1P5UB

X-ray structure of the ternary caf1m:caf1:caf1 chaperone:subunit:subunit complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
149
structure length
149
Chain Sequence
ADLTASTTRTATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein Caf1M
publication title Structure and Biogenesis of the Capsular F1 Antigen from Yersinia pestis. Preserved Folding Energy Drives Fiber Formation
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Chaperone, structural protein
total genus 23
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2003-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09255 Antig_Caf1 Caf1 Capsule antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1p5uB00
1Z9SB 1P5UC 4AZ8B 4AYFB 3DSNB 3DOSB 1P5VB 4B0MB 3DPBB 1P5UB
chains in the Genus database with same CATH superfamily
2R9HC 1FN4B 1Q72L 4P8QA 1LE9A 4WY7H 3D69B 3QDME 2BP8A 5EOQH 3ALXA 4LPTA 4A6YH 4ZMWA 2ZTBA 4PPTA 2HTLC 2ENQA 5F9WB 2ZNXA 5IFHL 1CL7H 2WZ5A 4N5ED 2WLKA 3V6BR 4FL4C 1G7HB 4UQ2B 5C7ZA 4HCFA 5FGBC 2E59A 3GMNB 2C7UB 2XI9A 4NN6B 3FCGA 3QK0A 3ZO9A 4IQHA 1DDHB 1MZYA 2NR6D 3UTZB 1PYWB 1BXXA 5K93A 1LEIA 3EO0A 1EHLL 4KY2A 1JJUA 3BAWA 4TOYH 3X17A 5B8CB 4N2BA 2CA4A 2DQTH 5FLVA 2DQHH 2KYIA 5KEZA 3VD5A 1EFXA 4XNUH 1MCHA 1WG3A 5E1HB 4GXUM 3AWGA 4XNMB 4JRFA 3KYMB 2OMYA 5ABZA 2VN7A 4FABH 3FZUC 4TNVF 4UT6H 3QEGL 3AWFA 3K72B 3N06B 5I9QB 1RLBA 4LLDB 2B4CL 4OIIH 1B9ZA 5FW7A 2IAND 3D4GA 4XC3L 2P28B 1S7QB 3UTQA 2VH5L 1MAJA 1W0VA 3QBTB 1IBGL 1T5XB 4Y4FD 1HZLA 5EV7A 2NY2B 4JO4H 3QZWG 3N85L 4XBEL 5B3JE 2H6PA 4OUOA 4LPXA 4XVTH 1LJMA 2NY2D 5DQJB 1ZHLB 3B37A 3DNKA 4U7KA 5K59F 1MJUL 4AJVA 3PNWB 1SEQL 4JE4B 3MV8E 3TA3B 3L4TA 2K1MA 2QVTA 3VXNA 1NOLA 2XQ0A 1X5ZA 4YXLL 5KSBF 5CCHE 1CE1L 5ITFB 2J6EA 2F1AA 4G7YL 4Z7UA 4AYMC 3RFZC 3RBSA 3RBGA 5J8OA 4OKVA 3NCCB 3SDXA 1JV2B 1OANA 2LHAA 5GRVL 3EJZC 5EU5B 1ED3B 3POCA 4GSRA 3I6KA 5FOBA 2EEBA 5CSGA 3RUGF 4PJCE 1QTPA 1EJ8A 4FLRA 1D5MA 3QEUB 2EDKA 1OCCB 1YG9A 1HKLL 5FWRA 3Q6FB 1PZUB 4F15C 1GY1A 3GXMA 1H3VA 4MD0A 2VQ1A 2DF3A 4P3CH 1FP5A 1FVDA 2BZ7A 2WXHA 4JFYB 1CPUA 4GI8A 4HH9B 2EE6A 4KK5D 1M2VB 5D5ME 3VB8A 4BRJA 2R1WA 2AQTA 2ZX5A 1U3HB 1MRFH 1WF5A 5LG6A 2VR8A 3E9UA 3V9FA 3SE4C 5C0BD 5J1SC 1TQTA 4XVJL 5H8DA 3BKML 4Y8AA 1IEAA 1CGUA 4GQ9L 1YEDA 5DHMC 1MAKA 4HWBA 2VN4A 2DYPD 2W9LA 4J27A 3ZKXC 2BSED 2V5YA 3EZJB 5MI0C 3UO1L 1HDMB 2OTWA 4S10A 1W9XA 4PRDA 3JV4B 5TF0A 1XR8B 1EUTA 5IVXE 4QUOA 2VC2H 1AH1A 1NCAH 4TSBL 3UTPD 4G8AC 4AMKH 5IHZA 4PVMA 3NSJA 1UWEH 2X2JA 3ABMB 1FNSH 4W9ZA 4A7SA 4ZOBA 3BD3A 3T8XB 5HHOD 3VRIB 4FA7B 1KB3A 3IAQA 2J5LC 5EBLB 3P73A 2ADYA 4D9RD 2XTJD 3VRJA 5CEZD 1MNNA 4Z95H 2YXFA 4Q6IB 2J6EL 1HL9A 1Y6NR 2FBRA 4KK6D 1IAOB 1CGSH 4QTFA 3CFEA 4HLZH 5KVMC 3ZTJH 4MDJA 4XN5A 1O7SA 4MNQA 4KI5C 5E8OA 2QHRH 4R4FH 3V4PH 4DPRA 1PIGA 2X6CA 3QYMA 3MFFA 5FA3B 5DJDA 1ZHNA 1EANA 1H0DB 3CFJB 2OZ4A 1J0KA 5IWLA 2ZYRA 4X7DC 5DVPA 3KPSB 3HZKA 2OMTB 1G1YA 4YBQD 3RDTC 4JRYD 4W9CC 3U79A 5T1KA 1C7SA 3FN0H 3PWUB 4G3YH 3L3KB 3UXFA 4F7MB 4FLOA 5IJVB 4G6FB 3T0WA 3V7MA 5CF3A 2P8PB 3NDZE 4Y2OA 1TYJA 2WOYA 2ZUQC 3MRKB 1DL7L 4TVPE 4ZOEA 2YC1A 4OT1H 4W9LC 1GZPA 3B2PA 6FABL 2CDFA 1D6EA 4LEXH 1NINA 2F54E 3KR3L 4NGHL 3GMPA 1Z9SA 2BP0A 2G3ZA 3LV3B 3PGDA 4C56B 2NXZC 1FN4A 2ADGB 2UUDH 3IMBA 3WJJA 3MRDA 5K1NA 4HWBL 4LCCA 3KE0A 4NAMA 5E8PA 1A65A 4C56D 3ARFC 1HH6B 4U0RC 2GJPA 3HNVL 3JZ7A 2NR6A 1G7HA 3LRSB 4UQ2A 3SKOA 2W94A 5JW4Q 3OAUL 2HJKB 4TUJA 1TJXA 2RQ8A 3GMNA 4JFVA 2NXYC 4LCWE 4ZYKB 1BYNA 1F4YL 5C09B 4OZIB 4DCQB 3UTZA 4KVCL 1OY3B 1IC7L 3C75A 4PJ5D 3LIZA 1SJXA 1II4E 1WT5C 3F84A 2XIDA 2XZCL 4MNGE 1KGCE 3QHFL 1X7SA 3R0NA 1J1PH 4Y4HC 4OCYL 1RZKL 4DVRL 1T4WA 4OGXL 3PWNA 4DEUA 1YECH 2VZUA 3JUYA 4N0YH 3ZPDA 1MNUH 2VZOA 1QPKA 5GRWA 2OZ4L 3ARPA 3WN6A 4LT7A 5CZXC 1AGBB 2RB8A 1KJVA 1JIBA 2OCJA 4LLDA 4Y4FA 3IJ7A 3QUMB 2IWKA 1OW0C 2YPLE 3W5NA 2QLYA 1KIQA 1X9QA 4GJTB 4JGJA 1F13A 5TDPB 4DKFH 2K3HA 4UINH 5D7SH 2B2XL 1N7ML 3DMMD 1T5XA 1XTMA 1BVKB 2WAQA 1EEUA 3GK8L 4QTIH 2AC0A 1D5BA 2AJ3B 3IDYB 4M6OL 3Q8CA 4YC2B 2GUYA 2Y7SA 3A4AA 4PAZA 3KNBB 3CVCA 1YEHH 4HD9A 4JE0A 1CYGA 3KJ4B 4M7ZC 3L3DB 1HHKA 1IGIL 3NACH 2QJDA 4U1KB 1M56B 3RPIB 1NWPA 3KDMA 4JFDE 5L6YL 1ZV5A 3BQUC 3BWZA 4M7JL 3LJ3A 4PB9H 4RGNE 3OKOA 3JT2A 1IC1A 1F1AA 2YZ8A 3C08H 3ZZLA 3RURA 1AFVH 5ITFA 3ULVE 4M7LH 1VIWA 5DJ6B 4Y4KD 3NCXA 1JV2A 4ZTPH 4TS6A 1PLGH 1FFNB 3F04A 4MMZA 1CTMA 3U4BH 3FFDB 2BIMA 3N2JA 4YFDB 5CCJA 5CR8A 1I4FB 4XN7A 2EDWA 1NCTA 5EWIH 4F33A 4FTVE 2R56L 3D7PA 4Z3IA 2EDDA 1MSPA 3LIZL 2VSKB 3CC5B 2AAAA 3QEUA 1S2EA 1E8ZA 3FU5A 2WVUA 1XF4B 3KVDD 1KGWA 4IHOB 1NCBL 1YN6B 2W65B 3QPKA 1F3DH 5JW5A 4WW2A 4JFYA 3IBEA 1AZVA 5C0BA 1XH3A 4HH9A 3TBYB 2IBBA 4NCC1 1QEXA 1S3KL 1TZIB 2F7RA 3FCSB 4PLJC 5CJ8A 2BSEA 1FDLL 1QQDB 2C5DC 2WWOA 3JWDH 3PJNA 1U33A 4EUPB 4ZUSB 1GH7A 4HYTB 4MGXA 3MLYH 3FTXA 4KO9A 1HDMA 4JO2L 1GOFA 2DTSA 4U33A 1NIAA 3FONB 2ADJA 1DQQB 2XKUA 4PGBA 5D1XC 2DDQL 5HHOA 2HMID 4YX2H 1ET8A 3DX2A 3PQYB 5DS8B 4Z76B 2DJ4A 3X11A 4JFOB 4I88A 1WZ1L 2GJRA 4ZUWA 2GK2A 2EH8L 1A6PA 3WKML 1A7PL 1G7PB 3WS6A 3WO4C 1Z5HA 2CPUA 2XQBL 1PEWA 1IAOA 5EG6C 4XNYH 5D70H 1I8UA 5INDB 5I30H 3UJJH 3O6LH 5EULV 1ECZA 4QHNA 2PW2A 3AITA 4Z7VF 3W9DB 4O02B 4X8CA 1ZHKA 3ABLB 4JRYA 5FA3A 4OLZL 1L4IA 5CZVH 3QI9D 4LAJH 1ORQB 1TCRA 1JZDC 2WM0A 1ODUA 2ZWSA 2OMTA 3QDJB 3OKNB 4PGEB 3BXNB 1AYRA 3O8XD 3CN1A 1HXMB 4DGVL 2AS5M 1BREA 4F57L 3L3KA 4UT9L 4F7MA 4NXSA 3MLVH 1MFAL 5IJVA 2IG2L 4Y9GA 4BK5A 5ELIA 1BEYH 1XD0A 2P8PA 3PXHA 4FFVD 3MRKA 3WHE0 1T2XA 4MAUH 3TIEA 3HZYA 2H32B 2QQNH 1FIGL 3WKNA 4BUHA 4LPCA 4FQIL 5H37A 3DJSA 2X0VA 1EJOL 3LXAA 1C08A 1OVZA 1PZ3A 1J0IA 3LV3A 3O41B 3CSFA 4RFOH 4C56A 3DGGA 4IRZH 3W82A 4PJXF 4N5UA 4ZXBB 4Y9CA 1G9HA 1JPGB 1WWWX 2ADGA 3HN5A 4DKEL 1WRFA 3W81A 4LSUH 2ORBH 1TXKA 1DUYA 2DLHA 1A7BA 4JRWA 2DQEL 3LS4L 5HHVL 2JMRA 1HH6A 2HT3C 5JIKA 4PRIB 4XOEA 3APFA 3LRSA 1YEJL 3WN5B 1I7RA 4PJ5A 2WGNB 2YOAA 4RWHA 3RVUC 5CEZL 3UG4A 3WIIL 4JFFE 1UHVA 1FF5A 5I5MA 4R0LC 4QRPE 5I1EL 4PG2C 2XN0A 3MCYA 2X4OB 4NZRL 3TV8A 4YHZL 1Q9KA 2EO7A 3UC2A 4PJ6A 2P1YA 1SN0A 4YS4A 4JKMA 5K1VA 3IXAB 3DPBB 2J43A 3BD4A 1KC5H 3O81A 2CR3A 2W95A 3SKUD 3VG9C 3BW9A 1UB5B 2WPGA 1RIVL 2ICWJ 2VW4A 3ET9F 5L88H 3TWCH 1BP3B 5ID0B 4MMXB 3US1A 2LFGA 1YC8A 2FJHB 5AKVA 5D7IF 3D25B 3CZNA 3MLUL 1FYTE 1AXSB 1AGBA 2QTVA 3FPXA 1SPDA 4MTMA 5A40E 3QUMA 4F8TA 2CU9A 2QL1A 3JWDC 5I6KA 1LMKA 1B0GB 1A0QH 1F0LA 4UILL 2YPVL 3O2VL 4ODTH 4R7NA 2R29A 4NP4L 1BVKA 2W0PA 3IAPA 2VLRB 4E42A 4GS7B 4YDZA 4I2XB 4WI7A 5IMOB 5AFAA 2E6JA 2XA8L 1YPZF 3HC4H 4ALAH 2FJUB 2OR7A 2WBJB 1FZMB 4JM2C 2VLRD 3ZDXE 5C6WH 4PSRA 5EZJB 4U1KA 4GKOA 2ENPA 2HYMA 4NHUB 1T83C 4I3SL 4MB1A 4QHPA 4Y4KA 4BFNA 2WBJD 4FZEH 2GBAA 4F1ZA 3HC0A 1QTSA 4NT6B 2I32A 3VGEA 4CN6A 3L9RB 4A7GF 3OB8A 3MJ7B 3VXRB 1ONQB 1PD0A 1VGKA 5DJ6A 2FH8A 5HSFA 1QI4A 1ZPUA 3KL0A 1LDPH 2EE2A 4ATTA 2GY7B 4XCCL 3D85D 4HAFA 4XCYB 2Q3ZA 1BD2E 1DHKA 3R4DA 1ZA3A 2ZWZA 3ARDB 5E2WH 3SE9H 1I4FA 1XCTB 1YZZA 43CAB 1KV3A 3CDGA 4AM0A 4HMCA 4IIQB 3CC5A 1CGVA 3QDGD 1PLAA 1O7VA 1WWBX 2D2OA 1NCOA 1QI5A 5CBAA 3MBED 2D7TH 4ONGH 1XGTA 4ABWA 4IHOA 2W65A 1YN6A 3L54A 5ESAB 4BFRA 1OSZA 2CR6A 4WU7A 3NFNB 3CWGA 5JLZA 3UACA 1XF2B 3KLAB 2MPVA 2DL9A 2FCBA 2WV3A 4WWKB 4AYEC 2BH0A 3A23A 3MRFB 1BFTA 4LVHC 4K5PA 2H9GB 3FCSA 1QX1A 1JXFA 1N18A 3M1BA 3QUML 2F7IA 3MVSA 4RQQB 4WWKD 4PTTB 2Y7QB 2I60H 4R84A 2B0SH 3S2CA 4EUPA 3KEHA 4UAOC 1BAFH 3EGDA 9CGTA 2R29L 4IU3B 3LKNA 5IJBC 3F01A 1J1XH 1E4XL 1NDTA 3K0WA 2YRPA 3U83A 1MHHB 5FW6A 4Z7NE 5KBNC 3FONA 5CUSH 1MWOA 4AYFB 3L2NA 3AUWB 4ZDHB 4CVUA 2EXWD 2N1TE 1GGBL 4OCXL 2MQ0A 3GLEA 2XWZA 3HS8A 2AEOA 2YN5A 3IGLA 1NLBL 1SXAA 1G7PA 4PWIA 4XBGB 1OOAA 3FFOA 3LZQA 4JDTH 5FO9B 1WFIA 1NMAH 3N1MC 7FABH 4HDIB 1OPOA 4S1QH 1UQSA 1AQHA 1ROWA 4MLIA 1ZS8A 3FT9A 4O02A 3H0TA 4H44C 4XHQA 1JFQH 4MJ6B 3UEZA 2VSMB 2ICWB 2WBXA 5F8QC 5C07B 3TH2T 3G6JB 5KVFH 4JFSA 1DTUA 3OZ9L 2CRZA 3T4AB 1UT1A 1VPOL 3WCYA 4PGEA 4TULH 1IEBB 2F7OA 5DFVC 1U8QA 2WGXA 1ACXA 2ATPB 2DQUL 3VMNA 3QNYB 3OQ3B 3SY6A 3VJ6B 3ZMRA 2XFXB 3D05A 5C07D 5E4IA 2B1HH 1BIHA 1HSAB 5EC1B 3SYAA 4JFTA 5FO7B 5M94B 2Y6SD 3JWOL 1DFBL 1Q9LA 4JUSA 3LQAH 2H32A 1VFOA 4GIOA 4NO5B 4ALAC 5DMIL 5C3IA 1DBKL 1OSYA 4BSWB 3QARA 1ZV9A 2V5RA 3S3DB 4EIUA 4ZOCA 1WFJA 4LLAA 1YDPB 2X4RB 3OKKA 1TQCC 4LXFA 3B2VL 4DVBB 4J8RA 5AVYB 3BI9X 2D3VA 3NFSH 1JPGA 3F5WA 4HGWB 2CUAA 5KYYB 1BQLL 1JGEB 1UFUA 5KVGL 2NY6C 1OT2A 4I3RL 3V0FA 2R4SL 5CFAA 5A2FA 3JZYA 2F53E 4OFIA 2CK2A 1HFUA 1R3JB 4ZI8A 4R90L 3O3UN 1MW0A 1OP3H 1ILUA 1JHTB 4JHZA 3IKKA 3GMRA 3IDMA 5F96L 4L8DB 4Q9QH 3G04A 2X4OA 4KTYA 4YFEA 4JL1A 3S36L 5DZJA 1D3CA 1MDTA 2RFXB 3DX8A 3SOTA 3QJOA 3IXAA 1FUNA 4AEIH 2OTPA 4H25A 2FR4B 4WHCA 1UB5A 4OLVH 1Q1JH 2HTKC 5AWNL 1TNNA 2B08A 4I3GA 4O02L 4BCXA 3D0AA 2JI3A 2LAAA 3QORD 4FQQA 3ZL4H 4ZPTA 2YK1L 4P5KB 1AXSA 4CMHC 1V27A 1MLCB 4QI3A 3WS3A 2NNAB 4MKMA 1WK0A 4HMDA 2H2SC 3MJGX 3WD5H 1F18A 1KJ2B 4QHLB 2BLFA 2B5IC 4ZTOH 1G7LB 4CVXB 2VLRA 3THML 1QFHA 5I8EA 2FGWL 1EHXA 1RHHB 1SLVA 2COQA 4UV4H 3MJ9H 3UCRA 2X88A 3VWJC 1LQBC 2WBJA 4IRSC 5DK2B 5HD8C 1FZMA 3LSOA 3BH9A 4XP5H 3LMJL 3EUDA 5CINH 3VFMB 3D1MC 1HS6A 1H3GA 3KJ6L 4I7ZC 3U0WL 4B0MB 4NHUA 1K8DA 4PB0L 3EYSH 4X7SH 1QFWI 4X6DF 4RLDA 4XAKD 1KIUB 5L4MA 4P2OC 3TESA 3F6JA 3D85A 3FO0H 5JXEC 3FRUB 1UEYA 3MJ7A 1LK2A 1ONQA 2EXTA 4M5ZH 3TO2B 1UWXK 4FLQA 5MENE 5EZLA 1OQOA 1BFOA 3PS6A 4KJPD 1L9SA 1X7TA 5CD3B 2EINB 2EE3A 2YGVA 4XPAH 3QDGA 1LO4L 2O1AA 4PVBA 2H1PL 3NZ8B 1XCTA 3L45A 4ENED 3DETD 2DD8H 3BAEH 2VN6A 2GBUA 3MBEA 4KUZL 1A1MB 3KXFB 5IQ7H 4IIQA 3V5DB 5AVZB 4Z7WB 4G80A 1JBJA 4NJAH 4Q0XH 4BDVB 2OM5A 4U4IA 3F12B 3LQAC 5C0NC 3KXFD 1JZ6A 3DXAB 5IK3B 4X8XA 2G60L 2JELL 4GRLD 4GRWB 4ZX6A 1XF2A 3WYRA 3II2A 3MX0A 2CE6A 4WWKA 4WSKA 3MRFA 5FGSA 1INQA 1L6ZA 2AJXL 1BOGA 1WD8A 5A2KH 3U9PL 5JUEL 2A6KB 3L5XL 4IKLA 3F85A 4PTTA 3IJ8A 1TQSA 1RUPL 1MI5D 2GKIA 2Y7QA 3H4HA 5LBGA 2Q10A 4EVNA 5ANMB 1R5WA 3LRLA 4L23A 1ZTMA 1DSYA 4UANA 3KL5A 4YDIL 1L5GA 1PZCA 3OGOE 4M1CC 2GFBB 4PJ7A 3OXRB 4K5OA 4BSVB 1T0MB 5JHDB 4TNFA 1L9OA 2AJUH 2E76C 3HBPA 4XWGL 1WVZA 1KCRL 3H2WA 2YHGA 5EU7C 3UGXA 5KAQG 4MD5A 2UWEF 2J1KA 2B39A 3V0VA 4K8RD 4U6VH 3BWUC 1UD8A 1J0ZA 3AVEA 5I71C 3ML8A 4MD4B 3FCTB 4P9HH 1NGXB 5I1KH 3FYIB 1ORSA 4A63A 8FABA 4Y2DB 4A38A 3QJVB 4Q52A 2BOCB 4LCIL 1FNGB 4V1DD 3CU1A 4W9IC 3RVVC 3WL9B 3MTXA 4I77H 2VN3A 3LKQA 1CG9B 2ICWA 3MJ8B 5C07A 4AVHA 4U1MA 1SF3A 3G6JA 3E9TA 4LKXB 2ZUSA 1J5DA 4P4KC 3V4UL 4PEEA 3RY6C 3INUH 3BO8A 3DUHA 4OUUB 1H5BA 5EBMB 3A22A 2ATPA 4OFDA 3VJ6A 1RY7B 2LTQB 2XFXA 1F2QA 3KLQA 3M8OL 4FFZA 1HSAA 1HHIB 3LDBC 4YFLF 3FUIA 1FH5H 5FO7A 4YDVA 1J0YA 3U46A 1NCCL 4GP4B 1TTRA 2VDLH 2NDGA 4NO5A 1FFRA 1MW1A 2KZ1B 3T8MA 4BSWA 4RGOH 4WTZA 1NUFA 4F58H 4NUQA 3T8VA 5IREA 1JCVA 2BHZA 3NQIA 4KI5F 1UM4H 1UOKA 1NBZA 1QD0A 4TSAH 5DC4B 4DVBA 4HFWA 2E7LC 4AK1A 3TT3H 1YJDH 3AS0A 4HGWA 3MZGB 1I1AB 3LCYA 3BVWA 3VUAA 2VDPB 1U4FA 2XZQL 3DPDA 4JO8A 4JZJC 4M8VA 5KYYA 2YD2A 2OMUB 1M7UA 1MFCL 3RNKA 2ESVD 1RMFH 3UMNA 2IWGA 2A38A 1HOCB 2YA1A 2WINB 2MCPL 3ATBA 3QUGA 1JDAA 4A7QA 1IGFL 2ARJB 5J4MA 1E5YA 4AIXA 3ERXA 5E6RB 2PWDA 4IDJH 4HPOL 4FZ8H 3T71A 4NERA 2HVKA 2J4WH 2CCLA 5LGJB 4HA1A 3VD7A 1PNDA 3LN5B 1A3RL 1FPTH 5TQ0L 2WWMD 3DO4A 3I9IA 4G72B 4POYA 2EE9A 3JTSB 3QORA 4GUOA 4JANB 5E0QA 2OMVB 3NIFB 3C87A 5ICZA 1R75A 3G08B 3UROR 4ACPA 3U0PA 4IOIB 3H2PA 3LKPA 4XXDB 3UH8A 1DQIA 3ULVF 3QIUB 4P5KA 3JYCA 1ZCRA 1EV2E 1CXKA 4L3EB 4HULB 1PZAA 1AMXA 4X6BB 3C5ZD 1JMZA 5D6DC 4NUGH 1OF2A 2CO6B 3KBPA 2ZUTA 1Y18B 2JXMB 4UU9B 3QIUD 4FFWC 4FFZL 4L3ED 1G7LA 4BCZA 3F7LA 2E27H 4KHTH 1KJ3H 5FHAH 2KHAA 1IC5H 4AEFA 3MLZL 3S9DB 2HZHA 4J3UA 1BFVH 3OGCB 1OAQH 4KNSA 4PJ8D 5DK2A 4L4JA 1MCEA 3GBML 4P23D 2CDEA 5HGAB 2K45A 3GINA 1OGTB 3IB4A 1OD9A 1KTLA 4AGMA 1UJTA 4FNLL 4NQDB 4XVOA 3VFVB 4M62H 4Q74A 1ZVYA 2XNAB 3EDEA 4KROB 4P9HC 1TQBC 3NIDE 5BZXA 3SKJH 4P59H 4HHWA 1ML0A 2EJ1A 3TO2A 4NQDD 3QQ4B 3O4OC 4GB9A 4I48B 2D7NA 3WLBA 4D3CL 5C2BL 2YKLL 1A6TB 5AALA 5CD3A 1CLZL 5GRUL 3MQIA 4JFPA 4PW3A 4Y5VC 5FB8B 1ICTA 2ODHA 1W72B 4N0UB 3J27A 3QXTA 1AANA 2FLRT 2H2PC 4KKZA 3DHJA 2ATKA 1A1MA 3KXFA 2EKSB 2JIXD 4O4YH 4Z7WA 1KEML 3K91A 4GRLA 2OP4H 4JN2B 4N6RA 4X5PA 1ND0B 3DX7B 1EXUA 4BDVA 5LKNA 1HEZB 3LRMA 3BJ91 1IZKA 5K9QI 3E38A 3GPSA 4LSSL 4IHBA 3OHXC 2UXVA 4GKLA 4KBPA 4QGTA 1AI1L 2VLKD 4QKXB 5CN3A 3K71B 3JWNH 5I18H 1XGQB 3QG6A 5EEVA 1FVCB 3EDDA 2HP4A 1MI5A 3BDYL 4G7QB 3B9KC 4WO4D 3F7YB 3U9UA 1QW8A 2COVD 2X09A 4LOUD 5HVHC 4MJHA 1YJDC 4YO0B 5E6UB 5CJXA 1OSEA 4LE8A 2A6KA 3QDAA 1MWAA 5KVEL 1KOAA 4Q97A 5L4FA 3UTSD 1KJ2L 4FQ1H 2WD0A 1ZIBA 4JR9H 2Y07L 4NZUL 2SODB 5ANMA 5CP3A 1I9EA 2J8UB 2F8IA 1UFGA 3CN3A 3OXRA 3CFDB 4PJ9D 5KSBB 4BSVA 4Y7MA 1EZUA 2E7CA 2XY2A 5FFOA 3OSKA 3GSNH 5D8JH 3CHPA 3V9EA 1BSIA 5EUKA 4FQPA 4N86A 4A7TA 3HB3B 3MA9H 4ZSOB 5HI4C 2EIZA 1KCVH 5DVLA 1WHOA 1MCLA 4QRQA 2P8MB 3R7RA 4YAQA 2PN5A 4V1DA 1EGJH 4C54A 1A66A 1KLUA 4NFCA 3FCTA 4LHQB 4Q7DA 4MJ2A 2X4UB 1CU4L 5A6IA 4OV5B 4R2GC 4YL9A 5F9JA 2BJML 3SDDC 5B38G 4PRBA 4PBWD 5EORL 3WL9A 3GI9H 2BFVL 1OALA 2EC9U 2MPAH 4EIBA 3MJ8A 3UO8B 1AY1H 3MUZ1 5IW6B 2EO9A 4LKXA 3VMOA 4RRPA 1ZEAL 2V5MA 3QULB 4KY1L 4OUUA 7PCYA 2CLRB 1REIA 4AG4H 1ETZB 4FQJH 4WK0B 1W15A 4FXKB 4L9LB 1HHIA 3WEOA 2XKSA 5IW1B 5I0WA 1TTBA 5FDWB 1WJ3A 1AC0A 4P2CG 4JMNA 4AGLA 2WXFA 1CD1B 3Q44A 3PV6A 2AFNA 3LKRB 3WNNA 4ODVH 2AAVA 4HQQH 4YZFE 1OTUC 2PO6C 4NKIL 4PRHE 2X2IA 4I0PD 1NMBH 2ESVA 3QYCA 2BVYA 4DPCX 1FNLA 3L5JA 3MNVB 2EKJA 3BYYA 2EH7L 1MAML 4JPVL 3DX0A 5C08B 3WE6B 1HOCA 2EABA 5F97E 5D1QB 5CU5A 1IKNA 2CKBB 3VXSE 4J6RL 4D2NA 1A7QH 5IVZA 4ZFOA 3V4VH 1UXLA 4LF3B 3X14A 1T7ZA 3P3RA 1WUNT 2NSQA 1SJHB 3ZOAA 1D7CA 2AV1B 1DLHB 1RUMH 2RH0A 3LN5A 1AJ7H 1KGJA 3QGVA 3SD5A 1YVLA 2GJ6B 1WA0X 3SPCA 1QPXA 1CICC 4JANA 1AO7E 3JWNC 1JZ4A 5CIPH 4B9JA 1S7WA 4XNZC 2JKSA 3I6LE 2GJ6D 3G08A 3C5ZA 2P4AB 2DI9A 2JKJA 4XXDA 3BKCL 1NM9A 2NCEA 3B9VA 1QZNA 3O4LE 3QIUA 5DUML 3RZCC 1FL3B 2K4AA 4L3EA 2AQ1A 5F8RC 3SGEI 5EIIG 3QJSB 4BSJA 2HWZL 4WJKB 1LE5A 4UU9A 2JXMA 2W9DL 4UQEA 1ETJA 1AGFA 1N3NB 2JLLA 1E67A 2Y9RT 4ZAKB 2EAEA 5F7YC 3FTWA 4P57A 3SCMB 4PJ8A 4N3UA 4XNXL 4WDIB 1SHXA 2IMNA 4P23A 1OLZA 1FLRL 3T2QA 1YEFL 5FYLH 3T0DA 2UZXA 3B9DA 3SCMD 4ZAKD 4KKCC 3MV7E 2FUQA 1HINH 2AZUA 3TZVC 2PYEB 2XU9A 4WHDA 3RWGB 3VYPA 4ZZKA 1KYFA 3CQFA 1IB5A 3LHPH 4NQDA 3VWKB 2VDPL 1PCSA 5H94B 4ES9A 3PHSA 1U42A 1OARL 2R0ZH 4ANKA 1Q72H 2CJUL 4BKLB 3QQ4A 3L9EA 2VZSA 3COOA 5A1AA 4AWJC 4AT6A 4G8EB 2JIXA 4OZGE 3FUMA 2FATL 4NS0A 3AY2A 2VRAA 3BVUA 3PRZA 4OTXL 3UAFA 4P5TC 1N26A 5IFHH 4XP1L 4QRAA 1N6QL 3LEXB 2F58L 1DDTA 1BJ1H 3AG2B 3QJTB 3U4KA 2EKSA 4X7TB 4HOZA 3B3IA 1U92B 2RTTA 1KLGB 3DX7A 1HEZA 4YLCA 5CBEB 4WO4A 4X5WB 2VL4A 2X3CA 4WO0A 1H15A 4HWZA 2HX7A 1OSPL 2VDNL 3KPTA 2VR6A 4TKWA 3PAVA 4WJ5B 5I8CB 3NAAL 5ITBL 1IQWL 1XGQA 4ONHB 4ZK8A 1ECYA 1UWFA 2WUBL 1FVCA 2J88L 3CZKA 3UTSA 1BZ7B 3ARZA 3F7YA 3PUCA 1ERNA 4EZKA 1XIWC 3SOBL 2QPFA 4OB5L 2XV2A 3RHWK 4QAMB 3BPNC 1QLEB 3C8DA 1GJUA 3CFQA 4Z78A 5A6MA 5FCUH 1JNJA 4P4RA 4XOAA 1XF3A 3DX6A 4PJ9A 4ZW6A 3QEGH 3ISYA 1IARB 2WVVB 4XCFL 3S3PA 4PLNC 4QF1A 2B4CH 1AP2A 3QRBA 1ZK5A 3CFDA 3AWEA 5KSBA 4F92B 4MQXC 5DU7A 3NGBC 2VH5H 3TF4A 1RK7A 4MA1B 3TJPA 3ZMNA 3GIZL 2AVFA 2IF7A 3BQVA 2NW2B 5TGBB 4WI2A 3N85H 4XBEH 5DR5L 2GCYA 4ZSOA 3VI3E 5E9DB 4AUUA 5IROD 3BVDB 3S8WA 4L3CB 2VR9A 1CIDA 1C5DA 1HYSC 2JJTC 3WEAA 3DVFA 5A7BA 3RUGA 5AL8A 1JYVA 1SEQH 4PJAE 4R7LA 5E9DD 1L0PA 2A6IB 3LZOA 2BIPA 4JY6B 3RWEB 3S3JA 3MUY1 1GCYA 1O6VA 5JO5B 4YXLH 4FQLL 2XIBA 2RBLA 4G7YH 4AV0A 5G4NA 4AYSA 4JO1L 4BRVA 1MHCB 3MCG1 4J23A 1E43A 3RTQB 1IL1A 2FX8L 4N0CC 3ZU8A 3QP3A 2HFTA 5CJBA 3QUXB 2BNQB 4YHYB 1L7IL 4Z77B 1Q90A 4L9LA 5AW7B 1G4MA 1KIPA 3S5LB 1M05B 1QA9A 5IW1A 1DVTA 3OMNB 1IBZA 5FDWA 5CO1A 3GUFA 3P11L 1CD1A 1NGWB 5J1AB 1HKLH 4RVBA 2F2HA 1GS6X 2ICES 2XZAL 1OTTC 3S4SG 4J4PD 6PCYA 4JJ5A 1CXIA 4PJEE 4Y16B 1FJ1A 1ODAA 2GC7C 2N01B 2VUKA 3A47A 4OZHB 4OGYL 3S3SA 3QUHA 1XWVA 1C16A 3KGRA 4XMPL 3VFGL 2VDOL 2BO0A 2VWEC 4U7SA 3ARGB 4RNRA 4JFEE 5IB3B 3WE6A 2MH4A 4PH8A 3TGXA 2W5PA 3ULAB 4FYQA 4K2UL 2WBKA 3V10A 1GMIA 1WFUA 2WQUA 4LK4A 4LF3A 4PR5B 4MRBA 3UO1H 3WTYA 1CGYA 2WQ8A 4IJ3C 3FS9A 5FO2A 3PY9A 3P2DA 3UG5A 2AV1A 2YSSA 4FQXD 4Z7VB 4DEPB 1DLHA 4M93B 4TSBH 4PSPA 1UZ6F 3S35L 1TPXB 5C0EA 5ID1A 5HHQA 5C0AD 1M1SA 2IQ9L 4OD2B 4XX1G 2GJ6A 2FECI 5KANG 4RFNB 2DWXA 3MLWL 2EVFA 2GEQA 1NANI 5FDYA 5IUSA 1S78D 3FPYA 4K7PL 3IJHA 2GHZA 3FUKA 4NENB 3F64A 3W39A 3VGFA 3BWSA 1JWMB 4QDGA 4ZBJA 1HNYA 1VEMA 1AR1D 3VFTA 2KLSA 3PL6D 4H0LC 4LMQI 3RNQB 5DD0L 4ADJA 4HAKA 4PWGA 2XCMC 2G3NA 4JKPL 4XXWA 5LGYA 5IQLA 3W11D 5JQ6L 4MRCA 4GG6F 2YEQA 1NC2B 2ZSWB 4AE1A 4PJFE 4ETQB 1BXUA 2X4TB 4U1JB 1DUZB 4HZ1A 1B4LA 1XSJA 2YPKB 3MOBL 2H5UA 5ERWB 2B4CC 1LK3L 4ZAKA 3SCMA 4PJXB 1T0PB 8CGTA 2DLGA 2XWCA 3QR1A 5LAXA 4HIHB 1NC2D 4AIZA 1WFNA 2WNWA 1GW6A 3CMOL 2HSIA 1KIRB 1XAUA 3MODL 1QEWB 4E0RB 2EYSB 1ID5I 3NIGF 2AJVH 1DL7H 3RWGA 5I1CL 1SVZA 3IJSA 5GGRB 1ZPLA 1I9JL 4NGHH 1S9XB 3VWKA 5HI3C 2VMCA 3BGAA 2OL3B 4HLZG 1D5XA 1J7VR 1M1XB 3DUSB 3EBGA 4J3OH 3SPVB 3C60B 1M6OB 3SBRA 1WBXB 2QKIA 1PX3A 4BKLA 4HUKB 3BKYL 5F7WC 2ZXBA 4DO6A 1DCLA 1MCPL 5DZPA 4R8WL 4HWBH 4AYGA 3SB3A 3V0IA 1H3XA 4F8NA 1WISA 5CGYD 4MA3B 1TO4A 4NJ9L 4AGPA 3OR6B 3VI4E 2OR9H 7TAAA 4NKMB 4X7TA 2ZIDA 3UBXB 1FG2B 1HWHB 1IGTB 1JGVH 2VCOA 1EJ6A 1U92A 1KLGA 1FIEA 1NCHA 3UCQA 4Z7QE 4HW6A 5CN2A 3L5WB 4HKZB 2O5XH 3MA7B 5GRZA 3F7QA 5JIPA 2K6ZA 4KVCH 3ZK0A 3GXIA 4X5WA 5E08L 1I9RL 4QYOA 1IC7H 2PR4L 3JVFC 4R4BA 3I84A 4WJ5A 3DHPA 1KBPA 2CBPA 4IDLA 5I8CA 2WSDA 3VXTA 4LL9A 5AAMA 4ONHA 2BVOB 1L0YA 4I0KA 4R3SB 1IAKB 3QHFH 3SKMB 3BSZA 4OCYH 1IKFH 4FQHB 1RZKH 4U1GB 1X4YA 2JVUA 4OGXH 2RGSA 5T5FL 3C2AH 5GGSY 1YPZB 1ET7A 4BBWA 2GIYA 1ETA1 2QBWA 3F3HA 4LOFA 2NYZA 1RJYA 5H35A 3WAKA 3BLPX 2MRYA 3EHBC 3RY5A 3ULUH 3WEMA 4N87A 1SMAA 2DWYA 3SBWC 2MOVA 1XMEB 3UDWA 4CGTA 3EH2A 2C3VB 2B2XH 4L0ZA 1QSEB 5IROA 1N7MH 2NY3B 3GK8H 4UT7L 4EIZC 4K7FA 4UV7H 4M6OH 3VFUB 2NW2A 2ALAA 4LRIC 3U0TB 1UM6L 4GIPD 5E9DA 2JWYA 3T0BA 1JSYA 2VW7A 5BOPA 3HR5A 1IGIH 2WCPA 1S46A 1VESA 3UEQA 1GYVA 4W70A 2B16A 3F7VB 4UNVA 5L6YH 1TEYA 4M7JH 5SX4I 4I1NB 3RWEA 2L7UA 2VISB 3SQRA 4JZNB 4KXDA 4YHIA 4KTEH 2ZOKB 2XVBA 1N8ZA 4HV8B 1MHCA 1MREL 2GQHA 3QNFA 5D2NE 1SY6A 5J11B 2XPGA 3MRHA 2XQYG 1RZ8B 3KW7A 3L4UA 1ZTXL 3HR6A 2ICEB 1XCQA 3BWUF 1KCKA 4QHUB 5I6XC 1WAAF 3H9YA 2LFEA 3S5LA 2DY2A 3FF8A 3LEYL 1K2DB 1KPUA 2BFGA 3CK0H 1QBLL 3LIZH 4J4PA 1GW0A 3MROA 4CVZB 4DF9A 2E46A 1BAWA 1T5WB 5J1AA 3W0WD 3BSZL 4QXGL 2XA3A 4GT0A 5IBTH 5J12C 1NCBH 1QLEL 4H8HA 4APQB 6TAAA 3QPQC 4DGUA 4X4ME 3X12B 2NY0B 2GBTA 2GVYA 5IB2A 2QHLA 4J3OC 3K5SA 2BHYA 2DQGL 2Q8BL 1IGCL 2APVA 1JERA 5AAPA 1MVFA 1N0LB 5F3BB 1FDLH 2X4PA 5IQMA 2NY0D 4APXA 3TU6A 3T4YA 2CRIA 4M3JA 3V6OC 5FF6B 1X6NA 1XGUB 2AXGB 3MRGB 3NFPB 2VAAB 4FLSA 4G6AC 1TNMA 3P77A 5DFAA 5AOIA 5C0AA 3VXUE 4PR5A 4QYAA 4TN9A 3K5RA 3BPLC 4JO2H 5GRJL 1TUPA 2BW5A 3ZQWA 1P4LB 5AB2A 4Z7VA 4JFWA 3QDMB 5IUCA 2DDQH 1LEGB 3RWJB 3NEEA 4HGKC 3PWPD 2WKOF 5KUKA 2NZ1A 5I1JL 1NJ9B 1P6WA 3I9AA 1MQ8A 1WZ1H 3GI8L 3D4CA 3PL6A 4OF7A 3KGTA 1JI1A 1S5IL 3WKMH 1AZCA 3ALWA 3LZFH 5DRZA 1A7PH 4NBYB 1JWMA 3AREC 2FRGP 4TLUA 2NCMA 4EZMA 5JPNB 1RZKC 4J3XA 3QFDB 3NIDF 4QHMA 3RNQA 1SY6L 3ZDWA 1SF5A 4N2KA 3EG9B 4KWUA 2IAMD 1BVLA 1YNKL 5IWLC 1NC2A 3FOLA 5FXCH 1YQVH 1HQRB 4U1JA 5EU6D 4K9EH 5ERWA 2AW2A 3REVA 1VB9A 2F68X 4PJXA 4JQXA 3MNDA 4N2AA 4Z3TA 3ULUC 1YEGL 4MXVF 1IT9H 4YSQA 2QVIA 1OM9A 1X9RA 4HIHA 3TO4D 4F57H 4UT9H 1SEBA 2BW4A 1MFAH 2IG2H 4E0RA 2EYSA 3D0LA 1FIGH 1CFNA 2JCCE 3F7RA 4MQTB 3FQRB 4FQIH 1BF8A 4KK9D 3WKYA 1S9XA 1EJOH 2A6JB 1TQWA 2Z0BA 2OL3A 3FU0A 3M45A 1M1XA 2OJEB 3SQBB 3WSQL 2AERT 2HRLA 3NCBB 5GZND 2A4EA 3SE3C 1WBXA 2YBRB 1CE6B 5F9WC 2KZBA 4UQCA 1BV8A 3AT9A 4XN1A 1G7MB 4FHKA 3LS4H 2YRBA 4Q58C 4K5NA 5DEJA 4M5SA 2ZOOA 4ZS6D 1SOXA 4MA3A 3T6XA 2WQXA 3FTGB 3OR6A 1RSFA 3MV8B 4NN6C 1YEJH 2CO7B 2R9HD 4PD4K 3NCMA 1BZ8A 4A2LA 4H88L 1GXEA 2H4EA 1FG2A 1IGTA 2DQIL 4DZ8B 5CEZH 3QXWA 5D7IA 3WIIH 4WGVB 3L5WA 3BP4A 2HTLD 4P2RE 1CO1A 3MV8D 4AJWA 5I1EH 1PKQE 2Z0UA 5B8CC 5E2UL 4NZRH 5CLYA 4YHZH 1HCVA 5L2KB 4GKZB 2Z8SA 4B3EA 2BVOA 4R3SA 1IAKA 2DW5A 3FT3B 3IM1A 4YXHL 1PLBA 4FQHA 1G9MH 4PJCB 3CMGA 2PMZA 4LIQE 4F3FB 1BG9A 4KJYB 5HYQB 3PG2A 3K6FA 1RIVH 5L2KD 1YPZA 5HVFB 3D18B 3KVPA 1PZDA 1VA9A 4XPFH 1MQKL 3MLUH 1RU9H 3MO1B 2YO3A 1HSBB 1HU8A 1Z5YD 3DSNB 4JGUA 2JQMA 3FTUA 3PV7A 4QXVA 1ZV2A 3QHZL 3QXUA 2NY2C 4QRUB 5CMAA 5D5MB 4PREB 4UILH 2YPVH 3O2VH 2C3VA 4A7GA 2ZUWA 1ZDSA 3FZUD 3EO9L 3AABA 4L9DA 5DGRA 4AM0Q 5D4HA 3LHAA 3SDAB 1FCGA 2DM3A 2XA8H 3DJ9A 3L5IA 4WWOA 3LNGA 1PG7X 1XZWA 2OL3L 1UZ8B 3GJEA 3TA3C 2XTSA 5AYUL 4B9KC 4WW1B 3DTXA 2FWOB 2HLAA 2YAMA 4BIKA 2I9TA 5I73C 2BHUA 3L4WA 1RCYA 2UZYB 2VISA 2WKLA 3TONA 4G1MB 3IS0X 3UZQB 5KBDA 4JZNA 5EU4B 3NJMA 4FN0A 1KB5B 5F1KC 1FLTX 4C8XA 4X9BA 4L1BA 2GSIA 3L1EA 4NZFA 1OAKL 1AZZC 3T3PE 3ZRSA 2D7PA 2QSVA 4MJ5A 1Q0YL 2APWA 4XCCH 4K9EC 2DYSB 2N1KA 2JLPA 4L05A 4QOKE 1TSRA 1A02N 2ICEA 1UVQB 1G0YR 2P5WE 3W0WA 3EXLA 1SM3L 1GS8A 1P6AB 3O9WB 1ZGLB 1VEOA 4M3HA 2EIJB 5LUMA 1J5HA 2G2RB 4G7SB 4KK5C 5HDBE 1U58B 1EFQA 4OCMC 4G6JL 3EJZD 4TLTA 3W37A 2R15A 4QO1B 4MWFB 5AW8B 5JW3L 3UPRB 3PNRB 2HVBA 2A77L 2MNJB 1QR1A 5E8NA 3DVGB 2YD8A 4APQA 1CGXA 3B1UA 2DAVA 1U3HC 3PHQA 2ED9A 4U49A 5I15L 1DVZA 3VA6A 3KHQA 4F5CE 1DZBA 2M1KA 4PWEA 1GS7A 3QUMH 1N0LA 1RZJL 5F3BA 3CLWA 2FIRT 5GGVY 4NDMA 3G6DH 1IM9B 2AGJH 2ZX7A 4LLMB 4U0QB 4ZW8A 5FF6A 3W3BA 2AXGA 3L4YA 2R29H 2VAAA 1Q0XL 3N5AA 5EU3A 5LGKA 1JYNA 3OC5A 1QO3A 5K39B 3PWPA 4AITA 4EIGB 4CL7A 4GRMA 4LVNB 2LAGB 3D5OF 2CBTA 4YN3A 2XBDA 1DLFH 1P4LA 4JKNA 2Y7NA 3X1GA 3FUEA 4KXAA 1LEGA 3HFMH 4WKZB 1KEGL 2AQPA 4Z7IA 4U1SB 3NJIA 1MW2A 3FO1A 3KEDA 5ALBH 4ES8A 4WK4B 1CK0H 1BPLB 1F4WL 3AU1B 1NJ9A 3O6FB 5IB5A 3H4FA 4Q6IC 1OK0A 2VIRB 2EXSA 1NLBH 3BGMA 1UH3A 4BQCA 2FD6H 3HE7B 2IAMA 2P5ED 4LCWB 2E56A 1EO8L 1NGZA 3ARWA 3F8UB 5AOMA 3LN4A 1G9MC 2A9CA 4LLWB 5BOZG 2DYRB 3H8NA 4KOBA 5HYJB 5EU6A 1N64L 4LVOB 1TZAA 4BZ2H 3S34H 5KVDL 2JJWA 4KNTA 3EG9A 4OCLC 5KOVC 5A43C 1S4IA 3QNZB 5HYSG 4FJZA 1T0NA 5HYJD 4OZGF 4MNGB 1HQRA 4NPYB 3LNEA 5B38A 1X7QB 3R1GH 3TO4A 1AGDB 3W9EA 3T6QC 4WUUE 3OZ9H 4HXBL 4D0CA 4BK5C 2DQUH 4KI5D 5J5EA 1IGML 4NQSA 3O3DB 1UH2A 5D2LE 3T9WA 4A55A 1BMWA 5I5IA 3JWOH 1DFBH 1JZIA 1SLUA 2YPLB 1JZHA 4N8PA 4TV3A 1U41A 2AQRA 5DMIH 1KYAA 1DBKH 5GZNA 3FQRA 3BVXA 2X05A 3ZTCC 3PP3K 1OXYA 2Q3XA 4MZ2A 3NZHH 3UTOA 1MLBB 1ROCA 3B2VH 4M7LT 4NNXB 2ZCHL 3F83A 4LGPB 3WAJA 1D7DA 1S7XB 4X5XA 1EIBA 2BCKB 2YBRA 1XVSA 5HGDB 4AW4A 1RJCA 4FGMA 4EUPH 1G7MA 1BQLH 5KVGH 4I3RH 2VXQH 1SXZA 2R4SH 2FEEI 1HJBC 1QBML 2NXZD 3MV8A 4RGNB 5IBUG 4PHZA 3JT0A 5CU9A 1S7RB 4DZ8A 1NFDE 1TQUA 4R90H 3CH1A 5CNHA 5FGBA 1UGKA 4N8CL 3ARFD 3OKMA 2NXYB 2XWBB 4JBSA 2IC2A 3VI3F 3VX0A 4X0KB 2Q7NA 4ANXA 2F15A 5T3ZE 5L2KA 4GKZA 3S36H 3NJLA 2NXYD 4IKNA 4QHKJ 2HN7A 4FTVB 2YFOA 4WFGE 2X6BA 4X2UA 3L7FA 4PJAF 5HYQA 3MU3A 4LEEA 4P3DB 3GHEH 3L3JB 4PJHE 3E3QE 4O02H 2YD1A 1M3JA 4QJ3B 25C8L 2YK1H 2IO5A 4ODHL 3OC8A 3MO1A 1HSBA 4Y4HD 1RVFL 3UAEA 3DSNA 2YAHA 4X6DA 1PZ5A 3H7BB 1LWRA 3GZPA 4PREA 5TE7L 1KTCA 4RDQF 1O7DC 3IDYC 1TZOA 4YC2C 4RMRA 1MFDL 4QXWA 5CZXD 3THMH 2FGWH 2H32H 4EKXA 1NWOA 3AMLA 5T33L 4R97B 1BXAA 4KRNA 3HG4A 1QNZL 4DN4H 4HX1A 1HT6A 3WMSA 1UZ8A 3LMJH 4WW1A 4PJEF 3FT4A 3KJ6H 4NOBA 4TMPA 3IVKB 3U0WH 4PJDA 4CU7A 5B3SB 4PB0H 2WMPA 2VLLB 5EF1A 2UZYA 4GAYA 4IK6A 1WFMA 4NQEB 5IBLC 1AKJB 3UZVB 3TEYA 1KB5A 4YPGA 5F3HB 4JL2A 1FNEB 3BZFB 4KI1A 4NQED 1WPCA 3BQUD 3BLBA 3VSQA 3ZQXA 4ABQA 3RFZA 1AKJD 3IFNH 5DMGC 5KS9E 2XYCA 4EQ3A 2OYPA 5MEOB 2EIKB 5MP6L 4KXBA 4KUZH 3TM6A 4AL8H 1FV1B 3O9WA 3L1GA 4WEBH 1ZGLA 1DBML 1XF1A 5KYWB 4X8GA 1U58A 1ASPA 2BOLA 2X1PA 3JWOC 4QO1A 4MWFA 5ECGA 4XZ4A 1IVTA 3CDZA 3BPOC 2G60H 2JELH 2Y24A 1CLVA 2YSTA 3RA7H 5IGXL 4ANUA 5ICUA 1A7RL 3CPLB 1PS3A 2UWEA 4M29A 2AJXH 4QY8B 5F2FA 3Q2LA 5ICYA 5ISZB 4JM0A 4LOVA 5JUEH 2CIKB 5E6IB 2F18A 1TF4A 1RUPH 3WJLA 3NEXA 3ES6A 4PJFF 4A6YA 2B3RA 2DM2A 5ISZD 4FKEA 4E9SA 4YDIH 2BY2A 4IW4C 4PLJD 1YY8A 2D0HA 1G7JA 2VITA 1MCJA 4Q8BA 2IPKB 1A14L 3X13B 4XWGH 1KCRH 3NK3A 2DS4A 2P5EA 3V0JA 1LO3L 2YAOA 3ZDZE 1YNTF 1BZDA 1PSKL 3P9LB 2VIRA 3N1PC 1FYHB 1F42A 2JKRM 5GSVB 1N5YH 3F6LA 4RIRB 1KB5L 5D1XD 1LNUB 1BQHG 2G0KA 3BP7B 3MXWL 2NUPB 2UY7A 4JFFB 4X9GA 3HAEB 3L4XA 3A6CH 3ZKNC 3X1NA 5HYJA 4LLVB 4XRCA 3AQZA 1AXTL 4ZX4A 1WZKA 3IDGA 3FRPG 1SYVA 1EMTL 4G5ZH 3E8UL 2FLBT 3B2MA 4LCIH 2M26A 1KENL 1F3JB 5I1DA 4NPYA 4PGJA 3HHSB 2I27N 2ZP8A 4UT6A 4MS6A 4MB5A 4YVNA 4Q9RH 4JDEA 3V4UH 3VI4F 2AK4E 4JFXB 1GJIA 5E51A 3ZR6A 4KMTL 2BRQA 1A1OA 1IAIM 2BWDA 2WYHA 1JPFB 4QRFA 1I9IL 1FYTB 1OAZL 3VXQB 1H9DA 2WLYA 1NCCH 2YPLA 4HBCH 2FNBA 3WNLA 4N1CA 5DZAA 3GBLA 3CVHB 3CVBA 5EA0L 1RK0B 1FYTD 5DEFA 4PVNA 4KXCA 4ADIA 3QO0A 4ZXBC 2TSAA 3CXHJ 1JZJA 4TVPL 4G9FB 4L1TA 1S7XA 4G42B 2F61A 5HGDA 4WY7L 4RMBA 2DKMA 2NPLX 2XZQH 5EOQL 2ZWLT 5D93B 3HS0B 2BSDA 4G9FD 1DEEA 3F7PC 3WN5C 1CL7L 4NQVB 2MCPH 3ARFA 5EUOE 4H2AA 4JY4A 1KB9J 2BIIA 3WY1A 1OAJA 2GSMB 5DK0A 1E65A 4RFEB 4AL8C 4JFHE 4FNPA 4HPOH 1X5YA 3E8VA 4FULA 4K4KA 4V11A 5FYKE 3ZMEA 2HT3D 2IWEA 5DS2A 1H6EA 3DWTA 5CM1A 3KVQA 4CKVX 4XBMA 1E3ZA 1BD2B 4X0KA 5HJGA 3U4AA 5TQ0H 2DQTL 6CGTA 1A4BA 3RVUD 1WZLA 4KX9A 3HC3L 2VXSL 5SV3A 4ERSH 1WT5A 2NY5L 1D9KB 4FTVA 1NAMH 4MMXC 3HPJB 5HDLA 4P3DA 3GDCA 4LDCA 4Y4HA 5CILL 1R3KA 2IQAB 2UX7A 2A83B 3BH8B 3AQXA 4NPJA 2XWRA 2NYKA 1U3YA 4WKXA 1UT2A 3DX9B 2MQ3A 1SN5A 3C12A 4GOSA 4X83A 2DQFB 4XTRD 2H41A 1TYEB 4N2FA 4YDJB 3O0RH 4NC1E 1OW0A 1MCFA 4NM8L 1PZSA 3EDFA 4GS7C 3C2SA 4HKXB 3ENEA 1ET5A 2R0LL 2AK1H 3MGAA 1MHEA 4IMKC 2WBJC 1TJGL 1TJHH 2A5UA 4JVPA 2DMBA 2DEWX 3L7EB 2EYTA 3VM5A 3S37X 1ZLUH 1B3IA 3GBMH 4M8QA 4EPSA 3ZDYF 1PEZA 3QFJE 4S2SB 3IVKA 4WTXA 5LJYH 4RMSA 3K0YA 1M71B 1TDQA 4NQEA 3X1FA 2OJZL 3BQUA 3Q9QA 1AKJA 1LYQA 4JQIH 1PZ2A 1XCXA 4MQ7B 1YA5A 2WQWA 3ZE1E 1OO2A 4XH2A 5KOMC 4D3CH 5C2BH 1DQML 3ARDC 2V3DA 2IADA 4HJJH 1CLZH 3V4PA 3RE0A 5EO9A 5FKAB 3ULVL 3IFOB 3U7AA 5LBVA 4IIQC 5D7LE 1PGRB 2ZWYA 1MXDA 1JRHI 3BUYB 1KEMH 1PNCA 4WFEE 1TU2B 3PWLB 3L81A 2IDQA 3KPNB 5HI5D 1K8IA 3KPPA 3S6CA 3O3AB 3ZGIA 3AXIA 1HAUA 5DD5L 4WWKC 1AI1H 3A24A 4R7XA 4DP5X 3B5GA 3U2SA 2K3TA 3WUWB 4XMUA 3O45A 4NRYA 3BDYH 3PU7A 3KM1A 2ZICA 3CC1A 4POUB 4QY8A 1EHAA 5ISZA 2R83A 1W0WA 2CIKA 1TZ8A 2R8SH 1DANT 1GYUA 3FYEB 4PP2B 5F0JB 5KVEH 2Z92B 1KJ2H 4ZJ9A 5DO8A 2K6WA 3KWVA 4XN4A 3ZE2E 2Y07H 2HKAA 2YEZB 3GYRA 1J05B 4BQ9A 4M8UA 5AKTA 5DEGB 4AEEA 2F9BT 1M7IB 2WXOA 5DMKB 2WAHA 2H0EA 2VC2L 3QQDB 2EDOA 4TQEL 2R0WL 2IPKA 3MREA 5F88B 4ODBD 4ZUTB 4HIJB 5D1XA 3PF2A 2WLLA 4MBRA 3MRIB 5J56B 2F53B 4J3OF 2AJZB 3JWNG 4D8PB 4PI2A 5GSVA 3ZHDA 4QRSB 4RIRA 4ELME 1LNUA 3BPCA 5CGTA 2VR7A 5GS3A 1J8RA 5LBSH 3TN0C 3P30L 2E74C 4ECNA 3ZHKA 4LLVA 1PF3A 1TEFA 3VFWB 1QP1A 1CU4H 4PGDB 5I8OH 5F70A 4P05A 1P7KB 2BJMH 5C0RL 2ICCA 3RX8A 2YAQA 3RWDA 5EORH 3B7TA 4XO8A 3EJUA 2BFVH 3OX8B 3T4AC 4EBQL 5HYIA 1ZSDA 4KZEL 4XI5C 1K3ZA 4RH4A 5E8DL 2YLHA 4KY1H 3FHAA 3VRLF 4HWEL 5I0ZA 2CNZA 1X5HA 4CA4A 1S9YB 4G3YL 1T22A 4UQ3B 1JPFA 1FYTA 3VXQA 4HJ1A 4EE2A 4OT1L 3Q8BA 5B3NA 2X41A 4K73A 2OKMA 3I9GL 3ZE0F 3K6SA 3FB8A 1B3JA 3CVHA 4M61B 5DFVD 1RK0A 2PPCA 4NKIH 3BUIA 3SO3B 3KH4A 2G4EA 5BS0E 1L9RA 3CXHK 4G9FA 5SWZE 2J73A 2R1YB 3HI5H 3ULUF 3TBTB 4JGNA 1KULA 5CP3H 1S9KC 1NUGA 2A9DA 3L3IB 1ZVNA 2M83A 3E6HA 3HKFA 1MAMH 3QZLA 4JPVH 4NQVA 4IM8A 3ECUA 3TIDA 4YDNA 3MUHL 3TYFB 4BJLA 2W0FB 2XJKA 3VFSB 4J6RH 3WEBA 5E4AA 1KB9K 3N42B 4LCYB 4F37K 2CALA 3IN2A 4RFEA 1VACB 2RD0A 5DEZA 1PFCA 1WHPA 4PCYA 5KYNA 2NY6D 1V3JA 4Y1AE 3S96B 5MENB 4NO2B 1T7WA 1WCBA 4RDQG 3WTUA 1BD2A 4PG2A 5SX5K 3ZYOA 3V6FB 3CG8A 4F2MA 1TR7A 3FHEA 3OV6A 3LOWA 5GGTL 1D6VH 5CEXB 2UXFA 3QR0A 2IQAA 1MNUL 5IMMB 5L8KB 1V55B 3CSYA 2MEJB 3BKCH 3IU3B 2D0GA 3DYMA 5DUMH 2DQFA 4AW7A 2DPKA 3QJHA 3AXHA 5IF0A 1SFDA 2HWZH 1NC4B 4CC1A 4YDJA 2HTKD 1WC7B 4DKFL 5I8KL 2FX7L 4D9QE 2GSGB 3AZUA 1P4BH 4QTIL 1CR9H 4XNXH 1WBYB 2YA0A 2IH3B 5DUPH 1EX0A 1FLRH 4GBXB 1YEFH 3JSSA 3K2KA 2KQNA 4UM9D 1NC4D 3S3BB 5JIQA 1RZGB 3CVHL 3B2DC 2H2SD 1HESA 4RSYA 5F7EL 2GTZB 3L7EA 1I82A 3WI9A 4M03A 3HW7A 1BLIA 3HUJE 4S2SA 4F91B 4DWHA 5IV2A 2K70A 2QQKL 2BNUB 4L1HA 2VDPH 1LEKB 5EIQA 3C08L 4HPHA 1T83A 4ENEC 1AFVL 3ISWA 3S0PA 4TVUA 3E0GA 4IRSD 5HD8D 3VTMA 4ZW5A 1JAEA 1OARH 1OEZW 1CLYL 1U8KB 2WZAA 1S3RA 2Y1AA 3MRPB 5BQDA 2CJUH 4X6CE 4J7RA 4MAYC 4OJDH 4HH8A 5DQ9B 1EAPB 1FAIH 4OTXH 3WNIA 2K7PA 4B7LA 5FKAA 1XFPA 2BM3A 4P2OD 1F1DA 2WOBA 5I1AA 1NKGA 4DN3L 1SZNA 3LIUA 4XP1H 4GUPA 5JXED 3GM8A 1N6QH 2ZKHL 2F58H 2AEQL 1XL6A 3LVTA 4TXVB 5JORA 2AEIT 3BUYA 2CO4A 2FT7A 2AITA 1GZHC 1VFAA 4Z0BL 1WBZB 1HN1A 4N90D 4CUCA 3L3GA 4HMEA 2CJ3A 5KTEL 5LDSA 4HP5A 3CN4A 2ZZUT 4DUVA 4LRNH 4WTQA 3NAAH 2MKLC 5ITBH 1IQWH 5DURB 2HJLB 2WUBH 1WE5A 1A3LL 2X53A 1K4CA 4G71B 2QLVB 4OB5H 5C0ND 3SOBH 1M9SA 4IRZA 4NQCE 4YHKL 4ZUUB 2IFFL 4PP2A 1QUPA 2ODIA 3D3VE 3U1SL 1U4EA 1F5WA 1LP9E 4LCUA 4Y9BA 4MB3A 4XCFH 4X9IA 2D2CC 2F8XC 1NCNA 3DIVA 3B7UX 5JDSB 3QQDA 3IDNB 5D7KD 2V7HB 4K5MA 4X4XB 3NZSA 5GJTH 2DWDA 5F88A 1XTLA 3TA4D 4ZUTA 2IFGA 3MJWA 1ZXQA 2F53A 1E4WL 1XDTT 2AJZA 4L8SB 3X3FH 4B9FA 5F1SA 3QUYB 4I1PA 4QRSA 2XN9E 3T1WA 1F4XL 2EZ0D 3RL2B 3UYRH 2WB1A 1SLXA 2ZT9C 4Y2DC 1S5HA 1PMYA 4H8WH 1J5IA 4Z7OF 3GQFA 1CDJA 3ELQA 3UJJL 3O6LL 2L7EA 5DJZB 1I3VA 4PGDA 4ZUVA 4FQLH 4LSPL 3EH4B 4HSCX 4AVJA 4RGMB 3TPKA 3OX8A 1W72H 1UA3A 4JO1H 4W93A 3RVTC 5IMKA 5EEXA 4GMSL 1U8IB 1KPVA 3BSGA 5HY9B 2LTQC 1DSFL 2FX8H 5CZRA 4FJYA 2OX5A 2WK2A 1UOLA 3AB0C 3LQZA 1L7IH 2NNCA 2F5AH 4UQ3A 1INDL 4JM4H 1THAA 3DRTB 1W91A 1W6LA 2X6MA 1P1ZA 5L0QB 2QQNL 4P4KD 3P11H 4X99A 1F3RB 1P7BA 3QRGL 3TFKC 3N44B 1DQKA 1R0AL 4L8CB 1EAOA 2XZAH 1KTBA 5T3XH 1BZOA 4PRPE 1JPTL 4RFOL 4IRZL 1I1AC 4BUGA 1XHHA 1ADQA 4JLRB 2HRPL 1ZLEA 1FHGA 2R1YA 4GINA 2YA2A 4PJHF 3FUNA 2ORBL 4OGYH 3VO0A 3VFGH 4XMPH 3LH8A 1IKNC 2FEDD 3NJFA 1UG9A 3Q1SH 4TL4A 4I13B 5DI8A 3TYFA 3FMGL 1YAZA 2W0FA 3HG1E 3AQYA 3K4DA 1WGOA 1BM7A 3KPRB 3NJNA 4K2UH 3NIDB 4QAWA 4Q6KA 1VACA 1ZIAA 1F97A 3ZTEA 3K1KC 3E6FA 2ZXGA 4GG6A 4NZ8A 3KPRD 1BYOA 4WFHE 2IQ9H 2Z7YA 2ZX9A 3RGHA 1T04B 4PBDA 2LV4A 3MLWH 1LL1A 1EZLA 1QW9A 3ESNA 4XE0A 4OM1H 4K7PH 5CEXA 1QR4A 3GSWB 3ZBMA 3TWCL 3QIUC 3HC2A 4QXTA 4D7PA 5IMMA 3D09A 5B7MA 5DK3A 3I3EA 1G7QB 4Y8DC 4QCIB 4OZIF 2KT6A 4JKPH 2WXPA 3BEVB 4NUPA 1EK3A 5FLUA 5JQ6H 4FMVA 2EIBA 2FJGB 5IQNA 1I75A 1A0QL 1NC4A 4GW5B 4OGQC 5HYSA 3GZQA 4LLYB 5KS9F 2GSGA 2WKGA 4DQAA 3D07A 1CFTB 2UVFA 3LZNA 5GHWL 2IH3A 3WMPA 4P46B 1J5CA 3HJ0A 4BEIA 3CMOH 4LAQL 2VXVH 1BECA 2NLJA 3JV6B 3GXFA 2R39A 4YE4L 4DZBA 4ZPVB 3K6NA 2QSQA 3B5HA 4FFWD 1WZAA 2G75A 3GUTB 1U2CA 1ADQL 4P46D 2HRHA 4KZDH 4IRSA 4KROC 4L4VE 5AOJA 1IM3B 5A16B 2BNUA 4JCWA 1LEKA 4QLWA 4H8WC 4DH2A 2XDHA 1KN4L 3F58L 3PP4L 3VGHA 1DVSA 1U8KA 5DFTA 4NWTL 1IM3D 1MFBH 3NVQA 5JXEA 1YMMB 2CKBH 5DQ9A 1EAPA 3BKYH 1MCPH 2W80C 4R8WH 4PW4A 3ZT7A 5IOPA 3EBIA 5L8LB 3KMDA 5CSZA 4HXAL 2EACA 5IB1A 3SE9L 4NJ9H 4TQHA 4BFKA 2CLZA 4FAAB 1Z9PA 5I6LA 1YMMD 1NFKA 4YUEH 1JE6A 2OBGA 1XXDC 3WXWH 2RALA 3AMKA 3MXVH 3IF1B 1WBZA 4E41E 1PAMA 2D7TL 3HRZB 4ONGL 3AXLA 5E08H 4KH9A 1I9RH 1Z1WA 1JWUB 3LKSB 1LD9B 2PR4H 5ADPL 4BE5A 5KZCB 1RD6A 4W9DC 1A4CA 4HJ0C 1PAZA 3CZJA 4L37B 1RZ7H 2BC4B 3DC0A 5C0CE 4J3OG 3KM2A 3H3PH 4EI6B 1NGPL 5T5FH 1BX2B 2VM3A 4XE5B 4ZUUA 3CN2A 2CKNA 3CHXA 4MJIE 3UFIA 2B0SL 4PRHB 1A6VL 4W9FC 3ZKMC 1BAFL 4OLUL 1WH0A 1JGDB 5BVJB 3B9KD 4XP4H 4B3VA 3CAFA 1JWSB 4G1EB 1P5UB 1I1FA 3C5XA 1YCSA 2E9GA 3IDNA 2OTUB 3TBVB 3M6DA 2R1XA 1IJ9A 3CDYA 3HB3C 3QZPA 1BZEA 1IIKA 4DK3A 1IE5A 3PDGA 1FZOB 1ZJBA 3P9MB 1I53A 1UM6H 3QCUL 3VXSB 4FD0A 1OK8A 3ZRFC 1TVHB 3GS0A 4JDTL 3RL2A 2FE0A 1NMAL 1P53A 1WAAA 1JG9A 5BZZA 7FABL 4IMLA 2F7PA 2EDJA 3D2TA 4S1QL 3EW3B 3OZLA 2GITB 4FG6C 12E8L 3NTCL 1S7UB 1J5OL 1EEZB 3VDAA 1WP6A 1MREH 4L4TE 4Y5XC 5GS2H 1AO7B 5I16A 1U8IA 5F93C 3MCKB 1HE7A 5G5DB 5HY9A 2BVQA 4TULL 3RTLA 3PJSA 1IFHH 3IXTA 4FXKC 4L9LC 4P4KA 4R2GD 1ZTXH 2N59A 3SDDD 4BUQA 5C2UB 3RY6A 1A7OL 2XG4B 5J9PB 2B1HL 5TE6L 3FW6A 1NFIB 4NUJB 1E4JA 4XCEA 3T0EE 3GLZA 3LEYH 3AS1A 4X7FC 3BIAX 2OW6A 1GZQB 4JUTA 2VM9A 3ZJAA 4PJBE 3KYNB 2B14A 4F2EA 3DKHA 3RGVC 2OXHB 1L9PA 1TT6A 4EEEA 4D0DB 1HZHH 4QXGH 2A74B 2YQGA 2ZXAA 1I3RB 1DVQA 4PLKC 4R96B 1K4DB 4P2QE 4LDEB 4AQAB 1QLEH 4JLRA 1HXYA 1A3QA 2E7LA 3EOTL 4N85A 2H3NA 3Q5OA 4CNIA 5JHAA 3N50A 2WKOA 3MV7B 3M7FB 1FNAA 2W8CA 1JZ2A 2DQGH 1OTUD 2PO6D 1NCWL 1IGCH 5D1QC 2Q8BH 2H6UA 4OCNC 4DP7X 1N9PA 5IOKA 4CRPA 2D4DA 1CURA 4LGRB 4JZJA 1BOYA 4KK8C 1YQ2A 1N6UA 4L5FH 1KXTB 1JNHB 1DJZA 3KPRA 5AW3B 3U1QA 5D7JB 5GRJH 3SPHA 2A1WH 2GYSA 5DTFB 2C9XA 3BUQA 4LESA 4DK5A 2Q9OA 4OZGB 2KBGA 1T1YA 4Q56A 2VQUA 1BWMA 2VDKB 5I1JH 1J88A 2BSRB 1A7NH 4FFYA 3GI8H 4AC2A 3DK0A 3OXSB 5F7DB 4OLVL 3WHXA 3GSWA 5GS1B 1JZFA 4F8PA 2FZ3A 1EEYB 4AXWB 4JK0D 5JOPD 3V7AE 3ZL4L 1BQHA 4DKTA 2JJSC 2Y2WA 1CICD 5FYJE 5JPMB 5F1IB 1TTAA 3QJFB 5LN8A 1A6ZB 4OQTA 3SCMC 4ZAKC 1HHHA 1YNKH 4N3TA 3FRPA 4UTBA 2QEJA 4GW5A 4EN3B 1UCTA 1VFBB 5D6DA 1CFTA 3MLXL 3RZCD 1KF9B 4P46A 1L9MA 1G6VK 1P5VB 3JQOB 5MHSE 2VRKA 4E68A 2DQJH 3JV6A 2KL6A 3S88H 3QUKB 1CDCA 1S9VB 4XP5L 2DWTA 3GUTA 1DSWA 1CFQB 3VWKC 4L2LA 1IM3A 3ARTA 1E3FA 2YXVA 5A16A 1KN2L 5JA9A 3EIFA 2Z7WA 4KKCD 1PY9A 3NJKA 3CFNA 3DSFH 5M7QA 3TZVD 3WSQH 5IHUH 1R5VB 3CTTA 2J1YA 4B96A 1ZMYA 3PWJA 3VI3B 1UADC 1U93A 1YMMA 2BNRD 3ETBF 3STBA 4A67A 2WC7A 1H19A 3RPKA 4LPUA 4CW1A 3CBRA 1ZT1B 4H8PA 2NY1B 2DD8L 4PJAB 2VL5A 4K3HA 1V54B 3MOQA 5IQ7L 2OPCA 3JYBA 4H88H 3ORJA 4P5RA 2B1OA 4XVUD 5B7FA 4NIKB 4ELKB 2NX5B 4NFDA 1ZHBB 3OLDA 4NKDB 4FFYL 3HRZA 4P5TD 1KLFB 1NDGA 4OFQA 5AAMC 2R0KL 3LKSA 4K07A 5JZ7C 1KCWA 1FZJB 5E2UH 2NX5D 4Z7UE 1D7FA 1EHKB 4LNVA 2GJZB 3GGWB 4ELMF 3SDXE 4YXHH 1MCRA 1DJXA 2VKXA 2Q6WB 2WHVA 4OQTL 3B9KA 1R47A 4LLUB 1BX2A 1U8NB 4GSXA 3DA0A 2FL5B 4UTBL 2YGPA 5HHMB 3FSWA 3T2PA 1J10A 2CSPA 2LVEA 1NTDA 3HEIB 3QQ9C 1MQKH 2DWSA 3T77B 5LGHL 2RAMA 4PJEB 2DQCL 1S7VA 4IBSA 5HHMD 3WHE1 1XIWD 1I1RA 2KZWA 3MUUA 4G1EA 4URKA 3CCHA 2EYRB 4MA1C 4LB8A 3WELA 1NIDA 2OTUA 5CWSB 5HHNB 2AJUL 2NNFA 4BFBD 4AMWA 2EDHA 3QEQD 2IV8A 1OTSC 3V4VB 3H9ZA 1ZVSA 4JFEB 1NGQL 1CGWA 2XVKA 5BUPA 5FO8A 4TUKL 4PYGA 5TPWL 1HL4A 3LPWA 1MH5B 1SQ2N 2YUWA 1FFOB 1Y6MR 4MQXD 2OL3H 4HUNB 4LARH 1MDAA 1ASQA 4HUUA 5AYUH 1U91B 4HCGA 4P9HL 1OP5H 1DJWA 1JZ5A 3LXBA 3NG5A 2AXWA 1CS6A 2YR3A 1NKRA 2J21A 1UM5L 2JB5L 2PXYB 5IJDC 3ECVA 1S7UA 2EDBA 3RTQC 2GUOB 4AYBA 2DLFH 5GIRB 1FZKB 2G3MA 3FQWA 3R0MA 5F0LB 1HYSD 2WNXA 1AO7A 3QUXC 3DI3B 1OAKH 3MCKA 3MNZA 4YHYC 4U1IB 1Q0YH 5EO1A 1TFHA 1T1WB 3GRWL 2I07B 3D0VB 4J4PC 4NUJA 1NFIA 3DTDA 1SM3H 2OCFD 1QASA 1NIEA 2O4EA 3HMWL 3O11B 3V5HA 2OMNA 2VDLL 1IE4A 3OBAA 4PJFB 2FHBA 2J12B 4JW3A 5LLIC 4Y16C 3BP5B 4UZUA 4UOJA 5EHFA 5JW3H 4R96A 1I3RA 3K6IA 4MNQE 3TJHC 3B8SA 2PO6A 5FYLD 4AQAA 3BC9A 4YEFA 1J8HD 3I02B 4L2YA 3RX9A 2DWEA 2R7EB 1W8EA 4K23L 3ARGC 3ZSSA 1K5NA 1FWXA 5KYXB 3VU2A 1OTTD 4WSGA 1RZJH 4KKLC 4Y2NA 3EFOB 4X5RA 5F1NA 1YN7A 1FFTB 5SWSB 3IMUA 1OZTG 1JP5A 3IDJA 2E47A 3OL2A 1Q0XH 3P0YL 5MERA 1U8CB 3VRLE 3LZPA 4DEPC 2BMKB 4M93C 3H54A 2CLVB 1TPXC 3QDHA 5EIIB 4Q14A 2GC4C 5DTFA 5SWSD 3L4ZA 1L3NA 4RFNC 4OZGA 1KFGA 1PZBA 4NZDA 5F89B 4OVUA 5E7FA 3RX7A 4FI8A 4QLRA 4OI7A 4H26B 2BSRA 2HFEB 2Q7AA 3VI4B 3WNMA 1H3PL 4NHCL 5DHEA 1QRND 3ARVA 1CICA 1X5AA 3OXSA 5F7DA 2VDQB 3MRBA 3UP6A 3C6LB 1SVCP 2Z93B 1P4UA 4BWTA 1EO8H 4AXWA 4Z7QB 1JD7A 1I7UB 3V8CA 1N64H 2ZXEB 5E00A 5F1IA 3C6LD 3PUUA 2HG5A 1GGCL 1A6ZA 1M2OA 2V2XA 3CX5J 1ZLWK 3RZCA 1D2OA 3TEWA 1KYUA 3TBCA 3EFFB 3M17B 3P4NB 1VFBA 5DO2C 4U6XB 1UUNA 1U8OB 4KHTL 1BF2A 1ZANL 4HXBH 2EUWA 1TSHA 4QNPF 5I5RA 1ZT7B 4YK4B 1BFVL 1WAPA 3K4ZA 3P3TA 2IBGA 2JK5B 3B4NA 3DVIA 1OAQL 4HKJA 1DCEA 3SZKC 3QUKA 2H3KA 3FB7B 3GSNA 5BXFA 2NUTB 1LM8V 4KJWD 1CFQA 2FSEB 4XPGL 1JZ3A 2IANE 2Q1EA 4F27A 1CMOA 1WEJH 4U05A 2V5SA 2BNRA 5DA4A 5C97A 3C60C 4LP5A 3I3BA 3F65A 4OSUH 1JDDA 3US0A 2ZCHH 1D5IL 5FUCC 1V8HA 2CBOA 1VERA 3VI3A 1QAWA 1QMUA 3GF8A 4BH7B 5HI3D 1KXVC 4DSYA 1XMWA 4GT7A 5EIVA 4PJAA 3FU6A 1QBMH 1Y0LB 4LKCA 1OV8A 2D9CA 4P5TA 2Y3AA 3HN3A 4O4YL 4ODXA 2Q0ZX 1XZ0A 4X80H 4ELKA 1JHKL 2NX5A 2VDKL 1ZHBA 4R5XA 1NEZB 2E9BA 4N8CH 4NKDA 2FWLB 4FS0A 1GGIL 1KNOB 3SY0B 1FZJA 2ZUVA 4U1GC 3O3EB 2V6HA 3GGWA 1BM3L 1Z5LB 4AIEA 5J0BA 2Q6WA 3GMMA 4H8VA 4UIKL 5A2CA 3GTTA 4TF4A 3WENA 3IJEA 1EERB 4LLUA 3RQ3A 1U8NA 1VZIA 1BHGA 4EUPG 4FQ1L 5DJXB 5FV1L 2X2YA 2DEYX 3GEWB 1RZJC 1EFXD 1B88A 1JGUL 2Z3FA 3QEQA 4PJEA 4E5XB 4MDIA 1RVFH 5BW7C 3FCBA 1SN2A 2NY3C 2EYRA 3CGTA 4LPYA 1FVEA 5CWSA 3VGAB 5E6ZA 3EHBB 3K74B 3GSNL 3V4VA 1MFDH 1A64A 3ZTDC 2ZOLB 4IK7A 4IBWA 2PWHA 3DK2A 4XP9L 5C0BE 3VXOB 3EHBD 1JCKA 4HOWA 4HKBB 1IBHA 1A4KB 1FFOA 2CXKA 2WLHA 3BHBA 3IETB 5BRZD 3VXUB 2IIJA 1U91A 3HMXL 2R2BA 3ILEA 3QC6X 2WXJA 3VD1A 2DIJA 2JJTA 2EDTA 3R06B 3UTPE 3VFNA 1NCGA 2O30A 1P7QD 1RL1A 4XPBL 5J11C 1C8QA 2ZYSA 2GUOA 2H26B 4Q2ZB 3WU1A 5GIRA 2MPAL 1FZKA 3EJCA 5HHOE 1E7VA 3MBWA 3S35X 1TTGA 1ZD6A 3FF7A 3K1DA 4D9RE 4U1IA 2Y5TB 2XTJE 2BVEA 4FQJL 1S8DB 4WEEA 1DO6A 4TLSA 4OF8A 4K7PX 3QIBB 3MACH 3K3QA 4XNQB 3ISRA 3O11A 2XHNA 3OJDB 3TV3L 3QXAB 1DBMH 4CMMA 4B0MM 2MQCA 4LHUB 1SHWA 3QS3A 3T08A 1J8HA 1ID2A 2HLEB 4ODVL 4HQQL 5CLZA 5ESVA 3BP5A 5I5JA 3PDOA 5AW6B 2E8ZA 2G5UA 4APQC 1F6AA 4DESA 2WW8A 1SHMA 4LHUD 4WI9A 3U2JA 3TURA 4WHTA 1VCAA 2FHCA 4JRYE 2OXGB 2R7EA 3QHTC 5FOJA 5IGXH 1R5IB 2OYKA 2VXTH 3PE9A 1DVXA 1A7RH 2X89D 4MQSB 3MTRA 4DQOL 3QIWB 3AGVA 1HC1A 3IWVA 1YNTA 3QR2A 3EFOA 2JCCB 1P7HL 4PY7B 3QPQD 2ZWKA 2Q8AH 5IJCC 2LU4A 5SWSA 1HCFX 4BFIB 4KX7A 3V4VL 1SOQA 3QIWD 4J3OD 1E9OB 2BMKA 1PD6A 2DM7A 3Q13A 1QRNA 2B7DT 4BHUI 1AJ7L 1G7IB 3HBGA 4PJIF 5EZPA 4G6AD 1ES0A 3NCWA 1UA6H 1LO3H 3VI4A 2X6AA 2O61B 3LPFA 1PSKH 3KPMB 5JPNC 3FU3A 1U3ZA 3C6LA 2Z93A 1KB5H 3MXWH 1SUJA 1I7UA 2AP2A 4P2RB 4KZCA 2F74B 2E4FA 2FBJL 2IOIA 1A9EB 4KMQA 1AXTH 4RCAA 5C0IA 5CCGE 1PKQB 4PJ5E 3RX5A 1GSMA 1EMTH 4WFFD 4P2YA 1T1XB 3E8UH 4CAGA 5KN5B 4D0BA 5E9NA 1KENH 3KWWB 3CX5K 4GSDL 3L17A 1JFHA 3ARED 3EFFA 2WIIA 1X4ZA 4ATWA 1V5JA 4OJYA 4PRNB 1RIHH 4XBPA 1XBDA 1EO7A 1U8OA 1IV8A 1F90L 3KWXA 3NIFF 5BQ7B 4KK9C 1L6XA 5LXVA 4KMTH 4A7VA 1ZT7A 2HT4C 2JK5A 1HINL 1I9IH 1OAZH 2Z65C 3FB7A 4GAAA 1OCWH 2NUTA 3T04D 3UJTH 3ULUD 3LNHA 5IEKB 3PXJA 3DURA 1T20A 5EA0H 3ZO0A 1IVLA 4P5MA 4YIQB 3O2WL 3PP3H 4PBVC 1RPQA 4TVPH 1UTDA 1DJGA 1KZQA 3PWVB 1TZHA 3QFGA 4G8FA 4RRPM 2UXTA 1URZA 4Y0GA 3RY4A 3WFHB 3ZHFA 1QSVA 1X5MA 4FCHA 2V8MA 4ODUB 3QYNA 2FO4A 4G70B 1Y0LA 4OF6A 1FRGL 3QXDA 3CHQA 2EVGA 4NPKA 1WLHA 3WMQA 2CGRH 3EGXB 3DV6A 4ZX3A 3UTTE 1C12A 4A1RA 2RHEA 1XGRB 5FPIA 2DH3A 2X28A 2VDQL 2OW7A 3WFDL 2EC9T 4QOKB 3WTXA 3A4EA 3QAQA 3KW8A 1K72A 5DCCA 2P5WB 2VXSH 1XL4A 3BVVA 3HC3H 2NY5H 4KDTA 4NC2B 5T1DH 5IR1A 4S0HA 1V3MA 1E9QB 1G6RB 5CILH 4KH2A 5FCUL 5HDBB 4WWID 5DJXA 2BK8A 1AHWB 3FQNB 5EEWA 4Z3FA 4DP8X 4HOMA 3EJYC 3UADA 4QWWC 4LL1A 3LZLA 4HEPA 1AVAA 2A4CA 1W16A 4ZMAT 5I6PA 4MXWH 3M7OA 4YFLI 5DC0A 2X87A 4NM8H 2PW1B 3U4EB 2R0LH 1T5KA 3L1FA 5BRZA 3SBWA 1JZGA 3SDAC 2ZOLA 4ZT1A 2JKWA 3Q06A 1TJGH 2EICA 3GSUA 3POHA 5DJ8A 3EZ8A 3O2DA 3SDYL 5DQDL 3GKWL 3IETA 4LRIA 1AIZA 5EMYA 1P7QA 3VXUA 3AS3A 2VT0A 3ETSA 4QR7A 3TBWB 2J8UF 3FN9A 1HWWA 5I1GL 3LRGA 2ZP9A 1BBJA 4NFBA 4XO4A 3R06A 3UP1A 2OJZH 2VO5A 4Y88A 5TQ2H 5I73B 4RMUA 3B34A 2XVLA 2Z8VC 4Q2ZA 5TJWK 5ES4B 3TA3D 3KPQB 1QWHA 1V3LA 2AEPL 4J3VA 3MNWA 1DQMH 4CADB 4DGIL 3MGOB 2APFA 2WTPA 3ULVH 3O9WC 3EFDL 4K55A 4BFGA 3D87B 3DIFA 3KYAA 2QPSA 5DRWB 3CNKA 3G5XB 2V9RA 3QXAA 5E9AA 4LHUA 4RSVA 4WTZG 2NDFA 3C5SA 5JOFB 2Y5QA 3BP6A 3RIFF 2VR4A 4R26H 5DD5H 2X89A 4WUUB 5JIHA 3CVDA 1AGEA 3GSRB 4HWUA 5SWQA 2OXGA 1JF5A 3GHPA 3MPCA 4WI3A 1R34A 5I76A 3GSOB 5D2LB 1IO4C 2PP9A 2WB7A 4LNRA 3ZSTA 3WIFB 2UV3A 3WJLC 1RP9A 2NTFA 3FN3A 3QIWA 4KV5E 4CC4A 5DDHB 2GW5A 2YS4A 1ZT4A 2GK0B 1U3HD 3T0XA 1G0XA 1AS7A 4LVNC 5ENWA 1Q4NX 3T6VA 2KLRA 3V6OA 4BFIA 5KANI 1CC3A 2Q86A 2J2ZA 2XQYK 1E9OA 1FL6B 1CDIA 2Z64C 4Z7OB 2R23A 2XWJA 3ATDA 3ARXA 2R0WH 1Q9WB 4TQEH 3O2DL 1CBVL 1RKRA 1B2WL 1YEEL 3O6FC 3TCLB 4AE0A 2HAZA 1AHKA 3VSVA 2PR9A 3RIAK 4R6UA 3HE7C 1GOGA 2O61A 4ENZA 2EVJA 1MN4A 4IBVA 3LKOA 2AQ3A 1NFDB 2NY5C 4X98B 5DYOB 4LVOC 5DJYB 3ALPA 4EO5A 4WCYH 3P30H 4P2RA 3AREA 2F74A 5AVTB 4BA8A 3HE6B 3R4RA 4UCFA 2UY6A 3MV9B 2VR3A 1TOXA 3QWOA 1T1XA 1EVUA 1AZRA 4JHUA 3STZB 3HHRB 3BSHA 4ODSL 5C0RH 3KWWA 3RWCA 5DUBB 1PQZB 1O6TA 3RLSA 2YD5A 3IRPX 5JW4N 4EBQH 1KXHA 4KZEH 4PRNA 1S7SB 2OMBA 3MV9D 4JPIB 3ZT5A 4N2DA 1U8PB 2V2WB 5E8DH 1SJEA 4HWEH 5BQ7A 3NCJL 4PJHB 5E7BA 2Y7MA 4FA6A 3TTYA 3KPSD 3GEFA 4FADA 2AJVL 5AOLA 1DQDL 3VW3L 1HX0A 5FECA 4DGYH 1JK8B 3I9GH 2P49B 1GAFL 2JKIS 1OPGL 3RHWF 4G6FD 3RL1A 3UG3A 4NRZB 4PIRF 2Q76B 3CPUA 4XMXA 3GBDA 3PWVA 4FP8L 4OKDA 4M9PA 2EECA 5HHXH 1UC6A 4B7IA 3D69A 2XV3A 1N2RB 3U7WL 4CU8A 5C0DB 4N2HA 3SE3A 2VLRE 4XXCC 3MFGB 4RGNC 4WHYG 2P52A 2VNCA 4EOWL 3BLKA 1AQ8A 1OGPA 2MQGA 2OR9L 4K15A 3V0WL 3IE4A 3ULVC 1YC7A 2C7UA 4HF5L 1JGVL 1V3KA 4P99A 1DDHA 2ENSA 2O5XL 4F9LA 1PYWA 1FGNL 1HHGB 2BERA 2WJ7A 3TFBA 1OT1A 4HLEA 4ESKA 1H8NA 3O3BB 3D51A 3Q6GL 5C09D 4AKOA 5KS9B 5B8CA 1TETL 3HAEH 3PHAA 4DPBX 2ZWNA 5IFAL 4KQ4L 1IKFL 4AUYA 4JO5A 5IHHA 5DHVB 2DLTA 5GGTH 3BDXA 4UUJB 3C2AL 1KCUH 3QDGE