 2Z35A 5DURD 2I60L 4G5ZL 1XH3B 2I9TA 5E8DH 1UWXK 3BKML 4PJEA 1NQBA 5CSZA 1D5ZB 3S5LA 4QXUH 4Y1AE 1FLRH 32C2B 1QSEA 4MHHI 1PQZB 3FTGB 2X89D 2VNCA 4LCUA 3Q0HA 3MZGB 1U3ZA 4MJ2A 5E2TL 3MRFA 2F53E 2IMNA 4K3DH 3LKRB 5F88A 5HHOE 3WDJA 1D5XB 4MNHB 1KELH 1ZGLM 1D5BB 5CEZD 3CU1A 4JM4H 4NQTA 1J12A 3E6FA 2ICCA 4FQLL 4RMTA 1NBVH 4R97C 5LXGH 5F9OL 5C09B 3S96B 2DM4A 2W59A 4ISVA 1XGUB 3NCCB 3NFSH 4TUOA 5JIIA 3SGKA 4L1HA 4OCXL 5CGTA 1K4DA 2YC1A 4KMTH 2IH1B 3IFOB 1DQDL 3U0PA 1NEZB 5I8KL 2GK0B 2F54D 4JKPL 1ED3A 1OQOA 1IAMA 2IH1A 4IOSD 2NX5D 4M61B 3MLYL 4MNGB 4EI6B 1KLFA 1MCQA 5C7XL 4OD2B 1KTDB 2NW2A 1Y18A 5GS0H 2XKNB 3DOSA 2EXYD 3JWOH 3EFFB 4HWEH 4Z78A 2OR8A 1BQSA 4HS6B 3V0VA 2IMMA 3O6MH 1YN6B 2B1AL 2A6DB 5T33H 3CK0H 3KPNB 3MRDB 2BXZA 4L8DA 2CIIB 4N8CL 4L9LB 1DVFB 4EI5C 4APQB 4XMKL 2B4CL 1IKFH 3H3PL 2BSED 5E1AA 2JE8A 2YBRB 3QXAB 2Y36H 4FQ1L 1U95B 3A6BL 5DK3A 3QUYB 4K8RH 4FTVE 4LRNH 3SO3C 1KC5H 4MLIA 3W2DL 3WL9A 4PLOB 4IRSB 3QEQD 5I1DB 35C8L 2YD4A 3VFTB 2WP3O 1O7VA 4Z7QE 1S5IH 4ZXBB 1I1CA 3QIBC 2V7NA 1I9IL 1OGAD 4PGBB 5FUZL 1J0JA 5E8OB 1FFPB 4FQ2L 5BQ7A 1NL0L 4O58L 1KLUA 3I3EA 1IE5A 4LLYB 3OB0H 4CVZA 1SVCP 1E4KA 2GITB 3AB0C 4LLAA 4JFDA 1OM3L 4LCWE 2R2HB 4R0LC 3J7HA 4O5LL 2DJUA 5TFSH 2AJYH 3FKUS 3G5XA 3W0WE 2M8XA 3SKMA 3IGAA 4OZIB 3FO1B 4WWKD 5HYQB 4AH2B 4CVWA 4HGWA 3SDXF 5DD1H 3VI4E 4LL9A 1WF5A 1CD0A 4GKOA 3CLEL 2DKUA 4YDJA 5ESAB 2YS4A 2A6JB 2YMXL 4QRPD 2ILLA 5JDSA 3RNQB 4GSDH 3EYVB 4PTTA 4ZSOA 5FCSH 1A7NL 1KJ3L 2J4WH 1UENA 2CMRH 5KS9F 1DLFL 4ONOA 2CRZA 4D0DA 1F3DJ 1BBJA 5CGYD 1WGOA 1CTNA 1I3RA 3FQWA 4R4BB 3O9WD 3L95B 1Q1JH 3WIHL 4RIRB 3UX9B 3JUZA 3U36B 4JFZH 5HY9B 5E8PB 5FM8A 2H26B 4NHCL 4ZAKB 3ABZA 1X4XA 3CZJA 2GK0A 4JVWA 5E6IB 4U3XA 2X4OA 3P4OA 4RDQF 1UT9A 2R56L 1X6NA 2YKLL 5MI0C 3GGWA 2W9DH 2BDNH 4KXZH 1CFVL 2BOCA 1J1OL 1JGUL 3FQRB 1TZHA 2YPVL 1BBJB 3BWUC 2HJFB 5DDHA 3ARYA 4WY7H 1G9MH 1MFAL 4OLUL 4LGRB 4WHDA 5KANG 4YHMH 2HJKA 4NPYA 2CLRA 2VISA 3R4DA 4M7LH 5C6PB 4NWUH 5C08A 4PGJA 6FABL 3CVHH 1OTSC 2FYYA 4P2QA 3BDYH 1S78C 4M7KL 5E4IA 1BM3L 3OMZA 4GG6A 4IS6B 5EOCL 1DBBH 4G80A 2X09A 2EYSA 2XFXA 4JR9L 5DJ6B 3BXNA 3LEYL 2VLJB 4K94C 2NY0C 1UA6H 1LNUA 1DJSA 3W11D 3K4AA 5DD3L 5KSAB 4BZYA 4PJEB 5DD6A 4NKOA 1H3WM 4CKVX 3GMQB 3O2DL 4L3EE 3SO3B 4NKIH 1WZMA 4D9RE 4P5MB 5E2VL 1LDPL 4ODUA 2XNAB 3K46A 5EUOE 1QRNE 1T04A 3QULB 3MV01 3MRGB 3DROA 1MI5A 2NY7L 1CT8A 4BUHA 4IRZL 3SGDI 3T0AA 1JK8B 2WZPD 3MRGA 4H20H 4WVRA 4X4YB 4NN7C 1QBLH 2E9WA 3W9EA 3CSYB 1FZOA 1VFAB 4K2UL 4BK4A 5I17A 5IESH 2MOVA 4HIJB 4KK6C 4KRPC 5EOTB 3I75B 3F58L 3GMQA 4G6AD 3ULUF 4YO0A 1T6WA 1G0YR 2VRAA 4NKMA 2BSSA 3QXWA 4J8RA 5I1AB 4AT6A 3QWRA 2XA3A 5KW9L 2VIRB 3H9SA 3RUGA 5HHPB 3EFDL 1S8DA 2IADA 3L5IA 4MAYC 4PJ8B 2I9LB 2IGFH 4RGNB 1F8TH 1OLLA 4NO5B 5CWSA 5KAQG 5HYSG 1YMMB 3OHXA 5E2UL 5B3JE 3R1GL 5EIIA 5LBSH 4I1NB 1OGTA 3NH7L 3OF6D 1U8JB 1UYWL 4NM4H 2NY3D 1U93A 1UADC 2EIDA 4NKDB 1NFDE 5TF1H 1A7OH 1P1ZB 2QSCH 2R0ZL 3C09C 3MJ6A 1EDQA 1MIML 4BYHA 4ZFFB 2NY2C 2DLHA 3FONA 1KXVC 3PQYE 1IC5H 4KROC 2V5YA 4PY7A 2Q8BH 3RVXC 2VDML 4QNPE 2FDBP 2WINB 3N85L 1GGYA 1RUMH 1IFHL 3S88H 1RJYA 2YSSB 3NH7H 4RBPH 1KEGL 3B3IB 2FBJH 4C56D 4TNVF 1GGBH 5DJAB 3LS4H 3KR3L 5IWLA 5ICXB 4Q0XH 4IRJA 5D7SL 5FOBA 3D2UB 1CFSA 4YHZH 5EC2A 5B8CC 5DEZA 3FTGA 4HH8A 2YOCA 4IDJL 5CJXC 4YR6B 4PLNC 1CGYA 1SBSH 1OTSD 2LV4A 4PTUA 2ARJB 5JLZB 4S10A 3QDME 3G5XB 2CR3A 3PGFL 4IBLT 3BKMH 2H2PC 3L3JA 3PL6D 1PY4A 1MCJA 3C60B 2IANA 4UNTA 3MUY1 3TO4C 3U48A 2ZSWB 2SEBB 2NY5L 4R4NC 2OL3A 3OKKA 1MCWM 1A3LH 1ERNA 1RUKL 3QISA 5J9PB 2HLFC 3HZMA 1FFPA 5BQ7B 4R26L 1J1PL 4N0UA 2V2TA 2YPLE 3C5SA 1IGMH 4YDKL 4ZS7L 1QRNB 1GOGA 1M05B 1TITA 1I1YB 1UVQB 2EC9T 3FB8A 1T5WB 4ZYKB 3DXAA 5KVEL 1FORL 5KSUA 4CNIB 4MXWL 4ETQA 4UB0L 5DLML 4JRXD 4JQXA 5DK0A 4FFVD 4MQXC 3KAAA 5DC0A 3PP4H 4DN3H 1C08A 4KDVA 4O9HL 1OAQH 1AP2A 1U2HA 2PYFB 2XN9E 3T0EB 3OXRA 4JM2A 2VSCA 1WITA 4Z18A 2OSLB 1ZWIA 1FNGA 2FJFA 4HLJA 3MNZB 2YD6A 1IM9B 3P9LB 4P2OB 5FXCH 1KB9J 2EH7H 1YUHA 3L3IA 2ESVB 4NRZA 1EHNA 5FYLE 1G0DA 2FH8A 3LEYH 4F7TA 3HNVH 2J8UA 5GJSH 4MNGA 3CDCA 4EBQL 1A7PL 1DQQB 3REVA 4KAQH 4PJDF 4TRPH 2D7QA 4LEXH 4U4BA 4WDIB 4MS8C 4XNXL 5DT1L 4MDIB 2AJ3A 3UPRA 1Q0YL 1BD2D 1ZLVK 3ULUH 5FHBL 4ZS6C 2CKBB 1JGLL 1I9IH 1P1ZA 2B4CC 5C0AA 5IG7A 1S7SB 3CFKA 1LDSA 3PGCA 2WV3A 1KCSH 2J1KA 1O5DT 1NCBH 4PREA 1U8JA 1X5XA 3O11A 1T0MA 5EORL 1QSZA 3W2DH 1J0ZA 1YMMA 1G7IB 1K4DB 1VEOA 4XH2A 4F7TB 3VD4A 3WHE1 2X1WL 2P7TB 3DMMB 4NUJA 3KPLA 3CDFA 5EWIL 1FFOB 5CINH 3RZCC 1EMTL 4IIQC 4C83B 5B3NA 1YNKH 1JNLH 4XCFH 2BNQE 1RZ7H 4LF3B 5BV7C 4HXBH 4K7PL 4NZUL 4ORGB 4OD3H 5GGVY 2FHFA 4CDHA 4F9PA 5KAQF 5IW1B 4JG0L 4MD5B 2BZDA 1F6LL 3DVGB 2G2RA 4QTIL 5IQ9B 3P30L 1ETZB 1U8OA 4E42B 1FO0B 3QDJB 3MOBH 3WE6A 2H8PB 5GGTH 5F7FA 2XACC 3RZCB 3ZKXB 3TYFA 5SWZE 3O4LE 5F7WC 4PGDB 4M5ZL 1YEEL 4X5XB 1VCAA 2VLJE 4RSVA 4G8GB 4GW1A 5H94A 4FQPA 3WIIL 2OBGA 4RGNE 1KELL 2H3NB 3MV9A 4PJ5A 3HI1A 1MEXH 5MENA 1MEXL 2YPVH 4PJBB 1WBZA 4JFFE 1N5YL 3CFEB 4QYOA 1KCUL 3HB3D 4JREC 3WE6B 4N1CA 3QUZA 1AHWB 4LCCB 4I8DA 1J1PH 3BEVA 3WHE0 1S7QA 3QCVH 3CZFB 1FFOA 3VD3A 3NAAH 4FXKA 4JEGB 3JWDH 2FEEI 2CRMA 3GJFA 1P84K 5DR5H 4TYUA 4OCWH 4YEFA 2EDQA 4FMKA 1ZHLA 1FL5A 2NY5C 4LGPB 1EVUA 2JIXA 3IS1X 1NKOA 1NSNH 4PRHB 3UP1A 2R0WL 1XF2A 3CH8A 1D9KA 3Q3GB 1JRHL 1A02N 5CLWA 4I5BA 2X4TB 4JPIA 4FFZH 3U0PB 5HPOA 1JUFA 2P45B 4LQFL 3MOQA 5T1KB 1RD6A 2BCKB 3QUXB 4K8RL 4HH9B 3C60D 3CFKB 2FRGP 2DQDH 2EKSA 4PJ8A 2GYSA 5T3ZL 3CMGA 1YNTA 3REWB 4JPKH 4ONGH 2DIJA 1K8DB 1PKQE 3CMOH 3GNMH 1S9VB 5A3IC 1U41A 1SVZA 1BJ8A 3DHMA 3HPLA 3BO8B 5IVZA 4Y4FC 2Z91B 3C60C 5CP7A 3SE3A 4C56B 5I1GL 5E99H 1KYOJ 5HGDA 1MHEA 1T2XA 5CS7A 4MYWB 3TF7C 1FE8H 2YUWA 3NCBB 4WGVB 4MDJA 3G5YA 5HI3D 3DXAB 5HD8D 2B1HH 3CD4A 3QDAA 4PJAE 5HHXL 4ODTH 4F15C 4QRRE 3TO4D 5JIKA 4O2FA 4KZDH 4NRYA 4HBQA 1NGQH 1HIML 3DROB 2XA8H 1S7TA 1CG9B 2VLKD 3PGDB 2BVYA 5EZIL 4S1DD 4QT5A 4GW1B 3PGDA 1WCQA 1YY8B 2IQAA 2AJVH 3H9ZA 3MZTA 4YX2H 2MPAH 5HTSA 3UJJL 2DMBA 1B0RA 2Y6SD 3MRQB 1LEGA 5CP3H 3TCXA 2V5MA 3O6LH 1FV1A 2IC2A 4ZO6A 1OF2A 5FYLH 2EEBA 4Y2DA 4GAGH 2X40A 2VDLH 4OI8A 1H5BA 4XC3H 3PWLA 1RUML 3S88L 5IFJA 4XWGL 5AG8A 4N90D 5FYKL 4Y5XC 4GQPH 1OPGH 3L7EB 3NIGE 3HPLB 3FRUB 4WENB 5IVOA 4L8DB 4S1SL 4DVRL 3MNWB 2E8YA 4E5XB 3MO1B 5DDHB 1CFSB 1MRFH 3OZ9H 5EC2B 5M7QA 1X7QA 3H7LA 1JYVA 5HHMD 1TZGH 2Q6WA 1II4E 4PV8B 4UDTB 4G8EA 3BKYH 3GBLA 3IKCA 3NZ8A 1C12A 3OKLA 4PYGA 3V7MA 4Z95L 3IDNB 4LVOB 3CVHL 3KXFB 1U92A 1DTUA 2BRRH 4WO4B 3DUUA 2RCSH 2VQUA 3RY4A 1F90L 1A9BB 3RL2A 2JJWA 4N0FB 1KB5H 5D4QA 1FBIL 4AIOA 3QCTH 2NX5A 1XF2B 1KEML 3MRKA 5F7EH 4OLYH 1N64H 5T5NG 5DK2B 3RWDA 4HPYH 3P11L 4F9LA 4D2NA 1EJ6A 3G04B 3U9PL 1A4JB 1YPZF 2HT2D 2N7BA 4JZJA 2VITA 3CFIC 3B9EA 4LCWD 5IFAH 1G7MB 3CFJA 4YDLB 4KI1A 4KQ4H 3BIKA 3VE0A 4YHOL 1SJHA 2DTML 2BK8A 3WHXA 3G5VB 5EB9A 2YRLA 1JPFA 5JTWA 1ZWIB 3MGOA 5FEBA 5LJYH 2VZUA 2KUTA 1WBYA 4GRMB 1CT8B 2DMCA 4X0KA 4QRPE 4XPBH 4O2CA 2FD6L 2XN9B 3IDMB 5H35A 4P2RB 4JFDB 4KGLA 1UWXH 1FPTH 1MCOL 2UV3A 3T2NH 2EDWA 3GMNA 1ACYH 4PGDA 3KYMA 3SHSA 4L8SB 1QSVA 1D6VL 2FLBT 4X98A 3BPLC 1NFIA 1EXUA 4IRSA 2QADC 4MJ4A 3ETBF 2OL3B 1CGWA 5F7KC 3KWWB 2GT9B 5LQBH 3QBTB 4OZHF 2Z8SA 1G7JA 3OJDB 1PKOA 2CKNA 3CDGB 3ULUL 1BF8A 5J1SC 3HUJB 4XZUB 2X5PA 4Y2OA 1U3HD 5ID0B 1T66D 1M7DB 1XF4B 3DX6A 4P46C 2J8HA 4OLEA 4U0RC 2R29L 4GAJL 3AAZA 3MGAA 3T0ED 1CE1H 3VXOB 4F7MB 5DMGC 4XMPH 5CKGA 1CF8H 4UINH 5F6HJ 4V2CB 3GEWB 1BD2A 1EEZB 5J13B 4PGEB 5DMKB 1KIRB 4QCIA 1NAKL 3BPNB 3EYQC 4A6YH 4BQ6A 4OZ4B 3DIFB 4XPHH 4M62H 1RPQA 1N59B 2IWGA 3DVFA 1BLNA 3ISWA 4XBGB 4ODVL 4KKAD 3TNMA 1JF5A 1C7SA 4YH6A 1QOKA 4ZG1A 3BD3A 4HCRL 3RFZC 3F7QA 5C70A 3TC9A 3UZVB 1MCPL 1VA9A 3KXFA 4BELD 1HHHA 1GGIL 4AEHH 4LRIC 4OLVL 3VRIB 4AEIL 3U36A 4GXVL 2CRYA 3FN0L 1TFHA 4MNQB 3G9VA 1LWRA 5D1ZC 3H7BA 3WUZA 5EBLB 4LLVA 3CNKA 1RZ8B 4NC1E 4RFOH 3FQNA 4X8JB 5EO9B 3RVTD 4D0DB 1UEYA 5CJQL 1N8ZB 1TCMA 5DEFB 5EU7E 2Y06H 2R23A 2DQJL 3GM8A 2W65A 5EO1A 5GRUL 1YYLL 5A3ID 1LILA 5ELIA 1NUFA 5J7CC 3PWLB 3RDTC 3FHAA 1G6RA 5KN5B 4MHHG 4HIIA 3T3PF 4TTDC 4YAQB 3VGAB 1WTLA 4OD1H 2W07A 2F58H 3W9EB 2QJDA 5E4EC 5HHMB 2VWEE 2JB6A 1HHIA 4C58B 4O2FB 3WXWH 5DZNA 4B53A 4LOUC 2IBGA 4JFEE 1CK0H 4WFHE 3H8NA 1IC7L 3GMNB 5BS0B 3IXTB 2J7LA 2AK1L 3QDJA 5C07B 4OFPA 4PB0L 5D6CB 2IH3A 4WU7A 1UXWA 3ECBB 4DOHB 1MY5A 1I3GH 4AMKL 1NBVL 4JRWA 1QLRA 1U36A 4NKOB 3H3KA 3FHQA 1NDGA 2F8VA 1TMCB 1A6TA 3EDEA 5TJWK 4XXCC 1L0QA 9CGTA 1E4XL 3G08B 2D7NA 4Z76A 4RAUB 4Y5YA 1MHHB 2YN5A 3AU1B 1ZVYA 4GRWE 5ICZA 4AM0A 2FJGA 4XP5L 3AS0A 4NCC1 4ZD3L 4G9DA 3QUZC 3O3BA 4MB4A 3BDXA 4UT9H 4LHUG 1E28B 5F70A 4Z77A 4NJ9H 4WI3A 1A7OL 1BZ7A 1L7IH 4RAHA 4QO1A 4Y19B 5I8CB 1KTLA 5ILTH 1H3GA 5E2WH 2DBLH 2R2EB 3NCEB 4WO4A 2X4PA 5DMJB 1WAAA 4OI7A 5K9KB 1YQ2A 4Y5YB 4P5KB 1ZLSL 4B50A 3VFGL 2UZXB 4YQXL 3FFDB 2FHCA 2YPLD 5J56B 1A3QA 4KC3B 3ROOB 2QQNH 2ZUXA 1HYSC 3D18B 1R3LB 2J8UE 1MWAA 4H0GA 1T22A 2W1NA 2Z31C 4P59H 1SHMA 5J6HB 4JRXE 4M6MH 1CFQA 2BFVH 2AKRB 2NTFA 4OZHB 5DJXB 5TPWL 3T1WA 3GBML 1JI1A 5F3HA 5DRXB 1K9TA 3I6GB 4YQXH 1T7YA 1VFBA 3QDMB 3SJVA 2XTJE 4HJGA 4KJWD 3HI5L 1F02I 3Q6GL 3P0VH 1EAPA 3QIWC 4R4FH 3ZHKA 4OT1L 4AENB 1I7ZA 1AGFA 3GMMA 4LLQB 3KYMB 4EOWH 2DICA 5D7IB 4CMMA 2NR6C 2GSGA 5E8NA 4BQ9A 1V7ML 4OLXH 4I2XA 1S9XA 4RNRB 1I85C 3HI6L 2GSGB 4NQVB 4M02A 5E8NB 2HFEA 4NKQB 4FQHB 5IM7B 4KK5C 3BN9D 2DQHH 3BVNA 4ZXBA 3NCYS 3IAGC 1OSZA 5KVFL 5JHLH 3CC5B 5C9JB 3B6SB 3M8OL 4XAWH 3X3GH 4GKZA 2P8PB 5T33L 2CKBL 1Z5LB 2D7MA 1FZMB 2HTKD 4P46A 4YHPB 3TH2T 3CFBA 3QCVL 4G9FA 5DRWA 4YWGH 2CPCA 5DJZB 3UC0H 5I0ZA 1CIDA 2CUIA 4CW1B 5L7XL 1JTPA 5KSAD 1GGTA 1XEDA 1GAFH 3MRJA 5CIPA 1JJUA 1TQBC 5A2FA 5LVEA 3B9KA 3I2CL 3HE6C 5KVFH 1OT1A 4PPTA 5I1JH 3WLWD 1KJVA 1S9WA 4LASH 1ULVA 1MQKH 2BNQD 3QUKA 5IG7B 1VGEH 5IHUH 1XCTB 4WU5B 5T1MB 3QDGB 3MJ9L 3MRKB 3QG7L 3D3VA 5CJ8A 3MLZH 4OUOA 2IFFL 4H1LH 5BCAA 1JN6A 4U1MA 5CZVL 5EOCH 3EO0B 1SJEB 5F8RC 2VDNH 3G6JA 4IRZH 1X5GA 3QI9C 1NGYA 4YPJA 1EEQA 1XR8B 3U82B 4AIZB 2D9CA 2VLMD 3P9MA 4NCDA 4NYLB 3SKUD 4JPWL 1AE6H 3O45B 3H9SB 1N0LA 2N7AA 4RRPA 1LO4L 4XVUD 2VLJD 5SX4I 3FFCE 4IHOB 4XPFH 1AIFB 5F9WC 1LO0L 1BVKA 2GJ6A 4M93C 2Z8WC 2LTQB 2XIDA 3RDTA 4D94A 2ZUWA 4RGND 1OW0C 3C9NA 2XWTB 1S7QB 1H8SA 3QZWB 4GAJH 1X5IA 2ESVE 5J57B 5HHXH 5DUPH 2Q87A 2JJSA 4X5WA 1A6TB 3JWOC 1YDPB 5ANMA 2VE6A 2X4QB 5KS9E 2OZ4A 5CEYB 1L0XA 3MODH 3VWJC 1PG7W 4XPTH 1R3IL 1K3IA 2H3NA 4QWWD 4XPFL 1XR9B 3GMLB 5ADOH 3IU3A 3GSNA 5MERB 4X6CB 4MQ7B 4QT5B 3RIAK 5L6YH 5GSRB 1KJ2B 1T83A 3O4OB 1LO2L 4LNRB 4PRPB 2VL5B 2ZOKA 2FATH 2W9DL 1L6XA 1DZBA 4U1LA 5IB5B 1YC8A 3QG6A 4B41A 1HILA 1JCKA 2EE6A 3ARGB 3HZVB 4KU1A 4CADA 1K3ZA 4MX7A 5AD0A 2PR4L 3M8OH 4XAWL 3X3GL 4XHJC 3QH3B 3VXNA 2CRIA 1RZIB 5CHNA 3L3HB 4F8TA 5TE6H 1RIVL 3FN0H 2Z92B 3LKSB 2Z9TA 4GRWH 3AXLA 1Q94B 5F6HI 2P5WE 3LVEA 4JDVA 1YMHB 4OLXL 1KT2B 1UJ3A 1A3RH 3FT4B 1TPXB 4ODVH 5A43C 3ROLB 3MCKB 1YN6A 3T4AB 1MIEL 5JW4Q 1X9QA 1LP9E 5H2BA 4KK6D 4KRPD 2PYEA 2DMKA 3SY0A 1JPSL 1MFBL 2FSEB 4DGVH 1FNAA 3ZKMD 3RZCD 2ATKB 3H0TA 3MGTB 5FIEA 5HHNA 3SE8H 3TNNA 3VFUB 3UO1H 3VXMA 2P8LA 3LD8B 4FRWA 2YK1H 4M1GL 4BA8A 3WNNA 3V52H 1DFBL 4PJDB 4GBXC 4PREB 3HLAA 3SDXE 1I7TA 3QAZB 3BSZL 4PUBH 4PJXF 1H15B 4ZFGH 5C0AB 1A2YA 3STLA 3QFDA 3KPQB 4DW2H 1MNUL 1K5NA 2OTWA 3QFJA 5EUOF 1U8PB 4R7NA 4RMWA 5GRVL 5HPMB 1LGVA 1IRAY 4FQLH 4XMLL 4EBQH 5SWSE 2Z31A 1F58H 5LAXB 3MYJB 4V2BA 4GUPB 1DBAH 1R0AL 3VFUA 1MCCA 5IV2B 3K1KC 2KZ1B 1TTUA 3QHFH 4KI5D 2XG5A 1IGML 5IMKA 3GI9H 4KMTL 4XTRD 2NY4B 2D4DA 4UIMB 1XCQB 1NLDH 3FOMA 4HZLA 5C0CE 1T1YA 1WT5A 1R5WA 3AS2A 2C4XA 3FT4A 3HAEA 2YD9A 1RZJC 2C3HA 4NZTL 4Y5VA 1I1AC 2PUQT 4XNUH 3VH8A 3QCUH 4U7KA 5I1JL 1KJ2A 2I9TB 2LU4A 2G9HB 3GKWH 1U8MB 4PJ9A 2ED9A 4HKZA 1C5CL 4X9GA 4YXKH 2BNRD 4X6CA 4HHAB 4N0YL 3QIWD 4GBXD 4D9QE 5AD0B 3DUSB 2GEEA 4XCFL 4JFXB 3JV4A 4X99B 3TJEH 5B38A 5INDB 4WHYH 3D5OF 2O5ZL 3HA0A 4HFWA 2FR4B 4M1DH 4X99A 4HQQH 3DBXB 3O8XC 1K6QL 2LU7A 2V9TA 4QEGA 1NAMA 4PV9A 4ERSL 1OP3K 5GSRA 3OAZH 3O6KL 4QHLB 3V4PL 4BH8A 4QXTB 1XF3B 3I84A 3IU3B 2HLFD 3GUTB 3ARUA 2P24A 3MR9A 2AABH 4J4PC 4LCYB 4POYA 2VDQH 2AEQL 4FN0A 4KHXL 5F9JA 1M71A 2VYRE 1JGVL 2XY2A 2F5BL 5IMOB 4PG2A 3IDUA 5TF1L 4YHZL 5TDNA 4YHNB 4DVBA 4NGHL 2BY2A 3JXAA 3TN0A 2ZOLB 4KKBD 2Y07H 2R2BA 1UM6H 3WO4B 3TO2B 3UXFA 4LSUL 2Q7YB 4J1UA 1FQ9C 3D39B 4FG6C 2E7HA 1U58A 5IROC 3VFOA 2NZ9D 3OG6B 4DUVA 1JRHI 3PWJA 1MLCB 4L4TA 1F11A 2EIZB 5DC4B 5I75B 4IIQA 5CEXB 3JWNC 5KZCD 1VESA 1F4AA 4HUWA 2Y5TA 5D7KE 4H0HB 5BMFH 2EDJA 3MLUH 3CCHB 5D8JL 5DK2A 3INUL 4WU5A 5T1MA 3MRRA 3P4NB 3T0BA 3WXVL 5IKCA 4JDTL 1YEEH 4UT6H 1B2WH 5F1NA 3SEPA 1TJHL 3EW3B 2PYEE 2VQ1A 3UJTL 3TVMC 1RFDH 4WDIA 4HDIA 4PRAA 4A6YB 5GS1B 4OLVH 4HEPG 3VFOB 4JFFB 5JORB 2FZ3A 4O2EB 4ODXB 3IDYB 4GAGL 4P2CG 1CD8A 3IS0X 2OXHA 4DQOH 3A6CL 2ADIA 3SDXB 3VA2C 3LQZA 2V5TA 1QLEH 32C2A 4W70A 8FABA 1H3UA 1WBZB 4PJDE 2BSSB 4OQTH 2DQJH 1N5AB 1CFVH 4HT1H 5FA3B 2XQBH 3UROR 1JPGA 3GBNH 1Q9WA 3VDBA 4MLSA 1CXHA 1I3GL 3N1GC 4C4KT 3EYUL 4DKDC 1QSEE 4HAFA 3IDJB 3QH3A 3V6BR 3GHBL 2OK0L 5CLTA 4JRYA 4NFDA 5DVLA 5IB1B 4QHMB 5FKAB 5EA0L 1JK8A 3FFCB 5JW4M 4XNZB 1AO7E 3GI9L 1HHIB 3BVNB 3T4YA 1GC1C 5FKAA 1RHHB 1H8NA 1QFHA 3LZFH 3IVKB 2P8MA 4YHIA 2DIBA 4CN6A 2EKJA 1J1XH 4QRTA 3IJHA 1S5HB 5GS3A 4HF5H 2EO9A 3QCUL 4OQ1A 1FORH 4Y5XA 3HE6D 5E9DA 3ARDA 4XNXH 5DT1H 2F8OA 1MELA 4GRLD 3VD9A 2A0LC 5BRZE 2RBLA 1YDPA 3GNML 4NKIL 1S9YA 4PY8J 3O2DH 2UZIL 4I0PB 3GSRA 4JFYA 3RIFF 3C5ZB 3CVHB 3D85B 3L3GB 1QA9A 3ARZA 4JFFD 3OKYA 1H3XA 3ARFA 2NW2B 5HSFA 5CP7B 4L9DA 5B38G 1RIUL 3NPSB 4MCZA 4KK9D 1CLOH 2PETA 3DWTA 2AV1A 4P99A 3QNZA 2EDEA 4OIBA 1OTUD 2BY3A 5D1QD 4EN3A 3RVWC 3LKQB 1MPAL 4K23L 4DGYL 3T2PA 1AD0A 3NA9L 4OF6A 4RA0C 5JQ6H 3MRRB 3VXRB 4PR5A 5I6XB 3PIQA 2EDFA 5K9QI 3FT3A 4TQEH 1ZHBA 3HLAB 3TT3H 1IC4H 1A0QL 3E6HA 4CDGC 4TPRL 4KJWC 4L4VA 5AYUL 1BD2B 3QIUA 1CDHA 1D5XA 4PBVC 2R29H 1G7PB 5D7LD 5T3XE 4C57C 1A6ZB 4JHBA 4JHAL 3L7FB 5IHBA 1MJUL 3MA7B 2Z0BA 3W39A 5C09A 3S96A 1FYTE 3TCLA 3WLBA 4JFZL 2MFNA 2AXJA 5E2JA 3ZMRA 4KKNA 4WFHD 1PDKA 5I1AA 3VD7A 1FL3B 4G9FE 4GSDL 4EUPH 1ZS8A 3FO2A 1DBJH 1KB5L 3WFCH 1EO5A 3MTRA 4A2MA 2KKQA 1D5MA 3ARBB 1F6FB 3MRFB 2X7LB 5DK0B 1CGSL 3SN6N 3GUTA 2A6JA 4TUKH 5T1DH 15C8L 1XGQA 5TGBB 1UM6L 4RFEA 5IBTL 5C6TL 2VLLA 3TBWA 4Y8AA 4YHPA 4F58L 3VFPB 4X4YA 5B8CA 1NFIB 1SEQL 4HMCA 3KPMB 4M6AA 2NXYB 5CZKA 3OAZK 4JM2F 2MNUA 2MQ0A 1N6QH 2R1XB 1QLRB 5EZLB 4ZTPL 4HC1A 2A74B 5C07A 3INUH 5C3TA 4HS3B 3SJVE 5KZCB 3ARFC 3D0LB 2XZCL 1RUPL 4HK0B 2VLKE 1RHHA 2HWZL 4U1NA 3S37H 4NBYB 4OIIL 4JHWL 4DW2L 1M7IA 1ZA6A 5HJ3A 3S36H 4ONGL 4TULH 1JPFB 2WM0A 2GI7A 4ACPA 4KZEH 4CVXA 4HJ0C 4M3JA 1CDBA 3DTXA 2EDOA 2A73A 5B22A 1EX0A 2DTMH 1ACYL 2APTA 2W65B 4LDOB 4POZC 1ZV5A 4UILH 3FB6B 5LCVH 1MHCA 4OKVA 2AP2A 1AQDB 5EOQH 1ADQA 2DDQH 3OAUL 5JOFA 4ZQKB 1YEGH 4JFHE 1T22B 4N90E 1HDMA 2IQ9H 3O45A 1CWVA 5GIRA 1MCIA 4XBGA 2YA1A 5LGKA 4XB7A 4BQBA 4M7JH 1Z9SA 5FB8A 1H15A 2IPUK 1IEAB 4XCCH 4BFBD 5DZOA 3OTTA 1A22B 1KIRA 4QCIB 4YNYA 5EN2B 4ELMF 2MWCA 1C1EL 3BP4B 4U1MB 1UM4H 5I73B 3MREB 3NABL 2HT3D 2I07B 3EO1B 4YUEH 5KSBB 2XTJD 3BIBX 2YA2A 4PV8A 1U3YA 4UDTA 3RBSA 3SY0B 3P4NA 1IAOB 2L4OA 2J88H 1SMAA 2IADB 4PJHB 1BGXH 3L3DB 2X4RB 3EOTH 3W5MA 3T0VA 1EJOL 3RRQA 1Z9MA 1NCCH 5ID1A 5E03A 1ZT7B 2BJML 5JZ7C 3QIBA 3D3VD 1AR2A 4P0DA 3L7EA 3WNMA 4WHCA 4DEPB 1YNKL 4LCYA 5EPMA 3ARDC 4R7DB 1RUQH 1T4KB 3V4VH 4ELKB 3IAQA 2LVEA 1X44A 2C7UB 4R90H 3G9AB 3GJFH 4YC2C 3O6FA 4U1LB 5IB5A 3W0WB 1YEKH 3QPQC 1KIUA 1JWSB 4Z5RA 3MOBL 4GH7B 5IUSA 1BVZA 1I1AD 1QFPA 1MFDL 2IH3B 2IBZX 1OTUC 1HIMH 5H94B 1TQCC 4HAGA 2JF1A 4I2XB 4WUKL 2X9YA 5IVXE 3RGVA 5JQHC 5D5MF 3GSNB 2J12B 3UBXG 4NQCD 5E8OA 5C0BB 3V5DA 4WEUD 4K7PH 4NZUH 3MNVA 1SJXA 2H41A 5F7EL 5C2UB 1YPZE 4LAQH 3P40A 5GSVA 2YZ8A 1CDCA 3QXDB 1I4FB 2CQVA 4LSRH 3DUSA 5IV2A 3BAEH 2DQIL 3RWHB 3BUYB 3SDCA 3SGKC 3T2OA 4Y16B 4RX4A 2XPGB 4HHAA 2XOTA 3QUYD 4GW5A 3B2UC 4XBEL 4I0KA 3HZYB 4P23D 2XTJB 3OKNA 5A2LH 1A21A 2Q8AL 4PFEA 3UBXA 1NMCC 1PYWB 3KPTA 1XF1A 2DD8L 3VXSD 1Q9OA 2CIKA 3MLSH 1P7KB 2WBJA 1NCWH 3VI4F 5HGBB 4M5ZH 1LE5B 5FOJA 4Y4HA 5IOPB 5EO9A 1CICC 3QFJB 4OGAC 4RFNB 1RMFH 1YNTB 4QRSB 5I76B 1IC7H 3BHBA 2X41A 3RWDB 4KJQC 2ZKHL 4Y8DC 3W5NA 1SYVA 1L9NA 1CU4H 3MREA 3CSBA 1O7SA 3PABB 4LPXA 3UZQA 3WFZA 1QBBA 3ET9F 2OJZH 3K2UH 1HWGB 1S7WA 4YFLI 5JXED 4NWUL 3G6DH 4ZNEE 3IFOA 2X4TA 4Y19A 4R3SB 5E8PA 3O3AA 1S7SA 2D9QB 2Q76B 3FQTB 5HDLA 1BECA 3VXRA 4G43A 4NWTL 3DGGB 1IQDA 3D69B 1BF2A 1Q9KB 4UQ3A 4XHJD 1E4KC 4U1JA 1DVFD 2B2XH 4OZFB 4OZIE 3FJTA 4RAUA 2DM3A 2VTFA 3LAFA 1T1ZB 4M7KH 4Y4HD 1HH9B 4LCUB 3ARDD 1IGJB 4F2MA 3BMWA 4Z6AT 2AK4E 5HYQA 1AH1A 1B0RB 4JM2B 3UDWA 4NRXA 4UT7H 1U8NB 4ONHA 4X4ME 3NZHL 1R24B 1FGVL 3QQNA 4X80L 5JPNA 2XZQL 4BM7A 4LHUA 4HWZA 4P3DB 2H45A 4M6NL 3DHJA 3OKOA 3VXRE 3HCVA 1C5CH 3E2HB 5TQ0L 3RGVB 1HNGA 3BW9A 3CFDB 5HGAA 3DECA 1BFOB 3KLAA 2H1PH 3HMWL 5D71H 4QOKA 3OBAA 5HYEA 4HIEA 3DLQR 5FGBC 2BRQA 2H9GA 3CJJA 2AI0L 4YDVA 1EFQA 3KHQA 3SCMD 4RZCA 1V3LA 3LN4A 4F80A 3EYFA 3RGVD 1GHFL 5ESVA 4JY5L 4O51B 3NFPA 3FZUC 3S9DB 3C60A 5IQ9A 2VDPH 4KTYA 2E7CA 1CZ8L 4HUXB 3QRFM 1ROWA 4LPVA 4I18A 1N8ZA 4YXLH 1BQHG 4BSWB 5E24E 2DI9A 5GGQH 3TCLB 3BT2L 5DSCA 1QR1B 4PY8I 1SMOA 2EEAA 5AYUH 4DK6A 4PG9A 5SWSD 1LP9A 5DMYA 1DP0A 5KSBA 1QQDB 3GBMH 1T0NA 4Z7WB 1I9JH 1I7UB 5D96C 1YPZA 1T0MB 1KCRL 1N5YH 1WIPA 3DX7B 1TCRB 2P5WA 3BH9B 1TZHB 1QBAA 2DWEA 3X14A 3QFDB 3TBTA 2HG5B 1N59A 3VWKC 2XZAL 4UQ2B 1AD0B 4P2RD 1RULH 1JF1B 4FTVB 4XTRC 1CDYA 5F1OB 3DVIA 3CPLA 4NUGL 1ZLUK 2X1XR 4JPIB 3U7YL 3V6OC 2EDYA 1JPTH 3VG9B 2HH0H 3MRMB 4K3GA 3QIUD 4LKXB 3TO2A 2I5YL 5I2IA 1BZ9B 2F19L 4D9LH 4Y4FD 2OZ4H 2ZG1A 4HXAH 4KJQD 1TZIB 2LVCA 2B4CH 4K07A 1KCKA 2R39A 1RULL 2ZUYA 3CDGA 3QXVA 4K9EL 3ZHLA 2HMIC 3HI1B 4YBLC 4WNQA 2VZVA 1AJ7H 5E9DB 5GRVK 5HHQA 4WHYG 1S5HA 1HXYA 4Y2DB 5D5MA 2A74A 4Y16A 5IF0A 4GOSA 2ADFL 4ZOEA 2ICWJ 2QEJA 1CICB 3OKEB 1I9RH 1A3LL 4GRWF 5LWYH 2E7LC 1KYOK 2H9GB 3FFCA 2WP3T 1WWAX 5C0BA 2HLAB 4OCXH 1DEDA 4DKFL 1MLBA 4X9FA 3VA6A 4K94L 4MQ7A 4RFEB 5GGSA 1EVTC 4HKZB 4LARH 3ZDZF 4LVHB 4FA8A 5DRZA 1BREA 1MVUB 1PBYA 1Z0MA 1U8LA 4KK5D 5DLMH 2VB5A 4KV5E 3C5ZD 3D85D 2R0KL 4K2UH 1P53A 2ARJA 1WVZA 4K23H 3O6FB 3VG0L 4XP9H 4FXGB 5SX4H 3KPRA 4XCCL 4X6BA 1B9ZA 2B1AH 2XWJB 3I50L 4FQCH 3E3QE 1RIHL 3BN3B 3X3FL 3GMOA 1EUUA 2XWBB 2PYED 4UV4H 2EYSB 2XFXB 3TFKD 5ALBH 2Y1VA 1OAUH 3H7BB 5TDPA 2EH8L 3U0WL 3UTTE 3GIZL 5DD0L 2QSCL 2R0ZH 1DDHA 1VFOA 2QHLA 3B2VH 4PB9H 3SKOB 1A1OA 4MJ5A 1G7LA 5C2BL 1RUAL 3RTQD 3QIWB 3QJFA 4OGYH 3MLWL 4ZUWA 5LBSL 2HG5A 4HGMA 1LEIB 2VABB 1X5HA 1PLGL 2FGZA 4EOWL 3VW3H 3VXMD 1OPGL 3VFSA 4HJJL 4DEPC 2VDRL 1ZGLB 1A9BA 1DQMH 1S7WB 4JO2L 2VXUL 4WGWB 4I0CC 1YPZB 1QLFB 5E2WL 5D70L 5DYOB 2VAJA 3QDGA 3JTSA 2OX5A 4YK4B 1T1WB 3LSOA 5D1QA 3OGOE 4XX1G 3KLHD 5I1KL 3VXUD 2JJUA 2VLME 2XYCA 4UDUA 3HRZA 5I16A 3N9GL 1FYTA 1BP3B 1NGXA 4JQXC 1FZKA 1ZT4B 4P5TA 1KBGL 3U0TA 3HI6H 1KEMH 1SBSL 4TUKL 5C92A 2G60L 4I3GA 3FFCD 1FSKC 2COQA 4KUCD 5IIEA 4CNIA 1A5FL 5ESVB 1P7QB 1FV1B 2EYRB 3IVKA 1EHLH 2OSLA 1EK3A 1I7RA 2OI9C 7FABL 4H8WC 1B6DA 4G7YH 2V2TB 2XKSA 3WLWC 3ESUF 2DN7A 2AS5M 5IROA 5B39G 3LEVL 3KS0H 1CGXA 1F4XH 5I8EA 4C4KO 3EAKA 3RVTC 4ZUVA 5IEKB 3MLXH 3LN4B 4WI7A 2PN5A 4GT7A 4JZOA 5C8JA 5DEGB 5DGQA 1NJ9B 2J8UF 1BEYL 5CEYA 1MJ8H 5IW3A 4DFHA 5KSVB 4WJ5B 1OAYH 2K7PA 3KYKL 2R1WB 4HS8L 3PHOA 2E27H 2HYMA 4F7PA 1HXMA 2F58L 2CD0A 1FCCA 1MCOH 3HCVB 4M7LL 1FPTL 3RNKA 4UV4L 2YPKB 1RJYB 2YSSA 4RBPK 5FA3A 5JHDD 3BDYL 3WKMH 3OB8A 4DTGH 3HRZB 1DVFA 3MLTB 4GG8B 3THMH 1MJ8L 2NZIA 5DD5L 2APXA 2R4RH 2X4RA 1JL8A 3EYOA 4XNUL 4GO6B 3QRGH 2DQDL 4NUJB 4JGMA 1A2YB 1Z6JT 2XKNA 4G9FD 1A1NA 4ZD3H 3NCJL 3DETC 1HHHB 3QPXL 3RI5K 3EOAB 1KCVH 3F6IA 4KMLB 1Z0NA 1F11B 4KTDH 3O8XD 3SOBL 3X11A 3O4LB 3TT3L 3WUWB 4JKMA 3OHXB 1J7VR 5I8CA 4YBLB 4P5TC 1UCBH 3PABA 3EJJX 3U0WH 4L3AA 1U3HC 2O5ZH 1UKQA 4NNPH 5KVMC 2Z31D 1T20B 1QO3A 5I1EH 1VHPA 1BWMA 3KJ4B 4BZ1H 3DIFA 3QUMB 3QDJE 5JW3L 3ZHDA 4Q58C 5C07D 3ZKND 4ZQKA 2P48B 4LLMB 4TVPL 4XC1H 3U6RA 1GZQA 4JPKL 5C3LD 4S1DC 1EMTH 2E9BA 5I1KH 4KRLB 4G6JH 4U6TA 1LVEA 3RAJH 3GSOA 2F74B 3LN5A 4KK9C 1G84A 1INDL 3KWWA 3SCMA 1ZVSB 4Y89A 4NN5B 4DVBB 4ZFZB 1OP3H 3VWKB 2AJYL 5ACZB 3VFMB 5FCUH 2IPKB 3SDCD 3HUJA 4XZUA 5KSBE 1HILB 2DQTL 1LD9B 3ARGA 4DZBB 2O93L 1FHGA 5D6DA 4NKMB 1TJIL 1UQSA 4OCSH 1I3VA 2ICWB 1J87A 4HK0A 1T04B 5C8JB 4NQSB 3F7VB 3UTZA 4PJBE 4RNRA 1WZ1L 4NQCA 2YPLA 2Q8AH 1G9MC 4LFHG 4M62L 1DUZB 1AY1L 1PSKH 3DBXA 3SDDA 4ZFGL 3EDDA 4NQEE 1A6UH 4U49A 4U1KA 1VACB 1RFDL 1UJTA 3SDDB 4U7MA 3UJTH 1GOHA 4NQDD 4BSVA 1I9JL 5ACZA 3QDMA 2F9BT 4GW4A 5D7JD 2EECA 4BH7A 4ELKA 1FNLA 4PRNB 3G5YB 4Y4KC 4I48A 3OGCB 1C16B 1ONQB 5BJTA 4EI5D 1W2KT 2VLRE 1LK2A 3AVEA 3LEVH 5ISZB 3PJSA 4YE4L 2VISB 2DQUH 4Q9BA 1QTYT 5IVXB 1FAIL 3JV5A 1F90H 3G5ZB 4G6KH 3X13B 5IB2B 4NYLA 1A8JH 4GKNB 2J2ZA 1WWCA 4M6OH 4OZHE 4IS6A 2EKSB 5BOPA 3FFDA 2IAMB 3MMEA 4I77L 5EPMB 5KVDH 4HWEL 3U4EB 2D7OA 4HZAA 1HINL 1XMWA 3SO5A 3CGTA 5CBAB 1SEQH 5D72H 3EO0A 5A1AA 3S6CA 1MAJA 1P7QD 2VZSA 5ABDE 3RDTD 3H42H 1DANU 3VFSB 1C12B 3OKLB 1T1XB 2ATKA 2OTUA 4Y16D 4JFEB 4W4NA 4OZIF 1LEIA 2W9EH 1GL4B 2JCCB 4ODSH 3STLB 1IZKA 1OHQA 2YD3A 2CK0H 3H9HB 4BFIB 1AJ7L 1KTRL 4BZ1L 5DQJA 4P23A 4QF1B 1X5LA 4RQQB 1H9VA 1DN2A 5C0CA 4UB0H 3MCLL 3O0RH 4PTTB 4FZ8H 1Y6NR 1IEAA 1OB1B 1ND0A 3ARGD 3OJVC 5L2JA 3RNKB 1BFTA 4EIGB 4UTBH 4WWKB 3VFVB 3TBVA 1UM5H 3WKNA 4J23A 1DQJA 4K3JH 2VIRA 1LEGB 3BYYA 1FH5H 2AI0H 3MBEB 5FUOH 3QSKB 2ENYA 2FECI 3RPIA 2MJWA 4Q9QH 1EEUA 1OL0A 2D4FA 2AXGB 2NLJA 4NO2B 5DD5H 3C6SB 3AXLB 4ODTL 3MUGA 2FIKA 2H2SC 2YUVA 5DF0A 4DGYH 1NC4A 3WO4C 3OKMB 2FD6H 3NN8B 1BIIA 2OTPA 4Q6IB 1I1YA 1KNOB 3BH8B 2Q3ZA 5AWNH 4F37F 4AENA 5I15H 4S11A 5I15L 4X83A 1JZ3A 4GS7C 3C8KA 4Y0GA 4HJ0D 5CD3B 4PRPA 2EE2A 4JZOB 2Y07L 4P46D 5F6IC 5T5FH 2BNRB 3QQ9C 5INCA 3WIIH 2NY6C 5KOMC 1INQA 2X05A 1XGTA 3WFEL 5HHVL 1OVZA 1CE1L 4KJPC 3B5TA 1OD7A 1MAKA 1N3NB 3QQ3B 5EBWA 2FJHA 1QBMH 4JANA 1RSFA 4EN3C 2JCCF 3MLWH 2QQNL 4U1SA 3QA3B 1WEJH 2EDXA 3TBWB 4CL7A 1Y0LB 1U8IB 1GGBL 3RVVC 3QB7C 4Q6IC 3KXFD 5DHVH 5T5FL 1UGNA 2VXUH 3C8HA 4AK1A 4AIZA 1E4JA 4C54A 2UWEF 2HTKC 1WK0A 5HBBA 2XKUA 2BCKA 3QUXA 4TOYH 3T3MF 3QHZH 1KPRB 4M5YL 3P0YH 1ED3B 3V0AC 4PRID 5E08L 5ID1B 1WJ3A 5F1IB 2CGRH 1MCLA 3REWA 3H9HA 3FT3B 4ZO8A 1T1WA 3LSOB 2AK4D 4WUKH 3ULSB 5ISZE 1MCWW 3GGWB 1PJ9A 4S1QH 2X89A 5GJTH 3QJFB 2QTEA 4FQIL 4LHUD 3O2WH 1BX2A 1NCWL 1SJEA 2DLIA 4D0CA 2VXTH 1QYGL 4FNLH 4JQIL 3QHZL 1NCUA 4M5YH 1PG7X 2HKHH 1EHAA 3V5KB 3H0TB 1H3TA 4UBDC 3TH3T 3HR5B 2VABA 1W0WB 3ZYZA 1G9NH 3SDDC 3VXOA 3FT2A 1HEZA 1F4WH 3HTLX 5IOPA 4WFFE 1FNGB 1RAMA 5IVXA 3NMEA 3TEUA 5GRJH 4FQIH 1R3KB 4BFGA 5E7BA 4ZUUA 5DRZB 2V5SA 3TIEA 2P24B 3OGCA 4CVXB 1NCNA 1X5JA 1AXTH 4NZTH 3TBSB 4NN6B 5D1XA 3IAPA 4LCWA 4MX7B 1G7HA 4HX1A 2E9IA 4LIQE 1J0IA 2QQKH 4JE4B 3SKMB 3RZCA 3B5HA 2ADJA 1JRHH 1H3PH 4RMSA 5E94A 3NN8A 2E6QA 3DJ9A 2W9EL 3DSNA 3WO3B 2FECL 2NY2D 4UUJB 1IEBA 4NC1C 2APFA 4H25A 5HI5D 1T80A 4U2YA 1VPOH 5J12B 2BY1A 1A7PH 4LQ1A 4QWWC 1E27B 4X5WB 5D1XC 2F53D 2AQ2A 3O4OC 1QNZL 4C83A 2UYLB 2Y6SC 3PV6A 4P2RE 1MVFA 4NM4L 5I1HL 1UYWH 3I6LE 5IMKB 3QUYA 1YEJH 3KPLB 5CEZE 1AO7B 3VE0B 3MRIB 3QXUA 3AREC 5GS1A 5CEZH 2X1OA 1AIFA 1JMXA 4MZ2A 5TFSL 2R69L 5DO2C 2CIIA 3ARWA 4OCYL 3RWJA 2KBGA 4LMQI 1BLNB 3HFML 3IDIB 1R5VB 4DUWA 4QRQB 5EWIH 4NKDA 3HRPA 2GQHA 4HUWB 1Z9LA 4RA3A 5DVMA 3I85A 4U1HA 4RFOL 2VH5L 1FNFA 1KJ2H 2F8XC 2R0LH 4TUJA 4NHUB 4ENEC 2EDRA 3N06B 2VQ1B 3H9YA 2VKXA 4NO0A 1JPST 2AXFB 3UTTB 2BHYA 4OCRL 2BSRA 5JHDA 1MIEH 5HHOA 3G08A 5F97E 5D93C 3U9PH 1HNFA 1JWUB 3BQUA 1SYSB 1IAIH 3HFMH 5C0FA 4OCMC 4IIQB 3FRPA 5CEXA 5E9DD 4G7YL 3MNWA 3SDAB 1REIA 5JXAL 4AM0B 3Q6GH 3GO1H 2CUHA 4M8VA 4XPHL 3RTQC 3TA3D 3RQ3A 1CCZA 1GC1H 3DURB 1G7JB 4UAOB 1T0NB 4Z7WA 4DQOL 4X6FB 2JELL 5KJRH 4GW5B 4ETQB 3I02A 2WW8A 2BFVL 1LO5B 2ZJSH 4F9LC 5EZJA 3TT1L 4OTXL 5C9JA 4PJCF 4OAWB 5CJBA 3SE8L 3T0EA 4GXVH 4EDXA 4YFLF 4M7ZC 5MENB 2JB6B 1FLTX 1WC7A 4GXUM 5SX5H 2OL3L 1N0XL 3JBG7 1QHOA 1NC2B 3HG1D 2G5BA 1PAMA 2P8MB 4PJ9B 1MAMH 3EYFB 1CR9L 3V6ZA 2ARWA 2A6KB 1HHJA 3WS6A 2FR4A 4ZFOL 4MNQD 4JFXA 5GJSL 4BKLB 4XCNA 3FQUB 1XGYH 1KPUA 4F2MB 2D31B 4JY6B 4X8JA 3TGXA 3U30C 3BP7B 1U8MA 4GRLC 2H1PL 4LHUB 4WI4A 3SE4C 3UZEA 2DQFB 4OUUA 5GRXG 2L7UA 2NYYC 4HUKB 2C4FT 3CIQA 5B21A 2GCYA 1MHPH 3K81A 5FUOL 5HPMA 1IGJA 2RJMA 4X80H 3FT2B 3RIAF 2HT3C 3JWOL 5ERWA 2Q76A 3EJZC 4HSQA 4JFEA 2YWZA 1NGYB 4NN6C 2WINA 5AAMA 3VRIA 4HWBL 3QIUB 4KTDL 4TSBL 1YNLL 2IFFH 2QSTA 3X11B 3FOLB 4N8PA 3EOBA 3IDXH 2AW2A 3HR6A 1NBYB 1BFSA 1DBKL 3RX5A 3A6BH 3VJ6B 3SKNA 4GLRI 1ZANL 5D5ME 4OGXH 1O0VA 2WLYA 3T4AA 2Y5TB 5FF6A 4N1EA 3V0WH 4QTIH 4ZTOL 4ZUSB 2NPLX 2AJ3B 4F7EB 3UTSD 3Q6FA 4JPWH 4J8RB 3UBXI 3ZKQD 3LN9A 5F88B 1NGQL 1J0HA 5E2UH 1NL0H 1FFNA 2EE3A 1G6RL 4OZGF 4PRHE 4QRUA 1AO7A 2GT9A 4PJGE 1I75A 1FZOB 1YEFL 1U3HA 4BSWA 3QUZB 4JO2H 4WWID 1G1YA 1Z5LA 4CMHC 5IJVB 1JNNH 1UZ6E 43CAB 1YJDL 4WTZG 4OLZL 3OJDA 3WUWG 5DEGA 5IHLB 1T2QL 1B4RA 5DMIH 4NQVA 4OGYL 4P4KB 4HWUA 1XF3A 2NY0D 3PWPA 4U6VH 3X17A 3MLUL 1X5ZA 1WZKA 4PJIE 3GMRB 1EXUB 5FUCE 3T4YB 4G8IA 3DI3B 2ADJB 1IM3B 2CK2A 4EKXA 4KKBC 2DQCH 3C5JB 4P4KD 3EJZD 4TOYL 1R5IA 2V9QA 3BWAB 3BW9B 1TETH 5FO9B 5HYSB 3HE7D 5BOZG 4WW2B 4DJMA 1IGFH 2A6IB 3IDGA 3PDGA 3EGSB 4FP8L 1SM3H 5DQDH 2IALA 2GFBB 4LSDA 3NIDE 3BFOA 4HXAL 4X6CE 5F93C 5D2LE 5LGJA 3V52L 3BPOB 3CUPA 2XY1A 4HUVB 1M7XA 4OLWL 3FQNB 3BQUB 3VRLF 1YMMD 4WCYL 4PP1D 1MCNA 3GSOB 2AXFA 2FZ3B 5MEOB 4HV8A 1QFWI 3C2AH 4M1CC 4G3YL 3WUWA 1D6EB 1SM3L 2QQQA 1OAKL 2YRZA 2WUCL 5SWQB 4R26H 3VDCA 1LDPH 5GRZA 3PIQB 5I18L 1J05B 2Q6WB 1JHKH 4YHYB 3FQTA 5E5UB 4G6ML 3DXAD 3FN3A 4OB5H 1RIUH 1W0VA 4R3SA 1WT5C 4EUPG 1PZUB 3FOLA 3DUUB 1UCTA 5CBEB 3F12A 3LHPL 2F5AL 1KIPB 3VFNB 3EYQD 4U6YA 5DUPL 1MI5E 3B9KD 1UB6A 2AABL 1BJ1H 4KZDL 4Z76B 1QVOB 3PXJA 4X6DB 4NP4L 4CW1A 3CSGA 4EDWH 2IAND 2CXGA 1QR1A 3CFBB 4G9FB 1CI5A 4NQDE 3S3SA 4CRPA 1DR9A 4OZIA 1GJIA 1BQLL 3PNWA 3O8XA 4GQ9L 2VAAA 2HRPL 3QIBD 4P9HL 3MV9B 2VZ1A 4PJ5B 3GJEA 5CGYC 5K9JH 3HZYA 5IEKA 2A83B 1IEBB 1CFNA 1KSRA 3LRGA 3OPZL 3NFPB 1NMAL 3DPBA 1RUAH 1VFAA 2M26A 5HYJE 3JSSA 4NSKA 1IARB 3ES6B 4P46B 3WS3B 1JVKA 4ENED 4JY4B 3WFHB 2V17L 4PG2C 1VACA 4YEEA 3SQBA 4CBPA 4Q9CA 3VXQB 1MUJB 2VLKB 3HN3A 1G7HB 1EV2E 2A6KA 4HX1B 3UTOA 2AJSH 1V8HA 3DO7B 4NFBA 4NQCB 5MEND 4LKCB 4XI5C 4JFPB 1ORSB 4U05A 5FO7A 3O2VL 1FZKB 2ICWA 3CVIH 3U0TB 1J8HD 1IAIL 4Y5VB 1PEZA 4I4WA 3UMTA 3HC0A 4Z95H 4JN2A 5BVJB 3WNPA 3VXPA 4PJGA 1JTOA 5DJ6A 5DFVD 4IRSD 2A2QT 4LLVB 2J6EH 5HGDB 2IF7A 1I85A 5KG9A 4NT6B 3CFJB 3PWVA 4MSWA 2QQLH 1KB5A 4B7IA 3BO8A 1HSBB 4EQ3A 2C3VA 2FEEL 3AY4A 4RCAA 1MWAB 3F62A 4OBSA 4X6EB 2O5XH 1NKRA 2DM7A 4XP6H 2NTSP 3QUMA 5HI5C 2FB4L 1OAQL 1CVRA 3ZT5A 5E2VH 4WTZA 3TBTB 3JTSB 3ZDZE 1KTDA 4O02L 4YPGB 1HZHL 2P46B 1S7XB 2XTJC 1HQRA 1T7XA 4LCIL 1NGWA 2QQLL 2VWEC 4XT1C 3ZL4L 1P5UA 2W38A 3Q3GA 4NNYA 2HJLB 2DQHL 2I25N 5L88L 1FVDB 3PWUA 3QWOB 5EU6E 4Z9KB 5ERWB 4JFDE 7CGTA 3OQ3B 3QNYA 1YQVL 3X13A 1CE6B 3GSRB 4S1RL 4V1DA 4MA7L 5IT2H 1JFQH 1D5BA 4NQEB 4XMKH 3M07A 5CSZB 2X9WA 4U1SB 2KH2B 3LOWA 2CSPA 4KKCD 4NOFA 5TQ2H 4HQQL 3LCYA 2GKIA 2VLRA 3BZDA 5C71A 1SY6A 4POZD 2V2WA 4W4OA 3HNVL 5C6WH 1F8TL 5JNYA 3O4LD 3Q48A 3RWCA 3M45A 3MODL 3GRWA 1OOAA 3DI2B 2OK0H 5DUMH 5F9AC 4YXKL 2WQ8A 1P2CA 1RZFL 3CMOL 2PW1A 5I1IL 5INDA 3ARDB 5T1LD 4X6DE 4L4VD 2K9UA 1EFXD 1TQBB 4EEEA 3MV8D 1NCBL 2FIKB 4J3SA 4P4RB 4YUEL 3DRTB 4PRIE 4HWZB 4P3DA 3TP4A 4NO2A 3VXQA 1IM9D 4JFOA 1VFMA 5DTFA 4MS8D 3AM8C 3ORJA 5DVOA 2WIMA 5FGBA 4XXDA 5K9OA 5ISZD 3RWCB 2YZ1A 1KEGH 4ZFZA 3RJDA 2C1PB 5B39A 4IRJB 2HN7B 4W6WB 3DGCR 4BJLA 1RIHH 3BN9C 1XIWD 5J6HA 4JFFA 2PTTA 3SPVB 2VITB 4GFTB 1MFNA 3QNXB 3CLFH 4P23B 1QD0A 4MQXD 2J6EA 1QRND 1KXQE 5JHDE 2OTWB 3DGGA 4LP4A 2EIBA 5FF6B 1BOGA 4WFFD 1TVHA 6CGTA 1MJJB 2VDQL 4N68A 1AQKL 4X5LA 1WQVT 4PRBA 1WZ1H 1A6ZA 2P5WB 1BVLA 1KCUH 1WBXA 3BD5A 4P23C 2X4NB 4MWFB 4Y2DD 1T21B 3ARRA 1I8MA 3MRCA 4XBPA 1YEFH 4JO4H 1MCEA 3QDHA 4LCIH 5TDOA 1PY9A 1BPVA 1W0VB 5EFIB 5EU4A 2VR9A 3GHEL 4P57B 3IKCB 2HKHL 3JVGA 3HPJA 1MFCH 4E0RB 4IRJC 3PP3K 2HFGL 3PF2A 3P9LA 2FGWH 5FO8B 3MJ7B 1XGRB 3RWEB 4HG4J 4YXHH 2MHAA 1CXFA 1ZTXH 3FRUA 5TE6L 1ZTXL 2B8OT 3BZEB 1R3JA 1MHHA 4Z7VF 3NGBC 3QEQA 2OZ4L 1WLHA 4CU7A 3B9VA 3TJHC 2XG4A 1DUYB 3I75A 5F7NC 4G7VH 4N8VA 4ZFOA 3NOIA 3LDBC 1INEL 4QXGL 1RZGB 4M1CD 5ESQB 2ORBH 4I77H 2G75B 3BGMB 4TVSa 1Q0XH 4OIIH 2AJXL 4HFWB 2DM2A 3HB3C 4QY8A 3DYMA 1P6FA 4UAOC 4S1RH 5IMLA 5GZND 4MA1C 2B0SH 1RU9H 2ERJC 3RTQB 3OAYK 5IMLB 3LH2L 3HNTL 3NABH 4Y4HC 1M05A 4DKFH 4OCWL 3C8KB 1PX3A 2FL5B 5FYKU 1FDLL 5EO0B 4OKDA 5B38B 2ITCB 3NACH 4UOW1 1UEMA 3ARSA 2MCPL 4URTB 2UY7A 3PWPB 1A1MB 4PJ9C 5J1AA 1JWMA 4MZ3A 4HKBA 2E5EA 3G5VA 5FDWA 3VWJA 1WICA 3OKOB 3D9AL 3LN5B 2AKRA 4TN9A 3RBGA 3I50H 4FQCL 2ZP0T 4Z7VA 2LABA 4M7ZB 5CMAA 1AGEB 3QEUA 2HJKB 3RU8H 4IRJD 1RZKL 5BRZA 1OAZL 3JVGC 3LV3B 1OLZA 2OR9H 3IRZA 4Q9QL 4NDMB 5FYJD 3PDDA 5E9DE 2DLEA 2FIRT 1W8OA 35C8H 1SJHB 3V6FB 4DKEL 2HJLA 5I19H 2I07A 3EO1A 5DA0B 3D25B 1I1RA 5BZDB 4PS4L 5EU4B 5IESL 4PS4H 3V5KA 4Y2DC 4U6YB 3CLEH 4TSBH 4GJTB 4CUCA 3BGAA 1WUNT 3Q6FB 1GCFA 2D03L 4QF1A 2GJZA 4U1IA 4TQEL 1IJ9A 2KQMA 1HQ4A 1A6UL 5D7LB 2FEDD 4OF7A 5IVNA 1DLFH 2CMRL 1PEWA 1R5VA 3IDIA 3SKNB 3BH9A 3LRSB 1UB5A 4P9HH 2X1QA 2F54B 5I1EL 3GMPB 4FABL 1D6EA 3MLVL 1CGTA 1BGXL 2C3VB 5DHYB 4UOW0 4LPCA 3I6KA 2GAZA 4RMUA 3ARQA 2XXCB 3D39A 5DZLA 4MXVE 2V17H 2EE9A 3ARBD 2JJVA 3UYPA 1QFWL 4XP1L 5CHNB 3GK8L 5FKPB 4XNZC 3QWRD 2VDKH 1LO2H 2R0LL 3WFCL 1L4IA 4OQTL 3RI5F 3L5WA 3WYRA 4DVRH 3CC5A 3U1SH 5C0GA 4NJAH 15C8H 4HKJB 1TDQA 4FXLA 1HHJB 3ILQD 3CVIL 4LKCA 3OX8B 5EU3B 5J13C 4EQ2A 1TJIH 1NC2A 4QRTB 4H5SB 1IFHH 3PUCA 1T5WA 2FB4H 1V7NH 3J8F7 3KYNA 1NAMB 4JO3L 4PV9B 3D1MC 5L7XH 1R6VA 4IMLA 1VB9A 4R96A 1TXKA 4YHOH 3AM8A 3K2MC 4NO3B 2FL5A 2Q86B 1KOAA 4OIAA 3T0EC 3O2WL 3MLYH 3O3UN 4N0UB 2CK0L 4MQTB 1X3DA 3UJIL 3MXWL 1T66C 1UWGL 1FG9C 1SBBA 2P42B 3NACL 4X6CF 1FNSH 4GAFB 4WI6A 5J89A 2VDOL 5C1MB 3GI8H 1IGFL 3VRLE 1YECL 4AEHL 5CCKH 3K80A 1VGEL 5AUMA 5J6GB 3MV7A 3RKDD 2VMFA 3R06A 43CAA 5KS9B 3BZEA 4PTUB 1FL6A 3MBEA 2Q20A 1ZEAH 1UKTA 5KTEL 1LMKA 1XCQA 2APBA 3ZE0E 3ROOA 2J5LC 3L5XH 3L5XL 3P9MB 4K3DL 1RZKC 5E5MB 5I0DA 3B3IA 3TO4B 2CO7B 1EO7A 1Y18B 4DWHA 3MRMA 3F5WA 4MAUH 5GHWL 4IJ3B 3U9UA 5J0BA 4JDZA 2AEIT 1JIBA 3MV7D 1BQHA 1NCCL 3CH1A 1SYSA 1WWBX 5FYKD 3T2NL 5GGTA 5IKCB 3BQUC 2WLZA 4L3EA 4MMXC 4PJCB 1XR8A 1JV5B 4O5LH 4NO0B 3ULUE 2BERA 3LZFL 5T1KA 5T3ZE 5GXBB 4H20L 4U1IB 2DYPB 3KJ6L 3RUGF 5M95B 2X10A 4KROB 1ZHLB 4UT7L 3MRPB 4YDLC 2LAGB 4RRPG 5FV1L 3DYOA 4J6RL 3D3VB 2GSIB 2ARJQ 5F6IB 2H32H 3PHQA 1DN0A 3DTXB 4GG6E 4EDWL 2G5RA 1QNZH 4HPOH 3TZVC 3VW3L 3RWJB 1A0QH 2HT4D 5I75C 4XPGL 3QEUB 1S9YB 4XPAH 3SKJL 3B43A 5FGSA 3RWFA 5IMOA 1D5ZA 4ODHH 2PYFA 5ACMA 3S5LB 5CIPB 5FO7B 4QRPA 1CGVA 5C86A 1PZ5A 3CLFL 4WU7B 3DRTA 3QFJE 1GOFA 5I1CL 1S9XB 3L3HA 5JR1L 3IU4H 5D2NA 1EGJH 4X5XA 1R5IB 5E56A 2VZOA 2NY1D 5FM5M 2HLAA 2IFGA 1CS6A 4CMHB 4JCLA 1M7IB 2RCSL 1CN4A 1LE9B 1N6UA 2M1KA 4HKXB 5E8EB 4ZMAT 1GIGH 5I8EB 5JW4N 1DSFL 2DI7A 2ICEB 4I3SH 4P4KA 4QOKE 4ELMB 1JZ7A 5E5RB 1IGIH 5GGUB 5CZXC 2NNAB 4WW2C 4JPVH 2NMSA 5GZNC 3O8XB 4EVNA 4PGCA 1PKQB 2I5YH 4GS7B 3V6OE 1I7RB 1F4WL 1T6VN 5I1DA 3NCYP 1VFBB 4QRRD 3LS4L 4AEFA 2A6DA 2HFTA 4M9PA 1UC6A 5FYJL 4F57H 4M3KB 2BVOB 3MSPA 3P3YA 5F3HB 5DI8A 3EFFA 1MHEB 4KV5F 4HULB 3QO1B 3L7FA 5E2TH 1MAML 5I73C 2YD8A 1MI5D 1SEBA 4XH2B 1G9NC 4L9LA 3U1SL 4LLMA 2PCPA 1J88A 3K8MA 3VGGA 2J5LB 3EIFA 4Z7UB 5D1QC 5CCKL 2PKDA 3CXHJ 3TNMB 2Y5EA 3DV4B 3HNSH 4L29A 3MOAH 4PR5B 1ORQB 2BSRB 1N0XH 4QXWA 3O3AB 3ZYJA 3H42L 3U7WH 3NAAL 1IAII 1NMBL 1MREL 3U2SB 2HFFA 2JCCE 4K94H 2YEZB 2X4PB 1KN4H 1NLDL 5EIIB 3HC3H 3OXSB 4D0CB 3IT8D 4LEOA 1CIUA 1C5BH 2ZPKL 4Y19E 3EOAA 1PGRB 1UZ8A 4PJIA 4PP1C 5DQ9A 1BMGA 4M7LT 4XNMB 4LHQB 5FK9A 2MMXA 5EOCJ 1VPOL 4HD9A 3S98A 2A0LD 4AL8L 4J6RH 4N5EC 2DL2A 1R0AH 3GKWL 4UU9B 5HGHB 1NSNL 4U2ZA 1JYNA 2O5YL 2HMID 1H3PL 4XPAL 3SKJH 3LQMA 1PYWA 1C08B 4ODSL 3ARFB 3RNQA 4UILL 3LKSA 4ONFH 5DI8B 1NCAL 3IFLH 3B2VL 4PB9L 3QIUC 2IAMC 1QA9B 4QRRA 1BZQK 4L8CA 2FJFB 1CF8L 3ALXA 3PHOB 4S0TD 4UINL 1N7MH 5IWLC 3CFEA 3HMXL 3LPGA 4QYOB 3ZKXC 4GKZB 5HDBF 3WDHA 3QG6B 1S7RB 3M1BA 3MFFA 4H1LA 4KQ3H 1WCBA 3VXTA 1U8LB 2GIYA 1UXWB 3ECBA 1KG0B 1RZ7L 4F7CB 5HDQH 2EDLA 1NCDL 2SEBA 4YBHA 1CFBA 3D6GA 3ARED 2P47B 3C6SA 4ODWA 3MV9E 4HKXA 4PJ5E 5J8OA 4OCRH 3ULVL 3BISA 1F3JB 5CIPH 3SDAC 1WBYB 3F6LA 4Y7MA 2GY7B 4PLJC 2VLJA 5CILL 5T3XL 1YY9D 5D93B 1AQKH 3FMGL 3RAJL 3P4MB 3AC0A 3S4SA 1HHKA 1JPGB 5C0EB 4C56A 3I6KB 3BJLA 3QIBB 4PP2B 3V4UL 5JDJA 4NPYB 3X12B 1ADQH 3BKCH 5EU6D 3FONB 3KPSD 4JFDD 5GRUH 1U8PA 2HRPH 4R7NB 4U6XB 2PTVA 1AKJA 4J3UA 3RY5A 1U8HA 3L3KB 5DJAA 4Z78B 4XNYH 4Q9RH 3CCHA 5LGHL 3K2UL 2DAVA 2NX5B 2CKBH 2BNQA 1SQ2N 4M93B 2VC2L 3AMLA 2AJZB 3DVNB 4HLZH 4LRIA 5E7FA 3SE3C 1MJ7L 1DBBL 1TNNA 4JN1H 2E7BA 2WWMC 1P84J 2IG2L 4Z7VE 3RVXD 5BV7B 2HFGH 3EO9L 3O3EB 5HYJB 1AKJB 2ZUUA 1WISA 3GIVB 1D9KD 3O2VH 3T0EE 4Y4HB 2WIIB 4L4VE 3LKOB 5J12C 3P0VL 2YD7A 3CK0L 3OB0K 1E6OL 1EEZA 1ZKAA 2EC8A 4MNHA 2W0PA 3MV8E 1AI1L 1B0GB 3IXAA 1L6ZA 4NRZB 1TNMA 3KR3H 3QXTA 4TTGA 3VXNB 5GS0C 2OI9B 3SDAD 3V5HB 1IMHC 4AH2A 4X6BB 2OQJA 3MRQA 2QV2A 1GGCH 4X98B 1CLZH 3LDBB 2EEDA 3QA3A 1OSZB 4G8IB 4MB3A 1FSKB 1WAAE 2B2XL 1QG3A 4XWOC 5F21B 3V5DB 5IHUL 1AE6L 2ZG2A 3PP4L 3GMRA 4XVTL 2BVQA 1PG7L 2XN9A 1EO8L 3IDMA 5H35B 2BVPA 4GXUN 3D87B 1WC7B 4Z7QF 5IW6A 4JZNA 5CD3A 4LFHD 3WNLA 4UMGA 5EOQL 3B83A 4GMTH 4LAJH 5D1XB 2V9RA 1MCDA 3ILPB 2X42A 3GSVA 1MWAH 2ERJB 3FMGH 1EJOH 5D71L 1SJVA 5DHVB 1C7TA 5DA4A 4G8GD 4CN1A 1ACZA 1DE4A 4N8CH 3GM0A 3WKML 1T83C 3QQ9D 3C09B 5GZOD 3WLBB 3ZE2E 2HJFA 5FOBB 2N56A 4GQ9H 2AV7B 4RAVB 4OZGE 1IT9L 1IBGL 1T1ZA 1U8QB 3MA7A 3VFGH 4GRWB 4OCSL 3O6KH 3V4PH 4XVSL 5F96H 3W11C 3ZKMC 1XIWC 5I71B 4P57A 3GSNL 1YEIL 3GSNH 4LEXL 5FYLL 2VZTA 3MRCB 4XBPB 2CLRB 1G6RH 1JZ4A 1ZGLA 3GZKA 1PLGH 2F5BH 4JKLA 2YXFA 4M8QA 3KPQA 4IOFC 1ORQA 3VXUB 1TVHB 1ZAGA 3K0WA 4V1DE 4Q2ZB 5DO2D 3CH1B 2CLVA 1JNNL 4YBQD 3ZTNL 5HHVH 3ZTNH 4N0CD 4JG0H 5EU5A 1HOCB 4PJAB 1EHXA 4KI5E 1VKXB 1OSPL 4HC1L 5E08H 5EU6A 3DXAE 3RKPA 2A1WH 3HI5H 4S2SB 3JTTB 3KDMA 3QJHB 5EC1A 3GSQA 3QEHA 4NT6A 4K7FA 5SWZB 2PXYB 5F7YC 3S4SB 2NY6B 5BV7L 4PRIA 4F57L 1XF4A 3DX6B 1KBGH 2Z8VC 3ZDXF 2OMBA 2DQEH 4XCNB 5DXWA 1PVHA 3X12A 4KTEH 4OQTA 1ZA6B 2DLFL 2IANE 3EO9H 1BHGA 5F9JB 1RMFL 4HUXA 4J3XA 4YIQB 2Z4QA 1OARH 3KGRA 2DQTH 3H9SE 1YECH 2CXKA 5I17B 4OM0L 4ZYKA 2X70B 3ARPA 4WJ5A 5L2KB 1P2CB 4JCMA 2V2XA 1S7RA 3M1BB 4H1LB 5GQBA 2RQ8A 4NO3A 1LEKA 2P49B 4NOBA 1IQWL 1U6AL 3QO0A 5ESQA 2A9NL 5ALCH 4NQXA 4WWKC 2IQ9L 5DRXA 4WFGD 3U4AA 1D3CA 2BVQB 5JHLL 3QEQB 5KANI 1T03H 4HKJA 5I16B 1CYGA 1EFXA 3BP5B 2DOCA 2X4UB 2O61B 4MA8L 1YEHH 2IEPA 2F19H 4HEME 1RJLA 4D9LL 3SOBH 4HIHB 4ZOBA 3MBXL 1WTGT 3B8SA 2DTSA 5I2IB 1JHLL 3VGAC 4FFZL 4GMTL 2LE9A 4QRUB 4LKXA 4OZGB 1OWWA 3NTCL 5TDOB 4L4VB 1ZT7A 4M7JL 4IJ3C 1J18A 1LO4H 5IHZB 1DBML 1GZPB 5B4MC 1Q0YH 3WNKA 3MYZA 1LO3H 5EZOL 1UH4A 3OR7B 5JW4R 3RY6C 4ZODA 2BOCB 3FQRA 4I18C 4K7PY 2H32A 3N50A 4ZNEA 5J06A 3NCFB 1CD1A 3OR7A 2NW3B 3PL6A 3KLHC 2A77L 2OJEA 1LQSR 4BFEA 1P4LA 4L8BA 4UNVA 4QHUB 1RI8A 4JHAH 4U1HB 1YZZA 4KY1L 3KPPB 4L4TE 3HZKB 3D25A 5TDPB 4XC1L 1YUHB 3L3IB 3QUKB 3GSUA 1KGCD 1T89C 5DJZA 2FBJL 5HVHB 5EUOA 4JHZA 4TTDD 3BPCA 3MLTA 3BP5A 1KENL 1KENH 4NNPL 2K1MA 1U8KB 1NDGB 3R0NA 1KJ3H 5FDYA 4GBXB 2NNAA 4GMSL 5E6IC 1ONQA 1TJHH 3BYTA 1MCRA 4EUPB 3CZFA 4PRNA 1AO7D 4QXTA 2DS4A 4KDWA 1J5OH 1F4YL 5GGTL 3DETD 3UPCA 3BEWA 5DD1L 2CH8A 5MHSE 1CXKA 3BI9X 3N9GH 3DX8B 1KNOA 4H25B 3WFBH 4U3CA 5EU7C 3RA7L 5FHAL 1PSKL 4JZJC 3RIFK 1XZ0B 5D2LA 3S37L 3CXHK 1E6JL 2R1XA 3TH4T 4Z5RB 2Q3AA 2IPTH 4OF3A 3MFFB 2FLRT 1DQTA 2VE6B 1S7UA 4GAYB 1G9ML 1MFAH 4YHYC 2ESVD 3PDOA 4XP4L 4HK3J 3KJ4C 3ULUD 2NY4D 1HEZB 3ARGC 5D2NB 1ZVSA 3KHOA 4JJ5A 1RZ8A 1FNHA 4ZPTA 1KFAL 3UC0L 5J4MA 1KFAH 4XP1H 1E0OB 2R56H 1U9KA 2UWEA 1ZVHA 5HI3C 4PYHA 4ZUUB 3L3OB 3MACH 2VERN 2DJSA 4APQA 2DLFH 3QUZD 2KQNA 3GBNL 3I2CH 2PO6B 3G04A 1BX2B 5FM4A 2R1YB 5SWSA 4RWHA 4M00A 1IAOA 1T20A 2W0KA 2YD2A 4XP6L 1T7WA 3D9AH 3KPOA 3A6CH 3KPPA 3HE6B 1CDGA 4X4XA 4X6EA 5T3XD 4M61A 5IB4B 2EXWD 2HP4A 1HQRB 2YEZA 2MSPA 1KTLB 3BKJH 1FDLH 1YN7A 4YPGA 1KACB 4JQVA 5HVFB 1CD1B 1KLGA 5DUBA 4Z7OE 1L7TL 4W4OC 3EHBD 5JO5B 2YUZA 4WFED 3G6AB 3TN0C 3RL1A 2PCPB 4LLUB 4HLZG 3MBED 2OP4H 1FVEA 2VXQL 2PTTB 5HDQL 2CJUH 4QOKD 5HDBE 3F5WB 1JHKL 4CVUA 2FJHB 2OM5A 2GY5A 5CAYB 1FE8L 4NIKB 3ZE1E 4YDJB 2NY7H 3RWGA 1INQB 1SY6H 3MNZA 3BUTA 4MMZC 4M48H 1IT9H 1IBGH 4YC2B 1ZLSH 4JQVC 3RWHA 4E41D 3HMXH 2WQRA 1CXEA 3W9DB 2MKWA 1J0YA 1X5FA 1EUTA 4ESKA 1HKLL 4U1KB