1P61B

Structure of human dck complexed with 2'-deoxycytidine and adp, p 43 21 2 space group
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
241
structure length
229
Chain Sequence
RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNGGNVLQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLSTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human dCK suggests strategies to improve anticancer and antiviral therapy
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Deoxycytidine kinase
total genus 87
structure length 229
sequence length 241
ec nomenclature ec 2.7.1.74: Deoxycytidine kinase.
pdb deposition date 2003-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01712 dNK Deoxynucleoside kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p61B00
2XOKA 4O2LA 1KI1A 4AG5A 2VTKA 4GNKA 4PQRA 2P6RA 1IM2A 1YU9A 3TW4A 3GLHB 2GEDA 3JVVA 3HDTA 3ADBA 1NN5A 2AR7A 4PFSA 2PH1A 2RB4A 3PFIA 2XTZA 1CR1A 1TADA 4KI0A 4YONB 2WWXA 4BRWA 5B58C 2G0TA 3L82B 1QG4A 3IO5A 1UM8A 2OLKA 3ZZUA 4Q01A 2OO7A 1ZM9A 1Z28A 3WMGA 1T0HB 2E87A 2FV8A 1G7SA 3KJEA 3T1OA 2ORWA 3DM9B 4DLTA 4UJ5A 3W6NA 1VG9B 5J4KA 2ORVA 1N6IA 1NMZA 2ZREA 3IPYA 4FCWA 1R8SA 2JDID 1NN3A 3GJ0A 2QE7D 3LXXA 4JVNA 1AN0A 1RKBA 1KSHA 2AHOA 1AJEA 5FFMA 4X8HA 1RZ3A 4LYHA 4LOAA 1U98A 5K8TA 1JALA 1KSFX 1KMQA 1OV4A 4LBZA 3RSOA 1S3GA 4DKXA 3RWOA 1XCMA 1CJKC 2AK3A 5TV2A 3KQNA 2CDNA 2CLSA 2FOLA 2C96A 3K70B 4IOJA 2RHMA 1U94A 3CNNA 4HAVA 4XSHA 3ND9A 1AS2A 1DOAA 3K0CA 5BN5A 2FSHA 2BVNA 2OZEA 1OF1A 1QHNA 4PSKA 1SHZA 1E2HA 1H8ED 2NIPA 2QMOA 2CL7X 2F1HA 2NO7A 4A6XA 4EUNA 1KI9A 1YVDA 3BB4A 3JVUA 3KJHA 5EP1A 3FHOA 1FP6A 1XF9A 1DEKA 4M1TA 2QT1A 2AN9A 2J7KA 4QL3A 3TBKA 5CK4A 3WP1B 1T6NA 3FMOB 5SZHB 1NVXQ 2A78A 2HV8A 4Q48A 4PAQA 5F3WB 3X2SA 2WIBA 4A8JA 3O8RA 1SVIA 1IONA 1MV5A 3DZ8A 2PBRA 3GLFE 3CRW1 1YKSA 4A8JC 2CHQA 4GT1A 1IY0A 5D3MA 3T35A 2ZS7A 4D82A 4M1YA 4HDCA 3NXSA 2OLJA 3U44B 2PT7A 3QF4B 1AQYA 4FW9A 4DDUA 3B1YA 1N6OA 3DOEA 3KKMA 2DWPA 4KHZA 5B2ZA 1G7TA 2ZE8A 1R10A 5TVKA 3UATA 1I2DA 3ZVRA 1P5ZB 1YZQA 3R8CA 4QJ3A 5JS7A 3PV0A 4D4KA 4QKQA 2FGKA 1DO0A 5E7JA 5B30A 3WNDA 1RPZA 3WYFA 4IKEA 1Q1ZA 4ZDKA 1GNRA 1N5JA 4B71A 3I62A 1N5KA 4IOLA 3LWNA 3C5CA 4XH9B 5FTLA 3EC1A 1PLLA 3EZ2A 4NYJR 2RKOA 4ASUA 2R6DA 3PXGA 4Q03A 1RYHA 1KO8A 3A36A 1WA5A 3ADCA 2W6JA 3EARA 1ZUHA 3W90A 2G83A 1E79D 4IRUB 2V7QA 4PPGA 2R8RA 3UKDA 3CZPA 2HCJB 1MO4A 1JECA 1DAHA 4QM6A 2O8FA 1OLOA 2KB0A 1XXHE 4BGDA 3GJ7A 4NL4H 2W58A 3DKVA 3IEVA 3C16C 4M9QA 4LZZA 2IWHA 3D3QA 3ZDQA 1E99A 4LJAA 2W2TA 3RABA 2WWFA 1E96A 2O8BA 4OHXA 4XJXA 2ZM5A 2WZQA 1QHGA 3LLMA 3SOPA 2XJ9A 3CLVA 1XTRA 4HAXA 3HP1A 3HU2A 4DB2A 4XSGA 3QNUA 1XP8A 5D3QA 3ZVMA 4LBVA 4OHVA 1JR3D 2JIZD 2AWNA 3EZ6A 4M1OA 2ZU0C 5FPSA 3DO6A 2J3EA 2BMDA 3QKSB 2VL7A 2A30A 1SULA 3EZ9A 1KHTA 4Z54A 1JR3A 1ZCAA 2C78A 4DT1A 1R0ZA 3AB3A 5JEEA 2OAP1 1L4UA 4OK3A 5KPDA 5FBWB 3GLHA 1XMSA 5L3VA 4QHTA 4GOXA 4TMWA 2HUPA 3U3JA 4DVGA 5HR5A 1M1YE 3MWKA 4PQYA 4C3ZA 3TR0A 1NG1A 4I99A 2CNWD 3VNVA 2ZQ5A 4AKEA 4M2LA 1AA9A 4Q1AA 5DISB 621PA 1NBMD 2ZSBA 1IJFA 3RS0A 3FFBA 3HR7A 3X1YA 3TJZA 3D7MA 4CT5A 4PHFA 5LB4A 1IXZA 2GF9A 1E2KA 3RS4A 1JAIA 4EQ6A 2J0QA 1ZYUA 4MITA 3U3KA 1EFRD 2ZUBA 2P3SA 2H18A 1OFTA 4RD6A 2UVQA 4PZZA 2GVZC 1B0UA 1RE0A 4DSOA 4Q21A 4HAUA 4URYR 5CB6A 2O8CB 4H9GA 4JKYA 3AVUA 1XZPA 1HV8A 3PJRA 2G0NA 2J87A 5UKDA 1ZIOA 2JGNA 2QY9A 3HU1A 4OI4A 1WE2A 4EQ6B 1XMJA 4CEHA 2ZITA 4JLJA 4MRRA 4LJ6A 1G20E 3W3AA 3I73A 2EVWX 1ZW6A 1YRBA 4PO8A 4XTCS 3ZZTA 2F7SA 2JEOA 1KI2A 3PUZA 1YZGA 1QHHA 1FFHA 1COWD 3GMTA 3LW8A 3EPLA 4PC3A 4CEJA 4GL2A 2IUSA 4RKFA 2YWFA 1J70A 3MGCA 4TLAA 4NE2A 4QJ5A 5AJYA 4JLBA 2FPMA 4W5WA 5TMPA 3SS8A 2DBYA 2HYIC 1Z5ZA 3IEUA 3TAUA 3RVBA 5FTMA 3LXRA 4URZR 2G3YA 3SJCA 2IYTA 1GRQA 1XTQA 5AUPB 4WZAE 4KVAA 3TIFA 1KY2A 2CCKA 2WOJA 1JQLB 3EW9A 4FWTA 1HA3A 1VG0B 2GETA 1II9A 3VR1A 1U0LA 1EXMA 5FUVA 4E22A 1DO2A 3ZD6A 5FPTA 1G291 2BMJA 4MGKR 4X8MA 1IXSB 1NKSA 1DTSA 1PUJA 4QOSA 4TYWA 3VNUA 4TMTA 4CF7A 3K0FA 4OKSA 4FMCB 5GJWC 5DLQC 4UKDA 4AYWA 1MABA 3K0EA 1P3JA 2MSDB 4MYUA 3THWA 2LKCA 2J0SA 4Y0AA 1GRNA 4B47A 1GKUB 3IILA 4AY2A 1ELOA 4X8OA 4EPYA 4K81B 5KYKA 5CDFA 1K8RA 1RJ9B 2ODWA 2BJWA 4Z1MD 4OL0A 2H17A 2L0XA 3FVQA 1ZBDA 1D9XA 2ODNA 3LD9A 5C4MA 2GDJA 1P73A 2JLQA 3QVVA 1KJWA 4Q1DA 2W2VA 5A5GA 3THYA 1PV4A 1AIPA 4IDQA 2MMCA 3BXZA 2BC9A 4KV9A 3WHKA 3QSYA 2OCAA 4RVCA 4ZDWA 4C0BA 1WBBA 3QKUA 3HPQA 1JPNA 1T5LA 1N6NA 5ELXA 2FG5A 1E32A 5J4YA 2CJWB 2W83A 3W5JA 1S1MA 1A7JA 1TQ2A 4B3GA 4BPBA 1XD9A 2WTUA 3B1ZA 1JJ7A 4MUBA 1KNXA 4X8LA 1DAMA 1TNDA 4F92B 4Q9HA 4C2UA 1E2JA 5FL7D 1B23P 2H5EA 2OV2A 4HUTA 2XNDD 3AF2A 4IJMA 3A6PC 3VHLB 3LH5A 1ZC4A 4NU0A 4GZMA 5C1BA 2A5GA 2EFCB 1AGRA 2ONJA 4JJZA 4ZI3A 2D4HA 3VX3A 3ZS9A 2YHSA 2QORA 3LV8A 3B60A 4RFVA 4JYBA 3TGPA 3OFNA 2JCSA 1X8KA 3FMFA 4DLRA 4LWZA 1W2HA 2OM2A 1T8TA 3B6EA 2ECKA 3AF3A 3WXMA 5JFGA 3CH4B 1CF4A 5J47A 1TQDA 5FI0B 1VMAA 4V02A 2ZYTX 4XIGS 1N6HA 1OH8A 1GOTA 3VR4A 3QXSA 1KI8A 3T12A 3V00A 4LGMA 4Q4LA 1VYTA 4RZ3A 4UNPA 2R65A 4BFUA 3BH6A 4HLDA 4URVR 2OXCA 1YZTA 5K8UA 4NTZA 4BFYA 3B82A 1Z0FA 3GJXC 2BWJA 3OZXA 3PR1A 3IQWA 3PEYA 3B7GA 5FPHA 3D8BA 2FEOA 1N5IA 2OSBA 3TSOA 1KTVA 4UXJA 3MJHA 4BFSA 2C99A 2ZI9A 4JS0A 4N3NA 5EXSA 2OEPA 4EJSC 2YWHA 2G6BA 2JLUA 4ZDJA 5FTKA 3BC1A 3VR5A 3WBJA 2OG2A 4P0TA 3QVUA 1M2OB 4WZ6A 1S3SA 4B6FA 2CBZA 5KSYA 4EPRA 5L3RA 2WMNB 2IK8A 1T91A 1E2IA 2D3WA 2VA8A 4HB3A 4QG7A 4V0LA 1TF2A 3MFYA 3W34A 2OBMA 2EWVA 1GSIA 1NLFA 5CK5A 3ZGXA 1OW3B 2QSYA 4QBHA 1Q3TA 5EE1A 3MWLA 3CRVA 4Z8YA 4AD8A 4AKGA 2GZHA 5KSPA 1DAIA 2WWWA 5DN6D 1RC8A 3TAHA 4DJTA 1LV7A 1Z0JA 3FFAA 3LNCA 1RRCA 3K70C 3MG9A 3E1SA 4QXAA 2ZJ2A 2WJGA 3NC0C 1D5CA 4HB4A 3A4NA 1E4YA 2LCFA 2GTPA 4NMMA 1R4AA 1UJ2A 1N25A 4PANA 2XJ4A 2XGJA 2R9VA 3CX7A 3C4JA 4LJ5A 3B13B 4CIDA 2OCYC 2DCUA 4RY2A 3RS2A 4FINA 4GMXA 4DT1B 4XVRA 4DLWA 3VR6A 2QTVB 2FH5B 3ZQ6A 2QBYB 2OBLA 1JEEA 4AWXA 3SHFA 2ZE6A 3B9QA 2O0JA 4WXRA 4B76A 4LPSA 4PSVA 3HJNA 4OI2A 3QI2A 3GLGA 3PUYA 4KO8A 3IHWA 4BLPA 3R9XA 1TAGA 2SHKA 1UKZA 2IT1A 2FSFA 3NH6A 2JASA 3BERA 3HYRA 1W0KD 2FFBA 2VPPA 1S9DA 2W6IA 4R7ZA 3U7EB 4DBLC 1VCNA 2W2XA 1RRGA 4G5GA 5FL3A 4BEJA 2XZLA 1OFUX 1JXOA 1HT2E 4M4SA 4PO9A 1KMHA 1Z0DA 4ZCIA 1JBKA 3QUSA 4C0HA 2ZAMA 3FDIA 5CIQA 3P32A 1KK2A 3QE0A 4MYHA 3LVQE 5CJPA 2PMKA 5IF9A 3Q5DA 4LJ7A 4D25A 3GFPA 2YKGA 3K8YA 3PCRB 3WBKA 2VP2A 3QXJA 2OFWA 2PZGA 5G3ZA 5JEDA 1Z22A 2P6UA 3LBHA 3QENA 2LKDA 4RD4A 1Q1QA 4Q9LA 2ASEA 3SFVA 2J59A 421PA 2VRWA 1W46A 1P75A 4P32A 4YMSA 3THYB 1D8TA 2IS6A 4EPVA 3PEWA 3PQCA 2QGZA 4G0NA 4KFRA 2PX0A 3SI7A 4DLSA 5L3QB 1R5NA 2FF7A 4V0MA 2DHRA 1BIFA 1UDXA 3AP3A 2IA5A 4LYAA 4KLZA 4KODA 2IYQA 1UPTA 3EIQA 1Q3HA 3EZ7A 3QG5A 3MWYW 4W9MC 3W9YA 2WBLC 4GPTA 2RGNC 2B8WA 3CBQA 4BZQA 4OJKA 4ERNA 3VU9A 4A1FA 1FTSA 4IVRA 3W8RA 3HR8A 1TQ6A 4LCBA 4RCZA 5G53C 3ZIAD 4F93B 2IX3A 5EP4A 1TTTA 2I1VB 1S4QA 1X86B 4CGZA 3L2OB 1W5SA 4LJYA 4B48A 1NKTA 1ZD8A 1NI3A 4LBWA 3AVWA 1OXTA 2OBNA 1XEXA 2R6CA 3KUDA 1L7VC 5FH9A 2VYFA 1IN5A 221PA 3L8YA 1XEWY 3U3OA 2HF9A 3MRSA 3CONA 1T8UA 4PHHA 3OE7D 5F9FA 1XXHB 3SYLA 1W0JD 2I1QA 1VCMA 3QXHA 3T5GA 4FCTA 2F1RA 1W0KA 3GJ4A 3AVYA 2NG1A 3CWZA 2BM1A 5ANRB 2O8EB 3NHAA 1FUKA 2IEZA 4PPFA 1V43A 1XDBA 4IW3B 4DLXA 5DIFA 3T1TA 1EFTA 3DHWC 3ONWA 2ZRFA 1EESA 2WIAA 4LV8B 3SZRA 3RS3A 1GNQA 4N0DA 3EPJA 2WJYA 3KXIA 5EP2A 3K09A 3P4XA 4AURA 2Z6VA 2A3RA 4LPKA 1DBSA 5LDDC 3VR2A 3EWAA 3UG6A 1IBRA 2WKRA 2J1LA 2EFHB 3QKRA 2WWYA 3OEHA 2ZXUA 3KQHA 3K09C 2D7CA 2FFHA 2IL1A 1SVSA 2J0UA 1XZQA 5GVRA 4EPTA 1SZPA 3AP1A 4JLDA 1T3LA 4US1R 5FOTA 1U8YA 2V3CC 2FMXA 3SU8A 5JMTA 2C77A 4MQBA 4KJZA 2CJWA 1I4LD 1FZQA 1CR0A 1NN0A 1CJMA 2DFNA 4HLUA 4JIMA 1XCPA 4FMBB 4G5SA 1Z07A 3ZS8A 1IN8A 5HZKA 1E9DA 1UFQA 1YZKA 2OHFA 1Z2AA 3QKRB 2QROA 1KO1A 1IOZA 2H1LA 2EWWA 3E70C 4ACBA 2ODEA 4YMUA 1CXZA 1XD2B 4URUR 3U7HB 4TT3A 5A0FA 1TU4A 3AF1A 2VP9A 5BWMA 1KJYA 1LW7A 1WMSA 1VYVA 3C8UA 2FE4A 3B78A 1GVNB 4Q66C 3ZJYA 2ORIA 2CHVA 4O25A 1EFCA 4BFXA 5F98A 4G3XA 4NONA 5DH9A 3BORA 4XWKA 3GEEA 4MRSA 3H2YA 3X1WA 1Z6XA 3TUJC 2BBWA 4BLOA 1K5DA 1WDTA 2NOAA 3B2EA 5LB2A 3W6OA 2JJ8A 1OB5A 1XCGB 2FGJA 4GOJA 1NY5A 1UEIA 1E0KA 4Y0VA 2FU5C 4CT4B 1TU3A 4NKRA 5LBIA 2BEJA 4XVUA 3I3SR 2RHDA 4TN1A 3QF4A 4D4JA 1TPZA 4UXHA 2GJ9A 1W1WA 3CF6R 1IJEA 3WRXC 2ZRIA 2IYRA 2XEXA 6Q21A 3G0HA 3MUFA 2ZRBA 2F3TA 1U0JA 1JAHA 3DEFA 3NBXX 2ZS9A 4L8GA 3VKHA 3EWSA 1L4YA 4LHYA 2F43B 3RNLA 3U7FB 1UBEA 1SXJB 2F6RA 4V0KA 4TTQA 3AF4A 5DNYB 3WP0A 4TYNA 4LX0A 1G64A 1KZGB 1R0YA 3BE4A 2J5XA 3PEUA 3PG5A 2VSXA 2PCJA 2ZRAA 1NN1A 2NZJA 1H8EA 1COWA 1TEXA 4PPQA 2FX3A 4ZIRA 1FNNA 1UKEA 3C7KA 2GNOA 2IYUA 4DUGA 3RRMA 3UMFA 5M04A 1LFDB 2WV9A 4B44A 4OJQA 4MA4A 2O52A 1QRAA 5L3QA 3OHMA 4ITRC 4L15A 4DIDA 2RGBA 3FWYA 2J45A 3M0EA 2ZYVX 3UPUA 2ZI7A 2WWGA 4L16A 1QDEA 4DC9A 5CJ2A 5AK0A 4C0LA 2KBEA 2NPFA 5KU1A 2J0UB 5DHAA 2CK3D 3MJRA 2CE2X 4HUQA 4TLCA 4ACAA 4NHOA 1FPMA 3A1UA 4MH0R 4GFDA 5DGXA 4LHZA 3VTKA 4MKHA 3THWB 2ZI3A 1VCOA 3PITA 1XFAA 1H8HD 2N46A 4P31A 1SKQA 1U9IA 2H57A 4TMVA 1U81A 4I81A 4MGYR 1XEFA 1E2GA 2VSOA 3T34A 3FB4A 4LHWA 1QVRA 1DG3A 4Q4JB 4U5XA 4B3CA 3WYGA 5JSZA 2OCPA 2B8TA 4DEXA 1XPUA 1KO7A 4YDSA 1E4VA 2KE5A 3F8TA 5E7MA 3B1WA 2V55B 1G8YA 1F60A 5CM9C 3SE0A 3U4QA 3RAPR 1SVOA 4OQNA 4GP7A 4E09A 3LO5A 4IOKA 3UWOA 1E1RD 5GVSA 3ZIAA 3EA5A 3QBTA 1QHSA 2QA5A 1DAFA 3LBIA 3I1FA 5FL7A 2G9NA 1Y3AA 3CIOA 4LYFA 1RRFA 4F91B 3IIMA 3CX6A 5DI3B 1GUAA 1JR3E 1G3IA 1E9CA 1LB1B 1M7HA 2KI5A 3DMNA 1SXJE 3KXLA 2OE2A 4NPHA 2DYKA 3BFXA 2GBLC 3U2QA 3FKSA 5FPKA 3K9GA 1XMIA 4C9BA 4HZUB 2HLDA 2BCGY 4NH0A 2K5UA 2XX3A 3RSLA 4LC1A 1JR6A 2NMVA 1U8ZA 2A9KA 3CUEF 2GCOB 2GBLA 2OFXA 3TSWA 4US0R 3I5YA 4MYCA 2PLRA 4GP6A 1PLKA 1KNQA 5L3SB 4Q4AA 3K0CC 5EE5B 2CLDX 4M9SA 2F1IA 4KLNA 3DOFA 1N6KA 2YC4C 3RHFA 1GDDA 1VPLA 1MR3F 5J40A 3WMEA 1VHTA 3PUVA 1P2SA 1FQKA 1NF3A 2WJHA 4Z1MA 3U6BA 5HTKA 3ZH9B 2JATA 1KSGA 2DPXA 1TX4B 5J5CA 3X1DA 4D2IA 1AKEA 5DE3A 4WAUA 3UIEA 5EJEA 1OH6A 1Z2CA 2YVUA 2Q3HA 2R62A 2NTYC 3Q85A 1G3MA 1VECA 1XJQA 1ZINA 1A2KC 4AIIA 2HJGA 2D06A 1ZRHA 2ZRCA 3PIRA 4D4LA 4WBSA 1KO4A 2XNSA 5HCNA 3VMFA 1E9AA 1EX6A 2GHIA 3GD7A 4JL5A 2EFDB 1US8B 3A4LA 3NDBB 3GLIA 4CDGA 3R9IA 4BLRA 2WKPA 1S2MA 4BRUA 1P60A 5IK2A 2QZ4A 4KFSA 2F9LA 2X77A 4L9SA 1PZNA 2ZJ5A 1KMHB 3L43A 3WYAA 2IYZA 4DDVA 4YXWA 3V4RA 5JWRA 2E9SA 3NDPA 3FPAA 1VKJA 4WOPA 3R8FA 3RS5A 5CLQA 1G4UR 1G5PA 3EA0A 5HKKD 1C4OA 3DZDA 3K9HA 4WVFA 3W6PA 3SR0A 1D2MA 3GQBA 5E4FA 3KQUA 3RRZA 4JKIA 2Q9BA 1G9XA 1Z06A 1GRRA 2QG6A 3AGPA 5JLJA 3IPXA 1KIMA 1OYYA 3TK1A 4CW7A 2CL6X 1R0WA 1G19A 1SVWA 2GJ8A 1GP2A 4BUJA 5JCPA 5LD2C 1W36B 2DB3A 3VHXA 2AFHE 4A15A 5KUTA 4QGGA 5IDVA 5JWHA 1PVOA 4JT4A 1XD8A 3IIJA 2QBYA 1FQJA 5FUXA 1CLUA 2FNAA 2AXNA 1DARA 1M34E 4OK6A 2BV3A 5JRZA 5C46F 2Q0HA 2IYLD 5AUNB 1J90A 2QSZA 2MSEB 4FI3C 4G5RA 1RRPA 5EE9A 1QHHB 2XB2A 4TSFD 4AKIA 5B57C 3KKOA 2GVDC 4NBSA 1XBTA 1QBKC 1YR7A 2JLYA 2IF2A 2V1XA 4EFLA 3U5ZB 5H8WA 2WSMA 2DR3A 3RYTC 4D0LB 3LFUA 3WHLA 3LQRA 2ZE7A 1E79A 2B92A 4HZUA 5AUOB 4B3BA 2CHGA 3QIAA 4JLNA 2IC5A 4Q47A 4OI1A 2A5FA 3PVSA 1BYIA 5DHFA 1XB2A 821PA 1HQYE 4C4PA 2F1JA 2WAYA 3SEAA 3P26A 1EFRA 4RFSA 1G6HA 1W44A 4MRNA 4V0NA 4A0RA 4IFEA 1XNJA 4Z51A 1FX0A 4I1VA 5FOUA 2Y8EA 1YZUA 3IHLA 2GEUA 1LS1A 2ZR9A 1XX6A 1E9EA 2Z5FA 3JZAA 1F3OA 1GL6A 1XXHA 4KVGA 5HE9A 1E0SA 1P9NA 4I1UA 1SKYB 1W0JA 2XSZD 4GRAA 1FNMA 1H65A 4ZKEA 4NCKA 1V5WA 5C4GB 1XWIA 2XXAB 3U6KA 1N6PA 2X1VA 5IRCD 3U4QB 1IY2A 3Q9LA 3S1AB 2QAJA 4Q7JB 4QGFA 1Q57A 2ZSDA 2OCBA 3BWDD 3B85A 2JIZA 1ZAKA 3IUYA 2BKUA 2OAQ1 3LVRE 1H8HA 4RZXA 4ZI2A 3AVPA 3AF0A 3FGNA 5IK2D 1NIJA 4BLTA 3NWJA 3RRYA 3O47A 3RANA 4A8JB 3FHTA 2FSIA 4IDPA 4QRHA 1W5TA 1N3BA 4IDNA 5JI3E 2NO0A 4KFTA 2ATVA 4F7WA 4TMXA 1QHYA 3V9PA 3K0AA 3WMFA 1NG9A 5K8IA 1GKYA 4UNNA 1G16A 2ZANA 2YV5A 1N5LA 3BIFA 4BEBA 4TL7A 2WICA 2NQ2C 2CK3A 3UG7A 4DZZA 2C5LA 5GADl 3OAAA 1X8JA 2ZJYA 3SYNA 4JBYA 1XRJA 1OSNA 2VHCA 4KFUA 1FMLA 2G1JA 3CWQA 5CLLA 4A2PA 3EX7C 2ZPTX 2IBMA 5GJVC 3LLUA 1WCV1 1Q0UA 1LNZA 2VLIA 1NLYA 1K6MA 4KXFB 4B3DA 2C9OA 4RZUA 3MMPA 2OUKA 1GZSA 2AD5A 3D6TB 4XTRA 5EXXA 5FPYA 721PA 4RD2A 2UKDA 2ZIAA 4EPWA 1CJUC 4PQFA 1K5GA 5F2EA 4TZ6A 2EW1A 2CVHA 2IUUA 5FBLB 1Z6AA 4C30A 1G17A 2BIFA 5E7IA 2REXB 4FIDA 3SC3A 4PZYA 3U61B 2RGAA 4R71A 3RS7A 1Q12A 4PZLA 4OK5A 5KNCA 1R6BX 1KDOA 2QPTA 2EFGA 4BFTA 1Q44A 1G18A 4Q9JA 3SJBA 4DDWA 5CYPA 4TQAA 1XTSA 1EGAA 4PC1A 2XB4A 1QVAA 1FL9A 1KDPA 2QL6A 2AKYA 5JJIA 4DLYA 1UDWA 1W2GA 4B74A 2NGRA 1OXUA 3OE7A 3ZQJA 4D80A 2QRZA 2C03A 3NKVA 5JJKA 1E1QA 1VIAA 5C2JB 1CS4C 3B8HA 3H84A 2ZI6A 3QBVA 4TTRA 3GJ8A 1KDTA 2YNMA 3DL0A 1Q22A 5IT5A 1SHKA 2W6ID 2XZOA 1U2RA 5AJXA 2GZDA 2ONKA 4Q02A 5EZ6B 3ZLJA 2VP5A 2REBA 1NVVR 1JNYA 1Q1EA 2BDTA 2NO6A 4IDHA 2GZAA 2QMEA 1CIPA 3IBYA 3T1QA 4PSAA 3OIVA 2MMGA 5KNDA 1BKDR 2VQSA 4Q00A 1XD2A 4ZV4A 5BN3A 1J7KA 3TUIC 3TVDA 2QMHA 3MAAC 2ZJ8A 4RD3A 2GWHA 2GRJA 2BBOA 1G7RA 2FSGA 1G3QA 2GXUA 2QAGC 2XTNA 3CNLA 1CRPA 2OT3B 4P33A 2Q3MA 4B2IA 2VSFA 3GFOA 4CEJB 2IUTA 4HSEA 1OFHA 1YE8A 4DDTA 4LHVA 5JI2E 1ODFA 3PUXA 1WRBA 2AXPA 4HLUC 4IDOA 1FW6A 4KCGA 1N0VC 4NYJQ 1HURA 4JLMA 4TYPA 5BYJA 4R2HA 3ECCA 1EX7A 2DY1A 3OEED 4IXNA 5KDLA 4B2LA 5KDDA 2YJTD 2P6NA 3AUYA 2JLWA 1EWQA 1G1MA 4RZ2A 4B73A 4HAYA 2QI9C 2ZAOA 2QPOA 1R2QA 4S35A 4LV5B 1VTKA 4UJ3A 1GILA 1P2UA 1Z0KA 2NO1A 2QU8A 4R2IA 2WWHA 2GESA 5CIWA 5AJWA 1T5IA 3DPUA 2ZJBA 3AVOA 3O8BA 4YMWA 1G4AE 1E9FA 3EPKA 3BK7A 2XTMA 2PEYA 1E2LA 1F48A 2FDCA 1A5TA 3T5DA 3GEIA 4XWAA 2AD1A 1S0UA 2HCBA 4BLSA 4ZKDA 2JDIA 4FXPA 4JVSB 2F43A 2G88A 1P4SA 2HJVA 1BS1A 4TQ9A 1NSFA 1HYQA 2GILA 2YINC 2EFEB 2QMUA 4F38A 1ESMA 3LQQA 2O5VA 1HEIA 1ZM2A 1PLJA 3HYTA 5E3HA 1RVDA 3TMKA 4OHYA 3BFVA 1G3UA 1BH2A 1MABB 3KKNA 1SVKA 4RSGA 4A0HA 5BXQC 5FOXA 3ADKA 2P65A 4M9ZA 2BBTA 3RLFA 1W4BA 5DO9A 1KDRA 2G1KA 2GJAA 2ZUDA 1RFLA 4H1VA 4XD7D 1T4GA 4ZCMA 2BMFA 1II8B 2XOKD 2ZVQX 3J81k 3S1AA 2C9CA 1G3RA 3NBZC 1QZXA 3BS4A 3TQCA 4DWJA 4AKHA 3K53A 1YHNA 1C9KA 3OFND 2BJVA 4XD7A 1NIPA 1HE1C 3L0IB 1GG2A 3BAFA 4KU4A 1Z63A 3LY5A 2QRNA 4PAMA 4KBFA 4JLPA 1GAJA 2NPIA 1ZM4A 4JMPA 4EAQA 1VG8A 3EIHA 2ZJAA 3GLHE 3EAQA 3R7WA 2R44A 2YOHA 1ZNXA 3F5FA 121PA 1JQJC 2ZETA 4DEYA 3GLIB 1F2TB 3TR5A 4DCUA 4BZPA 4V0ME 3W8NA 5FR2A 2D74A 3A1WA 1P2VA 4I4LA 4TLEA 4E5UA 2XNDA 2F55A 3OF5A 1KAGA 4DHEA 1OH7A 4ZDIA 2Q9AA 2O8FB 4ZO4A 3LW7A 2ZEJA 3P27A 3KTAA 3M4YA 1PUIA 2YOGA 1KK1A 1M7BA 2RGXA 5DN6A 1IXRC 3EZFA 2GK6A 2ZJOA 4Q4HA 5B64A 1KAOA 1O87A 2ZR7A 3BB3A 3OIYA 3A1VA 2RGEA 2UZ3A 4Q1CA 1ETUA 1ZNWA 4CRWB 2BHRA 1KI7A 2Z43A 3WRYC 4D81A 2RGDA 4KAXA 4DSTA 2VHJA 1TUEA 2VH5R 5SZJA 2FJUA 2WJVA 1CJVC 3M6AA 1XPOA 2Q21A 5FOWA 4CYMA 1VHLA 3O8CA 3GEHA 1RJ9A 4IEEA 4URXR 5KNBA 3REGA 5LPNA 1U0HC 1CP2A 1LF0A 4W5HA 5KTYA 1JB1A 4QM7A 2OFOA 1EG7A 2JJ1D 2CL0X 2O0KA 2YYZA 1DVRA 1MRSA 2KWIA 2W00A 4ASUD 4C7OA 1DPFA 5GJBA 1NRJB 5EUMA 1UF9A 2HF8A 5DI9A 4TSFA 2WOOA 3RRNA 2JLSA 1YJ5A 3BH0A 3N2IA 1DAEA 2IWRA 2VHTA 1HTWA 2REOA 2R2AA 2D62A 1OIXA 3E2IA 4Q1BA 3O8DA 2G77B 2B6HA 2FZ4A 3GLIE 2XXAA 3AUXA 4G1UC 2RAPA 1XEWX 4M1WA 2IS4A 4A0GA 1ZP6A 4DSNA 2O8DA 2V8OA 2QT0A 2ZYWX 4IVPA 2GXQA 4OQFA 2I3BA 3SQWA 3CO5A 4M1KA 2JLZA 4EKDA 1E0JA 3A4MA 5JZVA 3AVTA 4YXWD 1QHXA 4P3YA 3BH7A 3THXB 4P4SB 3KXKA 4LI0A 1KOFA 2JA1A 4JJKA 2PJRA 1F5NA 2XAUA 3QXCA 5EE0A 1G5RA 1J99A 1TL7C 2GF0A 5KSZA 3QKTA 3FTQA 1Z6TA 2AX4A 1W4AA 2AL7A 1U8AA 2IHBA 3SN6A 1Z29A 3CF2A 2ODBA 4HDQB 4LHXA 2QP9X 2HT6A 1YR8A 2WVJA 3ETLA 4KSBA 3TNFA 4MGZR 2WKQA 3ASYA 2WJIA 2CCJA 3C14C 3H86A 4BWYA 2FZLA 4HLCA 4EDHA 1GKIA 5EXTA 3AVVA 4ESHA 1DELA 4MKIA 3BBPA 2C95A 1P2TA 3EG5A 4POAA 4G5OA 2RGCA 2QE7A 2UZIR 2RGNA 4QC2A 3HPRA 2ZS8A 3UWKA 1ZU4A 3NVAA 1CEEA 2JJ2A 3VQTA 2QM8A 4R98A 1E6CA 2DWOA 1YZLA 2B7CA 1UBGA 4R9UC 1XU4A 4TL6A 5AR1A 3RC8A 3F3YA 4PPNA 1DG1G 1WXQA 3AKDA 2FPKA 1G6OA 2X2EA 2HT1A 3AVXA 2EYUA 2O8EA 1J8YF 5EP3A 4JT2A 1KI6B 4Q18A 3R9WA 2R6AA 4PX9A 2PX3A 1IQPA 1G7CA 2IS1A 1AK2A 3LAWA 2YWEA 1FUUA 2OILA 2IYXA 2VP0A 2F3RA 4M1MA 3SBEA 4DXAA 8OHMA 4URWR 4PO1A 1CR2A 3SNHA 3PEVA 4O2RA 3CZQA 5GJCA 2OXRA 3QEOA 2PZFA 4DLVA 4QGAA 4Q4JA 1E9SA 4OQXA 2DFTA 2JAQA 2FA9A 4M21A 2QPAA 2ZRLA 2QN6A 2YC2C 1WBDA 2C98A 2X19A 3AM1A 4NDZA 1KSJA 2ZRJA 1GNPA 3N5CA 4DCTA 4DIEA 4DLUA 5TDHA 3AV0B 3CB4A 5JHHB 1OH5A 2VBCA 1O3YA 4TTPA 3SQXA 3WNCA 2JJ1A 2HDNB 3B1XA 3CH5A 1NP6A 2JLVA 4OQLA 3SJZA 4Z8XA 3FMIA 1KI4A 2WWIA 1Z6YA 1RW4A 5JJLA 1NSTA 2O8DB 4L4UA 3MD0A 2VF8A 1M8PA 4I1OA 4WXPA 1YZNA 4C0QC 4QBGB 1KK0A 4JLOA 1Q20A 2XSZA 5BW8A 1J2JA 1OJLA 2J7PA 1CKEA 5TB5A 2HXSA 1OKKA 2VIIA 4ZIRB 1NJGA 3KB1A 4HYYA 5L3SA 1OXSC 4HZIA 4OQMA 1R5BA 5FOSA 4CEIA 3T1VA 2AWOA 1AZTA 1VCIA 1NJFA 2H92A 3GJ3A 1HE8B 1KKLA 2GA8A 3FE2A 2FN4A 4Q7MB 1ZCBA 2QTHA 3OEEA 2XITA 4A9AA 3E5HA 1SVLA 1HUQA 2D2EA 3T15A 3FYHA 5BN4A 5H68A 1E98A 2RGGA 2NO9A 2B7BA 4PTLA 5EQTA 2ZSFA 4QBFA 4G5QA 4P4TA 2J7PD 1CR4A 2O0HA 4HI0E 4UXIA 3F0TA 3MSXA 3GLFB 2PJZA 4GMDA 4TL9A 3KKPA 5SZIA 3H1TA 2Z4RA 3NBYC 3QY0A 2Z4SA 3AVQA 1N6LA 1LTQA 1MT0A 1OXVA 2A5DA 2J41A 3LX5A 2GXSA 2EQBA 1N0UA 3BJIC 2XZPA 3QXXA 2PT5A 1TQ4A 3NIBA 4C0KA 1E2DA 5JSZB 4S2EA 5HCIA 2ZVPX 1P9WA 2JLRA 3D31A 4FN5A 5TY0A 5FOVA 1G8GA 1XTIA 1F2UA 1N6RA 1Z0IA 5D3MB 3TVTA 4EFNA 2ZRKA 1CTQA 4JL6A 1F2TA 3K9LA 4KBGA 5JRJA 4IVQA 2V4ZA 5KHOC 1CU1A 5AUQA 3GLGB 1GFIA 1I4TD 4AK9A 4LDJA 1XEXB 1E2PA 4B2PA 2KJQA 1NLZA 1ONBA 2QAGB 2C2HA 4NP6A 1LVGA 2A5YB 4LSGA 4B6EA 2VP4A 4LK2A 1SKYE 5AJZA 4D26A 4L9WA 3TLXA 4IFBA 3NEYA 2KBFA 1X3SA 4MGIR 2C8VA 4XVQA 4TWZA 2IXEA 2OESA 2ZRHA 2VHQA 3KTAB 4UNQA 3GFTA 5FBQB 3CX8A 1GWNA 1M7GA 2GCOA 3A1TA 4HEJA 1X6VA 4HUQB 1ZIPA 4Q4HB 4XOIA 2V9PA 5FTNA 3IO3A 4GSYA 1UBFA 4I1SA 1MOZA 1G5TA 3AH8A 1E0AA 2C9YA 3PENA 3LBNA 4NYMR 2DFLA 3I8XA 1MKYA 2QP4A 4BLQA 1W48A 2ZI4A 3OEHD 3CRQA 2N42A 4YC7A 2BEKA 1II0A 5KO2A 4JVLA 2VF7A 3TUZC 1ZJ6A 4TMKA 5A4JA 3K0FB 3K70D 3OAAD 2ERYA 3KQLA 1AZSC 2P67A 2F9MA 2W0SA 2QP3A 4GZLA 1W36C 3CF0A 4PC2A 5TARA 3TW8B 4Q5IA 1NBMA 1HH4A 3P20A 1KGDA 4LY6A 3B9PA 2J46A 4M1SA 3OIWA 4IHQA 2N1BA 4D4MA 2RH5A 4AC9A 1ZMXA 1U9IC 4KSCA 4FMDF 2CEAA 4B33A 3MLEA 3QKSA 4MKFA 3GPLA 2FWRA 2QQ0A 5HKKA 1E2EA 2BBSA 1WB9A 1D6JA 3ZZ0A 4EIWA 4ESVA 1S8FA 1XPRA 4AYTA 4HB2A 4LBYA 3VU9B 2HXYA 3V4FA 1L8QA 3U44A 5EXPA 5FBVB 2FFAA 1E3MA 2QUZA 4QJ4A 1JPJA 2BOVA 1OYWA 3GJ6A 4DCNA 3RC3A 1DAKA 2NZ8A 2QM7A 4FD2A 4EJSB 5JS8A 1OIWA 5K8LA 1BO6A 1C1YA 2BCJQ 4C7OB 4V0OA 3M1IA 2QGNA 3C15C 1G8HA 3IQXA 1NVVQ 4PXAA 3UMSA 1FTNA 4HB0A 3N70A 4Q7LA 4TT3D 4KITB 1DE0A 4JBWA 2P0EA 4PHTA 3TRFA 4B3FX 3Q8XB 2ATXA 3KUCA 4MRPA 2IXGA 4ARZB 2RCNA 1SXJC 2EYQA 2PMDA 4D0NA 2MSCB 4BE7B 4NCIA 5KPJA 1W7AA 1US8A 2GKSA 3H4MA 1KI3A 1SXJA 3B1VA 4M53A 3EC2A 3CNOA 1TMKA 3KL4A 4GBMA 1MRNA 3L0PA 4U7DA 1JI0A 1GIAA 4GDFA 4CEHB 3U3MA 4DUGD 521PA 2V7QD 5JECA 3IBGA 4A82A 3EPHA 3FKSD 4ABYA 2H8KA 3R7WB 1YR6A 1GTVA 4LJ8A 1ZUIA 3TKLA 4D0GA 1A82A 2AKAB 1UKVY 4E03A 1OKKD 2CVFA 5TXGA 3NH9A 4RKEA 2YOFA 3BRWD 2WPDA 1MO6A 4P4UA 3P1JA 1RIFA 2ZRDA 1CBUA 5JWOA 4JLVA 1ZU5A 2VHUA 3REFA 3P4YA 1R0XA 4JZKA 5LD2B 3QPVA 1P61B 1Y63A 3TSZA 4N1AA 3QF7A 1D2EA 4M8NE 3ZYCA 4RCYA 2WSSA 3KJGA 3A1SA 4PAOA 1W4RA 4KYIB 5FR1A 1UBCA 1I4DD 4NCJA 1GL7A 4RJLA 5J4HA 2J0VA 1XTKA 1CRQA 3SFZA 1R5OA 2ZSEA 3HWSA 3I72A 1YQTA 5E95A 3QEJA 4IOMA 5FBRB 4BECA 3CR7A 5FI1B 1MH1A 4TYYA 1KZ7B 3QG1A 3T61A 2PL3A 4A0FA 4EPXA 2V1UA 1MO5A 4K8OA 3UXMA 4PR0A 5EUQB 4C0SA 4RFSB 3I5XA 3K0SA 1FX0B 5HPYB 4C2TA 4QGHA 2GCPA 2ZU6A 4KYUA 4LYJA 3DVLA 3G82C 1Z47A 3CPHA 4BFWA 3DDCA 3HU3A 1UADA 4TLBA 2BM0A 3MCAA 1OE0A 4UNSA 3L0SA 3THOA 1N0WA 3KZ1E 4IXMA 2V6IA 3ZVLA 3IDQA 2O8CA 1E94E 1A4RA 2A2ZA 1HQCA 3TH5A 1KI6A 5CYOA 2JJ2D 4BASA 4HDOB 4PC6A 4FWIB 1X1SA 2R6GA 1ESNA 3AP2A 3C5HA 3FOZA 4HLQB 1W47A 4ARZA 5DSZA 3I92A 4W7SA 3KFVA 4K46A 1QF9A 1WF3A 3GP8A 3AEZA 3BD9A 2AFIE 1E69A 2YZ2A 3LX8A 1FMJA 1AM4D 1UAAA 5JHGB 5F9HA 4DCVA 1P9RA 2QENA 4DCSA 1G8FA 4JSYA 3WY9A 3ADDA 4DLZA 4TZ0A 1AGPA 1ZD1A 2FEMA 2ZUCA 3JZMA 1KYIA 1E2FA 2EU8A 2CCGA 1Q1BA 2AK2A 3IGFA 3K0AB 3QPUA 2GCNA 1NVWQ 5H1YA 4A2WA 1W4CA 4YQFA 1F2UB 1S96A 2ZRNA 3H0KA 3CRMA 3ICEA 2Z83A 2Q9CA 2WJJA 3CPEA 3FKQA 4TLDA 2V6JA 4OHZA 2IYSA 4LC0A 2X2FA 3FHCB 4CZ2A 4D6PA 3AQ4A 1KK3A 4BFVA 5L8VA 2QAGA 4Q1FA 1JXMA 5KSOA 1S1CA 3NBFA 4OHWA 4QNMA 1R8QA 4U00A 3CKLA 3QPWA 1E1QD 4QFMA 4DSUA 2PEZA 5HE8A 4ON9A 4YMTA 4OI0A 1P62B 4TMZA 3DMDA 4BZXA 3KKQA 4A6PA 1AS0A 1E2MA 2QNRA 1IY1A 4MKGA 1VYUA 2ZSAA 4J0QA 2QTFA 3SHWA 4CEIB 4Q9IA 3ICQB 4LJ4A 4NYMQ 1Z8FA 1EFHA 1QHIA 4MDEA 1E9BA 1Z6GA 2IYYA 3ZVNA 2GAOA 3L0OA 2BMEA 4B35A 1JJVA 1OT3A 3G5UA 1BOFA 2P5TB 2YWGA 3EASA 1IAQA 4DB4A 3GLGE 1SXJD 2WAXA 4WW0A 1NMYA 2IHYA 1T0JB 2HEIA 2PZEA 1D2NA 2IS2A 1N2CE 3NC1C 5KDOA 5SZKB 4AI6A 2Q3FA 1RYFA 1DS6A 2W6JD 3RWMB 4B32A 2ANCA 4UQOA 3LDAA 4JYCA 1OHHD 4QHYA 3NTUA 1W49A 2ANBA 3I32A 5EE3A 1CJTC 3UK6A 1ZM7A 4II7A 1AQUA 1E2QA 1G21E 1ZVQA 1Z83A 2WMOB 4ZPXA 1NVUQ 4RD1A 3UANA 4US2R 3U7GA 3ND8A 5FTJA 2HLDD 3SDZA 1GM5A 5CITA 2E1RA 2R6FA 1Z0AA 3A58B 2ZJZA 1IN4A 2B21A 4NYIQ 3A37A 4ZCLA 4Q19A 3GJ5A 5AWFC 1NL3A 2ZROA 4O3MA 3SJAA 1UEJA 1Q21A 5C18A 2ZE5A 1M6NA 1XJ0A 3AKCA 3I8SA 3KB2A 2ZRMA 2PCLA 2WM9B 5G3YA 4JLKA 1FOEB 1XMVA 1M74A 1SGWA 4EJSA 4NZYA 1II8A 2C04A 3K1JA 4QNRA 4CVNA 4UNRA 4JL8A 1E1RA 1ZUNB 1MO3A 1A2BA 1R7RA 3B5JA 3NEJA 5EZ5A 2A7QA 2Q6TA 2QEQA 1SQ5A 1IN7A 3X1ZA 1AKYA 5JCZA 4LRWA 4JVMA 2H16A 4C0JA 1W36D 3Q5EA 4TL8A 4M9XA 1ZD9A 2IW3A 2WHXA 1LF5A 2GXAA 1VDZA 4H1UA 4Q1EA 3TQFA 3KX2A 2GJKA 1KKMA 5J4LA 2D7DA 1U90A 3WNBA 5G40A 1TF5A 1F6BA 2O8BB 4HAWA 3N2EA 3KJIA 1I2MA 4NCHA 3W3ZB 1Z08A 1BMFD 3GLFA 2V54A 3BB1A 1IHUA 4O0MA 4YMVA 1ANKA 1ZC3A 4TQUS 2QQEA 4BFZA 2CE7A 3ASZA 3L8ZA 3R20A 3SYKA 4A2QA 4EFMA 1OHHA 1E9RA 3Q7QA 5CB8A 2DFKB 2H7VA 1X1RA 2VEDA 3AGQA 4PHGA 2ZTSA 3OIUA 1WP9A 2IYWA 3U3RA 1QG2A 4AYXA 3W5IA 3A8TA 4BQSA 4WIAA 1ZNYA 3I61A 4QHSA 1ZM3A 4HATA 2PLFA 2ZRGA 3K9NA 1NY6A 1YRAA 2KSQA 2TMKA 2IYVA 4OYHA 1LY1A 2GAAA 3GCGA 2P5SA 4B34A 4M0LA 1A1VA 4MYTA 1PJRA 2ZYUX 3LA6A 4GI7A 1YR9A 1KJZA 4GOKA 3AKEA 2IXFA 1X8LA 5IHPA 1KY3A 4ILEA 4IEIA 1LS6A 4WZBE 1J8MF 3CW2A 4V03A 2VP6A 2GJSA 4OBEA 2D2FA 4WA7A 4A4DA 2W0MA 3Q7PA 3QQ5A 3BGWA 3THXA 3Q3JB 4M22A 4FMDB 5AJVB 5BQ5A 1U99A 2Z0MA 3DKPA 1DAGA 1OFIA 1Z3IX 2IEYA 2J9RA 3KQKA 1SVMA 2ERXA 4F4JA 3VKGA 3X1XA 1OIVA 4YLGA 5DI3A 4F4CA 1TUIA 4JSTA 4LV6A 2ZRPA 4E07A 1OPXA 3VAAA 1NMXA 4B43A 4B75A 3DM5A 3VX4A 4B3XA 1DADA 1T9HA 4FMCF 3C41J 3Q72A 2HYDA 3U60B 2I4IA 1HT1E 3AKYA 1P6XA 5KOYA 5J4VA 4FCVA 1S9HA 5DYGA 1L2TA 3BFKA 1OXXK 1G41A 3OESA 2VO1A 4P4SA 1T3SA 2WSSD 1TF7A 1WQ1R 4N0EA 2CLCX 3SBDA 1CULC 2DWQA 5P21A 2GEVA 3QOFA 1EWRA 1D9ZA 1FP7A 3CRRA 1ZNZA 1HY3A 2RMKA 4QBIA 1VIYA 3KDSE 2CMKA 2WPDD 1P7CA 4TYQA 3CM0A 1IN6A 1GL9B 4NCNA 5JBQA 1BYUA 1AS3A 3I4LA 3IIKA 4RD0A 1OB2A 4HAZA 4W5JA 1XJCA 2ZI5A 5HZHA 3T06B 1T3HA 4C0AC 1NBME 5FUYA 3RDPA 3NG1A 3KFXA 4JBXA 2JLXA 2BKEA 3QJYA 5DYIA 1JEDA 1EFUA 2FPLA 5BYKA 5FUWA 2P2LA 4PC7A 4MDFA 5G41A 3VR3A 3PUWA 4A92A 5H70A 5CM8B 4Q9KA 1E2NA 3CPJB 1P72A 3NHBA 3EXAA 4G01B 4LUCA 1NNEA 1G8PA 3EIEA 4LJ9A 1BMFA 2X8AA 4U02A 1TEVA 1EK0A 4L5BA 4DRZA 3CR8A 1XTJA 3IKJA 4AG6A 4YDHB 3BOSA 1VG1A 4F4IA 2GK7A 4JLAA 4MUAA 2CXXA 2LWIA 1UKYA 3VKWA 4Q7KA 1GITA 3TE6A 1KO5A 2CNWA 3FMPB 3LRPA 3VFDA 4Q4AB 4MRVA 4XWOA 2FFQA 2IF0A 4NYIR 5CDFE 3MWJA 2ZR0A 3ZD7A 2A5JA 3UMRA 4A36A
chains in the Genus database with same CATH superfamily
2CXSA 3P2MA 1KI1A 2R84A 3OP4A 1H0KA 2VTKA 4GNKA 4ISBA 4O2LA 4U8GA 4G0WA 3NRBA 3FTFA 1OU0A 1YU9A 1D07A 4F84A 4KGZA 1DBPA 3ROPA 4B4KA 1ISIA 5KYGA 4IZOA 1B00A 4YACA 4KI0A 4YONB 3C98A 3IPRA 4BRWA 4CCYA 2PN1A 2G0TA 4GI3A 1QG4A 5CIYA 4K9MA 1CY4A 3WLHA 3IH5A 2K87A 2FPIB 2VQDA 5CG1A 1ZA2A 4Q01A 2AF3C 2Q7DA 3MGAA 3V80A 1GPH1 2H5JA 1TA4A 1G9TA 3WMGA 4EJ6A 1SXIA 1T0HB 2QVZX 3KEMA 3NC4A 4NK5A 4K9SA 3WWYA 3VZRA 3GY0A 3IL2A 1XTUA 4UJ5A 2IDMA 3EFEA 3HJAA 1VG9B 4H1TA 4XR9A 1E1CB 1N6IA 3IPYA 3NHYA 2J3MA 3JARB 3E81A 3N7AA 4FCWA 4Y2PA 5MN4A 1MW9X 3KEQA 4YIKA 2ZTUA 3JSAA 1QO0A 1YO6A 2DSNA 3E4CA 3GJ0A 3C7DB 4Y8VA 3TLBA 4K6HA 1KSHA 2AXEA 4C0WA 5LA6B 1NW9B 4E5YA 5FFMA 2I6SA 2VWGA 3NX4A 3RYHA 1V26A 2E85A 4NFHA 5K4AA 3ZX5A 4LYHA 3BWCA 1OXMA 4AY5A 4IDBA 3KD2A 1R6UA 1KSFX 1OV4A 2I6TA 4GD3Q 2AJBA 3ULKA 1XMPA 3ZCVA 3OY7A 2W8ZA 3BXXA 4DKXA 2HMSA 1XCMA 3AHCA 4BKRA 5HP4A 3I6ZA 1CJKC 3DAFA 5A02A 2CLSA 3K70B 3SOZA 2HX1A 1J8FA 3DO5A 2RHMA 1U94A 1JQAA 5E6RA 3K0CA 5IM4A 5BN5A 1SBQA 1QX3A 2BVNA 1V8FA 1OF1A 2FSHA 1BXRA 1ULTA 1XQYA 4QATA 1QAQA 2KW5A 4K9LA 3JQ9C 2EKQA 3KHSA 4IBOA 4CM7A 2F1HA 5IHXA 3BMCA 1NNUA 3P9KA 3ZWBA 3DP9A 3UFXB 5CCXA 3VC7A 4N39A 3IUSA 1DEKA 1J8QA 2QT1A 4V2IA 5D1NA 3TYXA 4D9BA 3M6XA 1SRQA 3TBKA 1DC3A 3E3AA 3Q40A 3ROKA 3WP1B 1P80A 1WHSA 5HNKA 1RLJA 2DF8A 3WKEA 3BHNA 3MK31 3TLGA 4CODB 2IRWA 4HGYA 1CVRA 1T2VA 1USUA 3ICOA 4RVFA 4BRZA 1NE7A 1APBA 1XLUA 1TKCA 4G8CA 4J3FA 4Y9RA 2CF5A 1P2DA 5I7EA 5LJLA 4LSMA 2PBRA 5DX8A 3GLFE 1ZGAA 3IFSA 2CHQA 4C3UA 5LMNB 2BW0A 3MUNA 2CKMA 3AILA 3T35A 2FW9A 3F6SA 1R66A 4M1YA 3HUEA 2WK1A 3NXSA 4U2CA 4Z4CA 3QF4B 2R68A 4NY1A 2GHRA 1MJ5A 4RF2A 4C6RA 5HDBB 1KTIA 1OREA 1VJ5A 1A7AA 1RE1A 3CYFA 3IAAA 2GBIA 3DOEA 2YYYA 4MZXA 3UJHA 4YHHB 2HB6A 1B2LA 3L9XA 1N32B 3U19A 4KHZA 4X93A 5TVKA 3ANTA 3M70A 4IX1A 1QVZA 3TZLA 1WABA 1Q7RA 1I2DA 3ITDA 4UZEA 4XUCA 5IDXA 2M6RA 4QJ3A 3PV0A 1Y1PA 1YVUA 3LC7O 3DGEC 5E7JA 5JY6A 2FX2A 1RPZA 3NTRA 1U0RA 4KUEA 1AUVA 3O4VA 3SF8A 3WYFA 4Z0TA 4XLTA 4IKEA 2GAJA 3IERA 1K7FB 1W93A 2IUFA 2V4UA 4KDFA 4IOLA 4LKRA 3NHJA 1UDBA 1UXJA 4J0DA 3EZ2A 4ASUA 2R6DA 1RYHA 1RXSA 2WABA 3ANXA 1MTOA 1GG9A 2VTDA 4EMBA 3RBZA 3O0DA 5DNVA 3W90A 1WDMA 4IRUB 2V7QA 1W5EA 2EX0A 2AMVA 2X23A 3CZPA 1U0FA 4Z2AA 4Y18A 1JECA 1EB8A 3AIKA 3R5XA 5C1DA 1XXHE 1KC3A 2Q8QA 4AXBA 1RI4A 1H6DA 4NL4H 2W58A 4L5AA 2HAEA 4E94A 5KBYA 3BKXA 1SZDA 3ORYA 4LZZA 4M9QA 1R6DA 5I6DA 5IM4F 3HSYA 4YPFA 1A4UA 1E99A 1EUQA 4LJAA 1XQVA 3L8MA 1E96A 3KPYA 3K8OE 4K6CA 5EZQA 4XJXA 2I4NA 4X41A 3LLMA 3SOPA 1V3VA 3CLVA 3CZ5A 1XTRA 3L8FA 3QVJA 3OF3A 4YRMA 5C3UA 1QU3A 2OGSA 1HL7A 4XSGA 2CFCA 2PSJA 3O75A 5D3QA 1Z0SA 1QNFA 3OD5A 4OHVA 3EZ6A 2AWNA 4M1OA 2WPNA 2R8EA 1DHTA 2J30A 2XUDA 4AUNA 4PLHA 1SXQA 5E3JA 1TDJA 1C7IA 4L85A 4TXJA 2A30A 4AJ1A 3EZ9A 4IIGA 4ROTA 3LSYA 1GYPA 2C1EA 3HRIA 5B1HA 3FIJA 5LBTA 2OAP1 1WUTA 2XUFA 3GROA 1P0CA 4CU5A 4GSKA 1K7SN 3JQAB 2HUPA 4QUBA 1O03A 1YWGO 1FRVA 2RI0A 1M1YE 5HR5A 1T2DA 3C1UA 1I6KA 2OORC 3BHIA 3F4BA 4YBZA 2FMTA 3OCUA 1NG1A 3RVNA 1Q7EA 1MHPA 3ITKA 4EUEA 4LF8B 2Q4DA 1X92A 1GTSA 1J5PA 3M6VA 3JYQA 2PD4A 3ICVA 2ZSBA 1IJFA 3IMFA 3PX3A 1TYAE 2BL4A 3RS0A 3X2FA 4BBAA 1UWKA 2I6UA 2HPAA 4IFTA 4QOEA 4UTOA 5D3ZA 3UFBA 2YHUA 3EZNA 3X1KA 5L7TA 4YJHB 5CBPA 1NBOA 4QFCA 1TK2A 3ZE8A 7REQA 3TB6A 1MAVA 1E2KA 3RS4A 4EQ6A 3HACA 4F8EA 3R0XA 2HK8A 2V5AA 2BKXA 1U0GA 4G65A 3L4BA 2ZUBA 1QP7A 1EZZA 4RD6A 4HEQA 3EXIB 3ZV7A 3HQ4O 1UOEA 2I2CA 3U81A 5HBRA 2CFSA 4KXVA 1B0UA 1PFUA 1R1DA 3G8YA 1P17A 3P96A 2Q5JA 4I4CA 5JYDA 4HAUA 5U9CA 3NWOA 1SEPA 2H1VA 3EE6A 3ZD8A 1IEQA 1VL6A 4HPWA 4OYRA 2P9JA 2J87A 3A28A 3K4PA 2ZWMA 3KEOA 3IR6A 4ALNA 4JT9A 2IYAA 1WS6A 1ZIOA 4G0VA 2XUAA 4OX9Y 4G2NA 5AKHA 4ZT2A 3RUFA 4L07A 4OI4A 4BU1A 4EENA 4RXTA 2QX7A 1XMJA 3V1LA 2ZITA 4PLTA 4JLJA 4LJ6A 3VHQA 3WYDA 4P34A 3NBKA 2GNAA 3I28A 1YRBA 2F7SA 1DIRA 4FGJA 4FZRA 3T3DA 1WCYA 1MJNA 5TR9A 1NTOA 3CCCA 1NM5A 1L4NA 1QG0A 4U4AA 4ITVA 4C89A 1SU4A 3O1IC 6AT1A 2NUBA 3H2BA 2YWFA 4RKFA 5CLIA 4RDIA 1GV0A 2HKIA 2J6HA 4TLAA 4JYZA 4QJ5A 4XJVA 5AJYA 5IM5A 4JI7B 7MHTA 1M75A 1J21A 4W5WA 3HBFA 1D09A 5DW3A 3U4MA 2NSYA 4MS3B 3ZLTA 2OCKA 3N2LA 3TAUA 5C35A 2VA9A 3WR5A 1MXFA 5LZ4A 5DBOA 3S2UA 2G5TA 5FTMA 4E4TA 4XR4A 2WIKA 1T3GA 3PWZA 1MX5A 1KEUA 5F1YA 3DMRA 5AOBA 1GARA 3D1VA 3IVRA 4N5NA 5BY2A 1HRKA 4PS1A 3TIFA 1W8IA 5I7WA 1BDJA 3NALA 5JMWA 3NHMA 1L7QA 2PYZA 2YQ5A 3EGWA 3A0UA 3BE5A 3HP4A 3UMJA 4R81A 5CW1A 1EWTA 2VAXA 4IPTA 5F77A 1DO2A 4FU0A 4MGEA 2FP3A 1N3IA 1YOBA 2QR5A 1JQ5A 2FY8A 1G291 4I55A 2BMJA 2H06A 5DNWA 5FPTA 1ADJA 1NKSA 3WK5A 1PUJA 4QOSA 2JGEA 5AXCA 2AN4A 4CF7A 1KERA 2JJYA 5JFTA 3K0FA 1OBHA 1ZH0A 3G9QA 3ZE7A 1V1RA 4ER6A 5CA1A 1JG7A 1RBYA 5GJWC 4YRIA 5DLQC 4PU0A 1OWNA 4KRXA 4RHYA 2C4NA 4YJ2B 2WI8A 4LI3X 1WUJS 2DLDA 4N82A 3IILA 4HNAB 2I34A 3ZDYB 4RHTA 1VSUA 1U3DA 1RDFA 3I12A 4Q3OA 4QO7A 2VJCA 4BKUA 4CCAA 1CEXA 4Z1MD 4OL0A 3ROXA 3GIDA 3EQ2A 1BEEA 3C5VA 3HHPA 3QU5A 3R40A 5TQ2B 1JKFA 1JYSA 4IIVA 1L7OA 3BDIA 2V0NA 1AUQA 4D6YA 1LCIA 4Q1DA 1E7WA 2GS9A 4QUIA 3THYA 4LDZA 3DE4X 1X1BA 3GCZA 5B1YA 4F4DA 3TQSA 4UMVA 4OHMA 1JPNA 4MRMB 1D8AA 1T5LA 2GGSA 2CJWB 2W83A 1P29A 3LCCA 2YJ5A 3W5JA 5HHTA 5KYTA 1TQ2A 4RTJA 1ESZA 3OQ1A 4OJNA 1DCKA 1XD9A 2PQ2A 4OMDA 3G02A 1K27A 3PC6A 3OWOA 4HTFB 5DEIA 3STTA 2AKEA 1C9NA 2I7DA 3K9BA 5FL7D 4DTIA 5REQB 3T5CA 2CVZA 3DCIA 2OV2A 3ICPA 3RIGA 4BJ3A 3GPCA 2IZOA 2BH2A 2E4ZA 5JNUA 3A6PC 3D3JA 4JUBA 4W9RA 1NWCA 1MEJA 1T9CA 1LLUA 2PU5A 1HI9A 1EJ6A 4NU0A 3IOMA 2VNSA 4LXYA 1UJ5A 5LC1A 1XHLA 1ECBA 2A5GA 4YPOA 1FJHA 3UYLA 3ANSA 4JJZA 1C1XA 4UD6A 4BTEA 1JMYA 3E7PA 5FWDA 3VX3A 3N0RA 2YHSA 3TLCA 1VL5A 2QORA 3LV8A 4JMLA 4CF5A 4PYQA 1T5BA 2JCSA 3OFNA 3FMFA 3BE6A 2I2FA 5LIPA 1MX1A 3AWIA 2ECKA 1JU9A 3AF3A 3C74A 4XDYA 3FNRA 4CMAA 1WDKA 1GCOA 1P45A 3GN1A 4RPKA 4BV9A 1BFDA 1ZSNA 4L6IA 3VR4A 3QXSA 1U7DA 4P0PB 3CJQA 5KQSA 4UNPA 2VPTA 2VSYA 5TGTA 4BFUA 2OXCA 1QDLB 2AOUA 3GJXC 1Z0FA 3PEYA 4PFJA 3OZXA 1DBVO 4Q7EA 2GTHA 2JIMA 5AVOA 4S24A 1JDTA 1N5IA 2FEOA 4NAUA 1H23A 2N0SA 2A1TR 5A71A 5K99A 4AN0A 4BMVA 1XDZA 4K28A 3K2IA 4P80A 4Q3KA 3NIGB 4QLBA 1JWBB 2YWHA 3DJYA 4HGPA 3T0GA 2G6BA 5A04A 1YNSA 4WZAA 4EL0A 1X3LA 3BC1A 2Y4NA 3DZCA 4CLEA 3A05A 1M2OB 4HFNA 3TDMA 3TNDA 3Q7EA 4B6FA 2C0CA 5KSYA 2NU8B 2WMNB 1E2IA 1QZUA 2D3WA 3PC7A 5KVQA 4HQ6A 5B7NA 1KEKA 2B2XA 1TF2A 2B3TA 3EUAA 3MFYA 4G41A 2VT3A 5D6OA 4JI3B 3TEFA 5B3KA 1NLFA 3KPVA 5LP6B 1OW3B 2QSYA 3ZHVA 1Q3TA 2RK3A 1V3QE 2V65A 3MWLA 5EE1A 4Z8YA 4AD8A 2HJWA 4KQFA 2DEUA 3JWJA 5DN6D 1G9SA 1ISRA 4NQRA 3TOXA 4X90A 3KZVA 5CAEB 4B4OA 3WGIA 2PU7A 1H2HA 3O1JC 4HGZA 4KH1A 3HVKA 2YWBA 4JB2A 4DMMA 3EDQA 4MEJA 3F7NA 1JDNA 1H1DA 2GTPA 1GZUA 3TTSA 3KZCA 1R4AA 1UJ2A 2JFHA 1EUZA 2XJ4A 2WP8J 3RKUA 3O8OA 2AX3A 3BK2A 3DYVA 4NBLA 2QX4A 1EEXB 3C7TA 2PUJA 1UQTA 1DKNA 4O2AB 4EI9A 1VL2A 2L19A 2HZBA 1LSUA 4R1QA 3M4XA 5JOQA 5IBRA 1I7SB 4DT1B 4XVRA 3U5TA 2X9GA 5EMMA 3KDAA 4DLWA 4XPIB 2BTQB 4A23A 1QRTA 1KOJA 2QBYB 4ZPJA 4GOLD 3EXEA 4MIOA 2WQ6A 3RB8A 2ZE6A 4OYLA 1UP4A 2O0JA 4QJBA 3EH2A 4B76A 4PSVA 1FSSA 3HJNA 3E58A 3I23A 3QI2A 2FPPB 2JVKA 3KAKA 3NEPX 3GDOA 2RONA 4CV2A 2R8BA 2X4GA 4BLPA 3FWHA 3R9XA 2LXNA 1TAGA 4MINA 1UKZA 2BFNA 3D81A 4R2JA 5JASA 1YU6A 1JIKA 3NHUA 2BSQA 1C8BA 2C2BA 3HYRA 1W0KD 5JZ9A 2FFBA 3H3FA 1JP7A 2VPPA 4BAGA 2ECOA 1GZHB 2B36A 2W2XA 4G5GA 2XMRA 3FWNA 1JXOA 3A6ZA 3GG9A 3NANA 1HT2E 2QTVA 3BULA 3IDOA 3IVMA 4M4SA 3VPAA 1Z0DA 2VSNA 2P78A 4WSOA 1MIHA 1KK2A 4G0ZA 4GI2A 3Q7IA 1Z34A 4Z7JA 5JSQA 3OWXA 3LVQE 3D7NA 4BNGA 4CIBA 1BCSA 4XUGB 3LXUX 3PD7A 5CMLA 5CJPA 2CYBA 5LQKA 4Q4DA 1Y9ZA 3VISA 5BNZA 1XCLA 4LJ7A 5AI0A 3GFPA 4I6EA 1BAPA 1CUYA 4UU1A 1EUDA 5IEBA 3PCRB 4ZTZB 4C7XA 3LX4A 4OB7A 4QQ8A 2OFWA 1FDIA 2INGX 3DXFA 1YA8A 2W2KB 3L01A 4WLFA 3LY9A 5DM4A 4D96A 2P6UA 5G0TA 3QHAA 5J5AA 2YL2A 3MT9A 2PRSA 1HDIA 4RD4A 4ZT5A 5ITSA 1RSZA 2ASEA 1GY8A 4KLRA 2WFLB 3FHJA 4Q9LA 1GZ3A 3D4LA 3TWOA 4AW9A 4CMEC 5L40A 3G5TA 4CMKA 4P32A 1LSJA 3VDRA 3R44A 3THYB 1D8TA 3HA5A 2VZ8A 3OURA 5CCBA 1Z8HA 3G5LA 1CCWA 2WLTA 4LMBA 4NCXA 1MGPA 3PQCA 1L7PA 3SI7A 4ZAVA 5E0KB 3ID6C 3ELBA 1PJ4A 3HCAA 4Z0HO 1PNOA 3UWDA 1R5NA 2FF7A 4BVEA 2OO5A 3BL6A 2HK9A 3HO6A 4ZALA 3TDNA 3JD0A 2I1LA 3VKUA 4KODA 2RK4A 2IYQA 4UCFA 1UPTA 2UVPA 1EA5A 1QUFA 4LDPA 3KPJA 4LTNA 4EO9A 4RMNA 2MINB 4URHA 3WK9A 5KYUB 3AESB 1W1UA 3FUWA 4IDFA 4KGXA 3ZNQA 2HBYA 5FT9A 4QTXA 4D8TA 4WNAB 3W9YA 1JMVA 2WBLC 3ZCTA 2B8WA 2WD7A 2Y1XA 3ABZA 1NVDA 3CBQA 5JSKA 4LVOA 5A5DA 2HMTA 3VU9A 3LZ6A 3FMVA 3FCYA 3HR8A 3HWX1 4MV6A 4BMDA 1KP3A 4F93B 1ZWLA 2C4WA 1LPSA 1X86B 4BVLA 1SA0A 1DOHA 1MQ8B 3L2OB 1GSAA 5LXTA 1NKTA 4JROA 3OMWA 1YRLA 4PZ0A 3PR3A 7YASA 4IF4A 4ZICA 2R6R1 3T1NA 2VT2A 4Q4CA 1VZ2A 3KUDA 3MMSA 4C4SA 5FH9A 1IN1A 5B3JC 221PA 2XW6A 1GUFA 1RPJA 3A4IA 5IASA 1UK7A 2GF2A 2HSWA 1BDBA 3OE7D 4W7HA 1I1QB 2FZCA 2ZYSA 2OOSA 4IQFA 1OFUA 1PSZA 2ZJ7A 1J5EB 2F1RA 4XYLA 3OSZA 4BNMA 5LNK6 3AVYA 5KVVA 5IYZA 2F8SA 5ANRB 3PLAE 1FUKA 5FIUA 1GFSA 1PZFA 2OC4A 2Y9MB 4GL4A 1YR1A 4CLRA 4FXOA 4NBKA 3UH0A 4IW3B 1X70A 4DILA 1RS0A 1IL0A 3DTNA 4AX8A 3WQBA 4ANFA 3TJRA 5INTA 1EESA 3SZRA 4HYEA 1H0RA 2MSWA 4IV8A 4RHUA 2AR9A 3N0VA 3O73A 2NU6A 4PY2A 3IA7A 4G4JA 5J2UB 1ZK0A 3PLNA 3P4XA 2P3OA 3AFGA 2G1UA 1D03A 3L7AA 3OQIA 4R2LA 4X63A 3VR2A 3ILXA 3F6PA 3RKRA 4E32A 1IBRA 3H9JA 3OEHA 4CLXA 4BNTA 4YRSA 5B6IA 5CFPA 2FFHA 1SVSA 1Q1AA 3A27A 5KWIA 1MB3A 3G1TA 3PC8A 3AP1A 4US1R 2XWQA 3FNBA 2CEKA 2M2IA 4J9VA 5E4TA 4GG1A 3RHZA 4DXDA 2NTJA 3CVXA 2OHIA 3IBFA 1U8YA 4QSMA 5K3FA 5JMTA 2FXVA 3EZXA 2O0MA 4MQBA 5HTOA 4KJZA 1I4LD 2DFNA 4HVCA 1T1IA 3EXFB 3NPMA 4FMBB 1LW6E 4G5SA 3URMA 3WGQA 5IUNC 5KQPA 1R0RE 4GXTA 7MDHA 4JVOA 3H16A 3TCKA 4F71A 2BUBA 2PKRA 4B6JA 3AZOA 4F6RB 1FFXB 3G2JA 3ROMA 3D8TA 3SHOA 5FULA 2NUTA 1WO8A 4IGEA 3TL2A 2Y1OA 4FEYA 3UK7A 1WL8A 5D3KA 2EWWA 2FKNA 2GLUA 3E70C 5DBHX 1CXZA 1PHRA 3WGUA 4G2TA 1F4PA 3E9YA 3G2NA 5JSYA 5BWMA 5GZ1A 1M0EA 1YA6A 1I2CA 1DWQA 2FE4A 1X87A 5JD6A 2JHGA 3DFMA 3F8WA 2G8NA 3VSBA 3NXKA 3VZSA 1GPKA 1EFCA 3RUEA 3EEBA 4LRXA 4FQ5A 4PZDA 4YAEA 3AONB 1OA1A 2I6FA 2O7QA 4WACA 5HJ2A 3E9EA 3N76A 2PNFA 3BKWA 3IKLA 1U8FO 2XT6A 1N9ZA 1WB5A 3CHYA 1K5DA 1MF7A 2NOAA 1I1HA 1VE1A 3HZHA 3L8HA 4UBKA 5LB2A 3W7VA 5EJ8A 3NUGA 1A1SA 4GOJA 2CD7A 5K20A 1UEIA 1IK4A 3RFTA 3O83A 3CVOA 4Y0VA 4FBGA 3VPFA 1UMBA 2E1PA 3FHLA 4CT4B 4NKRA 2BEJA 4BGVA 4YRBA 2XQFA 2CMFA 4N40A 5E6UB 5IKEA 4LYGA 1DLIA 1ID8A 5EWMB 1HWYA 3HJTA 3VOSA 2C1ZA 2GCEA 3QE4A 4TN1A 3T7JA 5A9SA 1TPZA 1W1WA 2BFPA 1IJEA 4YPVA 5EIFA 1V8OA 4M87A 2IYRA 3QEMB 4ID9A 5HCUA 4Z6KA 5ER6A 6Q21A 3G0HA 1QTIA 4LZPA 1GFZA 1U0JA 1NVBA 3DV9A 1JAHA 3DEFA 3KE9A 2ZS9A 5ELLA 5FLEX 3VKHA 1L4YA 1RMQA 1PQWA 2J5BA 1MVNA 1J49A 2F43B 3L0YA 3PDJA 4UEQA 3RNLA 1DRWA 4YJ3F 4TTQA 1C8LA 2R7LA 3DEJA 3MD9A 3ILYA 5DP1A 5JH7B 2YTZA 1FMFA 4LX0A 1G64A 3OA0A 1W76A 2D54A 3EK2A 3MM4A 4EF5A 1I6WA 5KOJA 2DHQA 2BF7A 3HVHA 5BSUA 4RPLA 4FI3F 3HXTA 1NN1A 1ST2A 1TLLA 2A4MA 3FCSB 4G81A 4QTZA 1COWA 1TEXA 4IHJA 2FX3A 4YJKA 1BROA 3KYJB 4IO1A 5A9TA 2GNOA 2A9VA 2IYUA 2WTNA 2Y6VA 3PVZA 4AKSA 3UMFA 5BWCA 5M04A 3DNMA 2ZUFA 1CZLA 5J5VA 2X5KO 4TYMA 4IJQA 4WCFB 2O52A 5JXJA 2A59A 3CTMA 3P9YA 2F59A 4L15A 3GVHA 3OSUA 3OZ7A 2RGBA 3Q88A 4PWZA 1B41A 2BP7A 3FWYA 4HR7A 1CUVA 4XD2A 3OT4A 1AU9A 3UJ9A 4EG3A 3IA2A 2YW2A 4AKTA 5MHTA 1GCIA 4QYIB 3W5VA 2ACVA 2AH5A 5B1EA 4JR0A 5CJ2A 5LLDA 2KBEA 4MQUA 3R4VA 1R27A 1U1FA 2W90A 3P9NA 4FYMA 4OXQA 3SQMA 2J0UB 5DHAA 1KF0A 3S6JA 2GR9A 4HUQA 5D5HA 1NQXA 1H22A 1NA5A 2OOKA 4NC9A 1OWPA 1KZ1A 3D64A 1PT5A 4FHFA 3FM9A 3KXDA 3THWB 3PKZA 4Z4EA 3SVTA 1SKQA 2WILA 5K8VA 1X7HA 2P2SA 4TMVA 2VDRB 5B3JA 2Q0XA 3DAPA 4MGYR 5CG2A 3ER6A 2VSOA 1NYQA 2H08A 1NI5A 4IRXA 4DIOA 3GUUA 2K7FA 3LUGA 4MPJA 4U5XA 4B3CA 5ED4A 3DBLA 1YK0A 4DEXA 1ULSA 1NULA 2DQYA 5H5JA 4GDMA 2N3ZA 3WGTA 4DMLA 4BATA 2GPWA 2QZZA 1G8YA 4ZI7A 5K0FA 5DTJA 5IUKC 3MT7A 3EVAA 3OQVA 4JJGA 3LO5A 4FGLA 4ZTUB 2D5BA 1XVIA 1WD5A 3P2JA 4X66B 3QBTA 3LKDA 3PFNA 2II6A 2NTVA 1ZD3A 3LBIA 1IHDA 3H2SA 3PGVA 1O5OA 1Y3AA 3CIOA 4HQOA 1RRFA 1KP9A 1XELA 1OUMA 4H4DA 4DLNA 1T6YA 4H18A 2CD9A 2JI9A 3V5NA 3AY0A 1SFRA 1FP1D 3OM0A 1E9CA 1LB1B 4E08A 2C2MA 1HYGA 5CNKA 5H83A 3KXLA 5G4KA 4NPHA 5AW5A 2VDQB 1V3TA 2JARA 3U2QA 4BLVA 5JIBA 5FPKA 3K9GA 2R0QC 1A8PA 1XMIA 3EXHC 4XLZA 3ZDEA 4F2DA 1YACA 1N2OA 1T9ZA 2Q50A 3H5OA 4L0MA 3RSLA 4BB9A 4IIUA 3CUEF 1IOVA 4GC5A 2GBLA 2WJ4A 2OFXA 5K3SA 1JEOA 4RVUA 4HF7A 1JIVA 4MYCA 1R8XA 2I29A 4EHJA 5B36A 2CLOB 2HGSA 1FQWA 2OA0A 2CLDX 2OD7A 4KLNA 1AMUA 5IJZA 4EZIA 2YC4C 1VPLA 1JUDA 1PG0A 4TRRA 3WMEA 1MP0A 1VHTA 3P2YA 3PUVA 5LSAA 3EMDA 1MC5A 5E1DA 4HWTA 1OLXB 1A8HA 3PA6A 1OBOA 3PXDA 4RKQA 3G17A 2Q5OA 5AVVA 5DNAA 2UYGA 1V0JA 5AKYA 5J5CA 4RGYA 4D2IA 3HS3A 1AKEA 1Y6ZA 5LQNA 3LQFA 2IXAA 1CUZA 3AJDA 4D8VA 4EFKA 2R62A 2P77A 3RNOA 5DBFA 1W75A 3H1FA 1A2KC 4RK1A 4YJGB 2VUHB 1ZRHA 2W5UA 2X9LA 2ZJ3A 2MIIA 1XRLA 3ELYA 3OEYA 4J7AA 3K73O 4WBSA 4CGYA 2YDYA 5A3VA 4G9EA 1SBNE 2XNSA 2XEDA 3F6CA 2EFDB 2IP1A 3RVLA 1DX4A 5CPBA 1IDOA 3SR4A 1SKMA 4J0CA 4CDGA 3R9IA 4GPBA 1B3RA 2WF6A 3KR0A 1S2MA 4I8IA 4U9IS 3G2KA 3USCS 2CL5A 2QZ4A 1S8AA 2ZSHA 1N7GA 4MO2A 4C7MA 1T4MA 2W8BA 3KEFA 4O1HA 1Z15A 4FGKA 1VRVA 1YFJA 1KMHB 2EEPA 3QWAA 4HTAA 3WYAA 4QEKA 5MFZA 5DOZA 1XL0A 2V6BA 3MINB 4TWBA 3EB9A 2F8MA 2GB4A 4OHPA 3RG8A 4X6UA 4L4XA 4NU8X 1L5GB 2PYDA 4IDDA 1CFZA 3JQ8A 5ERGB 4U6QA 2FJPA 1R6VA 2O07A 4P9NA 5JXWA 2RGYA 5HKKD 5IAGA 4BB6A 3MWEA 3FVRA 2X0NA 2O8NA 2SCUA 5FP0A 3W6PA 2CDAA 4EYGA 4Z4IA 3GQBA 3KQUA 2DZDA 3C6YA 1Y5MA 5CD9A 3BA1A 1PAUA 1LXCA 4GLOA 3WRWA 1GRRA 1CRLA 3C45A 5CVTA 4A0QA 1OYYA 3L7YA 1OYOA 5JCPA 4ZT6A 5LD2C 1SELA 5KUTA 1KJIA 2OCIA 3S2ZA 2GEKA 3CKMA 1D4FA 3VVBA 2WJZB 5JWHA 1FFAA 1NURA 1QZZA 2VEOA 1XD8A 3N8GA 4GW3A 4JT4A 4M7WA 3ZD9A 5FUXA 2AN5A 3UVEA 4A2CA 3HZOA 3LT4A 2W42A 1KAQA 4Z5XA 4KPYA 5KTNA 1Y5RA 4P53A 4OK6A 3OJXA 1QIKA 5JRZA 2VJNA 1WLSA 3AM5A 1U6KA 4UHJA 1PYOA 5AUNB 4M7OA 5B7QA 2OKCA 1ZSVA 2BFMA 3GA5A 1PHPA 3HCOA 1W5FA 2VYCA 5B57C 5IH7A 3C6BA 4EB3A 1L9XA 3KKOA 4QXPA 4NBSA 4U3JA 4XCVA 4D0RA 2JLYA 4DR5B 1ZNQO 2DULA 4K2AA 2CB9A 2V1XA 2FWAA 3K4HA 1I2ZA 1MB2A 4ZGGA 3U5ZB 5H8WA 4D0LB 3PU6A 4CG1A 4XB1A 2B34A 3IAEA 3GT3A 3LFUA 3WHLA 4HZUA 2F8LA 1L3BA 3CB2A 4AX4A 4M8KA 3HC7A 5CYFA 1A9PA 1N57A 5F7OA 4MB6A 4JLNA 3DZFA 4IIEA 3MGBA 4Q47A 1GU7A 4WXMA 2A5FA 3NJ4A 3PVSA 3GLSA 4MNTA 1XB2A 4YRGA 3NB0A 821PA 1HQYE 1KJ9A 2WAYA 3SEAA 1FIUA 5CDSA 5LZ5A 1DJOA 1W44A 2P9QA 3P9QA 4A0RA 4RF5A 3WLKX 1FX0A 4I1VA 3FR8A 2Y8EA 3IHLA 3EODA 1OAOC 2ZR9A 3DCNA 3MF4A 2H2AA 4CM8B 4YMGA 2XA1A 1F3OA 1XXHA 4S0XA 3OFSA 1KRWA 1FYEA 4E2WA 3OU6A 5BMVB 2EP8A 3UJAA 3WGKA 2XSZD 5DX0A 3GAMA 1H65A 3RYCB 4ZKEA 4TV9F 1V5WA 1OYVA 4DJ5X 2O3JA 1DXOA 1LDEA 1C7QA 1MJFA 4GI1A 3HV0A 1YZ3A 2BAGA 3SSMA 4HQRA 4TWRA 3T94A 3TZHA 3U6KA 3HI6A 1IY2A 1XTTA 1ZJWA 4YT4A 5KX5B 4QGFA 5ETJA 1UJBA 1GG5A 1Q57A 4DMRA 2IUYA 3DMTA 1H6AA 2OCBA 2X8WA 3MGKA 1N8KA 4NEHB 4EEXA 2JIZA 2OAQ1 4ISCA 3LFHA 4QPCA 4ZI2A 3AVPA 3FGNA 3TXXA 1O6ZA 4RY8A 5JDCC 3RVSA 4XX0A 3FHTA 3RANA 1SUBA 5BUZA 4IDPA 1JZSA 2NO0A 4KFTA 4PX5A 4Q93A 3EC7A 2CW5A 1QHYA 2H5LA 3K0AA 3NZEA 9ABPA 3Q12A 5FLXA 1EA7A 4XX1A 3GMIA 1O77A 2ZANA 2YV5A 1D2AA 2X7XA 2CK3A 4HDNA 1D7OA 7GPBA 3IJRA 4N3BA 5GADl 4E70A 2ZJYA 4LJSA 3SEQA 4HEA6 3SYNA 1F8UA 4FHGA 1I24A 3NDRA 1DUIA 4HTFA 2GKGA 3CWQA 1C3OA 1P2FA 3TTYA 2YWXA 1NF2A 3VZDA 5IABA 1YTUA 4Q15A 3BIJA 2ZPTX 1IOLA 1CP3A 3LLUA 3TEJA 5BSVA 1AXRA 1Q0UA 2IEIA 2DT8A 1NLYA 1K6MA 2W4IA 2IDJA 1S89A 4WFIA 3M9LA 4GKVA 3LL4A 3MMPA 2OUKA 4I5FA 2W2PA 4XTRA 3GFGA 2HWWA 721PA 5IKPA 4AZ0A 2WZCA 1CJUC 4PQFA 1O9BA 1V16A 3NKFA 1R88A 4TZ6A 2EW1A 1VMIA 4NDNE 4E2FA 2OZLB 3D6VA 2HREA 4KE6A 1G17A 4C30A 3N6XA 4HX9A 5EGSA 3M6UA 5T4HA 1T9DA 2B98A 2PA3A 5EINA 3WRYA 4PZYA 4ZU6X 1O6GA 4LCEA 1P77A 4E5PA 2SICE 3K2BA 1IC6A 1R6BX 4GC9A 3ISVA 3PXCX 4RPJA 3KSBC 4DUZB 3HJBA 2RH9B 1G18A 3BMQA 5FWYA 4DDWA 2PKWA 1SOVA 4TQAA 1XTSA 2YN4A 4RDHA 2FF5A 2QL6A 3BFJA 2PYIA 4OY3A 2AKYA 5L53A 4OH1A 2J85A 3U26A 1P5HA 1W2GA 1D6SA 3PXAA 2XCSB 4C05A 3KWLA 1L1FA 3L84A 3D4BA 4IO0A 3EPPA 5JJKA 4E15A 5AOCA 3NBUA 5IJ0A 1IFXA 1OFGA 2C7GA 5JFOA 1DG9A 3ZE2B 4YAGA 1H4VB 4GICA 3HCNA 3WL4A 1JJAA 2TMDA 2NQ8A 2ZB8A 3SHQA 1SHKA 2W6ID 3WNQA 2DFDA 3OQPA 2VP5A 1U9CA 2NO6A 4IDHA 2GZAA 3IBYA 1CIPA 4X84A 3ZWKA 3T1QA 4PSAA 3UO8B 1FLDA 3G3EA 2MMGA 1BKDR 3WNZA 3CX4A 4D9EA 4DDKA 3J7AC 2YJGA 1XD2A 3I53A 1SPXA 3TUIC 6REQA 3T5AA 1HZZC 1SUDA 4S0ZA 5EMKA 1NFRA 1AQLA 2GA9A 2JHFA 3R3SA 2FSGA 1M1NA 2GXUA 1G3QA 3GBVA 1OTXA 4I2NA 4RZHA 3NVDA 5CM2Z 1H9AA 4ZAFA 1NF9A 4F72A 4XDZA 4P33A 2OCXA 3GFOA 3OJFA 4Y9DA 4CF4A 5K8JB 3B36A 2QDKA 2CMHA 4MAMA 4YP1A 4L8YA 1WUIS 3L7DA 2OB1A 3MB5A 1IEVA 2BT4A 1UK6A 1XZCA 1L5HB 3G9TA 1NYRA 4GIBA 1DRJA 4H59A 4HLUC 4OXKA 4PYOA 1FW6A 4KCGA 4RC9A 1B73A 2B0JA 1VP9A 3SLGA 4E4RA 4HNTA 4DMUB 2DY1A 2H7CA 4WH0A 4IXNA 4DE5A 5KDLA 2PUAA 2Q49A 3EHDA 4Z9XA 3E1GA 3NR2A 1EWQA 4ZU1X 4YJ2F 1G1MA 3AI1A 4B73A 4HAYA 2QPOA 2Q1YA 4XM2A 4WECA 1NR5A 2P9TA 5HK8A 4Q16A 4ZQFA 2WWHA 5JD4A 5I3CA 4IF6A 2CLFB 3DPUA 3H2JA 3DHYA 2VRBA 3AVOA 4MUXA 4YMWA 3EPKA 1Q77A 2IQ5A 1P2BA 5CIWA 3BK7A 1Q14A 1RHMA 3DZJA 1X1TA 4LRTB 5AIBA 5CB4F 1NXTA 4UEOA 4KEAA 3DE3X 3T5DA 1JRLA 2AD1A 5J3JA 4BLSA 2PTGA 3TI7A 4ZKDA 5BV0A 3ZXIA 2GSDA 2PS9A 3DFKA 1UL1X 4CKCA 2HJVA 5DHUA 1BS1A 3KXPA 4LXXA 2IDKA 1ZIYA 3N3AC 1SMKA 3CUUA 5AJHA 3L7IA 2AVDA 1CZOA 1HEIA 3HYTA 5E3HA 1RVDA 1I33A 2JAUA 4OHYA 1G3UA 1BH2A 1MABB 2ON6A 3INGA 3QV2A 4F9EA 5FOXA 3A04A 2I54A 3EAFA 3ESBA 4BLUA 4BO4A 4YH1A 3LK7A 3IVCA 4KG7A 1IRIA 1T4GA 4ZCMA 2XOKD 1JL3A 1RVV1 2WRZA 3NEAA 2C7QA 2MOKA 1WB4A 2K6GA 1QZXA 5HF9A 5I7RA 1K5HA 1NUUA 3Q3GE 3VNRA 5FB3A 4DWJA 1C9KA 5HZGA 1MENA 2RBKA 3QVWA 2IOYA 4I9FA 4AN4A 1HE1C 3BAFA 1VL0A 2R3SA 4L0DA 1TYBE 1AXEA 1AX9A 3AY6A 4ZVPA 5EHXA 4XX0B 1B1CA 3LUFA 3KLBA 4JLPA 1WEKA 2ZB2A 3GVXA 1UDAA 1UJ4A 2NPIA 1WEHA 3LUKA 4IJWA 5CNJA 4ZYXA 2WG1A 2JGDB 3FNHA 1QMPA 4K9PA 3PDWA 3MEQA 3JXEA 5MN6A 1CNEA 1EWKA 2QIOA