1P5UB

X-ray structure of the ternary caf1m:caf1:caf1 chaperone:subunit:subunit complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
149
structure length
149
Chain Sequence
b'ADLTASTTRTATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein Caf1M
publication title Structure and Biogenesis of the Capsular F1 Antigen from Yersinia pestis. Preserved Folding Energy Drives Fiber Formation
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Chaperone, structural protein
total genus 23
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2003-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09255 Antig_Caf1 Caf1 Capsule antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1p5uB00
1P5UC 4AYFB 1Z9SB 4B0MB 4AZ8B 1P5VB 1P5UB 3DPBB 3DSNB 3DOSB
chains in the Genus database with same CATH superfamily
1TTFA 2YBRA 1E6OH 2VMFA 3MZTA 4UINH 3HLAA 2NR6D 2ZXBA 4LGRB 4R26L 4KUZH 4XP4H 3VXRE 5LVEA 1ZOXA 3M1BA 4UM9A 4OF8A 4LLVB 4P2OA 2YPLD 5LKNA 3JBG7 1FLTX 1QFUL 4FOMA 5D4IA 1NCWL 3HNVL 4IRSD 1N0XL 1A2YB 2AJSH 2JFCA 4X4KA 1T89C 4Y0GA 4DN4H 3DARA 1J10A 3HC3L 4ORZC 3NN8A 3K6SA 4GAGH 4X9HA 2HG5B 3VNZA 2H7WA 4F3FA 5EBWA 4RAHA 2IPUG 1RVFL 2Q6WA 5EU3B 3F12B 1UA3A 3P54A 1L3WA 4JFUA 3SGKA 1RIVH 2K70A 2QJDA 5TE7L 2QSCH 4MMZB 3A22A 5EC1A 1LD9B 3IFLL 1P0SE 4LF3A 4P4RB 3WL9A 2DV6A 3EXJA 2X44D 3CWGA 3WFDL 1F3JA 2W59A 2B1OA 2K3TA 4MA7L 3RWFA 1SMDA 4C56B 4JFPB 1CYGA 2EP6A 2R0ZL 2VWEC 4OVUA 4R26H 4JL1A 4WW2B 5AQ0A 3VAEA 4G6KL 5EIIB 1LWJA 5LXVA 2NX5A 5HY9A 1UB6A 4FEMA 1QFUH 1NCWH 1N0XH 2HTKC 3CVCA 3OXSB 1NSNL 1KXQA 3EO1A 3K74B 4I9WE 4CC4A 4JRYB 3H0TB 1UOWA 5EU4A 3HLKA 5IROC 3T04D 2AQTA 2CUAA 3SKOB 1FAKT 1IE5A 1RVFH 43CAB 4PRPD 1HHGB 3KPLA 3KPOA 3SDXA 1PZDA 4U1JB 4X42A 5TE7H 4OFVA 2VR3A 4Y19B 5JQHC 3TVMA 3MLVL 5B1JA 2W0FA 4M6ML 5EBLB 5LBGA 4MB3A 3WFDH 4I2XB 2OMTA 4HUWB 5FDYA 2V2TB 3RPIA 4NC0B 4MA7H 2ZJSL 4YE4H 1CD1B 4M48L 2R0ZH 2X4OA 4PH8A 1LEIB 4QHNB 3REWA 2WLKA 1QRNB 3VFTA 4U49A 4PJ5E 3B83A 4JFEE 4MJ5A 4OJFL 3WHE0 3IMSA 3QO0B 4UM9D 1CN4A 1NSNH 3ERXA 3K72A 4P2OD 3D34A 3Q0HA 4FJ6A 1M05B 4BV1A 1ED3B 1DDHB 5T5NG 2DJUA 1BG1A 2E46A 2IAMC 1E5CA 4YVNA 2K7QA 4LXFA 3FQUB 4NOFA 2ATKB 4ANXA 1ZA6A 1AKJB 3BW9A 4ZAKA 4D9QD 1G9EA 3RHWF 5D4JA 4F7MA 2P7TA 4EN3C 4HHGA 4QWWD 5FFOA 3F7QA 3QDMB 3MLVH 3KEHA 1O5DT 1GZQB 3N0AA 3RI5K 1UM4H 1KENL 1YPZF 5EBMA 5FM5O 2ZJSH 4B95C 3BUBA 4M48H 2RACA 3NIDB 1KGYE 4JN1L 3S97C 2GVYA 4YDZA 4QTHB 1OAYL 3QB7C 1AANA 4YL9A 4ZW8A 5DJ2B 1G84A 5CXPA 4I3RL 4NFCA 4J3OF 3CVHB 4N2NA 2E59A 4KXZI 4OJFH 3BWUC 4XO3A 3MBXL 5BW7C 5ESAB 2NX5D 3GLDA 4L8SC 5EZOL 4QKXB 4HCRA 1NC4A 5GS0L 1IKNC 1H6EA 1A9VA 1Z0MA 2UY6A 4K8RL 2P46B 5FYJL 5F9AC 5AAPA 1BX2B 4NNXA 2CDEB 5DHMC 1FZJB 1XF4B 1DANT 1WEJH 4Z7OF 5E6YA 1QW8A 4MAZA 1T0MB 1H9DA 4OZGE 3S8WA 1UZ8A 1HE7A 2BIPA 2JIXA 2CO3A 2JI2A 2XNAA 1KENH 4H1LH 2R23A 1SVCP 1A4JA 3ORJA 4DHLA 4ISVB 3TVMD 3ZE2E 2Y5TB 4X6CB 1QLEB 1DQLL 3HJEA 1TCRA 4PV9A 3TO4C 2WAHA 3KYOA 1NGXB 1Z3GL 3R0NA 1TQSA 4AE1A 3CLFL 4JN1H 4BIKA 1BBJA 1OAYH 1WCQA 2EO7A 3KGTA 5JXEC 5T1MA 1I1AA 4I3RH 1RXLA 3EJSA 4QCIB 4PRAA 4NJ9L 3AG3B 5ALCL 4QXTA 3B3IB 4V11A 3MBXH 2JKLA 5IK3B 5EZOH 3ZOAA 3QXAB 3ALWA 2NOYA 4YOKA 2NY1B 1ONQB 3U1SL 2R1XA 4NHUB 3ES6B 4K8RH 4Z3TA 4UYPA 2D31B 3BWAA 2LW3A 3AM8C 3BZFB 3QUXA 3D87B 1I75A 4PJXB 4KX8A 4HD5A 1S3RA 3P1VA 1EPFA 1Q0EA 4ZAKD 3L16A 1F11B 2JLLA 2VLJE 3WKQA 5I15H 2P5WB 4YQXL 3TBYA 2NY6C 2AXGB 1PZ3A 1FYHB 1Z9OA 1DQLH 4XXDA 3MJ9L 2X1OA 1Z3GH 3CLFH 4JREC 4PGDB 4JPIA 4KDWA 2DKMA 3VSVA 4A2HA 1MQ8A 3WN5B 1BGXL 4GO6B 4NJ9H 4UQAA 2NYKA 4NZUL 4U1SA 2BOBB 5ALCH 3TWCL 5GS1A 2JCWA 2Y36L 4A7VA 4GAYB 4Z18A 4LLAA 2O5YL 3PWUB 3VU1A 1S7XB 4NUJA 2BX5A 5FS5A 2OXHA 1T2JA 3MRIB 1X5HA 2YMXL 4ZMAT 3U1SH 2PYEE 1X9LA 2FIKB 5TFSH 3BHBA 5TK2A 3QEUB 4Q7DA 4BK5C 3WIHA 1INQA 2OCFD 1NC4D 2L0DA 4HA1A 1VLXA 4JVWA 5D7LA 5GRVL 1RH8A 4FTVB 3F85A 3N43B 4GRMB 3NABH 1RUKL 1E2VA 1RJZB 3MV7B 4QRPA 4YQXH 3CHPA 4HJTA 5CU5A 3ULUL 4C57C 3OWEA 4OR1A 1WYJA 1SF3A 4PD4K 1JI1A 2A99A 5EOTB 5D4QA 2HT2C 4TSAL 5E0QA 2PPDA 1NICA 2JIXD 1F4WL 1DE4B 1NBQA 2XWJA 5HHME 4L1LA 3WUWB 1QSZA 2Q7YA 1UA6L 4YVUA 2MOQA 2EYRB 4BCYA 3GSUA 4ZDHA 4AKOA 2VDQL 5CGYD 2WBJB 3SODB 3VFOA 3B9KB 4NZUH 3TWCH 3S8GB 4G8AC 1UG9A 2YLKA 2O5YH 5C0DA 3N06B 1I1AD 3BPLC 1JV5A 4J3UA 2F7RA 3VXUB 3BKJL 3NBNA 2CJTA 2YMXH 4JKKA 4KU1A 5GSRB 4AUUA 4K5LA 3QIWA 3TP4A 4E5XB 4X7DC 3L5WA 2HFEB 3X12B 4MDRA 4Z76A 2YGVA 4BKTC 4NN5B 3WNMA 2PWHA 4GINA 5EZLA 2BNRA 4TN9A 1QEWA 1RUKH 3QUXD 1S9YB 1IC4L 4G1MB 2H1XA 4HH9A 4GIPD 3ARUA 1XBRA 1PNDA 3H9HB 3K0WA 1V7NL 4TSAH 3FUIA 2WOYA 1TKWB 4N86A 1K4CA 1F4WH 2MPVA 2BJML 1UA6H 1FCGA 4LCWB 1BFOB 2ZNXA 9CGTA 3O11B 3APFA 2X0VA 2VDQH 4UAHA 2N56A 4OFIA 5SX4H 3SYAA 2AXJA 1JI2A 4OUUA 3IDMA 2B5IC 1S7WB 1XO8A 2FECL 3DURB 3V0DA 1XCQA 2I07A 3NCEB 3OZ9L 4YFDB 4L4VB 2WLLB 3W9DB 3BKJH 4UDTB 3L3GA 1YYLL 4WI3A 3IJHA 1R3HA 4DWHA 4LVNC 3CXDH 4M6AA 3GIZH 4W93A 1SY6A 4OGAC 4OD1L 4M9PA 2OV0A 3QXDA 3VTTA 3P4MB 5EU5A 4NZJA 4K3HA 1G7QA 1IC4H 2APFA 4HZLB 1VZGA 5D7LD 2NQCA 1V7NH 4O02L 1JNJA 4ELKB 1OP5K 3LEVL 2WINB 3EH1A 5CJ5A 4JG1L 4NPYB 4QRPD 3K6DA 4GRWH 4Q6IC 4RNRB 5FLUA 3TBSA 2BJMH 2YARA 4U6VL 3QAZB 2X0UA 4O2FA 4I18C 1DJYA 1YEJL 3UEZA 1KNOA 2X40A 4HIJB 3WTYA 3BGMA 2ZYHA 1NPNA 2WXOA 2FJHB 3VVWA 3R19A 3OZ9H 4NRXA 4BUHA 4GRLA 3SDDD 1FE8L 2WZ5A 5TK4A 4NQTA 2N7AA 1YYLH 2FQDA 3KS0H 4MTMA 4P48A 5AFAA 2IDQA 4ZMXA 1C16A 2VW7A 2EIDA 3AABA 5AKSA 1W16A 4U1IB 2CBTA 4P23C 4HZAA 3FNKA 3STZB 5ECGA 2Q2EB 1NUDA 2YKLL 4OD1H 5E9AA 1Y1DA 3QIWD 1OGTB 3NRQA 3F83A 1QZ1A 5IBUG 2PPEA 3NZ8B 4R8WL 3ZQXA 5J9PA 3O4OB 1J0ZA 3C6LA 1ZLUK 4LSDA 1G9HA 5IFAL 3LEVH 1RPKA 2BNRD 2DQFB 3ALPA 3PWJA 1KPUB 3LZLA 2XTLA 4NN6B 4WTQA 5GZOA 4JG1H 2IALB 3QQ3B 4NP4L 2IWFA 1TU2B 4U6VH 4GUPA 2XXCB 3B6SB 2JKRM 4GXVL 2P43B 4J39A 4LLVA 2DICA 4KUCF 1CL7I 2QL1A 2CO2A 2X42A 4KKPA 5DMJB 3N41F 1A8ZA 4OJEH 2PXYC 3IEAA 2J12B 1FE8H 4J2XA 2HG5A 5I0WA 3HN8A 4MASA 5GGRB 3VXRB 4BD4A 5TE6L 3FSAA 3LIZA 3FOMA 5EU3A 3IGKA 3F12A 2QSVA 5I5JA 4FQXB 1HZKA 1CG9B 2AK4E 2NY5C 2YKLH 3QJQB 2YJQA 4NQCB 4ZPTB 5EUOB 4MMZA 3BN9D 4BSJA 2DKSA 4NAJA 2EDHA 2C9SA 3OF6A 1FP5A 1MCJA 1RUAH 2VR5A 2YC1B 4FQ1L 4P4RA 4Y88A 1XSOA 3S2CA 5KAQF 5IFAH 3TNNB 3LZFH 3EOTL 4C56A 1HOEA 3N42F 1LWHA 4JFPA 4J6IA 5LDSA 2BNQE 5MERB 4NP4H 4XI5D 3D52A 5KZCB 4WW2A 1U8IB 4GXVH 2HLAB 3GMRB 5EIIA 1IBYA 1FFOA 2BHYA 1YQ2A 3UP6A 2CBPA 3FSWA 1WFNA 3UL4A 1IAII 1PD1A 4JR9L 3MRBB 4OJCA 3CSYB 4KI5F 3OXSA 4UCFA 7PAZA 3ECUA 3QZNA 4IIZA 5HHVL 4JRYA 3H0TA 4QTFA 3VFGL 5D1QB 4DGVH 3P9WB 2AV1B 2PW2A 4MZ2A 4YJZL 5TE6H 4Y1AB 4OM1H 3L2NA 3FTZA 5CCHE 1HHGA 1MOEA 4GRLD 4YIQB 3GMPB 4U1JA 3MUZ1 4NWUH 4Y19A 3UBFA 5K69A 2K6WA 1QZNA 2O5XL 3OG6B 3UMNA 4FLQA 3EJZC 5E1AB 5EBLA 3SKMB 3V6OE 4I2XA 3H7BB 1E4XI 4GSRA 4HUWA 2V2TA 3BP7A 4FKHA 2CD0A 5DJZB 3EOTH 3TGXA 1CD1A 2OXGB 3LPGA 5HYSG 3CIQA 3HFFA 1LEIA 3C6LD 1FVDB 4QHNA 4CC1A 2YD0A 1D7BA 3CCHB 4MJ6B 1NLDL 1QRNA 4OIAA 5GZOD 1MW0A 3K7UA 1A7PL 5A3IC 3MV9E 1CZ8L 1UJ3C 4JRLA 2VISB 5I6XC 4M93B 1ETA1 3QO0A 4L29B 2VDOL 4NLHA 1T1ZB 4TNFA 2ZX6A 4YC2B 5HHVH 3RWGB 2ZQKA 4W6WB 3VFGH 4CSSA 5KTEL 1T7WA 1M05A 4AQAB 5TJWK 3UJJL 1KBBA 3FQUA 3OM3B 2ATKA 5LBVA 4ZUTB 1AKJA 1VFMA 2PKDA 3ARWA 3VYOA 3WMPA 3H2QA 4QF1A 4PJ5B 2JXMB 1BVOA 1ZJAA 2YLHA 2WXRA 3UBXG 2X6VA 1NOLA 2YGNA 3QDMA 2O5XH 1LEGB 5CO1A 2VCOA 1GZQA 5T1LA 3JTBA 4MA3B 4UMSA 4W9LC 3EFDL 1KFAL 3UG4A 3U6RB 1PZ2A 4X5RA 1WWWX 3OKDB 3OF6D 4FXKB 3W11D 3QHFL 2ALWA 2QADC 5AVQB 4JFOB 3WNIA 4QTHA 2QPUA 1NLDH 4C56D 2YD7A 4X7EC 5DJ2A 3DGCR 4OFYA 1A7PH 3IN0A 3QARA 1TYJA 4AZUA 3O6KL 4GBXC 1CZ8H 2X1XR 3CVHA 3Q5TA 4PUBL 2VDOH 4LMQE 3LNDA 1JF6A 5ESAA 5SWQA 2YA2A 2D2OA 4I1RA 3CVBA 2M1KA 1P7KB 3VFRB 1SHSA 3CXHJ 1V7ML 5E2WL 4U2ZA 3DYOA 4DGYL 3AC0A 3I3DA 1A22B 4HUCA 4AENB 5T3ZD 3UJJH 4G9FE 4RRPA 2YEVB 2HVKB 3NCJL 1BX2A 4JRYD 4DW2L 4F8LA 2CXGA 2DRUA 4OCSL 2CDEA 2ZYSA 3W5NA 3ZHNA 1FZJA 1XF4A 3MTXA 1WZMA 4H5SB 3EDKA 4DK3A 3QZLA 1T0MA 4XN5A 2ZIDA 1RZKL 4R3SB 3GEWB 2CIKA 1QSFB 3EFDH 3FBQA 1AZCA 1KFAH 1ET5A 3ILQC 1DFXA 4G6JL 4Y9BA 3S3CB 4ZX6A 1NFKA 4Z7VA 4Y19D 4HFWB 2JJVA 4X6CA 3QHFH 4JVUA 1NGXA 4PJ8B 1EWHA 1WS8A 1D6VL 3EJQA 5AYUL 2B16A 1KLUB 3KJ4B 4LLQB 1FRGL 3TT3L 3Q8EA 2IFFL 5IJDC 1ODAA 3V5DB 5HPOA 1RUPL 2IDCA 4NOBA 2IBBA 4LLWB 4K4KA 4JQVA 4PUBH 3GBNL 3B3IA 3F58L 1QRND 5CHNA 3TZVC 4CA4A 5IK3A 3PNRB 3QXAA 2R69L 2DM4A 1V7MH 5E2WH 1HSBA 2ED9A 1ADQL 3T3ME 1DJXA 5JQ6H 1ONQA 4WSJA 4NHUA 3ES6A 4M29A 5LWYL 2D31A 4DZ8B 3ESVF 1KIPB 2EIZB 3BZFA 3NCJH 3I6LE 4X6EB 4DW2H 5C8JB 5I5MA 2P49B 3RVXD 4PVBA 3L9EA 5DZLA 3VYNA 1SJHB 4XOCA 5CEYA 4DUXA 1RZKH 1AKJD 5HI4C 1F11A 4MNQB 2P5WA 3FO0L 3WO3B 3HG2A 4A67A 5I0YA 2G9KA 3QDMD 4MJHA 2O6PA 2YQBA 2AXGA 3LKPB 4JFZH 5T1LD 2N4IA 1YN7A 2B39A 1YEDB 4Z7VF 2BZCA 2E9WA 5DFVD 1D6VH 5C07E 3B9VA 3VI3E 5AYUH 3MN8A 4PGDA 4DEPC 1FRGH 4X98B 3TT3H 2IFFH 2P5PA 4N24A 1CC3A 1PFCA 3WN5A 4QJ5B 3T2OA 1RUPH 4ODBD 4MA1B 2BOBA 3GBNH 4GAYA 2D3JA 1K72A 3F58H 3PWUA 2XV2A 5E7BA 5HI5D 1DO5A 1S7XA 3DLQR 4OFYD 1AE6L 3ARDC 3MRIA 1ADQH 4FP8L 4GG6E 1JTOA 5AW5B 3PAUA 5LWYH 3QEUA 3K2KA 3ZTJG 4LDOB 2HWZL 1N18A 1I8UA 4R97C 3H54A 2CJUH 4FTVA 5D1ZA 2JE8A 4ATTA 3CLWA 4IOIA 4GRMA 4XCYB 1RJZA 2YD4A 4OY9A 3MV7A 2JKIS 1XTLA 3FO0H 5J56B 1YECL 2VXTL 3D18B 3AREB 3DV6B 5DDHB 1X4ZA 3UTSB 2PYEB 3VGAC 5EOTA 5C0IB 2PTUA 4LKXA 1C5DB 1AS7A 4HWUA 1DE4A 4XVSL 3ARGB 4E9XA 1KELL 4DP8X 4B9GA 4XVUC 3SJVB 5BZDB 1T1XB 3WLBB 4PV8B 1J12A 3QUYC 2WBJA 2WXGA 1NINA 2GIXA 3B9KA 4JCWA 3SQOL 1G9NC 4G2AA 1GR7A 1I8AA 3Q2CA 3WY2A 3D3VB 4IHOB 4ZW6A 3K6FA 4ACPA 2AFNA 4BHUI 3B7RL 5ICYB 3VD2A 3VXUA 1P6WA 2D0GA 4FP8H 3DOIA 5DHVB 4JZNA 2VLKB 5GSRA 3V0GA 4JKLA 4E5XA 3B7UX 4I48A 3QA3B 3LQZB 4YHYC 4AW7A 1OM9A 2HFEA 2NUPA 2NY1D 2HWZH 2Y6SD 4K3EL 5I6PA 3UJIL 2Z7YA 3X12A 2LTQB 5ACZA 4AVKA 3N5AA 4XNBA 5DU7A 4MHHI 3KWUA 1NH6A 1QUNB 3PDGA 2PWGA 3BLPX 2VDKB 1S9YA 4G1MA 5F1NB 1AS6A 4ZZFA 4HLZG 1YECH 2VXTH 4L9LC 4XN8A 4F2FA 5IHZB 3H9HA 5KSVB 3H3KA 1EZVX 5I73C 3EYVB 1S7QB 4K9EH 5DUJA 1TKWA 1M1XB 2G2RB 1DVQA 1T7VA 2P5WD 3ELAT 2X9XA 4XVSH 4RWYL 1KIRB 1NKOA 1KELH 2AITA 3QJVB 4HG4K 4XX5A 4LCWA 4MVBD 1BFOA 1IU1A 4B7LA 3N44F 3V7AE 1U8NB 4OBRA 3L2MA 3SQOH 2AQ1A 2ZXGA 3DX4A 4LSVL 2WD0A 3PFQA 2HRLA 1S7WA 3ARVA 3V6ZB 1U3HC 1W9XA 3TA3C 3LEXB 5E4EB 1U2HA 4NN7B 1QFOA 3VRLE 2YRPA 4L4VA 4UDTA 1X7SA 3BDXA 2QDVA 3VFMB 2D73A 5DXWA 4JG0H 3LIUA 1MRFL 3JUYA 1KIUB 4E9SA 3Q7JA 1HHKB 3UJIH 4ADGA 3RILA 2WXIA 1JBJA 1G1OA 2WZPA 1MJ7L 5EEZA 4GW4A 3P4MA 4U2YA 4HZLA 2CBMA 3E3QC 1S7RA 2VDLB 4FTVD 5D1ZD 2QHRL 4WTZA 4NPYA 3MV7D 4RNRA 4XNYL 4RWYH 4UV4L 2BS9A 3NOIA 3TBTB 5IJKA 1FIEA 2O61B 3BGAA 1AZUA 1PY9A 1IGYB 4IRZH 1EEUA 5EU6E 4P4KB 3WJLA 4O00A 4BFFA 2VDNB 4HIJA 1CXLA 3V0FA 4W70A 3FSOA 5EZJB 1N26A 4NM4L 4KGJA 2FJHA 4QXGL 4YZFE 3IU3B 4OZHE 3LCYA 2I25N 2WBJD 5LBSH 2I9LA 3B9KD 1SDDB 1NBZB 2CMRL 4Q2ZB 4ZMWA 4DF9A 4QRSB 3MRKB 1MRFH 5LNGA 4M8UA 3L4YA 4U1IA 1LO4L 3VXUD 1JPFB 3STZA 3QS3A 3NQIA 5AW9B 1UJTA 1SN0A 2K45A 2KZBA 1MJ7H 3GUTB 2R1WA 1OLZA 1JFHA 2I26N 4OV5B 3GRWA 2J1XA 5LO7A 3BUTA 1XAKA 3RIAF 3S34L 4YXHH 3GRGA 5FCSH 1KPUA 3EO0B 2VYRE 3WKML 2IALA 3QQ3A 5AALA 4DKAA 2DS4A 2KDYA 2H47C 4RQQB 1TU2A 2ZD0A 3B6SA 5FWQA 3VM5A 4D0BB 2ZKXA 1TQCB 3BVVA 4L8BB 1CVRA 2V17L 4LBAA 1AZVA 3U0TB 1YEIL 4NM4H 4LCWD 5CGBA 4LSRL 4ZTPL 4QXGH 4KO5A 3DRQB 2IOIA 3OJMB 5KSUB 1ET8A 3OZLA 1RZQA 1UM5L 2CMRH 4UT7L 3WD5H 5GGRA 3VXRA 1DVYA 4EO5A 2O5ZH 1FFPA 5KSBF 3KPPB 4PQXA 4I1PA 1LO4H 3EFOA 4FQXA 3TTSA 2H1LM 2E76C 4L4VD 1CG9A 1G1YA 4BRVA 1LDSA 4NQCA 4MS8D 4ZPTA 2WP3T 5EUOA 3TLRA 4B0MB 1BXAA 3CZGA 2YC1A 3I9GL 3ARRA 3QWOA 2VSKB 4C54A 3WHE1 2MOVA 3IJ8A 5C86A 4L8CB 4JM2B 3S34H 2B0SL 3FFDB 2WZPD 3TNNA 5DVNA 1U92B 2YKKA 1U8PB 3MLWH 3OBAA 3WKMH 4ZBJA 5MERA 4AQ1A 1T7XA 3L7FB 1LTXA 2DMGA 5FUOL 1F5WA 1U8IA 2AK4B 2G3ZA 2HLAA 3GMRA 1P5UA 4CSPA 4MCNA 1QHPA 4NKDB 1YEIH 3MRBA 3QJSB 4RMSA 3S98A 3ZSSA 3CSYA 5A7EA 3HUJE 5J7CC 2BRRH 1L6XA 1RV6X 4LSRH 4ZTPH 2EINB 4Y9GA 3FU0A 5DMYA 3OJ2C 3OLEA 1UM5H 2BNQB 1XDTT 1D7FA 4JKNA 4UT7H 2AV1A 4LASL 5D1QA 1CI5A 4Y1AA 3Q6GH 4XGZB 1MELA 3KWWB 4I13B 4PW3A 4YIQA 1WRFA 2NTSP 4I87A 1S7SB 5KBDA 3BVUA 4EKJA 3CN3A 3HBPA 2Z8SA 5F96L 2P47B 5E24E 1ZAGA 3I9GH 4N2DA 5E1AA 3H7BA 2DDQL 5EEWA 5FO2A 2B0SH 3HC2A 5HGHB 1KUMA 4NQEE 4HK0B 4JRFA 5DJZA 3KLLA 2HT3C 3V9CA 2OXGA 1NM9A 5D93C 4Z7UF 4X8XA 1FVDA 2V5SA 5IB4B 4UT6A 2EIKB 1YNTB 2J5LB 5FUOH 1CF8L 3DX2A 4FC3E 2R4SH 4QLRA 3CCHA 4MJ6A 4FTDA 2XPYA 5EEYA 3FQRB 4G8GB 3JT2A 2VISA 1OANA 3GSRB 4H0HB 3DSNB 5CINL 4OKDA 1YY9D 1T1ZA 2EYSB 3LXUX 4PJEE 5B3NA 5F97E 1UZ6F 3RWGA 1L5GB 3GHEL 3JWOH 4OIBA 4NB7A 4LASH 4AQAA 3TPKA 2UUDK 4EUPG 1DJZA 2XHNA 1ACCA 5INDB 3ZE0E 4D7PA 1I1RA 3T5WA 1GKOA 3SCMB 3ML8A 3R0MA 4ZUTA 1W80A 3IAQA 3I6GB 2JXMA 4PJ5A 3UC2A 5A40E 3MV9B 1FG2B 3NRPA 4XO4A 3VXRD 4QO1B 5F96H 2J4WL 1CXFA 2AEPL 1ZHBB 1LEGA 3GBLA 4LCUB 1NGZB 4FQXD 4MA3A 2OKMA 3CN2A 4URTB 2DDQH 5IB3B 3U6RA 5BV7L 4NQCD 3W82A 1B4RA 2XXMB 3OKDA 4GW1B 4FXKA 4KKAD 2XWDA 1DVTA 4HAKA 1CF8H 4N22A 5HHNB 3FUKA 5IBLD 2EYTA 5ACMA 3RZWA 4KK8D 4JK0D 1USZA 5KZCD 4ONGL 5F3BA 2WLNA 2EDQA 2X2IA 4N0CD 4GUQA 2N7SA 4RVBA 1AZNA 2WWKO 4H26A 1CDHA 4NFDA 5CINH 3VGGA 1P7KA 3PJNA 3VFRA 3GHEH 4IOSA 3NCYS 5AB0A 4HUKB 3UDWC 2W94A 4FABL 4AENA 1LMIA 5B3SB 4Y2DA 1PS3A 2C3XA 2HVKA 4YH6A 2BSDA 4P5SA 3WNPA 3V79C 5D1QD 2O6FA 3LH8A 5TF0A 4H5SA 4HWNA 3EOAB 4RDQF 4N1CA 3MA7A 4Y1AD 3ZGHA 3EHBC 3DHPA 4R3SA 1HL9A 2AMGA 4HJEA 1QSFA 4HLJA 2O6DA 4WWKB 5B4MD 3V4PL 3ARXA 2BSRB 4HFWA 5CBEB 4BQ9A 4KKBD 4PGJA 3ZKNC 4M62H 4PJ8A 4X9IA 3SPJA 3D39E 3ASOB 1QX1A 5DF0A 1KLUA 4LLQA 1YAZA 3V5DA 3X17A 4ONGH 2Y2WA 3CVDA 1NAMB 1SPDA 4LLWA 1BM3L 4P3CL 4MCYB 4NNPL 4WI4A 2LVEA 3PWNA 3CZSA 5LDUA 5C0CD 4WV1C 5CJXC 3G5ZA 2AANA 4W4OA 2VL4A 5AB9A 4FABH 5IHWA 1K4DB 3U6XS 1NL0L 3V0JA 1D5IL 1KIPA 2EIZA 1UWXK 5C8JA 4AV4A 1TJHL 2IFGA 3MV8E 3FZUD 2CXKA 2CNYA 1SJHA 4X7CC 2YD5A 3NIFE 5EO0B 1Y6NR 4L3FA 3B1TA 3O6LL 3IFOB 1W8EA 4MNQA 4PJ5D 4AYID 2YSSB 4FADA 2YOCA 3G6AB 3T3MB 1KJ2B 3LKPA 3K8MA 3RU8L 5AW1B 4ZMOA 5LAPA 1DDTA 3HBGA 3MOAL 4P04A 3A4EA 1M6OB 4R7DB 4AEHL 4B9ZA 1E8YA 3K1KC 4J3OC 2PPCA 3T0VA 3V0HA 1BQRA 1JDDA 3VH8B 4H40A 4OU3A 4KRPB 4YHKL 3BLKA 4P3CH 5E56A 5SX4I 1ASOA 1BM3H 2VMCA 3Q48A 4HCRL 5TGBB 3AU1B 4NNPH 4FS0A 3QXTA 4JO2H 2VTFA 1IFRA 1DJIA 4PJBE 2AQPA 2VDPB 3FH8A 1L9NA 3TFKD 5C07B 1NL0H 5DZVA 3VI3B 1CD0A 1PZUB 1D5IH 2WTRB 1JGDB 1LVEA 1TJHH 2QR0B 5DGQA 4BZYA 4IOSD 3FUEA 4OJYA 5GZNC 1KMGA 3IWUA 2G5RA 4Y2DD 5EEUA 3VJ6B 4QJ4B 1JK9B 5CNHA 4TNWK 3ZLQC 3D18A 1VADB 3AREA 3L5HA 3DV6A 2Y7LA 3H85A 5DDHA 3UTSA 3PQYE 3HS9A 3MOAH 2H2SD 5C0IA 1QSFD 5DS8B 1C5DA 4AEHH 1G4MA 2J8HA 4NQDE 1GGBL 1WLHA 3SJVA 1E90A 1T1XA 3WLBA 5DHXB 1NOAA 4YHKH 3COOA 2VSCA 1OSYA 4PJ8D 4HCRH 1Q0XL 2XOTA 3DYPA 2FECI 3OQRA 4AIZB 3AXIA 3LQAC 1WZ1L 3DETD 1HYSD 3C5SB 3D3VA 4IHOA 5IW1B 4Q14A 5ICYA 3ATFA 3ZDZE 2WXFA 4OV6F 2VLKA 4G7YH 4H13C 5I6KA 5FYLL 4D8PB 1IGTB 4R5TA 3QA3A 3AQYA 3ILPB 3LQZA 3MGOB 3UZEA 2C1PB 3T0BA 1F86A 2IMNA 4N28A 1BIHA 4OD3L 3DUUB 5C09B 1QUNA 4LL9A 5F1NA 1CCZA 2IH1B 5IHZA 5IEHB 5CZRA 4PP2B 2HH0L 5I18L 4FI8A 1A6TB 4HAGA 3Q9PA 3BEVB 3DX8B 3BSZA 1S7QA 3KE0A 1J5IA 1NCUA 3UG3A 1M1XA 2G2RA 4MNQD 4WNQB 4N5ED 3H8NA 1KIRA 2BSCA 3SGJC 4NI6A 2XN2A 3RNQB 1KEGL 3B2PA 1I9JL 3G9AB 2VZSA 4FLRA 1U8NA 3FPXA 1Q0XH 1A4AA 1VSCA 2VRKA 3V6ZA 2PPAA 1S8DB 3T0EE 1WZ1H 5I71B 5DJDB 3DO7B 2E4TA 4BXVA 1M57B 1G94A 5HGBB 1QR1B 2D3NA 3WIHL 2QZ5A 5DMIL 4X99B 5HHPB 1W6LA 2NQDA 3VFMA 3UAAA 1S6NA 3ESOA 1KIUA 1GGYA 1OB0A 5DVOA 1ADWA 1HHKA 1WVZA 2FRGP 4PP1D 4GAJL 4GXFA 5L88L 3RUGE 4OD3H 3L54A 1F0LA 1XR9A 1BYOA 4QXUL 4FFVC 1EHNA 1PFOA 5GGRY 5KVGL 3FK3A 3N0PB 2JTDA 2VLRB 4HJGB 4R96B 2RR3A 2HH0H 1U30A 2YRLA 4UMGA 1F1AA 4PG9B 5M94B 4MQSB 1GKEA 3ARED 3GRBA 5ICZB 1IM9A 2VN6A 2VABB 3JWNE 3TBTA 2DQUL 3UTSD 5IMOB 1NCIA 1EXGA 3NAAL 2FSEB 4HUNB 2O61A 1IGYA 1JDAA 1A7RL 4G11A 3WO4B 4P4KA 2VMJA 5KS9F 5JMOC 2XTJE 4LNVA 5EZJA 3FU3A 4HCFA 2YBGA 3SJVD 3BEWB 4G82A 1RHFA 3IU3A 4Z3IA 5D7IE 4KH2A 3WIHH 5DMIH 3T4AC 3LPPA 1SDDA 1C08B 1NBZA 1S5HB 4Q2ZA 4EVNB 2EDEA 2DQHL 1SJEB 4QRSA 4DTGL 2FX8L 3MRKA 3D3VD 2D7PA 1E28B 1HI6A 2EO1A 5K1JA 1JPFA 4B7IA 5L88H 4GAJH 1IQWL 1BQUA 2VLKD 1C12B 3Q01A 1NCDL 3KM1A 4QXUH 5F9JB 4JFHE 4OV5A 5KVGH 1QG3A 1TZAA 4QTIL 5DEGB 1WHPA 4YBHA 5DO2C 3QDGE 2R2EB 4RQQA 1EJFA 4RMUA 4M1GH 4YDKH 2DQUH 3BAYA 3OSVA 4Q6YA 4YK4C 1KLGB 4AYFA 4D0BA 1E7VA 4A68A 3N55A 2ALAA 3ZE1B 5L8JB 1A7RH 4L8BA 4JO1L 4RAVB 4HS3B 3VWKB 2OMNA 3IBOA 2GTZA 3U0TA 4AUJA 3RZCC 3T77B 1YHPA 3ML9A 1N64H 1YEFL 1WSST 4DZBB 3DRQA 3P77B 1TENA 5KSUA 1E9PB 3L3DB 2BVOB 1U3JA 2ZXAA 3EAKA 4BQ8A 2DQHH 1R34A 1WAAA 4DTGH 2FX8H 2FO4B 4UWQB 4BK8A 3KPPA 5IIEB 5HP5A 3QXUA 4NQXB 4LFHD 3E8VA 1Y07A 3GI9H 1IQWH 3Q5OA 1NCDH 3KW8A 4HXBL 5DD0L 1KCSL 2NPLX 2FWOB 5I1DB 1TSHA 2Y7NA 3EW3B 3TBCA 4ODSL 1ZK5A 4XOEA 3HAEG 3RVUD 4FG6D 1DJWA 2B9AA 2W91A 3FFDA 2VT0A 1JXJA 4GXUN 4QTIH 1KYAA 2ZX7A 3G5YB 1U92A 4RGMB 2DIEA 1U8PA 5AW2B 5H37G 1UTDA 3MRFB 3L7FA 1OPGL 2AK4A 4HUUB 4YHPB 5BZXA 3DYMA 2EDFA 4DKFH 4JO1H 1JE6A 4XXCA 1YY8B 4JBSA 2ADFL 4NKDA 5D1XE 5ABDE 1IM9D 3IKCA 3TA4D 1YEFH 4TL5A 1A5FL 3TEYA 1HX0A 4P4KD 2FNBA 3HE6B 1AHWC 1SY6H 2BNQA 2X10A 4QD2E 2HX8A 4QNPE 1KG0B 3I85A 4XGZA 5C7ZA 2ZSVB 5LAXB 2Y2TA 3MNWB 4FLHA 3KWWA 3FUFA 3AB0C 4BKSC 1WAAF 1F2QA 1S7VB 1S7SA 3H2PA 4YXKL 5I23A 2N7BA 4HXBH 5DD0H 1OB1B 1KCSH 1HFUA 4HUXA 4YE0A 4C4BA 3AU0A 4G7VL 2PO6B 4ODSH 4YPGA 3RY6C 1KCLA 3FTVA 4BH7B 5HGHA 3IMTA 4MD4B 3NEXA 4HK0A 1KN2L 5SWSA 1KOAA 1R5IA 2FO8A 4MXQC 5JHBA 1TVDA 2OSLB 2YFNA 5IB4A 4HUVB 2D7OA 1YNTA 2BC4A 2ZUWA 1WF5A 3U2JA 1IAKB 4Z7IA 4ZFFA 4TRPL 1DANU 3SGDI 3FQRA 2CUIA 4K5NA 4G8GA 5F9DC 1EGJA 2ADFH 2JSFA 3V6OA 3VWJC 3GSRA 4FXGB 1N12A 5IBTL 1U4FA 5AOMA 5JPNA 1JZFA 1L5GA 3MQIA 3QQNA 1L0QA 1GMEA 3IMWA 1KDIA 2UZYB 1HYRC 4KK6D 5INDA 2ID5A 3SCMA 4L23A 3DXAE 3BMWA 5F7YC 3I6GA 2XXFA 3MV9A 4NQVB 2FK9A 5HDRA 1FG2A 4YXKH 5HI3C 1RCYA 5LGHL 1CVSC 4QO1A 1ZHBA 4LCUA 4G7VH 1NGZA 2H0JA 5FDWA 2W5PA 1BMGA 4YBQC 2X9YA 2BVUA 5IB3A 1J11A 1I7ZB 1KN2H 4M3JA 1KEMH 3HMWL 2FVNA 3ZE0B 3FCTB 2Q3XA 3V6FB 5GRWA 1FGNL 1MCCA 1NDMB 3C09B 4QR7A 4TRPH 4XBMA 1HWHB 3FQ2A 4Y5VC 2A4EA 5T3ZL 4KI5C 1O6SB 3FFCA 5HDBF 1OEZW 3A23A 4QOKB 3LOWA 1OOWA 4NO0B 2MEJB 2XY1A 4M1CD 4XVJL 5IBTH 3LIZH 2YEZB 5E6ZA 5A2BA 3MCLL 1NC2B 3Q5YA 4WEUD 5BUPA 1P6FA 4NXKA 4EIZC 3LZOA 5E08L 2F8IA 2BNUA 3NZHL 4KVCL 4HU8A 4M43L 2ERJC 5ADOL 5CN1A 3KPMB 4Q9RH 1AOHA 2VQUA 5GXBB 2BNQD 5GS0C 2KHAA 4MXVF 3EOAA 5LGHH 5DWPA 5IHLB 3MCYA 3U7YL 1EVTC 2OYKA 2XBDA 4FGMA 5AVRB 4IBYA 4OCLC 1UWFA 1JRHL 2BW4A 2ODIA 4N2GA 4WWKA 2BOLA 1E2ZA 2H2PC 4S1SL 5DJ8B 5HDQL 5CBEA 1QABA 2WK2A 1FGNH 4H8WL 4Z3GA 2A7BA 4M9OA 3MYJB 1OAUH 4PJ9D 5E5RB 1N59B 2OMYA 3MI6A 5I75B 5T3ZH 4H88H 1YSOA 2XWZA 5SWSD 3WEBA 3KEDA 1NAMA 1PF3A 2RMNA 3WDIA 4MCYA 1U8JB 4EMZA 4XVJH 1GIGL 1ZVNA 2LR4A 4HDIB 1XV8A 4L1HA 2W9DL 3MCLH 4G8GD 4MA8L 3MRNB 5TE4L 5EDXA 5E08H 4EAEA 4TLSA 1OCRB 3NZHH 4KVCH 1K4DA 3GKZA 3SDCB 1HEHC 3RDJA 5ADOH 4OLZL 4KQ0A 2C9AA 3OB8A 3PAYA 2WM0A 4UQ2B 3KWXA 2FSDA 2LHAA 1WPCA 4ZT1A 4OTXL 3U7YH 3QIUB 3SCMD 4HJUA 2IOOA 4MWFB 5EO0A 1TF4A 3QDHA 4N85A 1URLA 3IFOA 1JRHH 2Q7AA 3FQYA 3QJXA 3HE7C 2YSSA 4FA7B 3EOYG 3MFGB 2VUYA 4S1SH 1XHHA 3G6AA 3L3OB 1KJ2A 5HDQH 3T0AA 4AJWA 4AWJC 1AGDB 5D72L 3OHXC 3C75A 4H8WH 1M6OA 3RQ3A 3GKWL 4R7DA 2X7LB 3WAJA 1QFPA 3E80A 4I4WB 1RKRA 3CVHL 4N4YB 4RFNC 5B39B 1A6ZA 4KJPD 5LGJB 1E8WA 3OKEB 1T6WA 5ALBH 3VH8A 1AD0A 5TGBA 1VZIA 5HHXL 1GIGH 4OZFB 2WPGA 3KJ6L 3FFCD 2R59A 4MA8H 3CXHK 3VQLA 5IVXE 2ZCZA 2QELA 1E42A 1GY2A 3VI3A 1ETB1 4OLZH 3OAZK 4S2SB 4ZOEA 4FN0A 2WTRA 1X5ZA 1JGDA 4YAQB 3LN5B 1CLYL 1FO0B 5E6IB 3OKKB 2R0WL 5JIIA 4OTXH 3NZSA 3ULVF 3DVFA 3ZHFA 1LE5B 1W0WB 4KNSA 5F7LB 3V5KB 3VJ6A 3OKLB 1MG2C 1JK9A 1QLEL 4IS6A 4LQFL 5AW0B 4PJBB 3ROLA 5L4MA 1Z6JT 1GGCH 1IILE 1VADA 3IK2A 5A16B 4WSKA 1NANH 2Q0ZX 4KITB 5BZWB 1BQHG 2M2DA 4GG8B 3ULUC 4WWKD 3CVHH 3WTTA 3DECA 5DZ9A 3BGFB 3S36L 1J18A 4K2UL 2NSMA 5SWZE 3FTWA 3TU6A 1HSAB 1SYVB 2VMEA 4AIZA 3WEMA 4QHMA 4XO8A 5HHXH 4WHTB 3C5SA 3KJ6H 3UJTH 5IW1A 5L6YL 3PQYB 3RWCB 3MUJA 4R4ND 1EAPB 3L4XA 1A0QL 3OQ3B 3KL5A 2IANB 3LPOA 1TZIB 1F4XH 4NQDB 1SGKA 5BUAA 3RVVC 1OP3H 4NJAL 3ILPA 1TZHB 3MGOA 1CLYH 5JPMC 1T83A 2R0WH 3RHWK 2VJ0A 5C09A 3CTTA 1S78C 4MB5A 5DJXB 5HYSA 2MQCA 2XQBL 1D7DA 2EKSB 1Z5HA 5I8KH 1QLEH 4LQFH 2IH1A 4JVPA 5IEHA 4AGPA 3QRGL 2R2BA 2ZX8A 4PP2A 3RWDB 3ZDZB 4XPFL 1TT6A 3BOVA 1A6TA 4PJDE 1I3GL 2ZXCA 5JW4N 3QRFM 3BEVA 3DX8A 5CZKA 5EU7E 3IJEB 1NDGB 4WNQA 1ORSB 3TEXA 3S36H 4GI6A 5K9JL 1MAML 3TEUA 2JCCB 4K2UH 3OMNB 4TUOA 3CDFA 1LO5B 3RNQA 4HULB 3NA9L 3UTTE 1GYAA 5F9WB 4G6AC 4RGNB 4PRIE 3D0LB 2F6AA 1M1SA 2RH0A 3FO2A 4MX7B 4ONHB 4EUPB 3E1F1 1S8DA 5FGRA 2A73B 4WEBL 5DJDA 2A1WL 3DO7A 3QHZL 4K5OA 5L6YH 3CH8A 1JN6B 2R9HC 5HGBA 2FJSA 4KRPD 5TQ2L 3ZL1A 3EJYD 1QR1A 1A0QH 4X99A 1OTTD 3W39B 5HHPA 3ATBA 3ETBF 4LEEA 2Y1YA 3CGTA 3O2WL 1TZGL 5D71L 4NJAH 3MUY1 5JHDE 1L9TA 3G6JF 5JIHA 1LQBC 2GJ6E 4NO2B 4PU2A 5DD5L 3PXHA 2AJUL 1LM8V 2QKIC 4R2GD 1D9KB 2XQBH 3T0EB 3KLHD 2VN3A 3WFEL 4JUSA 3WS6C 2VLRA 4HJGA 4UNIA 3QRGH 4GRWE 4FNQA 4XPFH 1I3GH 4JZJB 4AMXA 1DO6A 3HKZA 4WENB 3INUL 4PG9A 3VG9B 4UOJA 5ICZA 4GSXA 5K9JH 1MAMH 2FBRA 5IMOA 2IQ9L 3ARPA 5F0LB 2EVJA 1V5JA 4FCAA 3BEWA 2A1WH 5F8RC 3QHZH 2R83A 5TQ2H 5L0QB 1SJEA 5D71H 2CO4A 3O2WH 1TZGH 3FN3A 4JFSA 1QMUA 1WITA 3ECVA 4N0UE 4UNUA 4WWOA 2J6WA 2OZNA 2PWEA 3DI2B 3DRTB 2K4WA 2H5UA 5DD5H 5KG9B 3D4YA 2AJUH 1C12A 1SYSB 5EEVA 1VIWA 4N9GB 1X3DA 3PHAA 4TS6A 2HT4D 3DBXB 2EDRA 4H2CA 4PRBB 4X83A 5F9JA 4Y5XC 1ZJBA 3WFEH 2BLFA 1I8MA 5D7IB 5F7UA 4YHIB 5C09D 3EOBA 4ABVA 5DEGA 1WA2X 3FAWA 1FIGL 2ZCKL 1ILUA 2IH3B 1JZ6A 2DYPB 2IQ9H 5E2JA 1KLGA 5L2KB 1AGEB 3ARZA 1QFWL 3I6KB 2Z31C 3K4AA 4RAVA 4HS3A 1AP2B 3KPTA 3ILEA 3T77A 3LZNA 1UASA 3TN0C 1T4WA 4J5VA 3C5ZC 5H35B 1T5KA 1GZHA 1UD5A 1E9PA 3L3DA 3FU8A 2BMKB 3UTZB 2FO4A 4PLKC 4NQXA 2IPTL 4ZMTA 1NFDB 3AG4B 1OT1A 1RK0B 3FQWB 1BJ1H 2YPVA 3H9SE 4HIHB 4U05A 2WY3B 5I1DA 2A9CA 4EI5B 5JTWA 4RBPH 5BXFB 1F45A 4PCTA 4FNLL 4I5BB 3G5YA 1OTSD 2FHBA 1OPOA 4UOQA 2J1KA 1FIGH 3WG7B 4A2DA 4UQBA 2VLRD 2ZCKH 3MRFA 1HJBC 3IS0X 2MPAL 4DESA 1H15B 1GC1C 4HUUA 3ZBMA 4DNLA 4YHPA 3EGSB 4APQC 4U31A 4YMPA 1YVLA 4XMPL 1YY8A 5LG6A 5K9OB 4XRCA 4XP9L 4WK4B 5AVUB 4PCYA 1G7HB 3I2CH 3JUZA 4O51A 2KLTA 1WCBA 4HX1B 4XHJD 1M7DB 3V9EA 4G42B 3X1EA 4F91B 4HC1A 2N01B 3F7YB 2WNWA 2ZSVA 3MNWA 4ZS6C 5LAXA 2IPTH 3MZGB 4I0PA 3WV0A 3QORC 1S7VA 3BUDA 3GRWL 3FUNA 2QGBA 3IPFA 5CJQL 5D1XB 2VNCA 2DH3A 4LARL 1G0YR 4LP5A 1ZLVK 2PO6A 4G72B 1ZDQA 3MXVL 4PJIB 1XH3B 4MD4A 4FNLH 4JFXB 4W9HC 3SKNB 2B14A 5C0RL 1ZHLB 1BWWA 1ZTXL 2ENJA 4RETB 2OSLA 4HUVA 2MPAH 3BD5A 3N1FC 1IAKA 2DWSA 1W0VB 3ISYA 4UILL 3B8YA 4NKMB 4XMPH 1K3ZA 2MQGA 1O9VA 2IWGA 4FMKA 4XP9H 1QA9A 1PZ5B 5D7KE 5C08E 3SBQA 4FXGA 3GGWA 1GJUA 4M00A 4J3BA 3B3BA 4P07A 3ESPA 4IJ3C 3U30C 1KJVB 2BY0A 4WHYH 2UZYA 2UZIL 2OYLA 3PPSA 4WGVB 4Y16C 4OF5A 3GRWH 2EDXA 3W81A 3DVNA 4NQVA 3KCPB 4JHVA 2H1PL 4LARH 5GHWL 4YBLC 3H55A 1NFAA 1KY7A 3MXVH 3QCVL 2BWQA 1H5BC 1I7ZA 3B1UA 1H8SA 3T6ZA 5IP4A 1SDAB 5C0RH 2QFRA 3FCTA 4XZ4A 3V6FA 1TEFA 4HH8A 1MLCB 4WWNA 1T7ZA 1NDMA 3NMEA 4JUTA 4QRBA 4UILH 5A2LH 4P3DB 3QAQA 1H9VA 3EYQD 3PWVB 5FPIA 4JAMB 4QOKA 2YEQA 4NO0A 4XHQA 2WSKA 4GMTL 3ZMEA 4J27A 3BP5B 1M71B 4TUJB 1NC2A 2YXMA 5CP3A 4WFFD 4IMKA 4ZK8A 2PYFB 4GOSA 2DW5A 5ECJE 4L8SB 3KPMA 4O9HH 2TRHA 1OGPA 3PGCB 5HYFA 2F5BL 1UQSB 4FNUA 1O7DC 3QFJE 5DMGC 2E8ZA 2H1PH 4S1DC 5DHYB 3VNYA 5I1HL 3N40P 4FFTA 2ZPKL 4BFEA 3NIGE 5GHWH 3UP1A 1A02N 4I0PD 1MUJB 3QCVH 4AXWB 3LB6D 5FCUL 4U6TA 5DJ8A 1A7OL 3GLAA 4GKSB 2PO6D 1DSFL 1T66C 2ENPA 2VAJA 4XMKL 4XNZB 3MYJA 3GUFA 1JYWA 3O8XC 4N2HA 3QQXA 2H0FA 3OR7B 5EN2A 4NZDA 2Q8AL 3NSDA 3P3RA 3L4CA 4KI1A 3O4LE 4GMTH 3FB8B 5IESL 1BM7A 4ODUB 2W8CA 3G3LA 3L5JA 1E9OB 4EDXB 3MRNA 1MAJA 3JT0A 1P84J 1RULL 4DOHE 4FFWC 5IFJB 3SIKA 3SDCA 4F5CA 1MWOA 2V6HA 1MZZA 4OLWL 2DQTL 1ZV9A 1DCLA 1EZSA 3HI5L 2F5BH 4Z9KB 5GQBA 1F6AB 4N0YL 4WLCA 5I1HH 1JZ4A 3QIUA 2ZPKH 2ZCLL 4BDVB 1TNMA 3IDGB 4MWFA 4I0KA 3UAJC 4UT6H 5FCUH 5E95B 1A7OH 1AGDA 4R7NB 1DSFH 4P06A 1T2QL 4XMKH 4I4WA 4N2CA 4QHLA 3OJDB 5DUBB 3GQFA 5LGJA 3OKEA 4RMTA 3MLRL 5I1EL 2Q8AH 2CM6A 1AH1A 3VXTB 4JREB 2Y7OA 4AGQA 1FL3B 5IESH 3DMMC 4OQ1A 2YA1A 4AV0A 2Y23A 3FT2B 4JM4L 2BIHA 1XT5A 3VD3A 4QOKD 1VF5C 4NO0D 1RULH 4KXCA 3WXVH 4WFEE 3IDXH 4S2SA 2WVVB 1S7TB 4W81A 4OLWH 3ZW3A 2DQTH 1G6RB 4G9DB 1HZHL 4YAQA 3LN5A 4NYLB 3HI5H 1FO0A 1NC2D 5E6IA 3OKKA 5AEAA 4N0YH 3CFCH 4Z7WE 2WQUA 1WFOA 1LE5A 1W0WA 4MQ7B 4HJJH 3UX9B 4JFVA 5FKPB 3OKLA 3US9A 4D3CL 4ERSL 3CMOL 3QDJE 4PJBA 3T3PF 3QE5A 4B9JA 3P3UA 5IVXB 5A16A 2CO6B 1S9VB 1MFNA 4YFEA 2FZ3B 1N4XL 2C9VA 3ISWA 5BZWA 4GG8A 1T2QH 4ENED 1EH9A 5D2LF 2B1AL 4KHXH 4EQ2A 1NEZG 4V33A 4KJWD 2KQNA 3CDCA 5I1EH 3MLRH 4KV5E 4B9CA 4UTBA 1HSAA 3FQTB 3KYAA 2V3DA 4IKKA 1SYVA 1VPOL 5K9QI 4WHTA 4E9WA 4U6XB 2OYMA 5KJRL 2Z64C 4JM4H 3PQYA 3RWCA 1OGSA 3A67L 2X4SB 1EAPA 5K39B 4QLWA 2GJZB 3EO9L 3M1OA 4F7KA 2IANA 2NNAA 4NQDA 1RSFA 4YSTA 4AQOA 4CADB 3UYRL 1QUPA 1JYNA 4ZOAA 5EO1B 3SDCD 6PAZA 2X41A 1P2CB 3HCVA 3OTTA 4D3CH 4F33A 2EKSA 4ERSH 1J9TA 2EEAA 1MRDH 3CMOH 1ZLDA 3GWJA 1HKFA 5C3IA 2E3VA 2ENSA 1IAIM 3RWDA 3FOLB 3QIUD 2C4FT 2CR6A 1N4XH 3NFNB 3BRDA 5C6TH 3IJEA 3KWTA 2L3BA 1G7JB 1ORSA 1I85C 2F61A 2B1AH 2QV4A 5KYUB 3SQRA 2JCCA 1JMXA 1LO5A 2LQRA 3FU7B 1KTDB 3F6JA 1XCTB 3R18A 3R4DA 4GO8A 3D0LA 1MDAA 3VFVB 3W0WE 3WGVB 4MX7A 4EUPA 4ONHA 1HINL 3C60C 1VPOH 1J8HE 3BE1L 2A73A 1J9SA 1JZGA 1DQJB 3IYLW 4GKZB 1HHJB 1JN6A 4DQAA 4IBQA 5KJRH 3WAKA 1RZJC 1YUHB 1BSIA 3A67H 4X50A 3EO9H 2B5IB 2V9TA 4QRQA 3W39A 3GBDA 5JORA 2Z9TA 4XAWL 4XMUA 3ZTDC 2DWDB 1FVCB 2JJWA 1QLFB 2ZZUT 5H94B 1M53A 3QUKB 4YSAA 4KY2A 4DSYA 3UYRH 4PRIB 2J8UF 2ICCA 3AQXA 3CZLA 3IPEA 2ZYRA 4NO2A 5F1KC 5JOEA 4LVNB 3SO5A 4RIRB 4ONFL 1D9KA 2BWDA 1PY0A 3T0EA 1N6QL 3MUHL 1SVBA 5E6ID 3QNZB 4P2RE 1JPSL 2G30A 6FABL 4UQIM 4LBEB 4M7ZB 4XPGL 3JWDL 5BRZE 2NSQA 2FYVA 3BKML 3IFNH 5F7WC 5E70A 5DVMA 4IQHA 2NZ9D 2FQGA 1I3UA 5MEQA 1TJXA 1UYWH 1OSZB 1MCRA 2IAAC 1CLOL 1A1MA 2JKJA 2KUTA 3C6SB 2AQSA 3Q43A 2GC4C 3VFPA 4Q6IB 2Y1AA 4PTUB 4L3EB 3MJ8B 1E30A 5EPMB 2JCCF 5LLIC 2VXSH 1HINH 5DJYA 1I3RB 3BE1H 4I18B 5DC2A 4E9RA 3LRKA 3I6SA 1Z2KA 4DH2A 3U1QA 1J0YA 3EUDA 5J1SC 3TJPA 4M4PA 4XAWH 4ANKA 4CMMB 3OAYH 2WP3O 4S0TD 3PQYD 4PJAE 2VDKL 2ENYA 3DRTA 5KG9A 1MFVA 2IAND 4JM0A 2OLDA 2H32B 4NQDD 4N9GA 4ONFH 3CU7A 4PRBA 3DBXA 1N6QH 4J4PC 1PG7W 3BSZL 4FLSA 2ZAIA 4NPKA 5SV3A 6FABH 2QVMA 2OMWB 4TNGA 4YHIA 1MJJB 1CICC 2Y4SA 4XPGH 5EIVA 3JWDH 4YHLL 2BVEA 4IBUA 3BKMH 4ATWA 2P9RA 2NYYD 3IGAB 4Z7QE 4GUOA 4N0UB 1LGVA 4WKZB 5JW4Q 1CLOH 1W6WA 2IH3A 5IEKB 1ETJA 1P69B 2DYPA 2EXWD 3IMVA 4HFUL 1AGEA 5L2KA 3PE9A 3I6KA 1QBBA 3MAWA 4BQBA 1AP2A 1H3PL 1MHPL 2J1YA 2NXYC 2X4UB 1FFTB 1G9ML 5H35A 3QQDB 4RGND 5IHHA 2MNJB 4IIQC 1WT5C 1T89A 3IT8D 2BMKA 3UTZA 2PXYB 4J3OG 2HN7A 3ETBJ 3QEGL 1NFDA 2VDKH 3HPLB 5C2UB 2YPLE 2FEDC 3LKNB 4JG9A 2DQ6A 2VDLL 3QWQB 4JB9L 1RK0A 3FQWA 2HLFC 4HIHA 4XCNB 3BSZH 2A3TA 1H8NA 2CRZA 2MKLC 2FR4B 1BA9A 5BXFA 1JL8A 3ZKXB 2X9ZA 3MBEC 1E4HA 5CIPB 1D9KD 4I5BA 4NCC1 3T0ED 3NJHA 3SBWC 1PCXA 3LRLA 2VDNL 1YG9A 3CDYA 5CF3A 1H15A 2BY3A 4HFUH 3EGSA 1W2KT 1J5HA 2CCVA 1H3PH 1MHPH 5T1KB 2ZOUA 1PY4A 1KV7A 2EDMA 3G04B 1MCNA 3GMLB 3SBPA 3B4NA 1G7HA 1C1EL 2YD2A 4HX1A 5CEXB 1M7DA 4LNRB 1QASA 1XF2B 4G42A 1DBML 2X4QB 1Q1JH 3F7YA 3LKSB 3QEGH 1WC7B 5GRZA 3BQUB 4POUB 2MMXA 3BD3A 4X8JA 5IROA 4O58L 1WICA 5GJTL 1KBPA 1PLBA 1DEEB 2VDLH 2BP0B 4JB9H 3KAAA 3RX5A 3OKNB 4PJGF 1C8QA 2FBJL 2CJSA 1ZGLP 4PJIA 1XH3A 1EO8L 3NFPB 3GT6A 2OFQA 2F74B 4JFXA 4KXAA 5F1IB 5D6CA 3SKNA 1ZHLA 2ETWA 2VDNH 1IKFL 1BW8A 1FFNB 2JH2A 3BFOA 5F6HI 3Q06A 4M5ZL 5C92A 4NKMA 1CBVL 4PRNB 2P24B 4P5MB 5BRPA 3S36X 1ZV2A 2XVLA 1HQ4B 1PZ5A 2CUHA 4JJOA 4GIOA 2DYPD 2EH7L 5AWNL 5L2KD 3UYPB 1UJ3B 1C1EH 4XPBL 5I6XB 4JFHD 1FSKB 4F15C 1KJVA 5AKTA 3UTQA 1ZGLB 2J73A 1E8ZA 3GHPA 4Y2LA 1DBMH 5E4OA 2CKBB 5DRZB 4WFHD 5GJTH 5FF6B 2IAMA 3L48A 5D6DC 2ZUSA 2DJSA 4NCDA 2NNRA 1G7LB 1JRHI 2FBJH 3IETB 4EN3A 5KSAC 1SUJA 1VAHA 4M8VA 1EO8H 4NM8H 2A6JB 1SLWA 4PWKA 1ZVSB 4JFDB 4PJIF 1MLCA 1OTUC 3AZUA 1KXVC 5BV7C 4D9QE 3N1GC 3M45A 3IDJB 2KZWA 4XE5B 2A74B 2QADB 1A1NB 2ZWNA 3PWVA 2YD6A 4S10A 4JAMA 1XTMA 5ABZA 2WW8A 5JO5A 1W72B 3O0LA 3P3TA 4PJHF 4BA8A 2EH7H 1XB6A 5AWNH 4URKA 1N7ML 2E9JA 1JGUL 4XPBH 1M71A 2ICWA 4TUJA 5TDPA 2E7MA 2MCMA 3BAEL 5BW7A 2DOCA 2PYFA 4N87A 4N8PA 4L8SA 1J48A 1DLFL 1KGIA 3B7SA 2OCCB 1PG7H 3RJQB 1IKNA 3PGCA 4C83B 2HTKD 4N8CL 1BECA 1UQSA 3RDTC 2DD8L 5DHYA 4U7MA 4YSPA 2VKWA 2ARWA 3QUGA 4LKCB 3T1WA 1A3LH 1BZ7B 5IROD 1MUJA 4XWOC 3VGFA 4AXWA 2NX5E 1OM3L 2RQEA 1WFUA 1NANI 3RIAK 4GKSA 1UATA 5ERWB 1QHQA 3I9AA 4JQIA 1KXQE 3L81A 1IJNA 1EGJL 2OR9L 2P5EB 3QFJB 3TO4A 1I7UB 4YFLF 2F5AL 5JDJA 2Q10A 3OR7A 3NIGB 5DLML 3CC5A 5LN8A 1UD8A 2YAFA 3FB8A 5JXEA 1N7MH 4ODUA 4FXTA 4OZGF 1PSKL 1E9OA 2P45B 4EDXA 3R7RA 3GXPA 1LILA 3BAEH 1KCBA 3TZVB 5LGKA 3H6JA 4UIMB 5IFJA 3ZE2F 1DLFH 3BWUF 2Z91B 5I74B 2Y3AA 4N8CH 5EO9B 3V4VB 1M3IA 2V8LA 5IJBC 1JPGA 2DD8H 1F6AA 1NUGA 3KPSA 3GFUA 4KC3B 5DA4A 2OAAA 3ULAB 1MF2L 3AM8A 3O4LB 1CDGA 5DZJA 5T33L 1DQIA 4LRNL 3IDGA 2HX9A 3STBA 4ICWA 2XWXA 3F04A 2IAMD 1OM3H 3IF1B 4DOHB 2NY2C 3SQBB 1EFQA 4R7NA 4EN3D 1BBDL 1EGJH 5K1NA 1BV8A 3OJDA 3OB0H 2WLJA 1ILSA 5DUBA 3POHA 1VFBB 3LZQA 4YNYB 3VXTA 3KYNB 5DLMH 3HB3C 4DEPB 3BP6B 1NBVL 5EA0H 3TOPA 4Z7OE 4FJYA 1FL3A 3FSVA 1XGPB 1WBZB 2X70B 2WAQA 1PSKH 1JWUB 3FT2A 3JV6B 5A2JH 2BXZA 1UENA 3SYQA 3OAUH 3GEFA 3L1OL 4U0RB 2Q3AA 1DBBL 4XX1E 2HUHA 2OP4L 4RZCB 2WVVA 1S7TA 1G6RA 3HAEA 4G9DA 4NYLA 3SOBL 3PDDA 3L9YA 3TIDB 2VSDA 4A6YB 2CLZB 4BK5A 1MF2H 5H37A 5T33H 4MQ7A 4X7FC 4ELMF 5FKPA 1CBJA 2X6MA 1LQSR 2Y1VA 1II4E 5IB5B 1JXDA 5B8CC 2CO6A 1S9VA 2AJ3B 4G80B 3UGUA 2FZ3A 5IQ7L 1MQKH 1BBDH 2D7TL 1TTAA 3UO1L 2G2NA 1NAML 3ARBC 4K5PA 3VGAB 3V8CA 3IXTB 5IJVB 1FGVL 1NLBL 3WSQL 3TV8A 2ZUQC 4FEIA 3WJMB 4PJCB 3AMKA 2JKTM 5DRNB 3ZDXF 1NBVH 4MBRA 1F90L 2MWCA 3LV3B 3J2PA 3ZO9A 3OV6A 4KFZC 2AMUA 3TO4D 2WVSA 2DM7A 4U6XA 1U0QA 1KCWA 3AS1A 5K39A 4J12A 2GJZA 3L1OH 1DBBH 5JXED 3BJ91 2G75B 2OP4H 1FL5A 1IT9L 3FS9A 2NCEA 3SOBH 4CADA 2DWYA 1JNHB 3L08A 4ZMYA 2RB8A 5EO1A 2CR0A 1IEHA 1P2CA 1KJ2L 2Z7UA 3R8QA 5I1IL 1Q9WB 4ZOCA 2XI9A 1C7SA 3KPSD 5IB1A 3FOLA 2BH0A 3NFNA 5IQ7H 3B7TA 3UC0L 2AC0A 3MX0A 4MJIB 4FYQA 4L9LB 2D7TH 3VYPA 3UO1H 1Z9PA 1M9SA 2D4DA 1MJ8L 1NAMH 4PD4J 4MLSA 5KYUA 5I73B 5KAQG 4P57B 1FGVH 1NLBH 3WSQH 6CGTA 3CNKA 3FU7A 1KTDA 3EADA 1XCTA 4ZFOB 5E1HB 1J9QA 1F90H 2GTWB 1UVQB 2B3IA 2VDPL 3Q8BA 5CU9A 4GKZA 1DQJA 3GBEA 3K5SA 1YUHA 4QYAA 1QWNA 4H1LG 3QUMB 2DLFL 1HTYA 4RSYA 3TA3B 2DWDA 1IT9H 3GI8L 1FVCA 5CZXC 3U4AA 1QLFA 4M02A 5H94A 3ULVC 1Q38A 2DYRB 3QUKA 2YXFA 1G7MB 2Z92B 4PRIA 4CRPA 3W0WB 2I85A 1KTBA 2X38A 2CDGB 5F7EL 4HGKC 1U3ZA 2WHVA 4NLAA 3SPIA 4RIRA 2X6CA 4I9XA 1R3IL 1KJ2H 1EBAA 3LTVA 2ZG2A 2AQ3A 2C3VB 1R47A 3ZZSA 3QNZA 4S0HA 3BISA 2Y6TE 4LBEA 5HGAA 4F58L 2X6AA 3WNNA 1CLVA 3X3FL 5K5YA 3CN1A 1MJ8H 1OSZA 3BKYL 2OL3B 2QVFB 4RFEB 1YEGL 1QFWI 2N59A 3C6SA 1RERA 4Q6IA 1TPXC 1OE1A 4PTUA 4L3EA 3C08L 5EPMA 1DUZB 3D33A 1I3RA 3LRSB 2VDPH 3MRPB 2HT2D 3PV7A 4I18A 3L1GA 1XGYL 4GS7C 5DD6B 4F2MB 1R19A 1JPEA 4UTAA 4YHOL 4ODWA 2DLFH 4QRPE 3BDBA 1ZLWH 1CDJA 4AZ8B 4Q74A 3ZHKA 4HPYL 1BFSA 1R33A 4NUMA 4JGNA 4XB7A 4OCRL 3F8UB 5F70A 1LK3L 4JGUA 2W92A 5F7EH 3AXHA 3ASWA 2H32A 3NJLA 4FYTA 1R3IH 1RLWA 4TV3A 2ZXWB 4P23A 1YJDL 4LHUB 3MLZL 1BDYA 2OMWA 4UOZA 1MJJA 5DVPA 4AQEB 2A9NH 4DPBX 4F58H 4YSCA 2MSPA 1L7IL 2VE6B 3PIQB 2WXKA 1B2WL 2WOBA 4PS8A 3X3FH 3IGAA 3KVPA 3KYKL 1JWMB 3BKYH 2KBGA 4WKZA 1YEGH 3VRJB 1UUSA 3PF2A 4LIQL 3TNMB 3VX1A 5F88B 3VXOB 3C08H 5GGSB 4LLUB 4UZUA 4BRJA 2X4UA 2ZWKA 4N90E 1U3NA 1XGYH 3ZO0A 3C8KB 4OW6A 4MMYB 4QT5A 2JTYA 3QQDA 4HOMA 4YHOH 2BNRE 5ILTL 5KVFE 1JHKL 1GYCA 4Z7QB 2PXYA 3L95B 3M17B 4M5YH 5J13C 4LGSB 4LSSL 3BN9C 4HPYH 5CM1A 1H3VA 4K94H 4OCRH 5K59F 4Z78B 1IGML 1LK3H 2YRZA 4G8EB 1XF5B 2ZT9C 2FATL 3NTCL 3LKNA 2EADA 1SN5A 1W8OA 3MCG1 4X7TA 5EF3A 1YJDH 2FD6L 4XCNA 3MLZH 2FR4A 1MVUB 2W60B 4PRID 4BFIB 5FGBC 3FMGL 2ENQA 2FQFA 3D12B 5I6MA 1L7IH 1GPOH 5CIPA 1B2WH 2NZ1A 5GRYA 1YQVL 4OGAD 1E9QB 3KYKH 2H4EA 2BRQA 1KB5B 2KS0A 4OCXL 4LIQH 1LP9B 4H8QA 4XR8C 3GBML 3KYMB 2GJPA 3G04A 3GMLA 2R4RL 3KL0A 3FCUB 1PPIA 5EFIB 2I60L 5FUCC 43C9B 4L3ED 1JUFB 1KGUA 3P02A 3X1NA 1FYTB 2IPUK 1JHKH 5CEXA 2C3GA 5ILTH 4LNRA 1QI3A 1XF2A 3D08A 2X4QA 4X8GA 4LSSH 4BUGA 1E43A 1WC7A 2C9PA 1TLMA 4XNUL 1IGMH 1OE3A 2IV8A 3NTCH 1PLAA 2FATH 4R9HA 2N3JA 1QBML 4KK9C 1DEEA 1G7IA 5BUGA 2BP0A 1BLNA 1I31A 1BQHA 3OKNA 5DR5H 2ILLA 4Q0XL 3UGEA 3RPKA 1ACYL 5DT1L 3FMGH 1NEZB 5BO1L 3NFPA 1U8LA 4P05A 2F74A 1HT6A 4WO4C 4P23D 1YQVH 2NNFA 5F1IA 5IV2B 1QTYT 4GQPH 1RZ7L 3K3QA 1X44A 4Z1PA 1FFNA 1TYEB 3KVDD 1WUZA 4OCXH 2YK1L 3ZUCA 5D93B 4MMXC 4ZNCD 4PRNA 1BEYL 1WQVT 2PABA 2P24A 3M7FB 4H0LC 2WJ7A 3GBMH 4LOUC 5AAWC 4ZW3A 2VR6A 1EUUA 1HQ4A 1HK6A 4L4TE 2WNGA 2I60H 3UYPA 3UBHA 1U8KB 4NKQB 1UJ3A 1DSWA 2PW1B 4NAQA 3FAXA 1JZ2A 5I5IA 4WCYH 5IR1B 1ZGLA 1EEYB 1LXMA 1U6AL 1WUNT 2K0RA 1M2OA 2X4RB 3LRGA 2CK0L 2CKBA 5DRZA 2D2CC 2YPVL 1N6VA 4XNUH 5FF6A 4MNHB 4J28A 2PXYD 1QBMH 5IUSA 4A39A 2F9BT 1G7LA 4Q0XH 2JKXA 4H8VA 1ACYH 3IETA 3I50L 5DT1H 1PLGL 5IHUL 3GSVB 1HKLL 4KI5E 1M42A 5BO1H 5C9KA 4WI2A 3L4TA 2A6JA 2AK1L 4NZTL 1VGKA 1JVOA 1ZVSA 2CM5A 3Q2LA 4JFDA 1KULA 1RZ7H 1ZS8B 2F0CA 2YK1H 3IDJA 4AEIL 3DX3A 3HLAB 1JTPA 5E8EB 2A2QT 1A1NA 1BEYH 4ZMVA 2OCJA 3M1BB 1W72A 4K0OA 3RBSA 1CTOA 2XN9B 5E9DB 4TOYL 2VR4A 3C87A 1A9EB 2V37A 4Q6KA 2LU7A 1AC6A 4X0KB 1CXKA 5LQBL 2AS5M 5EBGA 3O2DA 1U6AH 4YLBA 3GZPA 4NUGH 2DQMA 3RKDC 2CK0H 3K6SB 5I28A 3LMJL 3OLDA 5B7EA 2YPVH 1D2PA 4C83A 1P9MC 3BVNB 3F05A 4B5ZA 2LVCA 5JR1L 1V55B 1ESOA 4LKCA 1FZKB 1BZ7A 5BS0A 3I50H 5T1JA 1PLGH 5IHUH 4OAWB 1HKLH 3PJSB 7TAAA 3EHBB 2FT7A 2AK1H 2ZNWA 4NZTH 1FV1B 5ERWA 2WQRA 2HJFB 2AEWA 4NRYB 1CO1A 5T3ZE 4POZC 4YDMA 2WB1A 1TQBC 4JRYE 2P5EA 3QFJA 1I7UA 5KBLA 3EJZD 1PX3A 4GJTB 1I7RB 3ZTJH 1NEUA 1MRCL 2ZKHL 5I1JL 1MCEA 1MREL 3UERA 4TOYH 1MIML 1RP8A 3V7MA 5HY9B 4HC1H 2DJMA 3AS2A 5LQBH 2VJXA 3IDYB 4DN3L 1SFDA 1THAA 3TZVA 2CRMA 4UIMA 3LMJH 4I2XE 2Z91A 1BREA 2GI7A 3IU4L 3ZL4L 1Y6KR 2BW5A 4AEFA 5EO9A 3V4VA 5G4NA 3VGEA 2X2UA 1GJWA 4TQEH 5D5MF 2VQ1A 5JR1H 4PR5A 2BHZA 2XRAL 2W65B 1QRNE 3TVMB 3C2SA 1YPZB 4TVUA 1DN2A 3IF1A 5JXAL 3L9RB 1NEPA 2OMTB 1GA2A 2CUMA 4S0SD 3RPIB 1F4AA 3WIIL 5GGQL 3QJTB 1VFBA 4JFDD 4D8OA 3REWB 2WANA 3LN4B 4PJ7F 4YNYA 1ZPLA 2ZKHH 3FT9A 3KYNA 5I1JH 1MREH 3BP6A 1MIMH 3BD4A 1CF1A 4AC4A 1XGPA 1WBZA 1Z1WA 1KIQB 2QADD 2X70A 1IFGA 3QNXB 3ZRCC 4HLZH 3JV6A 3S6CA 1KBKA 4DN3H 1TFPA 3B2UC 4ZUVB 4BFRA 2G5UA 3MVSA 4ECNA 5FV1L 3F01A 2XZQL 4RMBA 3IU4H 3RE0A 3FT1A 1X5YA 3ZL4H 5I1KL 2Y9RT 1NKRA 3TIDA 4A6YA 2CLZA 4NQUA 2FTAA 3ATAA 1CGSL 1ZA6B 1J9RA 1OIOA 2XRAH 4ZMLA 3CQFA 1RZ8B 1TITA 3LSOB 3VGBA 3ZMNA 4ZUWB 1JGVL 3L7EA 3L2LA 2AAAA 4ODXB 4LAJH 5IB5A 5JXAH 4G80A 3RWHB 3B5GA 3GS4A 1FORL 5BS0D 3ZHLA 2YPKB 2ZXQA 2TRYA 5HHOB 3WIAA 4GG6F 3WIIH 2I24N 5GGQH 3D4CA 3IXTA 5IJVA 4UIKL 4FD0A 3WJMA 2Z4TA 4PJCA 3ILQD 1GH7A 5DRNA 3VMOA 1PIGA 2EEDA 3BPOC 5CP3H 2P5ED 3QFJD 2C3HA 3QUYA 3GTTA 4KZDL 2KLSA 1U41A 4EZLA 1OARH 1RAMA 5I5RA 1ZKAA 2G75A 3VA6A 4KX9A 1BMZA 3F5WB 1DVFC 1K8DB 1OD9A 1WA0X 5FO8B 5I1KH 1WFJA 4O2EB 2ICWJ 4Z7VE 2V7NA 4X6CE 1JNHA 3RWJB 3TZVD 1CGSH 3EDJA 5GS2D 1KZYA 3FHEA 4CNIB 1JGVH 4TKWA 1Q9WA 2AABL 2QGCA 1CI3M 1GZPB 1TO5A 3FH5A 4QHUB 1HESA 1SXAA 3U4BL 5I8CB 4Q97A 1ZV5A 1FORH 4UI2A 2XNAB 4MJIA 1FNEB 4L9LA 4WJG3 3W1ZA 2IBZY 4AGOA 4YWGL 2CIIB 4RH4A 3ZDWA 5HVFB 2UWEB 4PV9B 2YS4A 4UIKH 5HI4D 3VM7A 3ABKB 4ZFOA 1JAEA 1E50A 1R1CA 12E8L 4R6UA 2GTWA 1KXHA 4ES8A 1UVQA 1JGLL 4ZODA 3U7AA 4ALAL 3ZYOA 4KZDH 3N9GL 3IJYB 4M5TA 4MAUH 2DKUA 1FO0L 3P40A 3QUMA 5GRJL 2AVGA 2VLME 4KJQC 5H4YA 2K6YA 3TA3A 4AL8L 2CWRA 2L7QA 2P5WE 4MCZB 3N91A 4KK5C 2FIRT 2Z92A 3W0WA 3NJXA 1BFVL 5D96C 2XSKA 4U1NB 2D03L 4IOFC 3V55A 2AABH 5I1CH 2C3VA 2E9IA 2KL6A 4UV7H 5EOQL 3U4BH 3CFBB 3TCTA 2EJ1A 2VXVL 4KO6A 1AC0A 2YD3A 3B2XA 3QEQB 3TBYB 3V0WL 1BPVA 2Y06L 3AQDA 1N10A 2XA3A 4UTBL 1UWGL 5AOLA 4YWGH 2OL3A 4RFEA 3LNGA 1WGVA 2JQAA 2FH8A 2QQKL 3CDZB 1EFXB 4WNSA 3FTGB 3BC9A 5ICUA 5F6IC 3WEXB 5I1GL 12E8H 1DUZA 3CFTA 1J0KA 2V33A 3EJUA 3LRSA 1JGLH 3VGDA 3PFUA 1P7HL 4ALAH 4F2MA 3N9GH 4FTVE 3F62A 1AG6A 1FO0H 1J1OH 2DMKA 4XVUD 5DJ6B 5GRJH 2CHNA 4AL8H 2M26A 3MV7E 4J3SA 4GLRH 5CN3A 3QUYD 4AZ8A 3K0YA 2R0LL 2CGYA 5I2IB 2WMPB 4QRRB 4XCFL 3UACA 1KB9K 3UMTA 1OP5H 4B53A 1BFVH 4HOXA 4DFHA 1RU9H 3CSTA 2D03H 3K6OA 4JJHA 4KZ0A 4JGMA 4WK2B 3B2VL 4LEXL 2VGLM 1MY5A 4AQEA 4IMLA 2XZAL 2VE6A 2GY5A 2VXVH 3PIQA 4K71B 4OZHF 4LZKA 1YCSA 3V0WH 2Y06H 4MDIB 4UTBH 4XTRC 3VA2C 1JWMA 1UWGH 4W6YB 3DTXB 4K3JL 2D0FA 2AXWA 4HWEL 3VRJA 2QQKH 3VXUE 4ZZKA 3BWZA 3HI6H 4MJID 2GCYB 2XWJB 5F88A 1PJ9A 3ABZA 3VXOA 4BH8A 5I1GH 5GGSA 4LPWA 4N8VB 4LLUA 2V7HB 4YK4B 2ITDB 1DFBL 3MRRA 5CBAA 3QCTL 3SDDB 4MMYA 3VFOB 4U3CA 2I27N 1VHPA 4QGYA 2D3LA 4J2QA 3RZCB 3QRLA 1S3KL 3TFBA 3I02B 2R2CA 4JHWL 5KVDE 3L95A 2JLPA 3FYIB 1BP3B 4PVNA 3D25B 2R0LH 4C55A 4UQCA 1KC5L 2E7DA 2EQDA 4ZSOE 4A7GA 3FQXB 2GUYA 3QZOA 2YD9A 3IMRA 4XCFH 4LLMB 3DX1A 4Z78A 1E3XA 2DLEA 1ZLUH 1XF5A 3DJRA 3TA3D 4PCSA 5T5FA 3IE4A 1QO3B 1NGQL 4LCWE 1MVUA 2MQ0A 2X12A 1HH6B 2W60A 4WNJA 1HL4A 3NJMA 4UYQA 3N50A 3W0WD 3NVQA 3KPRB 4LEXH 5K9KB 1LO0L 1A4KA 2XZAH 1QPPA 3BFQG 3SPGA 1E9QA 4RDQG 5SX5K 4IGBC 4EUPH 2L7UA 4K3JH 1KB5A 1TQVA 4HWEH 5CD5C 3HNSL 1HWWA 4XB8A 2WUBL 3NCXA 4WWID 4DVBB 2EE0A 3GJEB 1BLIA 2HJKB 2VERA 2WGNB 3NJFA 1LP9A 4V1DE 3VDCA 2ROYA 5A6MA 1AMYA 5A2IH 3L5IA 1DFBH 3L9BA 5EORL 3QCTH 5EFIA 2BSEA 3ZYZA 4KY1L 43C9A 5KVEL 1JUFA 1S3KH 1FYTA 2E6JA 3TJHC 1FN4B 4JHWH 1E4KC 1LO2L 3VU2A 5DFTA 1AHWB 1D5BA 1KC5H 4MRCA 4CW1B 3HN3A 2C1OB 2ATPB 1SZNA 1UCBL 2DQEL 1AIFB 2L8AA 3ECWA 4JPQA 5HJGA 4U6YB 2VMDA 3WFCL 1NEZA 3QWNA 3WNJA 1LO0H 3HUJF 4G5AA 3FF8A 5AW8B 3PHOB 3KR3L 3GJFK 3MREA 1NIFA 4EKXA 5IV2A 2J25A 3NZUA 5FYKU 3MKKA 2WUBH 5HBBA 1EK3A 3GZKA 4XWGL 1JSYA 1OQOA 2N1KA 3P30H 2G5BB 4DO5A 3N41B 4WI5A 5C70A 2NT0A 4UAOC 1U8KA 5TDOB 5IREA 2PW1A 1EEYA 2X4RA 4ZFQA 1LO2H 4NRXB 2GI0A 1I82A 4CC0A 1CD8A 4OZIF 2XPGB 1FNFA 1UCBH 2DQEH 3KLDA 3KBPA 4L05A 4I85A 1C16B 4MNHA 3ECBB 1AFVL 1VDGA 4XC3L 4L4TB 1WISA 5AVXB 5DQ9B 4PJ7B 3WFCH 1XWVA 3GSVA 3O41A 1BOGB 1N70A 4ODVH 3UZQB 4E0RA 1NCOA 3KR3H 1B2YA 4E9LA 1UACL 3C6LB 4PJEF 3N42B 3EJTA 3PP3K 5E03A 3SZ6A 3AWGA 4AM0Q 4W9KC 1ZS8A 5HJBA 3UG5A 3UZVA 2EUXA 2C7UB 2EVHA 5E8EA 4D9RE 4XWGH 4GUPB 4H2AA 2XN9A 5E9DA 4K07A 4AYMC 3CPLB 1A9EA 1HQRB 1NTDA 4X0KA 4NQCE 5EUOE 2WWMC 3AGWA 4H0GA 1MJUL 2CBOA 3PXLA 3DJZA 1F3DH 4GT0A 2BSED 2RFXB 4OD2B 4DK6A 4R7XA 4Z7UE 3SZKC 3BVTA 1FYTD 3BVNA 3UDWA 9PCYA 3OKOA 2ERJB 1AFVH 3FOMB 4G3YL 1HHHA 1LHZA 1P7QB 2KLRA 1XR8B 4XC3H 1RUML 1FZKA 3T8XB 4KKQA 4OUOA 2Q7NA 4OAWA 3OKMB 4XVTH 3PJSA 3DO4A 3KGSA 1T1WB 3C9NB 3NSXA 3X2QB 1NM4A 2AJZB 4AG4L 1U2YA 1F6FB 1UACH 1FV1A 2HJFA 2F8VA 4NRYA 1HEZB 5GPRA 3FONB 3Q1EA 3SY6A 4YE4L 1B90A 2K6ZA 4OCWH 3GSOA 4KRNA 4XO5A 5D1QE 1I7RA 2O26U 1P4BL 4Y1AE 4XNAA 5J12C 1FFOB 4QMEA 1WA1X 4ZX3A 2DBJA 2HT3D 3AS3A 1OF0A 3SGEH 5AUMA 1ZWIB 1EAQA 2PCYA 4HF5L 3P0VH 3GMQB 1MJUH 4UUJB 1F02I 4AY0A 3B2MA 2V4LA 4LMQI 4AIEA 5DTFA 4KO7A 4B9KC 5HYQB 2BPBA 2O4EA 5CJXA 2PW2B 2GTQA 3QK0A 3VD1A 4IK7A 1WBYB 2RHEA 4G3YH 4XPAL 5TQ0H 3WENA 5BOJA 3W37A 1NPUA 2FT6A 4HBCL 1RUMH 2W65A 3MLTB 1H6UA 3LX9A 3SE8L 3AAZB 4FI7A 1EERB 3RJOA 5KOMC 1A8JH 1YPZA 4GP4B 4FXLA 4OLYL 4AG4H 1UM4L 3L9RA 3O3DB 3NP4A 3HE7B 3ZT6A 3II2A 1UM6L 3BP7B 4IBZA 1MFAL 1UXMA 2VN4A 3OHXB 3VDBA 2OMBA 5BQDA 1P4BH 3F2LA 3LN4A 4YSOA 4RFNB 2IXQB 2FAUA 2XACC 2CQVA 1WFTA 2CGRL 3QNXA 1KIQA 3MLXL 2X9WA 3AWFA 3NIFF 3X11B 2C4FU 2ZOKB 4HF5H 2XN9D 2MCAA 5E9DD 2CPUA 2H8PB 5D7SL 4ZUVA 1WTLA 2JB5L 3PABB 4NI3A 2V9UA 5IQMA 1OAQH 1ORQB 4YR6B 1TMQA 3FN9A 4ZD3L 2XV6B 2W0KA 1B4LA 3EGXB 2ZUTA 4XPAH 4BELD 2W0LA 3PJLA 3CQQA 1NMBL 4HBCH 3NCMA 5L9DH 4AV5A 1RZ8A 1G87A 3LSOA 4QF1B 4D2NA 1FC1A 4ZUWA 4P46C 3SE8H 3WELA 2J1WA 1WEJL 5GZNA 3RG1C 2NDGA 5HVHB 1T2XA 3NPZB 4ODXA 2XETA 3BJLA 4JQIL 4P9HC 3UABA 4BKLB 1XH2A 2EABA 5DWUL 4OLYH 2AXFB 2J72A 4MKMA 2SEBB 5T1LB 3RWHA 3PRZA 2YPKA 5JIMA 4PLNC 4FHJA 1UM6H 3ZN6A 5HHOA 2XPZA 4LE8A 1MFAH 1KYDA 3EHBD 2CE6A 4ZS7L 1AD9A 1IZJA 5DK0B 1ROWA 3TJEL 5BJTB 5CEZE 2XTSA 4K3DL 1FHNA 1H8OA 4A7TA 1IGIL 4ZX4A 2CGRH 5IWLC 4J1UB 2FNWA 3MLXH 4XN7A 1ACZA 4JHAL 2WVTA 3TCXA 5LNDA 1JYVA 1KF9B 2WLMA 3M8OH 4KDVA 1T22A 4XN2A 5D7SH 5DK2B 2JB5H 3D4ZA 2Z65C 1QSFE 5SWQB 5FO8A 3F5WA 1K8DA 3RP1A 1HZLA 4ZD3H 2KT6A 4O2EA 4JCLA 5GIRB 2OI9C 5AZEL 2ZTBA 4HLEA 2GC7C 5JNYA 3VFSB 1FNHA 3RWJA 1B88A 2HTLC 1NMBH 4CNIA 1WTGT 1TETL 5JPMB 5E5MB 4YS4A 1SHWA 4XH2B 1H0DB 2CCWA 4L37A 1GZPA 4JQIH 3DVIA 1TCMA 4ICXA 4QHUA 2KDGA 3HZKB 5DWUH 5JW3L 4Z95L 5I8CA 1UGNA 3HMXA 3RVWC 2CIKB 5I15L 1S7UB 1FNEA 4PN6A 4B5EA 5DGRA 4Z7VB 2CIIA 2XN1A 2UWEA 2LFGA 3S48A 5T1DL 1MCLA 2OTUB 4GKLA 1QPKA 4ZS7H 4ZO7A 2RTTA 2EDWA 3TJEH 2LABA 5HD8C 1E0OB 3WNKA 5FWRA 1LO3H 2J6EA 4K3DH 4M6NL 3SGJA 1HN1A 2W88A 1IGIH 4CKVX 2FWSA 5BOPA 4C58B 4GI9A 3BAXA 4NNYB 1G6RL 4JHAH 3IJYA 4B41A 4J3OD 2UX7A 5CHNB 3VGHA 3OL2A 4MNQE 3SB3A 1CFVL 4MCZA 2BVYA 5GGSY 1HSBB 2Z4QB