1P5UB

X-ray structure of the ternary caf1m:caf1:caf1 chaperone:subunit:subunit complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
149
structure length
149
Chain Sequence
ADLTASTTRTATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Biogenesis of the Capsular F1 Antigen from Yersinia pestis. Preserved Folding Energy Drives Fiber Formation
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Chaperone, structural protein
molecule keywords Chaperone protein Caf1M
total genus 23
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2003-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09255 Antig_Caf1 Caf1 Capsule antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1p5uB00
4AZ8B 3DPBB 4B0MB 3DOSB 1Z9SB 1P5UC 4AYFB 3DSNB 1P5UB 1P5VB
chains in the Genus database with same CATH superfamily
1YN7A 4W93A 3L3KA 4ICWA 3QRFM 1AXTH 3CDCA 1N19A 2RFXB 4U3XA 4F27A 2JXMB 3V7AG 3R4DA 5T1MB 1PKOA 1OAYL 4A66A 5J5EA 1CXFA 2FQGA 2BDNL 4PJGF 1J0ZA 4XB7A 5C9KA 1QFHA 4QO1B 2NY3B 5DTFA 3DBXB 2C4FT 1N8ZA 3NUKA 4ONFH 5A2LH 2JQZA 2PPEA 2QMKA 2RALA 3DHJA 3QXUA 1S5HA 4QHMB 4YVUA 5GISH 4UM8A 1PD1A 2Q0ZX 4F7TB 2CJUH 1E0OB 1HQRB 3FO2A 1PX3A 4NQDE 4NZRL 3V0GA 3HG0A 4RRPA 3O8XA 3DO4A 3H0TB 3QFDA 4LKXA 4M62L 1LWRA 4P5SA 4MZ2A 4R4BB 2OJZH 4PGDA 5C3LD 4H8PA 2PTVA 4GFTB 1P7QA 2JVUA 3FTZA 3FUKA 4P46B 2HJFA 1MNNA 1B6DA 4JFEA 4UDUA 4NO2B 1G7LB 4LSDA 3NSCA 3DK2A 5D6CB 3OKLB 4S11A 3ZKSD 4O5LL 1I3VA 5ICZA 3JV5A 4XVOA 3DXAD 2F7QA 3OF6A 4ABQA 2ALWA 4L3AA 3CDGA 4YO0B 2YMXL 1W8OA 1GOHA 1QKZH 4NBZB 4NLAA 1ZK9A 2VJXA 2L7UA 3FQWB 4U6TA 5CJ5A 2PYEB 3GJFA 3PWPA 3NN8A 2Y06H 3KLHD 1GJIA 4UBDD 4OY9A 1PZCA 3EO1B 4KJQD 2WNWA 1N70A 5CEXB 1E8XA 3H85A 3OLGA 4DJMA 3L5XH 1U3ZA 3WTVA 1BG9A 2AXGB 4BUHA 4KK9C 4W1TA 3WY3A 4WW1A 4K71B 3LD8C 3MV9A 3DROA 1I82A 2G0KA 4KY1H 4PJBF 1S7WA 2VH5H 2BS9A 3B3IB 5L4FA 1T6VN 1Z9NA 3EJPA 4KXZI 3MRIB 2IFFH 3HR5B 3RX7A 1ZLUH 3FDWA 4PUBL 4FL4B 4R0LB 4HWUA 1P1VA 3EYQD 2E5EA 4MA7L 2EE0A 2ODHA 3BEWA 4DO6A 2R69L 5A6LA 1T83C 1GOFA 3CVHL 1M1SA 1QFUH 4JVWA 4TN9A 3VWKC 3UC0L 5CBAA 3BVNB 5GISL 2MOQA 3CFJA 4X4KA 4EUPH 5IW1A 2YC1B 2VXUH 1UZGA 2MMXA 1FC2D 2NNXA 4HMDA 4DO4A 4DEUA 1TTGA 4GG6B 1MHHA 1RLWA 5E03A 2YK1L 1IT9L 2J88L 4YK4B 1MCPL 3GSRA 2V33A 4L37B 3O6KH 1WFNA 4AXWA 2WD0A 5IJVA 2M83A 4K3JL 4R7NA 3X14A 4AQZA 4TMPA 1U8PB 1NL0L 2IOOA 3LEYL 4N5EC 1DQDL 3V5KB 5FR3A 4GMTH 2W9EH 1IJ9A 1NIDA 4MTMA 1SF3A 4PFEA 2Z93A 4YLBA 3T1FB 1OPGH 2H0EA 2ADIA 3ZKXB 2YIHA 2B3IA 4U3SA 5ABDE 3HMWH 1N3NA 2AJZB 4M6AA 4UM9A 1H19A 3RHWF 1J5OL 2EKSA 2PWHA 4XPGH 4NFDA 3AG1B 3KCPB 4MCNA 5LAPA 1HXYB 1DJZA 1X6NA 2JKSA 1I3GH 2FO8A 3MCYA 1AI1L 2RAMA 2E76C 2ZUYA 1NUDA 1X7TA 2C7UB 1JHKH 3QEHB 3ZYIA 3VXTA 4UAOC 2B9AA 2OQJB 5FHBH 1FNGA 3QUXA 4PJIE 2PPCA 1TVDA 3MDJA 3DLQR 4RMQA 4JHWH 4W9FC 2NRDA 4HIXL 3AM8C 1A14L 2ZXEB 1XCTB 4FOMA 3U7WH 4FLQA 5C0BD 3DTUB 5D2LF 3SQOL 4PBVC 4EZJA 2YR3A 4WGKA 4OCXH 4BFFA 3APCA 3BP5A 4ZTPL 5INDB 1LO4H 4GP4B 3V0HA 5C08A 1S7VA 2OJEB 3UL4A 1JPFB 1HINL 1W72A 2GBTA 4L8CB 2CR6A 5JW4Q 3PV6B 4NQUA 5IMOB 4NOFA 2EIZA 4KZDH 1OANA 1KXHA 3OTTA 1DCLA 2XPYA 2YGVA 3UO1L 4I89A 2P8LA 4NWTL 2EYSB 3WKML 2YA2A 3ZDWA 4LE8A 4HS3B 3QJSB 1FI8C 5EU4B 5L2JA 1SJEA 1BFVL 3G5VA 3IDYC 3ULAB 1FFNA 1JPGB 1XGTB 2YUWA 4BQ9A 4DZBB 4ZQKB 2QQNL 4OQTH 1XAKA 4RH4A 3VAEA 3TJHD 5FM5O 1EJ8A 1JZEA 3ABKB 3IFLL 3H53A 3WFCH 2XQYK 2M1KA 5DZPA 1NCOA 2IV8A 4ZTEA 5FFGA 5HHNA 3BVWA 4AVJA 2BVOB 3NABH 2MCAA 4DAGH 4PR5A 4KX9A 3PGCB 1YEKL 4ODWB 4G7YH 3QRBA 4IHOA 2KI6A 2NX5D 5EIIG 2YBGA 2GUYA 3B3BA 4I4WA 2CO1A 4ONHB 4WFHD 2CUMA 4JPSA 5E00A 1FIGH 1U6AL 5CGTA 1XMWA 3ARBA 3T5WA 3VMNA 3K2UL 4YE0A 4Z9KB 3VTMA 3OXRA 4U4BA 3AADB 1BEXA 1HNFA 1Q0EA 1RIUH 4G70B 4PJAF 3TEUA 4YHYB 1RUML 3EFDH 1G7JB 2H9GA 3RWDB 2PCPB 2BP8B 3REWA 1QWNA 4UNVA 5FO8B 1K8DA 4U1NA 2R29L 5CWSA 2HG5A 1QUNB 3RL2B 3LMJL 5F7EL 4IRSA 1T1YB 1IGCH 2DYRB 4PTUA 5DEGA 4W9EC 2Y6SC 2N1TE 1WCQA 4KVNL 4TTDD 4W9HC 4ZAKC 5MHSD 2HRPH 3CHXA 3O0RH 5F70A 1HHJB 4ODHL 4FGMA 4GNKB 2X88A 1QWHA 1TO4A 3F7VA 3MRDA 5KG9B 3V52H 3VGAB 3BQVA 2OJ1A 3D4GA 3KPOB 4KOCA 4P57A 4F7CA 3WTYA 4MXVE 5I1KH 2FEDC 5IEKB 4YS4A 4NQDB 2WUCH 1TJIH 2DBJA 4U1KB 2FEEI 2WKGA 4QHKJ 3EHBC 3BH8B 3LHPL 3G9VA 3P3YA 2ZXBA 4KK5D 1PPIA 4I5BA 4OD3L 4PWIA 1ZTXH 4ZPVB 5IFAH 2F2HA 1IFHH 4QHNB 4UT7H 2EDQA 3KDPB 3QS3A 4BK5A 3WFCL 1NFAA 1F90H 1BAFH 4UV4H 5EV7A 3PHQB 5IQMA 4S2SA 3O4LB 2JCCA 5CP3A 1PAZA 3GZQA 4LDOB 1IAII 1RZ7L 5JHDE 3P69A 2ENPA 2Y6SD 4TTDC 5CHNA 3U30B 3EYVB 32C2A 2AK4E 2MWCA 1U91B 5C0ND 1LP9F 3G6JB 4DPBX 5JR1H 4X6CF 4J8RA 4NI6A 2FECL 4QKTA 2Z1PA 1B0GA 1WWAX 4NKMA 3AG4B 4FP8L 5D7HA 2ZSWA 3IF1A 3BKCL 3A24A 3STBA 4EZMA 2PO6B 2CDGA 4UQAA 4LCIH 4H88H 3WE1A 3GB7A 3KPRA 4JPQA 4MJ6A 1AE6H 1FNAA 4PJEF 2V17H 3CXDL 4ABVA 5A3ID 2CLRB 3PG2A 4C58B 1EAOA 1BFSA 1KIRA 5HJGA 1B4JH 4RX4A 5HHOD 2GG1A 1YECH 1EZLA 3U2SA 5J1SC 3GRWL 3R4RA 5AOIA 4D9RE 5I5MA 3X3GH 4YSOA 1YAIA 3RILA 3WXWH 4NJAL 4EN3B 5EFIB 3GMMA 3BGMB 2CKBH 2E9WA 5E8NA 3BAEL 5DK2B 3CN4A 3JT2A 3KPPB 1WVZA 1UWXH 5F6HI 5KYWB 2OTPA 4LPCA 1RFDH 4EOWL 2QQKH 1NM4A 4I18C 3D33A 3VFRA 2IQ9H 3MRQA 3AREA 3K4DA 4KI5E 3LYRA 4B5ZA 1E30A 4X99A 2YAEA 5AVUB 2WVVB 5CCJA 3JUYA 3VXMA 3F7YB 4A2DA 1KTLB 2FIKA 2K70A 4G8GD 3WEXB 3CZEA 3O9WD 4NPJA 4FYTA 5ADOL 1YEJH 4ZFOL 4LCCC 1O5DT 4RA0C 1HCZA 2HFEA 2QKSA 3MROA 3FBKA 3PHOB 1I1FA 3IRZA 1S8DB 2WLZA 4MAZA 4KVCH 1NJ9B 2MTPA 3O2WL 2NY5H 4YHNB 1XGYH 2VAAA 1ACYL 1NH6A 4R83A 1GY2A 4G11A 3DUUB 2VLRD 4U1JA 2VN3A 1QQDA 2B16A 1CT8B 3RTLA 4X6CB 1CS6A 3H9HA 4FNQA 4F8PA 2BVEA 3B6SB 3RDTB 3VX1A 4XAKD 5EWIH 3EGSA 3FFOA 4U49A 4PGBB 1TITA 5D93B 4TUOA 1DBAL 4OZGA 2QJDA 3GXFA 3LIUA 1MREL 1WJ3A 5JORB 3AROA 1NAMB 4WKXA 2H26A 2TRYA 2FHCA 3JTBA 3UTOA 2YPLE 5IQOA 4Y16A 4NQEB 3MACH 4UB0L 1ZCRA 5B3JF 4JQXA 3FJTA 2YQBA 3UGXA 4HIHB 2X89D 1AS7A 2WGXA 3OKEB 2FB4H 1OSZB 1KELL 4OAWB 3VXSD 4YXLL 5DA0B 1MAJA 3DOIA 1F4YL 5HHMD 3L3GB 1LLAA 4UZSA 5AKRA 3ZJAA 5L9DL 2WXIA 5D1QC 2BOBB 1GY1A 4MA3A 2E7HA 4S1RH 4Z7WB 3WTTA 5ILTH 1IX2A 3VWKA 2OZ4L 12E8L 4M5ZL 4NO3B 2E7LC 5JHLH 3ZUCA 4N9GA 8PAZA 4AYDC 2R0ZH 4OZHE 1JZFA 2K78A 4PREB 4K94C 1T2QH 5HI5D 3QDGB 1UWYA 5C0FA 4P4RB 1XGPB 3JTTA 2Z31A 2GSIB 4FC3E 1NMCC 4JG5A 3VFVA 1MVYA 4ZMYA 3HE6C 3BN9D 3Q1SL 2COQA 3N6YA 5D5MF 4Z7UB 4XCCH 1PY9A 4XHJC 1Z3RA 2F61A 2WZAA 5EU3B 5F7NC 4WJ5B 1QNZL 1CFSB 4X4XA 3GSNA 1YSOA 2VUYA 3ARFA 2QGEA 3FTYA 4JFTA 3UO1H 5ID0A 4BJLA 3NJLA 3QXDB 1DVFD 4ZK8A 2IEPA 1HL5A 3DYOA 5LQBH 4L8DB 2F5BH 4XO3A 2MKWA 1SHXA 1IAMA 2WXMA 2KPNA 2WWNA 4JN1L 5GZND 3UIZA 2W0LA 1XF3B 3HS0B 1YPZB 4LLUB 4O5LH 5E1GA 3Q48A 2VLKA 1WD8A 1XSJA 2XPGB 4J27A 3P4NB 3OPUA 2G3NA 1NCAH 4KKNA 4XVSH 2IALB 3DTXB 4IK7A 1R5VA 1K3ZA 3BQUA 4YFEA 2VXSL 2KLSA 3FU9A 4JDZB 4DOHE 1IC5H 1QPKA 1A3QA 1ERNA 1TKWB 4GP5B 4R84A 5F3FA 3VD5A 3JBG7 5DVPA 3RWGA 2IAMD 2CDEA 2XZAH 2ZPKL 4OV5B 5DEJA 4WUUA 3ILEA 5CSZB 1S9WA 1ESOA 5E6IB 3QHZH 4MD4A 3WV0A 2CQVA 4F2MA 2FHFA 2LTQC 4GRLB 4E42A 1EXGA 3QWRD 2Y23A 4WTWA 1CG9B 1G5AA 3NQIA 4XN7A 2IH3A 2ZXQA 3H42L 2IANB 4Y1AB 5C0AE 2I26N 1LO2H 3AFLA 4XNZB 3UTPD 2Y3AA 2CHNA 3CHSA 1TLMA 1FL6B 2PPFA 3RFZB 2BSED 3F6LA 4LMQI 4XNZC 4Y19A 2O30A 1OL0A 4RFEB 4PVNA 4R4FH 4GH7B 4FQ1L 5K9QG 2PF6A 3I3DA 4DP2X 3IMRA 4MAYC 3GMQB 3NYKA 1OM3L 3IDYB 3LZFL 3ZLQC 5C0JA 3GI9L 5I1GH 3IMBA 3ME0B 3L4ZA 4Y5YC 3Q44A 1K3IA 5HDQL 3FONB 1XF5B 2QV2A 3EDFA 5DMKB 1KOAA 2Q8BL 5H94A 5IFAL 4XVUD 4H44C 3S48A 2G5UA 4GUCA 1JF1A 2BCMA 1K5WA 2RCSH 3HPJB 5DYOB 4EIZC 2WYTA 4V11A 2BRQA 2HCZX 4QRTB 3SJVB 4Q52A 2FCBA 1I3UA 5IM7B 2NNFA 4AEFA 4JUTA 1T1ZB 5D7LA 5DFAA 3SDDB 1UUSA 3FB8B 2DI7A 5ID1B 3D0VB 5CJOH 4UTAH 1HYSD 3KDMB 2R4RH 3K5SA 3SIKA 3ZHKA 2YEZB 4E36A 1IJNA 3QIUD 2GC7C 3BUBA 4F8TA 3V79C 4J3BA 1F18A 4P2RB 1EJFA 4WNQA 5GS1A 4FMFA 2DBLL 2LE9A 3OHMB 2KDGA 1C5DA 3PGFL 3CDYA 3X12A 4CC4A 3WUWB 5DI8A 1L7TL 4AK1A 2E7MA 1QAWA 4LHUB 4KTYA 2GJ6B 3V0DA 3VW3L 4NIKB 3OB0K 3ZU8A 3KL3A 1SYVA 3RZCC 3MCKA 5ITFB 1HKFA 2FWOA 5FYKE 1SRDA 2XVKA 2NY1B 3L3OA 2VDOB 1O7VA 3T04D 4P04A 4HH9B 5D7JC 2JB6A 2MPAH 3JTSB 4DP7X 3HB3D 4Y9EA 1X5YA 5JUEL 1RFDL 2HLEB 4Q8BA 3IU3A 4HULB 1P5UA 3D18A 3AB0C 1IC0A 5HI3C 3BAEH 4IRSC 4D0DA 1SQMA 2XTLA 4EO5A 2P5ED 3EYFA 3HG5A 2VDLL 5TE4L 2NDGA 5LO7A 1GGBH 2MHAA 1FZJB 3IETA 4LASL 3GSQB 4H0GA 3B43A 4U0RC 3S5LB 2HKFL 2Y36L 1KLFA 2I9LB 4JRFA 3Q6GH 1USZA 2CKBA 5ALBH 3NJKA 1RUQL 1KC5H 4XC3L 1CCZA 4NRXA 3ZDXE 5DLMH 4JGUA 4EI6A 4OFPA 4R3SB 5CO1A 5HPMA 3CFBA 4UIKH 1J9CT 1DYZA 2FBOJ 4ZMQA 3UP1A 1D6VH 1RHFA 2HLFD 5DWUL 4QOKD 5IVNA 3S5LG 1TEYA 2QGDA 4GSDL 4A37A 4ADGA 1Q1JH 3O8XC 2XQBL 1NKGA 3MLYL 4ADJA 4D0BB 5KSUB 3EDJA 4HZAA 1TZIB 4N86A 4OSUL 2HJLB 2ORBL 5BZXA 5D1ZA 2GJRA 2LFGA 2APWA 1FL3B 4FABL 2VR4A 5C0RH 1Q1PA 3KWUA 3P1VA 1NDMB 1C16B 5AYUH 4UTBA 3T08A 1TCRB 5I18H 5DSCB 2LABA 5TH2B 1N6VA 3P9LA 3CC5A 1TETH 3GZKA 5HYJA 1OCWH 3ATFA 3IMUA 4OFYD 4QEGA 3RAJH 4Y4FA 1KSRA 1FBIL 1EERB 1U4EA 1YA5A 4X8GA 1T7ZA 1D7BA 1HCYA 3BKML 4PWHA 3LPFA 1EQWA 2VDQL 3AQXA 5KOVC 4G6FB 4HKBA 2XWBA 3I02B 4EDXB 3RPIA 3IDMB 5DURB 4ZFQA 1IM9A 1D9KA 2QSCL 3U6RA 3ISYA 3O4OC 4G8AC 2OI9B 5KW9H 12E8H 4M5ZH 3EG9A 4TOYL 1YEGL 2CKNA 4PP2B 5LVEA 1ZA3A 1UM4H 3ULUE 4PUBH 3T0VA 3FXIC 1OKEA 3T1WA 2K9FB 2D03H 3PWNA 3K6NA 5AOZA 2M2DA 4PV8A 3LJ3A 4LP5A 3JWNE 4ODSH 2PTUA 1GZQA 1BF2A 1KJ3H 5E1AB 1QR1A 3ULVF 3QGVA 4HJ0C 4C4UA 2YD1A 3ZRSA 1NFIA 3HAEB 5EO0A 3MLVH 5EEXA 2D9QB 4AEHH 3ECVA 3L4TA 5D1ZI 4FKKA 4JGMA 3A3YB 5T1LB 1R3LA 2MCMA 2XY1A 3CZNA 5T1LD 5TD4A 1SXAA 3W9EB 5LHDA 4HXAH 2C3GA 3QJFA 1FC1A 2HLAA 1R3LB 4G3YH 3R8BB 1Y6NR 2APSA 3KVDD 4U2YA 4KK8D 1TDQA 2NY1D 4JRXA 2YK1H 4YLCA 5IG7A 2IH8A 1RVFH 5C0DA 1RY7B 4LAJH 2Q7NA 1S6NA 5EBGA 4OZIB 1GZQB 4UIKL 3RE0A 4LLMA 4KWUA 3T3PB 5I6OA 5CSGA 1S78D 5CUSL 3PWNB 5KJ4A 1KBKA 1KTCA 3U83A 2V0AA 3H56A 1W8EA 5CLXA 3QJOA 5J89A 2V6HA 1MFAL 2HVKA 4JY6B 3U6RB 3MLUL 1N5YH 4Z7VF 2WLMA 4DN3H 1IQDA 2VXSH 1KYOK 4HKBB 5DHXB 5BCAA 2VDQB 6PAZA 2WSDA 3I9GH 4FHKA 4Y4HC 4HGMA 3MRGB 3MNVB 3IDIB 4OKVA 2ZCKL 2EVIA 4JKWA 1B4LA 2FECI 1J0JA 2GI0A 2D7PA 2XBZA 2JH2A 4Y4FB 5KUKA 5GRZA 4FKEA 4MFHA 2VDLB 3U0TA 4IU3B 3F7QA 3BAWA 3UZEA 5HYJB 4AV0A 3ZPDA 3CC5B 4HK0B 1BQLL 1BQ5A 3QRLA 3BUTA 3E2HC 3SKNA 3B9AA 4C54A 1AHWB 4K23H 2QV4A 1NBVH 5E8OA 5E8DH 1UB5A 2VMDA 4IU2A 4Y5VA 2ZXDA 1FL3A 4WFGD 4CSZA 2B2XL 3ZTDC 1HI6A 1I1CA 4JN1H 3F04A 4M8QA 2WYIA 4DP6X 4UT9A 2IDUA 3FT3A 1FFOB 2FSDA 3ZBMA 5DO2C 3U48A 2NSXA 3ZZQA 2BJML 5DR5H 2VM3A 1TFPA 5E9DB 1QHPA 5BOJA 1BYOA 4G6AD 4JKLA 3I74A 4BXSV 5D7IF 3EO0B 3F7RA 3KM1A 3U46A 1VEPA 1ZT7A 4ZT1A 3CVCA 3N1PC 5IVZB 3MSPA 5GS0L 2AJSL 1ET8A 1CQYA 3FF8A 4P2AA 2O6PA 2DD8H 4H2AA 4MMYA 3AWEA 1AANA 4F2EA 4EI6B 3ULVD 2MNWA 2AAVA 4NRXB 1KGYE 3IXAB 3QUZC 1UWFA 4YE4L 2BX5A 2BXZA 2JFCA 4GSXA 2OMBA 3AC0A 3W56A 2NY0D 1AZVA 3M17A 3ZIMA 2R27A 4TLSA 5JQHC 5GRYA 2MHAB 3GK8H 5E2UH 4QHUA 1S7TB 4IKLA 2OYLA 2BVUA 2L7QA 5IHUH 2HPOA 4Y7MA 1NWOA 4F5CE 4HC1L 3GXTA 4MD0B 3DJSA 1JV5B 5D6DC 2Z91B 3AG2B 4HEPG 3VGBA 1ZHBB 3IU3B 1I1AC 2TAAA 3MLZH 3IFLH 4P2QB 5FUZL 3QEQB 5I71B 4GI9A 2YD4A 1WQVT 2JE8A 3KPSA 4F8QA 2O5ZL 2DIAA 2H47C 1OF2A 3MCKB 5ITFA 1XEUA 2XQYA 3UJIH 5JA9A 3CPLA 2R0KH 3CFIC 3UP6A 3UYPB 4M1CD 3KCWA 2VR7A 3NJIA 2WSKA 5DI8B 3WKMH 3WUWA 1E5UI 1ADWA 4DCQB 3QARA 4J39A 1Q72H 1ZLUK 5AKTA 2DJMA 3V4PH 5EC1A 3KS0J 3VD7A 4GO8A 4K23L 1J1PL 1ZSDA 2VDNH 1UJ3C 4W70A 3QULA 5HDBE 3IAQA 3KDMA 3CSTA 4KROB 4PLKC 1EDHA 4XNYH 3OB8A 4KVNH 1AQMA 1LE5B 5DWUH 3SJVD 2X4NB 5DJ2A 1T1WB 4I0CC 5IM7A 4M62H 3WJMB 2WLLA 2Q7AA 4LIQL 5DHVH 1JMXA 2O5YL 4AM0Q 1PJWA 5GGSB 3HPJA 5DYOA 1U36A 2EIDA 3RB5A 4M93B 3BJ91 5DMKA 3ZE2E 2Q87A 4X5QA 3RDTC 1FIGL 4M93C 4URTB 3MJ8A 5A43C 3AZUA 5B3SB 5KS9A 2BERA 2C9VA 3T6QC 4KI5D 3BUYB 3ZKQD 1JG9A 1WBZB 2OZ4H 1UA6H 2YSTA 4AQ8C 2BS71 1PS3A 4N1HB 1EEUA 5JPNC 2QKIC 1MZYA 4YQXL 2VC2B 1IU1A 1HILB 4DGIL 4F7PA 2OXHB 4APXA 5ISZD 4CNIB 4G80A 4KO7A 3DX8A 4RFEA 5DD5L 3C5XA 1ADQL 1PMYA 1U92B 3CWGA 3O4LE 3SZKC 4BXVA 1FL6A 2CBQA 3D30A 1RHHB 1L5GB 1QHQA 2GJZA 4Y1AA 2IH3B 4XN5A 2O5YH 5IEHB 1S9XA 1JYWA 2WTPA 2VDPB 1GYCA 3H9ZA 4OJAA 3ZE2F 3RWEA 4MD4B 5BUPA 4NRZB 3BAXA 4Q0XL 3TIDA 4ONGH 1YYLH 4QHLA 4R2GB 4JCLA 4O02H 5A40E 4YDZA 1Q72L 5FWRA 2ZAGA 3Q1EA 3G6AA 1VESA 4U1LA 4JMNA 4NKDB 1IFRA 4YHPB 4P23B 3V4VH 3Q5TA 3OHXA 1QBAA 5GGRY 1NANH 2XG5B 5C0CA 5A16B 2CPCA 1J5OH 3HBZA 5JHDD 3O3UN 1IBYA 1JPTL 1KJ2B 1N7ML 4YDKH 4GKOA 3KPMB 2O5XL 5FWQA 5D2NA 2VLKB 1HH9B 2P8PA 3FUJA 1OQXA 2KZKA 1XF3A 4ODSL 4C57C 1JPST 3T2QA 1TENA 2W9EL 1HNGA 1WAEA 2FQEA 2O6DA 2K7PA 2W95A 3LRHA 1Z5YD 3QXDA 2R2EA 1AKJD 5CJXC 5F7DB 3FQTB 3IDXH 4M7KH 3MACL 4UNTA 2AV1A 5ID0B 3W57A 3Q8EA 1T21B 4HKJA 4NO5A 1AQKL 2I24N 4Q2ZB 3RX5A 3GSNB 2LLNA 2PXYD 3F84A 1MFCH 4JPWH 4JZJC 3LPOA 3X3GL 5C0GB 3Q43A 5IFJA 4CDGC 2D73A 1KNOB 1RJYA 1YEFH 3LQZB 5JNYA 2DKSA 2PNDA 5C0FB 2KBGA 3DIFB 4L0ZA 2BSRB 3QNYB 4UT9H 4WFGE 1MH5A 3LEVL 1Q8MA 4F7KA 2NX5A 4Z6AT 5A6MA 4R5XA 2FJFB 4DGVL 4Z77A 3RJOA 3CFEA 5AZEL 3V6ZA 1WHPA 3LZQA 1BG1A 3CPUA 4HJSA 1KB5L 3WNOA 5LCVL 4XVJH 4NC2B 4OCMC 4ADIA 3NEOA 1KFAL 3ZUNC 3QPKA 3HE6B 2NDFA 2YKLH 4RGMB 3EJUA 3GLAA 4EUPA 1AQDA 1KEGH 1F45A 2FQDA 2OS7A 5IUSA 1OSZA 5DGRA 1IBGL 3OKEA 1E40A 3CZKA 2QHLA 3T0BA 5L8LB 1ZA6B 1T0PB 3A4DA 3DVGA 3AU0A 4NQEA 4Y16B 4RMWA 5D1QA 1CD1B 4U3HA 3QWNA 4OT1L 1AP2A 3LXCA 3LB6D 1T1XB 2F5BL 2BP0B 1JUFB 1CGSH 1TLKA 5GIRA 5EUKA 1UKTA 3V55A 4R5VA 5IBLD 1DVZA 4S1DC 4DGVH 3HN3A 5BXFB 5CM1A 2XT1B 5A2JH 1A9EA 1PL3A 3H9HB 5DR5L 4YWGH 2GFBA 3TYGL 4CBPA 1ZHNA 1M2VA 4MX7A 3BFQG 4LBAA 5SWSE 3DUUA 4U1JB 4QRRA 5KYUB 3NRFA 3WAKA 2VAAB 4YHNA 5DUPL 2WVUA 4B96A 1S8DA 3OZLA 2OMVB 4FADA 4UILH 3MROB 4LEXL 4H26B 2HB0A 3QEGH 4PGCA 1CFNB 1L9MA 5ITBH 2GT9B 2EE2A 1FORH 2AJ3B 3PF2A 1KTLA 1R19A 2FIKB 2J8UB 4GKZA 3WEXA 4OZFB 3F7YA 3MV7D 1FZMB 1P84K 1ZT4B 2Y25A 1R3JA 1EHLH 1SHSA 5AZEH 4GIOA 3JZYA 2H2PC 4X99B 2VITB 3FQXB 1DL7H 3ULUD 3QIWA 5DJAB 2ESVA 4L9LA 4WI8A 3MRQB 3LEVH 4F15C 4KU1A 4YSDA 3CHPA 5DGQA 5KYWA 2EKJA 2EDLA 4BE6A 1CGTA 3MBWB 2AEIT 4HWBA 5F9AC 1M6OB 5EFIA 4EN3A 1RI8A 5ERWB 2NT0A 2Y1YA 3AS1A 1MFCL 3GXNA 4OJFH 2QLYA 5AYTA 3HHSA 1X5HA 3U2SB 4PGJA 4GKSA 1NWPA 4P3CH 4YE4H 4PSRA 5EBWB 5K9OA 1MCKA 4KDTC 2Y2WA 2I9TB 2DQEH 1T7WA 4YNYB 5JXEC 4ZS6C 2PO6D 3TURA 1DANT 3LZFH 3U4BL 1ASPA 2IWKA 1NL0H 4XGZB 1EH9A 3IMSA 4V2CB 3MKKA 3TNNA 3IF1B 3W37A 4JJHA 4QD2E 3C2AL 1OCWL 5AQ0A 2NOYA 3B2UD 1JZDC 2R1WB 1GVIA 1MJ8H 2A77H 1P6WA 4A7GF 4ERSL 3G6JA 1K5NB 4I8DA 4ZTOL 3IJSB 32C2B 2MRYA 3U30C 1QLRB 3OAUH 2JCCB 3QZLA 4KX7A 4GG6E 3KR3L 2IQ9L 4PHXA 1VLXA 4LOVA 2NUTA 4R0LC 4U6XA 3OM3B 4QHNA 3MAWA 2PPDA 4ZPVA 1TYJA 3O6ML 4Z0XA 2FZ3A 3AAZB 1A4CA 2L7JA 5I24A 3N3EA 3L3JB 1KCVH 3RWFA 2J1XA 3BW9A 4CRPA 3HMXH 3H4HA 5BVJB 5SX5H 3C12A 5E94B 1QTPA 3N42B 1DJSA 3S0PA 1CBVL 4F2ME 3OL2A 4F7CB 3D3VA 1FFPA 1M1XA 4JVPA 1Z6JT 2QQNH 4EE2A 1ZDSA 3APFA 3GBMH 4FI7A 2EEDA 1T3FA 2JCWA 2WXNA 1J88A 4G8FA 4TLKA 1SN5A 5K9JH 5E2WH 5I1JL 1LEIB 1F0LA 4RCAA 4EN3C 3D08A 4FQQB 4MCMA 5A6IA 4KXAA 1ES0A 4ACPA 2BNQA 3EUDA 4IRSB 3SE6A 4BHUA 2YLKA 4QXGH 2UZIH 1S4IA 3FN9A 2EDJA 1HL4A 1QUNA 1JZ5A 1MHPH 2HG5B 5CWSB 3FB7B 1U3HD 4TUJB 5DS8A 4GW1B 3O0LA 2GKIA 3VXSA 3RWDA 1OSYA 4YDLB 1OAXL 1M6UA 1E7UA 3BT2L 5MEPB 1TCMA 2IXQA 3MOBL 1EJ6A 3B7TA 4M1DH 3SQOH 4ZW5A 4DUXA 4P2OA 3ARBB 2V7NB 5IVXA 3VW3H 5L6YH 4HJUA 5K9KA 3TBCA 2Y7QB 4ONHA 4I4WB 1NDGA 4N2FA 1UA3A 4UTAA 4BGLA 5ACZB 3B1TA 5CBEB 4FEIA 3TN0D 3LV3A 1F4YH 1TQCC 5DJXB 4XNBA 3WGUB 4KQ4H 1K8IA 3QO1B 2W65A 2Z92B 1DLFL 5DVMA 1FSKB 3ZHNA 4RLDA 5ABAA 3CFKB 4OF5A 4DUVA 4QOKB 1F1AA 2YD3A 5EZJA 2UY6A 2LOEA 2NQCA 4R90L 4ZQKA 1XB6A 3BESR 5B39B 3OLDA 2NNAB 4FXGB 1N64H 2GAZA 4J8QA 1DBAH 2Y3NA 2QGBA 4HJ0D 3OBAA 3B9EA 2DLFH 1CTOA 4HS3A 1BZ9A 5DRNB 1WCBA 1SBSL 1V27A 1XR8A 5J12C 1AHKA 5JPNB 3FRPA 2WNGA 2EYSA 1FYTD 4J3TA 1FVDB 4QDGA 2DMKA 3ZR5A 3BZFB 1E9QA 3GD1C 4D8PA 2GPZA 4JM2A 2DQJH 3FQYA 5IVOA 3UTPE 4JJOA 3V0AC 4Q58C 3S35L 4P5TD 1TEFA 3O6FA 1PY4A 5B22A 1G43A 3BQUD 1CXIA 3FO1B 4OGAD 4JKPH 1HE7A 4B50A 5DVKA 1MLCA 3DETC 1PD0A 1NBZA 1CO1A 1GKEA 3D9AL 3GHEH 1OSEA 5B3NA 3QUXB 4Y4KC 1CL7L 1FNGB 2UZXA 4K3HA 1O9ZA 3CVHH 1MIML 3ULUC 3VXTB 3RIAF 1AD9B 4UYQA 4QKXB 3PIQA 5C0AB 5ETUA 3RUGB 1MJJA 3KCPA 5GS0H 3SGEI 4HQQL 3QZPA 4M03A 4NQXB 2MJWA 5KBPA 1SJXA 4Z5RA 4ZFFA 4UM9B 2R9HD 2G3MA 1N3NB 2AJZA 5CZVL 2FNBA 4M4PA 4IRZA 4OF3A 3B9VA 3H3PH 4U1IA 1J0IA 1E4XL 3UROR 2P49B 1N10A 3S36H 3WY4A 1JI1A 3WIIH 4WEBH 2G75A 3TM6A 4YSUA 4ELMA 3BFWA 4ENZA 3ESPA 5AAPA 1Q9KA 4PGZA 2OSYA 5FGSA 3N0PB 3B2VH 5IJVB 2Y72A 3P30H 3PP4L 5CXPA 4AXWB 1C5CH 1D7CA 4PIRF 4KMLB 4G9FD 3Q2WA 1IC1A 2ADYA 1IAKB 3QDMA 5DMGD 1J5DA 4A55A 3A23A 5HHMB 5C7ZA 1MSPA 1J11A 1E90A 2DTSA 4JHVA 2BNRA 3Q2CA 4NN7B 1E4KA 2YC1A 2EO7A 5FW7A 1MCNA 1HOCA 3U1QA 2AJUH 3B9DA 3PDOB 3D4YA 3TN0C 4UINH 1N6UA 1JHKL 1ZJBA 4HF5H 2WY3B 2VDPL 4ZFZA 3RNQB 4KXDA 1AG0A 4MVBC 3QHFL 1PBYA 1B2YA 1D5BA 2JELH 3CK0L 4IMKC 1G9NL 4MXQC 2NT1A 1E2WA 4R0LA 1CL7H 2HUHA 4N87A 3HR5A 3Q8CA 3NQKA 3AXHA 3SBRA 3UIYA 1ROWA 4BZYA 2OULB 4JM4H 1C7SA 2VN7A 3WDHA 4IQHA 4WW1B 1OLLA 2GBVA 2Y24A 3GM8A 1UD8A 3JUZA 2X87A 1ZD6A 2RGSA 3CBRA 4JHBA 4NZTH 2BSBA 3LZPA 2WZPA 1CFBA 3IE9A 4JLRA 3EO1A 3TCTA 2Z8RA 4J3UA 3D50A 2VDKH 4XN9A 3NN8B 3S88H 4AE0A 2AERT 2PYEA 3GJFB 1KZYA 1CD0A 3QJHB 5DWPA 3U1SH 3DX6A 3AGVA 2KMWA 3KEHA 1FVCA 5T1KD 1R46A 3MV9D 1BD2B 4UI2A 3WUZA 3EFDL 4AMWA 3QPQD 4XP5H 5ICZB 4BFBD 2XU9A 5CGYD 4DN4L 3IK2A 3OKLA 5L4JA 3GMLA 2NLJA 1H6UA 1JWMB 3QZWA 2VLRE 3GI8L 3ZE1B 4MNQE 4TSCL 1BVNP 3B2DC 1QHOA 3KYMA 1DE4A 5FF6A 1VKXB 2WXRA 1DVFC 4J3OH 5K33A 2RACA 5GGVY 1XGYL 3QFDB 3QAZB 2HTLC 3RVVC 1QTSA 1ICTA 4V33A 4G7YL 3PY9A 1HQRA 3QAZC 4N0FA 3BWUC 5AAMC 3TEZA 5DHDA 4H8QA 1BX2B 3DYMA 1Z5HA 3RKDC 4E9TA 4ZOEA 4IIQB 5D7KD 4GAGL 5DTFB 2WYZA 4CJ0A 4OQTA 4BSWA 5IBTL 4Z3JA 2C8NA 4UOQA 3S3PA 4WJKB 1I1RA 1R3IL 3WFDH 4KO5A 5BW7C 7PCYA 2DQTL 1ZGLA 3GMRA 4PRDA 3W11C 5A3IC 5MI0C 4HUNB 2R23B 5IESL 1S9VA 1G0DA 1Z3GL 2FX7L 1AXSB 2B1AH 3ZT6A 3L3KB 1CI3M 3GKWH 3T4YA 5L8JB 4HUVA 1LM8V 1BREA 3L5IA 4L3CA 2I07A 2MPAL 4D9RD 4UT6H 1XB8A 1EGJA 1J8HA 2V9TA 5C97A 4PD4K 3T2NL 2F54A 2ZWKA 4LOFA 3GXUB 4ZO9A 2Q7YB 4HU2A 2DD8L 1AGFB 3N06B 1MUJA 4YGAB 4L4VB 2ZX8A 2X4TB 2G9HB 2GITB 1AJ7H 2XZZA 2BWDA 3AUWB 5F9OL 5SX4H 2CBTA 3BWAB 3CXDH 4QXUL 4HCRH 1BQKA 1RK1A 3HKZA 5SX5K 1EEYA 3S8WA 3HMXL 3BIKA 1XCQB 2YAHA 4Y4KD 1YUHA 4YDVB 3HLAA 4IKKA 2H2SD 3BSGA 3WNMA 1Z9OA 4KTEH 1UCBL 4NXSA 3QDAA 4D9QE 5HDBB 3UJTH 2G60L 5DJCA 3HVNA 4XN1A 2Z0UA 2J6WA 4U3CA 3L54A 3CLWA 1BMGA 1VCBC 1NCAL 4XVSL 1DSFL 1XO8A 5IQ7H 3VMOA 4U1MB 1OT1A 2DQDL 2ITDA 8FABA 3MRMA 1N26A 2XWTB 4MGXA 2GJJA 3T0EC 1NGQH 4U31A 4JO5A 5I2IA 4NT6B 4AVHA 1AMXA 3MV8B 2ZJSH 3IWUA 3O9WB 3KBEA 2NR6A 3BP7A 4LVNC 3VFSB 2B77A 4HU8A 2VERN 5KVFE 4R2GC 5EUOE 3ZRFC 4DHLA 1PNDA 5FDYA 1OP3H 3AMKA 5IBTH 3ULVE 1JV2A 3SE9H 5JDSB 3DURA 5E70A 2HFFA 1JPSL 2YRPA 4YPJA 3EFOA 4AEIH 3FNKA 2JKLA 1LK2A 1A2YB 3DKHA 1KCBA 5DVLA 1FN4A 4HYTB 4MYPA 2D31B 2WXOA 3H42H 5TE6H 1MHEA 1MRDL 4PJIA 3HC2A 2F19H 3MLXL 5KTEL 3Q5OA 2NY7H 2FO1A 1ZWIB 1PAMA 2CUHA 3HAEH 1OCCB 5G5DB 4CMMB 3C5JA 1EANA 4RNRB 1I8LC 5MENA 1AVAA 1DN0A 2YUXA 5HGDA 2WN2A 3SQBA 5I1CL 5GSRB 3P9MB 4YZFF 4X9GA 2CO3A 1M7IB 3BDXA 1Z3GH 4R90H 5DZAA 1I7UB 2H1LM 4EZKA 3Q3GB 3W11D 4G82A 3HG1D 5DJYB 1TVBB 4AQAB 1A6WH 2ZX6A 1IKFL 3MRPA 4GBXD 1SFHA 2VZUA 4TNWF 1MN4A 4ESKA 1AY1L 2VC2L 4IRZH 4HDIA 3MRJA 3QDHA 3N40P 4LCYB 4PJ7F 1G7HA 5ANHA 1QPPA 1KJ2L 1DR9A 5I1AA 3C60A 1CLVA 1T20B 3FTWA 4M3JA 1KELH 2DWSA 2EDMA 1HEHC 2IANE 5MENE 2D3LA 4UQ3B 5FIEA 4B9JA 4IS6A 1J9SA 1UD4A 3BUPA 4LEEA 1NCTA 2B59B 4G6MH 1A7BA 3E9UA 3QH3B 4F3FB 1ODUA 4JFPA 4WW2F 2W80C 2FX9L 1TR7A 2F1AA 3QIBB 3UAJA 1URLA 3RWJA 1Z9MA 1LP9E 1T0OA 2Q6WA 4OCNC 4DKFL 2LAGB 3QT2A 3FHEA 3MV11 3LH2L 1M9WA 1SPDA 1PX4A 2HT2C 1ML0A 4ONGL 4BK8A 4P59L 2PP9A 3MREB 2FVNA 4UUJB 5HVFB 5L7XL 2ZX5A 3C5SA 3QUMB 3GNMH 1BGXL 4QY8A 3G04A 3V0IA 3WJLA 4AUYA 5BS0A 2BJMH 3TBSA 2B4CL 1R47A 4BK5C 1Q0YH 1JTPA 5EBMB 2RD0A 1D5XB 4U1SA 5DJDB 4H8VA 2NW2A 1I7ZB 3VE0B 3U1SL 3MUY1 35C8L 4Y4FC 2Z0BA 2FX8H 3TP4A 1BLNB 2G0LA 5J0BA 4QT5A 5JMOC 2HN7A 1NANI 3OVUB 3TJEL 1KXTA 1NBVL 1SEBA 4N0RA 5E2JA 1HIMH 5DRZB 3FCSA 1SDAB 4Z78A 3HZ3A 3D51A 2NXZB 3U1PA 4IJTA 4K7PH 3F7KA 1WEJL 3AXIA 3BRFA 1AC0A 4GW5B 2D9CA 3BMWA 1U8QB 4YFDB 2C1PA 5LNDA 4JDTL 4BZ2H 3T77A 3L7FB 2TSBA 1RQ5A 4ANKA 1B90A 1A7OH 3SDDC 5DQJA 5E24E 1R5WB 1E27B 4RA3A 1G7PA 5D2LE 3PABB 2IFGA 4RX4D 4ZOAA 3ARYA 1KT2A 3EH3B 3QBTB 1AZCA 1BFOB 5DQ9B 1O9VA 3OAZH 1Y0LA 3BN9C 4Y5XB 1A6WL 2B8OT 5I1KL 2AJUL 5CIPA 5T8IA 1WSST 3A5VA 1GZPB 4N2OA 4BQBA 3WIFA 1D6EB 1FJ1A 4WWKD 5I16A 4HUWA 4U7SA 2XVGA 4NM8L 5I1CH 4X0KB 1PKQE 3VXUD 4HG4K 2WWKO 3EJZD 2VL5B 1A6TA 2ZXCA 2L8AA 2JIXD 1MQKL 1Z0NA 4LCVA 4XP5L 1TMQA 1E8WA 4JCWA 1RIHH 1MCIA 1J87A 4JFOB 5A2IH 3AWGA 1E50A 2IDCA 2BMKB 1A14H 2H2PD 2EH7H 2QVKA 5DU7A 2C9XA 2Y0SA 1E5CA 3EOBA 3L48A 5IV2B 2NNCA 2FGWL 3TV3L 1RZFL 4DETA 3AY2A 5EORH 1OHQA 1JF5A 3IDNA 1DFBL 2VLJA 1YCSA 4RAVB 2J55A 2KLRA 3TA3D 3VQ2C 1KTBA 2H6PB 5GRXG 3L81A 3HRPA 5FK9A 5IHZB 4K9JA 5F2FA 2A9MH 5CCKL 3QI9D 3WHE0 3TH2T 3MRFA 4A7TA 3WBDA 1FDLH 2FGZA 1BIIB 1ZLWH 5B4MC 4AMKL 1QVOB 2VLRA 2WQSA 3PREA 5IB3B 4JQIL 5E4IA 3O3BA 1YN6B 4Z7WF 4C56E 1NCDL 4Y9GA 3MGOA 3GHBL 2C5DC 3WFHB 2PYFA 2X41A 3S37X 1Y18B 4N9OB 1YEDA 2DRUA 3RJQB 3SE4A 5FYJD 4TLUA 5IBUB 1HJCA 3NCEB 4MNGA 2A9AA 1O5PA 1D2OA 4M8VA 3V7AE 1E9OB 5BO1L 3S96A 1PQZA 4JFSA 2DDQH 3FT1A 3J8F7 2WKOA 2DQJL 3HB3C 2ED7A 4UQBA 3KNBB 5FUOL 1LYQA 4FQ1H 4HJGA 4YR6A 1OP5K 3S35H 1CK0H 3K4AA 5B38A 1VIWA 2BSSB 1NQBA 3EOAB 5DO2D 4N0UA 1KGWA 3DXAE 4OM1H 4Z76A 3RLSA 3QQDA 2OMWA 4BZ2A 3K74B 3A67L 5I26A 1P2CB 2C4FU 2GSGA 2BNRE 3GSOA 3C87A 2OX5A 3PHAA 1OE2A 3UMTA 4AV4A 4AIOA 4OU3A 3U4EA 1KJVA 1NIEA 3EJSA 2P28B 3Q7JA 3WNNA 1KCRH 4L4TD 4PJEA 2F8XC 4GRMA 5DHYA 3UTZA 1HFUA 5AW3B 1EX0A 3F62A 4WKZB 3SY0A 4Y5YA 3QK0A 3SDXF 3TT3L 1NIFA 1E3XA 4BELD 1U8MB 4JFDA 1RJZA 3DOSB 1VACA 2J1KA 4WWKC 5FYJL 5BVPH 4HQQH 4L8BB 1H9DA 3IGFA 1A1NA 5E9NA 1NMAH 43CAA 4F33B 4WWKB 1KWGA 3PUCA 1VFMA 3CH1A 3IFPB 3W82A 4AENA 5AALA 4KK6C 2IH1A 5INCA 1A9BB 1N12A 4Q9RH 2AS5M 2OYMA 5EMYA 1CGWA 3NJNA 4P5MB 4K5PA 5ELIA 4BWTA 3PQYE 1P1ZB 5AL0A 4LO9A 1UACL 4FG4A 5DXWA 2YPKA 3V10A 5EHFA 1QKZL 3NA9L 1QSFA 2AKRA 3M45A 3WL9A 1BXVA 4I48A 2YN3A 4OGXH 2BK8A 1FL5B 3PJSA 4ODUB 5EF2A 2F53B 2NY2B 3UBXA 4XMKL 5GS1C 2VW6A 3QPXH 2NY2C 4KGLA 4NUMA 4N2BA 3VFMB 2DYPA 4JL1A 1YMMA 1NLDH 3ASWA 1L9SA 4PRIB 3C5ZC 4G1MB 3GRGA 1J05B 5AW6B 1E43A 1DVXA 3CD4A 5GS3A 4LL9A 2UWEE 4Y88A 1VAHA 3S36L 3MRKA 3SOBL 3UZVA 4BFRA 5JLZA 1KJMB 3DVNA 3U7WL 1J0HA 3H7BB 3F5WB 1H5BA 3B2PA 3MNWA 3VXRA 3N43B 2ZCZA 3LHPH 4YVNA 2ICEA 3AW5A 2DDQL 4DQOH 2ADFL 3PNRB 1OW0A 4ZX3A 1OTUC 4JM4L 2VABB 5TQ0L 4RGOL 1QBMH 5HDWA 3L3HA 5CZRA 2VDRB 5SWSB 3QUHA 4G2AA 3QO0B 2IADA 4D9LH 2Y7NA 5BZWA 4JM2F 4I1NB 5J9PB 3DDGA 2ED8A 2RTTA 2V9RA 3F05A 3IPBA 3OR7B 4Q4EA 5EOCH 5GSVA 1G6RL 3CFMA 4PWGA 2IGLA 1FNEB 2VIRA 3ZRCC 1ORQB 1FPTH 3HI5L 3ROOB 4UINL 5HBBA 2ZKYA 2DTML 1N0XH 1PG7X 4PJAB 5KWYC 1P7HL 1U95B 3VFTB 3L16A 4PRAA 5DRWA 3GLEA 4LBEB 5BNXD 4M4RA 3DOHA 4NNXA 1T83A 4TSAH 2J5LB 2V2XA 2E7DA 3S9DB 1BEYL 4GUPB 5KSBA 3ULUH 3VX0A 1UUNA 1O7SA 3ULSB 4FABH 1M9SA 4ETYA 1DJXA 2XXFA 5C0BB 1KPRB 1HH6B 3MOBH 3ZR6A 1F11A 3KYOA 5DYFA 4F37K 2AABH 4WGVB 4WDIA 1AQ8A 5HI4C 1NCBL 4NZTL 4KMTL 3QIWD 2HRGA 4G1EA 2NR6C 3T71A 2WC7A 2CD0A 5E99H 4GUOA 5IVXE 4OGXL 2E7LA 4JY4B 3MO1B 4OGZA 4X42A 4XP9L 2EADA 4UILL 3CLFH 5E95B 3T2LA 5LNGA 5AD0B 4R4NC 5F8QC 1QO3B 1PF3A 1PW3A 1R3HB 2XZAL 3KHQA 4PJIF 3NH7H 1OIOA 1IGTA 1Q9OA 5TDOB 4RGNC 1L7IH 1P6AB 1OVZA 1UVQA 5FA4B 4XWGL 3ZTEA 5TGBA 4PLKD 2H8PA 3M1OA 1BYNA 3EZJB 1B0RA 3JYBA 1HEZB 3GDCA 1A3RL 4WFFD 5CUSH 1DEEA 3NZ8B 3VFOA 5AFAA 5DDHA 5FOBB 1YMHA 3BVVA 3TPKA 1OAUL 3C8DA 4GY4A 5I1LB 3ES6A 3SDCC 3EGDA 3KYNA 1ZGLP 3D3VE 3QCUH 5IUCA 1AKJB 4NO0D 2K6WA 2EXSA 1JRHL 5DD1L 3QAQA 4IGBA 4OLYL 1UG9A 2ZQKA 3KD4A 4HW6A 3CZFA 4M61B 3KE0A 2P5WE 4U6HB 3FO0L 2X4UA 1BQHA 2YRBA 4MVBD 4N0YL 4UT6A 5KAQF 3KS0H 2X4OB 4XXDA 2FX8L 2MCPL 1XGQA 1P5VA 1EHAA 5AW2B 3RWHB 3D05A 2UXTA 3WJLC 3VU1A 4Z7OE 4XTRD 5DZVA 4WI2A 4ZUVA 5MI0B 2X1WL 5I76B 1GGUA 4Y2OA 1DBBH 2FATL 5CP3H 4OM0H 3E80A 1D3CA 2PCFB 1GW0A 3G6JE 4TLTA 1C5BL 4HLZG 3P54A 1U3YA 1CFMA 5EC2A 4PB9H 2UZPA 2X70A 3E6HB 1SVBA 2YRZA 5B7EA 2BP5M 3D6GA 4FFZL 2K3TA 3D3VD 2HX7A 2H3NB 1FRGH 1WTLA 4QYAA 5A2FA 1EAJA 3MUUA 1TZHB 4FQXA 4X7CC 4L8SA 4MAYB 9CGTA 5A2BA 1FDLL 2EIMB 4XNXH 2WOYA 5T1KB 4IOSA 3K71A 1V3MA 5F7AA 2C3WA 2BY3A 3C75A 1SJHB 5FW6A 3VG9B 4CADB 2VXQH 4KFZC 3GXIA 4B3VA 1HHHA 4GQ9H 2GCYA 4KJWD 2IPUK 5F7HA 1DJYA 4PBXA 4AW7A 1U3HA 1I85A 1BOGA 3CX2A 5F9WC 1SJMA 5SWZD 2V5RA 4BCXA 1A7RH 1T6BX 2RH0A 1BJ8A 1OTUD 4FXKB 1MNUL 4P2OD 4WW2B 5IB5A 4O9HH 1A6ZA 3FZUD 3OKMB 4HCFA 2VB5A 4XX5A 4QJ5B 4Z3GA 5IHHA 4JFXB 5EU6D 2XWEA 3H2WA 5D2LB 4M9OA 3RX9A 3QQ3A 5IK3B 4JUSA 4OCSH 4NNPL 4PJ8C 4JG1L 4WHYH 3OKOA 3BT2H 4LKCA 1RSYA 3DSNA 2X28A 3C5ZA 3VG0H 1F4WL 1ULVA 2WLJA 4HCRA 1JGEB 1I9RL 5GGQH 2D2CC 4HCGA 3OMIB 2I5YH 1INDH 5IHLB 4OJDH 1J5IA 4ANUA 4DN4H 3ZXAC 3DECA 1PKQB 3Q6GL 3SE9L 2O93L 2WO3B 1JE6A 1N0LB 1NTDA 4KKZA 1XAUA 2XWXA 3THMH 3RZCB 3QCTH 3AUVA 3K46A 3O2WH 1FE8L 1WT5A 2C4XA 3FO9B 3GBML 1KF9B 4ZXBA 4MQ7A 1U58B 3IXTA 4EIGB 3QZWG 1S7RA 2W9DL 5LGYA 2EC9U 3V9EA 4AZUA 4HUMB 4CKQA 2XBTA 1KYAA 2XOTA 2XY2A 1X7QA 5G55A 2Q8AH 3PL6A 1A4JA 1KY7A 4KTDH 4XNUL 3T0AA 5F88B 1N67A 4BIKA 5CLYA 4TQ8A 4QRRE 4ENED 5D1QE 2XACC 3QUZD 2RHEA 2E4TA 2E8ZA 1FYTB 3US0A 5FKPA 4CJ1A 3DMMB 1OSPH 5ITBL 4XBPB 2BOLA 1H8NA 1DANU 2NNRA 1YJDL 4XP4L 4URKA 3L3OC 1MFNA 4K94L 2DQIH 5JZ7C 3PP3K 4PJBB 1VADA 1H3UA 4OLZL 4MCZB 2IAMC 2YPLB 5F89B 4QF1A 3MBEC 4QXTA 3LKQA 5L8KB 5SV4A 4RZCB 2IAMB 3GNML 2JKWA 2PR4H 2R51A 3U36A 3MUGB 5HJ3A 3EJTA 5FO7B 3H6AA 4HEME 3ZE0B 3ZYZA 1QBLH 3D0LA 4P2QE 5JDJA 5HHVL 1KYDA 5CEZH 1JFHA 2HT2D 4HIJA 3MFFA 4GS7B 4OT1H 1XZWA 3K1KC 1I8MA 5F7MC 4KROD 2B3RA 2D03L 2DQMA 4JJ5B 1OB1A 3L3IA 4K3GA 2EUVA 4ALAL 5EEUA 3MYJB 3VD1A 4MJ5A 4U1GC 2WINA 1KCLA 3FT2A 3EJYD 5E4EB 2GW5A 4Z3TA 3KMDA 3GPEA 4HKXA 4ZODA 3ABGA 1YEIH 4KV5E 1L9QA 2DQTH 4MD5A 4G83A 2NX5E 2XA3A 2H1PH 5ENWB 2AF2A 3PFUA 3EYUH 2NUPB 2EE3A 2D7TL 4HS6A 4U05A 2FX7H 1EO7A 2N7AA 2VSDA 2Q9OA 4N1EA 4U1HA 1MKFA 2EEXA 3EYOB 2XN0A 4ZMAT 4IBYA 4XBEL 2O5XH 2P24A 3MJ6A 3ULVC 3SO3C 3BH4A 4D7BA 2MKLC 3KVQA 5DJ6B 3NIGB 3PWVA 4J4PC 1MQKH 1DP0A 5FA3A 5D71H 4JRWA 4JM0A 3PU7A 1FAIH 4L3ED 5H35B 4YHML 3VJ6B 3GMNA 2YMTA 4X7TB 5EH1A 5I6KA 1F4WH 1BM3H 1TJMA 2V8MA 1QSEA 3CNKA 3N9GH 3QQ4B 4XI5C 5D7IB 3GHEL 3RHWK 3D7PA 1BA9A 1QLFB 4L1SA 4NQVB 1RMFL 3PGDA 4LSSL 5C2UB 1YYLL 5H2BA 4OLUH 4PJ7A 4UF7C 5KUMA 1X9UA 4LSRL 3DV4A 1P53A 3O11A 4A6YB 2VWEE 2CA3A 4GKNA 3HE7D 2BLFA 4PS8A 2AQ2A 2PR4L 1JZ8A 1JPSH 5JQ6L 1MFBL 2F53E 3BP4A 3AGWA 4M5TA 1MLBB 2ED6A 2I25N 1TVHA 2O6EA 4G7QB 4XZUB 2Y7OA 1MEXL 1Q9LA 1P4IL 5E5LA 5CD3B 4Y5XC 1B0WA 5CU5A 5A2CA 3FL7A 4MXVF 5GGSY 1OT4A 4JFQA 2AXFA 3SE3A 3EUUA 2BOCA 2J8OA 1CLCA 3BPNB 5LNEA 1NGQL 3GUTB 3D0AA 4I1PA 1S7XA 4LU5H 2E27H 2EJ1A 2A73B 4HT1H 2ZUSA 4GW4A 4MJID 5EZOH 2UZYB 5EA0L 4AL8H 3CSYB 3ET9F 2DIBA 4UIMB 3WEOA 2DH3A 1RUAL 1CE6B 2YEVB 1WITA 4LLQA 1Y07A 1QLEH 4XPTH 3V6OC 1KC5L 4XC3H 5DC4B 3O2DA 5I8EA 3U0PB 3T8XB 3NGBB 4KTGA 4F9LC 4PJGE 4Y1AE 2Y6TE 3HUJB 1A9VA 1E6JH 3ULVL 1EBPA 4J1UA 4NRYA 1B9ZA 3U7YH 1RUPH 1A1MA 1FHGA 3LRGA 4GXUN 1JHTA 4P49A 2OPCA 4JFZH 3SO5A 3UTQA 4JFFB 3NACH 2VDPH 3DO7B 3OG6B 1KB5B 2X4RA 3J2PA 4H2CA 4PJ8D 2WVSA 2R39A 1AO7D 1QFWM 2F68X 5F1IA 3O45B 3QJZA 3QUYB 1JYVA 3RWCB 4I88A 3U4AA 3RX8A 1JGIA 1Z2KA 4FLHA 1AC6A 3O8XD 5F9WB 5F7LB 5MEQA 3FU0A 1C1EH 1FQ9C 2ZCLL 3B8SA 4P3DA 1A7QL 4LCWA 3RNKB 1AS6A 5JQIB 1RMFH 2UUDK 4LSSH 4XCFH 1PU0A 3D8MA 3HBGA 4AIZB 2VDRL 2QPFA 4D2NA 4DSYA 3PWJA 3I6KA 5EU5B 1S7QB 3WN5A 4TQEL 1M71B 4U6VL 2CE6A 1JK8B 3OF6D 3G7TA 4H8UA 5JXAH 1VFAA 2P9RA 2VZ1A 4G43A 3SSGA 2EDEA 3LB6C 4X8JB 3PWUA 3LEXA 1V7MH 3GO1L 4J3OD 3B2MA 4M5YL 2Z7WA 4PGEA 5DS2A 1I8KB 1U8IA 3F12B 1TZGL 5IIEA 4FQJL 2C9AA 4DEPB 2G5RA 1RUKH 2YRLA 1SHMA 3IFOA 3UZQB 4X6DB 1FO0H 1L6PA 3LKPB 4ZDHA 1X9QA 4YAQA 1WFOA 1I1YA 4N3UA 4ZYKA 3R06A 5IMMA 3BPOB 3SDDD 3EGXA 3I6LE 3MGTA 4MMXA 1GGIL 5AUMB 1W0WA 1OF0A 2LAAA 4E9QA 2ERJC 2ITFA 4YFLI 3SCMB 2W60B 5B8CC 1TQWA 1O7DE 4QJ3B 3MZTA 3HVDA 3QISA 4HUXB 3QUKA 4JO3H 1CGYA 5AW4B 1AOZA 4G6FD 2XA8H 4RGOH 1OAKH 1IGJA 2BINA 4BFIA 2RQEA 1RZJL 1T5WA 4PJDA 3CUPA 1BMZA 4CL7A 2EO9A 1UGKA 3TA3B 1XR9A 1NMBL 2JWYA 1DSYA 1I1AA 3AXLA 2DN7A 4MQTB 4G42B 3ZZSA 2LU4A 1I7TB 3MC0A 2NW3A 4AMXA 2QR0B 3VWKD 2NXYB 2IPKB 4MS8C 4S1DD 3R8QA 1ONQA 2K1MA 1P69B 5C07A 4KKRA 5EEWA 3FN3A 4FFTA 2H0JA 4EVNB 1MCPH 3QPXL 1A8ZA 4QGTA 4FE9A 4LDLB 4D9LL 3NCFB 4NQDD 4YGVA 4HFWB 2JKNA 3ARGA 4JZNA 5IW3A 3L9RA 4HX1A 5FO9B 2CIIB 1BXAA 2PXYA 3UBXI 5BRZE 1TYRA 3C6LA 3FTGB 4BSJA 4HJEA 1FO0A 4JQVA 5GGUA 5AOKA 2Z8VC 3MRNB 2EIKB 2YPVA 3I75B 4FQJH 4X2UA 4C83A 5D1XB 5LBVA 4KZCA 1FA4A 2J8UE 1Y1DA 1DVFA 3FUFA 2OKMA 5CFHA 1J7VR 2A6IA 4JFYA 5DJZB 3HFML 3WENA 2D2OA 2EYRA 2DM2A 1BLIA 4JO1H 5EUOF 5E8EB 3VACA 1DUYA 2OM5A 1YY8B 1TQBB 1WZMA 2XV0A 2IVFC 2P7TB 3HZKA 4XXWC 2ATAA 4AQEB 4XP9H 1VZIA 3D4ZA 5JPMC 3O2VL 4GBXA 5HGHA 5JPMB 2HAZA 4R26L 4DGUA 4POUB 1AACA 1JXKA 3ARXA 3WTXA 1J0KA 3LXAA 2YEQA 4B3EA 1KXQE 2X4QA 5D55A 2BW5A 4ZSOA 1P0SE 2W07B 3TBWA 3BKYL 3HG3A 1DDHB 2FSEB 3MRRB 1E5ZA 1U8JA 4JFUA 4LNVA 5CJXA 2NCEA 2CRIA 2PP8A 3VTTA 2UZIL 1N4XH 3KGTA 2G2RA 3FUHA 3OKNA 1XT5A 4F7EB 5I1HL 3G9AB 1FVEB 5LGHH 4BA8A 4P5RA 5E9AA 4Q89A 4UDTA 1GMIA 1OAUH 1QFWH 1R1CA 1QWUA 2C1OB 2ZYHA 3QDJD 2A74A 3V8CA 1OGSA 43C9A 4FERA 3FB6A 3VWJA 1N6QL 5DRXA 3EYQC 1A3RH 4BYHA 1G9NC 3P4MB 3S4SB 1RUQH 3QIUB 4Z0BH 3IT8D 4XOBA 2AEQH 2EDTA 4PG2A 5FYLH 1FNSL 5KN5A 2OV0A 4N26A 2J2ZA 2R69A 4K73A 4QI3A 4TNGA 2A3TA 5LLIC 4NNYA 2HSIA 3IWVA 3GTVA 3DMMD 2YWZA 4X50A 3BPNC 3FB6B 1EHXA 4H1LA 2A74B 4ES8A 2ODIA 4FFZH 1FVEA 4HJIA 1S3KH 1H3XA 2ITEA 3KWTA 3QFJB 4QNPE 4KITB 1ORSB 5J4MA 5CLWA 1HZHH 3GSXA 2NY3D 2LU7A 2WNXA 2PTTA 4KBPA 5I18L 2KC0A 1QZNA 2W07A 5KSAA 2X4QB 2I85A 3V0WL 5JHDB 1KIQA 4X83A 2CLZA 4N3TA 3GPSA 1MFBH 1N18A 3INUL 4J12A 3SGDH 3WSQH 3QEQD 5EU6E 3ZTNH 3VYOA 4OF8A 5JPMA 1ECZA 2GHWB 3FRUB 4MDJA 4XE0A 4APXB 5HGHB 2ZP0T 1OGTB 2HWZL 4N8UA 1LE9B 1IGIH 2Y4SA 5JW3L 3FCTA 5TDNB 3HOGA 3TNMB 1YY8A 3TO4C 4TPRH 4GS7C 5FYKU 2A6IB 3AY4A 1U8OB 4JFYB 4WV1C 2Z64C 5DJZA 3FT0A 4NC1E 5GRJL 1P7QD 2ZE0A 3FT4B 4M7LL 5AWNH 1DQLL 4MA1C 4ODTH 1JGDB 3E6FB 2H32A 5E6ID 4XNDA 1FO0B 4FG6D 4UOW1 5D7KE 4AGMA 4I2XE 3ESOA 4F8OA 2PXYB 1WE5A 4PWFA 4MWFA 2QELA 5IJBC 3MPCA 2AEQL 3ZL2A 2EE6A 4TUUA 1NGWB 3L9RB 2K45A 5ADOH 3GFUA 1ED3B 2CCLA 4ECNA 4MNQB 4YGVB 3GJEB 3IU4L 1E42A 4XRCA 3ATEA 2FD6L 3X1FA 3GINA 3Q2VA 2CIKA 5C07B 2ZNXA 3TBBA 1K6QH 2VN5A 4LFHD 2Q10A 2QR0A 4LOUC 1CYGA 1DTUA 3BP6A 4NZUH 4OLVH 3AXLB 1XVSA 4PJFA 3VG9C 4JM2C 2OMZB 1XR9B 3TA3A 4GIAA 3BPOC 1MCCA 4OZ4A 5EPMA 2P5EA 4HD5A 5GGRB 3DI2B 3BWZA 1A7QH 4GB9A 4R6UA 2QVFB 3DV6B 4LGRB 5EN2B 3TCLB 3UG3A 1NINA 3VSQA 5I5IA 3A0OA 2BVYA 3ZTCC 1BVKB 3LZLA 4IRJA 4M7ZC 2AJVL 1XSKA 3LRSA 4UQ9A 1HN1A 5HHOB 3ARDA 5HHXH 3MJ7B 4PTTB 3D87B 4K2UL 1IQWH 3S3BB 5DHVA 4IOIA 5HGAA 5HGBB 2XQYG 4Z7UF 4IJ3C 5AUMA 2W88A 3E8UL 1ZKAA 3O3DB 3RDTD 2JLLA 2DTMH 1I1YB 4ZYKB 2Q1EA 3UACA 2G5BB 4Z7AA 4HWZB 1SDDB 3N1MC 1L7IL 1KIPB 3IFOB 4AYID 3LAFA 3ARTA 2ZWYA 4LL4A 4B97A 4L4VE 5I1IH 5IIEB 4P5TB 1I8KA 1U8IB 4F15B 4LCCA 4XCNA 3DC0A 3DJZA 4EI5D 2O4EA 4RSVA 4G43B 5DT1H 1PZSA 1E4WH 1YNTA 2OTWB 5F1SA 2K6ZA 5BUGA 5ECJE 3MLSH 1ZANL 2BNUA 3I6KB 4G6AC 4QPEA 2XJLA 3M86A 3N5AA 3PWJB 4NCDA 3TV3H 4EXKA 4X9FA 2BFGA 1UYWL 3T0DA 3MNDA 4MJIB 3ARED 4ETQB 3BPLB 4L5FH 2CO7B 3DGGB 1F6AA 1MCLA 2I32A 4L4TA 4LCWB 4W6YB 3RUGE 3HJ0A 3R0MA 2C3HA 3G5XA 2BVPA 3MMEA 4TVPD 2GK0B 2DKMA 3DRQB 4YJZL 5AW1B 3S88L 1DBKH 1SVCP 1WBXA 2J25A 5IB2A 4BM7A 4OZGF 3V8OA 3MXWL 4IHBA 2VXQL 4Z7NE 2J56A 3MRBA 3MA9L 2BM3A 4PYHA 3LQAL 1J9RA 5FUCC 4JFFA 3MBXL 1R5IB 3SEPA 5D71L 4RDQG 1GGIH 1JHTB 1UFGA 2VISB 7FABL 1ECYA 1GHFL 5IMLA 1NGZB 1WA2X 5I17B 1NZRA 4BGDA 3F2LA 1DVYA 3N9GL 6FABL 2WQRA 2VLLA 1ZMYA 3H9SB 2GSMB 4HCIA 3CVIL 2CUAA 4XPFL 1KJ2H 2NY5C 1HCVA 5DK3A 3VFUA 1CE6A 4M02A 2Z8WC 4UIMA 2A2QT 4OJCA 3CSYA 5E9DD 4JE0A 2ZX7A 3MJGX 2UWEB 2A73A 1NEUA 3P73B 4XNXL 1FWXA 1VDGA 3PCYA 2XTJB 1FORL 1EVUA 3RL1B 2AXFB 1AGBA 3TF4A 3HBPA 2F8OA 1F3DH 2EACA 1MWOA 1TF4A 3SKMB 2QQQA 2EINB 4KKAC 3VQLA 4GAJH 4LSVL 3SCMC 1MVUB 2L3BA 1NC4B 4NPKA 2B5IC 5TK4A 1IGMH 2A6JB 2Z3FA 1DUZA 3ESVF 2PKDA 2B4CH 1HQ4A 2B1HH 1IM3D 3MOAL 3UTTA 5I0WA 2ZWNA 2OMUB 4FNTA 5DZLA 3DV4B 3O11B 4A6YA 3IDJB 4ISVB 4WU7B 2HMIC 2FYYA 3GZPA 3PGDB 4KNTA 5LKNA 1NOFA 1X5IA 3PQYD 3QQ4A 1F41A 2XNAB 1IKOP 3UPAA 5DUJA 3GMNB 1TQSA 3FK3A 3EJYC 1OSPL 1EZVX 2LFEA 1LWJA 3HI1B 4F2FA 5T3ZL 3SYPA 3PWVB 3H2QA 1R75A 1CL7I 3AACA 3K5RA 4KKLD 1BD2E 4BFOA 3REVB 1I8IB 5BRZD 1UXSB 5E8PA 5HYQB 2VR3A 4M6NH 3MBEB 3JV6B 3EYOA 4M56A 3K0YA 4U1HB 1DLHA 4JO2L 3P77B 4WSKA 1HE8A 1GGCH 1NBCA 4ILDA 5B1JA 4HP5A 2Q8AL 1JSYA 3KWWA 4EJ1C 3MBED 5GZNA 3VXUB 2W9DH 3CN2A 1J8SA 3FU6A 1I7RB 4P5KB 1HVXA 3EDDA 4MJ5B 1W91A 1TMCB 2BNRD 2BVQB 1PZ3A 2V17L 4I3SH 3HZVA 5E4EC 2I5YL 2EP6A 3S3SA 1JN6B 3HG1B 4U2ZA 1HZHL 2BY2A 3F85A 3S5YA 4MB4A 2ZF9A 2AI0L 4OLWH 5KBLA 3K6SA 2XETA 3CXHJ 3LRLA 4X5WB 3WHE1 2RIKA 2N0KA 5GJSH 1K72A 2IAMA 4TS6A 4UMSA 1IM3B 3MLPA 1UH3A 4L5FE 2YPLA 5E5MB 4WUUD 5FGBA 2JJWA 4ZZKA 4IEFA 1LILA 1V3JA 5CFAA 4YLQT 2JLPA 2CGRL 1TTRA 4PJBA 4K3JH 4P06A 2BZDA 4MA8L 4FQLH 4XBPA 2J72A 2H3KA 2IQAA 4NYLA 4KJQC 5TK2A 2X9WA 1MY7A 3KPNB 5F88A 2DH2A 2Q86B 2X2IA 3KBPA 3ZT7A 3HE7C 3T6WA 4QHKI 3ZE0F 3M1BB 3UXFA 4ATTA 3WTUA 3HE7B 1NIAA 1BWWA 2ADGB 1S7RB 2FGWH 2Z4QA 4P4KA 3VU2A 4XBMA 1BJ1H 1U8NA 4ABUA 3IXTB 1C9SA 4FQHA 3HZYB 1MCHA 5BZDB 1CE1L 2EDOA 1UXWB 2K6YA 4MSWA 5AW5B 3FO9A 4N8CL 1QYGH 3N85H 4LARH 1F42A 1CQKA 1N0LA 2VWEC 2V9UA 2CK0H 3ZT5A 2OTUB 4WWOA 2YWYA 5CEZL 3IGLA 4MAYD 2V3FA 4X80L 4CC4C 2KHAA 1UB6A 1BM3L 4LLVB 4HGKC 1J1OL 5HYEA 4LSTL 3N04A 3HNTL 1XGUB 3E8VA 1NGXA 1HXMB 1TXKA 3HA0A 4LKCB 3IJ7A 4LSUL 4PJEE 5IK3A 3ESMA 4JDVB 4CBZA 4M1DL 3HW7A 4NOBA 3CXHK 4JFXA 3MGAA 5B8CB 1PYWA 2A99A 2H2SC 5F0PB 3VM5A 4NWTH 2ARWA 1MFUA 1NBYA 4K8RL 3VH8G 5TF1H 3C09C 3TFBA 5J13C 3EH4B 3N91A 3QWOA 4JO2H 4B60A 2R83A 3H55A 4KHXL 1PZUB 4ELKA 1BHGA 5B1KA 3ARFC 1DO5A 1YC7A 1U3HB 1IBHA 5FYKH 5D2NC 3TJEH 1CR9H 2XWDA 4W9JC 3G3LA 4Y4HA 5CGMA 4P0DA 1E9PB 4ATWA 2ZUXA 2SEBB 3D5OF 4HT1L 3U2JA 5T5FL 3KZ8A 1OWWA 1XCXA 4PG9A 3DXAB 4TYUA 1CU4L 5DUBA 2A77L 3IJHB 2X1XR 1FUNA 1TZHA 2APTA 4FQXB 1PDKB 4PS4H 3T3PF 2F7OA 2XWJB 3K81A 5FDWB 3O41A 3BAKA 4TXVB 3ETBF 1NKRA 4B5EA 2VL4A 5LGHL 1X7SA 4DTGH 4A67A 4ORZC 2X70B 3E6HA 4OFQA 4JB9H 5C2BL 2UYLB 1G4MA 3MTRA 5I8KH 3P4LA 1WK0A 4AUUA 5D96B 2GHZA 2DJUA 4Z7VB 1WS7A 3ASNB 4WNJA 4PJ5A 1H8OA 4TRPL 3TS8A 1Z9LA 4FNRA 5GGQL 3HUJE 4MQSB 4Y2OB 6CGTA 4ZUVB 4ZO6A 5I76A 3B4NA 3MV7B 5I75B 4A63A 3KG5A 1E5YA 1RULH 2YQ2A 1RK0B 4N85A 5C09A 4XH2B 1NPJA 1P5VB 3QDJB 3BE1L 4TNVF 1FV1A 3T0EA 1H3WM 3TBVB 4XXDB 1CDUA 1J12A 1RLBA 2DZEA 2X4OA 4GFXA 4NSKA 2BPBA 3NIFF 3QEUB 2X4UB 3T4AB 4AWJC 4XBGB 1RZ7H 1ZS2A 3CN1A 1W0VA 2ERJB 3CZFB 2PLTA 4M61A 4AYFA 5M95B 2O61B 1IC4L 1H9VA 3U9UB 3HCVA 3AT8A 4HBCL 1NLBH 1AKJA 3O6KL 4X8CA 3HKFA 5BMFH 1UWXK 2AQRA 3TO2A 2Z31D 4JO3L 2AXWA 1JWUB 5I1LA 5KBKA 3LKSB 4M1GH 4GRWH 4PMEA 1BQRA 5DDHB 1M3IA 1S3KL 1S7UA 2NQ3A 5FOBA 5KYYB 5EZPA 3MUHL 3KLSA 1HEZA 1T0MB 2JMRA 3B7YA 4MXQD 4F57L 2WUCL 2FO4B 5I19H 1Q94A 1M42A 5B7MA 2HTKD 3STZA 1QI4A 3UERA 1LVEA 4LRIC 2X42A 3Q8BA 5PAZA 3WHXB 4WNSA 5BQ7B 4TKWA 4KVPA 1R3HA 1TZGH 1G7QA 1YECL 3MNZB 4HIIA 5IROC 2EO1A 4OZHF 5AD0A 2KPWA 2JKIS 5EO9A 4NQSA 3MCG1 4NXKA 1KCUH 4IBZA 5FB8A 4WENB 1VEOA 5EIQA 3MO1A 4XVUC 3A6BL 3SDXA 2W9LA 4AY0A 1BPVA 3EIFA 4OD2A 4TUKL 4JREC 1KZQA 2ORBH 1JP5A 3IB4A 1SLUA 2WO2B 4G1EB 3INUH 4KJYB 1S46A 1VGEH 2HFGL 1ACCA 5I0DA 4WDIB 2B0SL 4KNSA 5GJTH 5T5FH 1JGVL 3DNKA 5I5JA 3BT0A 3RDJA 5C0BA 4UU9B 1OP4A 5C8JA 2YAOA 3FQRB 1QEXA 4OLYH 3ULSA 4TRPH 5AVXB 3OJ2C 2V2XB 1IGFH 3HRZC 1NUGA 5SWQA 3C9NA 1YLBB 4XO8A 4M4RB 3PWLA 4R8WL 4M6NL 1NEPA 1QRNA 1EMTH 1T0NB 4S1SH 2Y1AA 1SGKA 3EOTL 3QA3A 4A1RA 3VB8A 5LXVA 1NCWH 2V5MA 2VQ1A 4M6OH 1ETJA 4XVTL 3TBTB 1TU2A 3WIHH 1A64A 2AXHA 2XN2A 3NJHA 3OR7A 5GSVB 5B1AB 3EJJX 2OR7A 3KAAA 5EOQL 1GL4B 1LP9A 4EKXA 3MLRL 4FFYL 3DYPA 4HJTA 1Z5LA 4FJ6A 4JRLA 2VABA 4RIRB 1KIUB 3VVWA 1CGVA 1UD3A 3NIDF 4OGAC 5C08E 2H7WA 9PCYA 4KO9A 1IAOB 1U93B 5HY9B 2YSSA 1LK3H 3VXRB 1GA2A 3D2UB 4XCYA 4FG0A 1JK9A 1NEZA 2NTFB 1TTAA 3BN3B 1WTGT 1N4XL 3H7BA 3T6ZA 3T6XA 1V7NH 3KPQB 5DC0A 1CICD 1KJMA 1GRWA 1E4HA 1G7IB 3GS0A 2EIJB 3H6JA 1HS6A 2CR3A 4FFVD 4TVPE 2F8IA 3II3A 1F58L 2YZ8A 1NM9A 3ZL4H 4G3YL 3SKOA 4FA7B 2C9QA 2J4WL 3B8YA 3I9IA 4FXTA 2DYPB 2OW6A 1EPFA 1MEXH 4R26H 5E08H 3IAPA 3EH2A 5F6IC 4FMVA 4BEIA 1NKOA 8CGTA 3UBXB 4DP0X 2WIMA 3P0YL 2J6EA 4X98A 4HKZB 4P9HL 2X44D 2XYBA 5IFHL 4POYA 1IL1A 5AKSA 2YPKB 4NZJA 3CZJA 3LIZL 4ZMWA 3IPFA 1L9NA 1S9YA 4JEGB 4P5MA 4X5XB 4GRWB 4ELMF 3OR6A 3VVVA 1MWAA 3OGCB 1LWHA 3G5ZB 4L4VD 4W4OA 2DWEB 2PO6C 5ICXA 4AH2B 3ILPB 1ZT1A 1W6WA 2ZG2A 3DX7A 5LBGA 1ZS8B 4WWKA 1T5XB 4UAHA 5I6XB 3O3EB 4X9YA 4XPAL 1AKPA 3W2DL 1QBML 2CA4A 5I1IL 1XF1A 5I6XC 1CLOH 4FQPA 1KUMA 1A4AA 2C26A 2O6CA 1FNSH 2K8QA 1CFQB 3BHBB 1U8MA 3LDBC 5CILL 3GGWA 3EJRA 4O02A 5LAXB 5ISZB 5L9DH 2H5UA 1MAMH 2GVYA 2X2YA 4JRYB 4GMSH 1GC1L 3QNXA 1OD7A 1CFTB 3UTZB 4GRMB 4TM9A 5DHYB 2HWZH 1FGNL 3U9PL 3TEYA 1KJVB 1WZKA 2J57A 1BJMA 3LNGA 5EO1A 2DWYA 3VXNB 1PIGA 5E5UB 5EN3A 3V4VB 2FDBP 4H0LC 1YO4A 4G71B 5I6MA 1P2CA 4FQCH 3ULUL 5EIIB 4QWWD 1P7KB 2WUBL 2OMWB 3QQDB 3MOQA 4GAYA 3VD0A 2APFA 2YXWA 3NAAH 4PJ9B 2BSSA 3NCJL 1JXJA 1I3RA 4FQIL 4HJGB 4XCFL 3A4AA 4FHBD 3JWNH 1LEKB 1U30A 3FSZA 1N59B 1B2WL 4EIBA 4XOEA 3L4UA 4MNGB 3VB9A 1HT6A 3TVMA 1YEDB 4Z3FA 1BIHA 1FCCA 2X4SA 4Y2DB 3MLRH 2B7DT 4MBRA 3TXAA 2K4WA 4LCUB 1NGPL 2DMBA 3GRBA 1RZGB 3GMOA 1D9KC 3OJMB 4NDMA 4K9EH 4DW2H 3PWPE 4QTIL 4BH7A 1MCFA 1CU4H 5GS2H 2FJGB 1M7DB 2KS0A 4IOFD 1XGRB 3OAYK 4MKTA 4NQTA 3NJJA 1RJLB 1TYEB 2H6PA 3BDBA 2X2JA 4Q9BA 2KERA 3VMPA 1OPGL 4PCKA 1AR1D 4NHUA 3L95B 1GIGH 4UQ2A 1LO4L 4W9KC 1G5GA 4Z7WE 4I0PB 3AM8A 4JFEE 3ZL4L 3EKCA 2B15A 3HNSL 1FLTX 3BKCH 4AJVA 3BWSA 5IR1B 3CQQA 1KBGH 3ZTJG 1QEWB 1UQSA 5FKAB 3QCVH 2NSMA 5JA8B 1KXVA 2N4IA 4LSPH 3S7GA 4ES9A 4G8GA 2FJUB 5EBLA 3JVFC 1GTNA 3KHOA 5BRZB 1B4JL 1H8SA 2VL5A 2UVEA 4QGYA 1QRNE 4FYQA 4OUUA 3MA7A 1UZ6E 3PAVA 5JIMA 5FLVA 1OP9A 5I16B 1FJ1B 5D1XE 1FG2B 5E1IA 3OB0H 4OB5L 4ODTL 3TJPA 1V8HA 5CIPB 2QADC 4U7MA 2A38A 1NCCL 4TNEA 2WXGA 2HMID 1AZRA 2NMSA 4AYSA 1KT2B 3N43F 4KX8A 3IVKB 4AZ8A 4BV1A 5MEOA 4IW4C 5IROA 1G7PB 3L4CA 1E27A 2DM3A 4QRQB 1CXEA 1PLAA 4X6BA 3QVAA 4X5LA 4K15A 3BH9A 1T4KB 1GSMA 1EUUA 2C1PB 4KHTL 4HHAB 1U8QA 4KKPA 5T3ZD 3C8HA 4G5ZH 1WUZA 5FYLD 5CN3A 4KRPD 4Y16D 3G6DL 2OMYB 4M43L 2QT6A 4NPYB 3QC6X 4Z78B 1DBKL 1OTTC 3KXFB 3OKDA 1P4IH 4NKOA 2RBLA 4QHPA 2ZP8A 2VT0A 4QT5B 2OZ4A 1XIWB 2FE0A 3WKPA 1NUNB 2XN9A 5J11B 3L1GA 3BSZA 3VE0A 1I7ZA 4XNAA 4KDWA 3A6BH 2QPEB 3L6FB 1NC2B 4I9WD 4QWWC 4DIXA 4OF6A 4DVRL 1A7NL 5LXGL 3NFNB 4I7ZC 5ESVA 3RGVA 1OQOA 1CTNA 4BSVB 4MDIB 1R0AL 5ICYA 3B9KB 1MPAL 4DKDC 4OBSA 2WWMC 3PV7A 2WTOA 2LQRA 2DQ6A 2A4EA 5I8OH 3T65A 3GLZA 1T7VA 1OY3B 4OCSL 1TSHA 3H9SD 5GJSL 1P4BH 3BKJL 5KVMC 4UUJA 3NZUA 1HYRC 1NAMH 5B1BB 1A02N 1XXFC 2IBZY 3E0GA 1MF2L 2Q6WB 4GSRA 5AOJA 2XWRA 2WV3A 1AGCB 3T0EE 4H5SA 3X17A 2D7OA 3AS2A 2CG9X 2QLVB 2PW2B 5FYLL 4JFPB 4DPRA 5C09E 1SM3H 1UJ3B 2JI3A 3NCWA 4G5AA 3UBXG 5I66B 3C2SA 2P26A 3D2TA 5C7XH 2X3AA 1BBJA 3A21A 1UTDA 1UZ8A 4RMRA 3STLA 4ELME 2QVMA 1DO6A 4I1RA 4PJ5E 4GQPH 2EIBA 2JK5B 4NUJA 1I85C 4XPHL 2ENYA 4B95C 3M7OA 1HTYA 3WLBA 1MHPL 2YOAA 3AITA 4DUWA 2PW1A 1H8LA 1UM5L 1WRFA 1KDIA 3LNIA 4N2HA 1TZAA 3TTYA 4NWUL 4YDJB 4K8RH 3V6FB 3MRPB 4KXBA 4PRPD 1TVBA 4AQAA 4IMLA 1GAFH 4IBVA 3WMPA 4AX3A 1I7UA 1USQA 4OW6A 3IGUA 2X9XA 4QXUH 1P7BA 2YAPA 3X1EA 3P9MA 2DW5A 3QXAB 5I6NA 3SQBB 2XKNB 4M9PA 4LSUH 1DN0B 5DVNA 2YD8A 3LDBB 4HA1A 3V4UH 4F58H 1CDYA 1HHGA 2P52A 3CQFA 3E3QE 3HPLB 2F15A 4PJIB 1KLUB 4O2FA 3FB5A 3S34L 1KTJA 4GMSL 3R0NA 3TWYA 1HSBA 3BUQA 1UH2A 4LARL 3EJCA 4L48A 3HI5H 3QG7H 1OZTG 3EFOB 3LD8B 2XVLA 2JF1A 1A8JH 2HFFB 1UM4L 3IRPX 4XPHH 5FYJE 3X11A 2GBAA 2Z1KA 4OF0A 4TVPH 5K59F 3P4OB 2GJ6E 4XNUH 4I0KA 3TVMC 2YD0A 1YUKB 4MXWL 4PJXB 1MCQA 3MLWH 4KY2A 3Q5YA 4WEUD 3DPBA 4BE5A 1B88A 1PIFA 2PP7A 1DQQB 3EDEA 4HLZH 2OZNA 5I1GL 3VRIB 5F3BB 3CHRA 1M4KA 5E6ZA 1UA6L 4AEHL 3VI4F 1CICB 4JO4H 1HOEA 8FABB 5LBSL 3H7LA 3FTXA 5SWZB 5K9QI 1E4KC 1ITCA 4KMQA 4YBQC 3QYCA 4NB7A 3JWDH 4TV3A 2X10A 2NZIA 1YQVL 2QSQA 1NGYA 2YUZA 1U8LA 4TOYH 1ETA1 4NUGL 1ZHLB 4GUQA 2AEWA 3W5NA 1HKLL 2X6CA 3SDCA 4PSPA 2VDKB 2J1ZA 1FNHA 1TIUA 2DB8A 4MMZC 3SDAB 4IRJD 3T3MF 4C47A 4O2EB 1LL1A 2OK0L 3BIKB 3UADA 4U6YA 1EFXA 3BDYL 4AKPA 5HVHC 4R7DB 4M5SA 3RUGF 1BW8A 3KYAA 3VA2C 4RMSA 4APQB 1RZIB 3BRDA 5DJ8B 3TONA 3VXUE 4D3CL 3ZY7A 2WQUA 3VI4A 2GITA 2G3XA 2G9HA 5DUPH 3POCA 6TAAA 2H45A 1AGFA 5D4QA 3S4SG 1YEWA 3VI3A 2YQ3A 2Q7YA 3GEWB 1J5HA 1WWBX 4OBRA 4HMCA 3VXOB 4N0CC 3EBGA 2B39A 4J23A 1QOKA 1R4XA 1CBJA 4KXCA 4EI5A 3TBYB 2ZXAA 1K4DA 4HUVB 2PR9A 1BBDL 4HGWA 4V2BA 1AXSA 1NIBA 1ETZB 2WB1A 2HG0A 3WAJA 1BZDA 3A4FA 3TT3H 1JDAA 4GYBA 1ET7A 1HESA 1UM6L