1P6AB

Structural basis for variation in adenovirus affinity for the cellular receptor car (s489y mutant)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
124
structure length
124
Chain Sequence
GITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fiber protein
publication title Structural basis for variation in adenovirus affinity for the cellular coxsackievirus and adenovirus receptor.
pubmed doi rcsb
source organism Human adenovirus a serotype 12
molecule tags Viral protein/receptor
total genus 26
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2003-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p6aB00
1HN1A 2ADIB 3UTQA 1MAMH 4OFPA 1MQKL 4PJ8D 5A16B 3ZKMC 3OXSB 4WO4C 3EO1A 4U0QB 1JPGA 1DBMH 4LNRB 1J0IA 3ZHKA 2GI7A 5CP7B 5D7JA 2WP3O 2Z35B 1Z3GL 4ESKA 1UB5A 2H45A 1BZ7B 2WBJB 4GAYA 5IKCB 5KVDL 1S7UB 1YYMH 5C6TL 2R1YB 4NZUH 5GS0L 3RHWF 5IB3B 4KY1H 2Z93B 3T0EB 4HULB 4HIIB 1B4RA 1BVLA 4TRPH 4XBPA 4YEFA 1J0HA 1IGTA 3CXHJ 5IMKA 2XTLA 2P8MB 4NZRL 4X4XB 5D1ZD 5KANI 4ZFGH 2BVPB 4X6EA 2N4IA 3T09A 4MA8L 3BUYA 2AXJA 2EO9A 2GTWA 5GSRA 1GZQA 4NC2B 2HVJB 3D0LA 2OSLA 3NPSC 1OARL 3O6LL 2YSSB 4G80B 1CK0H 2X4SA 4JFFA 3DURB 3MJ9H 5KS9E 3S36X 3BRGC 4LGSB 4OF3A 1G9NH 2AEQL 2AK4B 2DQIH 2UZIL 1LE5B 2DLFL 4QHMA 4DK3A 2CUHA 1RJYB 2YD4A 3GMNB 4XBGA 1BM3H 1ND0A 5HY9A 2VB5A 5TQ2L 2NY2D 1QVOA 4JRWA 5J1AA 3ZT6A 3VJ6B 3HNSH 3LSOA 1NANI 4KXZI 2KUTA 3VRLE 5E24E 2ITCB 4P2QB 1KB5L 2MMXA 5D2NE 3S96B 4MAUH 1IT9H 5LGKA 3X13B 2EIDA 3EFDH 1N4XH 1FDLL 5AYQA 4UNTA 1HSAA 2Q1EA 1JPGB 1MJJA 2DIBA 1A9BB 4GG6E 1F3RB 4WY7L 2KL6A 2APBA 1H3TA 2XXMB 5E9DE 3RA7H 4UBDC 4M9OA 2CLZA 3KPRD 2CIKA 2ARJB 2BNQB 6CGTA 3JTTA 4GKSA 5CLWA 1GC1L 1OTSD 3K4AA 2N1KA 3ZLQC 4NQCA 4MD0B 3P4OA 2W9EL 3FO0H 5J12B 3GJFK 3N1FC 3CSYA 1KC5H 5MEOA 3HZYB 4NC0B 2E6JA 2VDPH 4OGYH 3TN0C 4AEIH 4PGJA 3IJYA 2NY3B 32C2B 3KPSB 4Z8FL 2A9MH 4AM0B 3G08A 4F58L 4C57C 1JBJA 3CLFL 2G5BB 4GKZA 3RY5A 3BD4A 2AI0L 2C3GA 1KEML 4NRZA 3JVGC 4ODBD 5I16B 1JYXA 4IMKC 4JFFB 3GJFA 3Q6FA 1D3CA 2ATPA 1HWHB 4XCCL 4PY8I 2R9HD 1FNFA 4QXTA 3D39B 4N5UA 4JFDD 3BP6B 4AZ8A 3MBED 1KCVL 1JPST 4YHPA 2EDEA 2F5BH 4LU5H 2P5ED 3VD5A 3ARDD 5GS2H 5JLZA 4Y4FC 3VXPA 4NNYB 2ERJB 4MAYB 3OJMB 4PJ9B 5BVJB 2XN9B 3ZE0F 1NGWA 4HC1H 1JRHL 2C1PA 1NJ9A 4UT6L 2QSCL 2ADJA 4KKCC 4G6JH 4YO0B 3BZFB 4PRNA 1X7QA 4UU9B 1N64L 4X8JA 3OKDB 1A1MA 4U6HB 5JOPD 4V1DA 3OXRB 4KJPC 3D69B 2AABL 3AS2A 3TBTB 3VE0A 1ZGLP 5IMMA 5T3XD 1IAOB 3HC4H 2FO1A 2HMIC 2H32H 1CFNB 2YMXL 1WC7B 2RQ8A 4OCNC 4YUEH 3MRDA 1I8MA 1FZMB 2G75B 1NEUA 3SKJL 5EZLA 3VW3L 5DZNA 4LVHB 4LHUA 4M7ZB 4JZJA 1IQDB 1K4DA 2GSGA 3CSYB 4CUCA 2N7AA 3WS3B 4BSWA 3VWJD 5JIIA 1OP3H 2NY4C 2AS5M 4JFPA 4U05A 1IEBA 2YPLD 1I3RB 5EB9A 2NX5A 4FQHA 4PYHA 2H2PC 3ILPA 2X4QA 4Q6IC 4PP1D 1DVFD 1B3JA 2LABA 3QIWD 5IQ9A 3RWIB 4X6CA 2PYEA 3LN4B 1QG3A 4N5EC 4TNVF 4Y2OA 1WICA 1ACYH 5DD3L 3FCTA 5JXED 5IT2H 2ZNWA 3FOLA 1AD9A 4R2GB 5HDLA 3X3FH 2YWZA 1M1SA 3VXRE 5IMOB 1HOCA 4UINH 4LCYA 2DQDH 4I77L 2Z4QB 1J0KA 5MP6H 1R3KA 4OLZL 5GJTL 1X6LA 1VEMA 1J0JA 2B20A 4RAVA 3UAJC 1AGDB 2R4RL 3LKQA 2AERT 3EYSH 5INDA 1ZE3C 1T1YA 4ONGL 5H2BB 2DTSA 1A6AB 4IRSA 3SE8L 4MNQA 1TMCB 3BWAA 4QGYA 4S1RH 5KSVA 4H8WL 4KK5D 1OSPL 4MCZB 4YBQC 5FK9A 5DI8B 3GI8L 5EIIB 4AJ0A 4XXDA 3R06A 1KPRA 4PD4K 3EYVA 4B5EA 3O4LD 1S7XA 5JHDB 5L8JB 3I3EA 4TUKH 2EDNA 2HTLD 2NLJA 4XVSH 4P3WA 4KDTC 3TVMC 1MOEA 3QUXA 4GAJH 1U8IA 4WHTB 4KZEL 1KB5A 1D9KA 2ZUYA 4XVUC 2DBLH 3IJSA 2J8UF 4UIMA 5SWSA 1ZLWK 4ODHL 5T1MB 2CRMA 3KLSA 4K55A 2J4WL 1DZBA 1BFVH 3FO2B 3HFML 5D6DA 1FG2B 4EBQH 1RZFH 3PG2A 3GIZL 3CGTA 4UV4L 4XP9H 1MCWM 1AO7B 5B39G 2XI9A 5DLMH 1F3DH 4JM4H 4HF5L 2DQHL 4JVUA 3PDOB 1P7QD 2H9GB 1CFSB 4JPKL 4X7FC 4EOWH 2C26A 1XIWD 4F7PA 3PWPE 1W0WA 3AS3A 3GHBH 4MNHA 4Y2DC 4XP6H 2XA8L 3MRLA 4Y19E 4C56B 3RWFB 5TFSH 1NGPH 1YEFH 4XRCA 1YECH 1RPQA 1UADC 3H9HB 4G6KL 4WWID 3DX6B 1NC4D 5I1LB 2HA1A 4LLDB 4LSPH 2I26N 2QR0B 5IJVB 4LLAA 4JFQA 4L4TB 4KMTL 3BPOC 3PWVA 2X9YA 3TC9A 4BK5A 5CP3H 1A6WL 3IGAA 3ZTJH 5BO1H 2XKNA 2IAND 1ZT4B 3DBXA 1KLGB 2MCPH 3THML 3W82A 5HI5D 1T1YB 2GK0B 4HK0A 1A6TA 1IAKA 1M4KA 1UYWL 1RHHA 5ALBH 4YH6A 1CICA 5CEZL 2Z8VC 3GSRB 3LEVH 1YC8A 4HPOL 4RQQA 3MV8E 1XF4B 4BM7A 1FZKA 4JZOA 3VFTB 1BOGB 1ORSA 5D7JD 3FRUA 4BFEA 4NKMA 1LEKB 3BJ91 1QRNE 3HS0B 3VU2A 4CVUA 1YEHL 1BREA 3P77A 3OKOB 4F7TA 3U9UA 3U1SH 1DUYB 1JPSL 5CWSA 4PRBB 4K3GA 3QHZL 3MRMA 1PD6A 3C08H 5FGCE 1MJ8L 2E5EA 1LWRA 5EU4B 4H0GA 4KZDH 2IQ9L 5ESQA 1KPUA 2MJWA 3WKNA 4YR6A 2DTMH 5IW6B 3G6AA 1CIDA 1X5JA 2FDBP 3VXUB 3RU8H 2VISA 5F9OH 3RNKA 4G6AD 5DJXB 3PIQA 1IGIH 3KS0H 4WHCA 4DZBA 3WLWC 4IBLT 3TFKD 4GMTL 4HBQA 4PY8J 1HHJA 4HKJB 4I18C 3K2UH 4V2BA 1RUML 4PG9A 3ZE0E 5HI4C 1YY8A 3NIGF 2Y9RT 4A6YA 1D7FA 3CJJA 1I9IL 1VEOA 5IB1B 5FA4A 1M7DB 5CKGA 3ULUH 1S5IH 2Z92A 3EO9H 4JFQB 2VZTA 1ZK9A 1DBKH 3PWVB 3RTQB 2EC9T 1ODAA 4JPIB 4LFHD 3TP4A 5F9WB 3BN9C 2NW2A 4G8GA 1TCRA 5GGVL 1Q94B 5GGRB 1YYLL 4N0FA 3SEPA 3JTSB 3MR9B 1NSNL 4JANA 4PRDB 5ADPH 4XVTH 2W0FA 1VGKB 1JF1A 1LK2A 1KJVA 1ZGLA 4RMSA 5J9PB 5D93C 3UJIH 1FZKB 3RWEA 1UKTA 3QWOB 2GTZB 4R0LA 1KNOB 2PW2A 5EU7E 5KTEH 4P46B 3BKMH 3W0WD 3OGCB 4LLYA 4Y16D 5CD3B 1TJGL 4ZMAT 5IK3B 4Y8DC 1DN2A 3P4MB 5HGBA 1BVKA 1F00I 1O5DT 1T6VN 3UTSA 5DJCB 3KPOB 3D3VD 1P4BH 3VFRA 1FBIH 4WI2A 1P84K 2Y06H 4I48A 5TQ0H 5C0AE 1MJ7H 5KSBA 2GAZA 3RZCA 1PG7L 5H8DA 3O8XB 3HUJB 5BQ7B 4B53A 3QG7H 5D1XA 2VUOA 2IG2H 2NY5H 4NN5B 3G6AB 3QNXB 4RGOH 3MLRH 3MFGB 3L3IA 2VLKB 3ULUF 1MNUH 3VGEA 1C08A 1UXSA 4NCDA 1UM5L 5CGYD 4P23C 1KTLA 3DX9A 5CEYA 5AG9A 3GBNL 3UTZB 2A1WL 2ZCLH 2M2DA 4OGAC 3FHQA 2AXGB 1A9EA 4OIBA 1Z0MA 2H2SD 4BQCA 1F6AB 5F3BB 3QJFA 3H7LA 2O61A 4PJ8C 1KGCE 1X5KA 5C8JA 4MB5A 3KWWB 5TE4H 4P0DA 4G8IB 3CFBA 2ZSVA 1HILA 2A77L 1KCUL 2DS4A 1YPZF 5JXAH 5ERWB 3C5ZA 5D96B 1PEZA 4BUHA 1MREL 3BIKB 3G9AB 1BVZA 2R69H 3MMEA 2BY1A 3H9YA 2WWKO 5GZND 5L9DH 4OF0A 2J8UE 1SEBA 5I0ZA 4UT9L 5EOCH 1LK2B 2DBJA 4IRJB 3EZJB 4K8RL 4PJDA 1GGUA 5D1ZC 2OZ4L 5T1KD 4MHHI 2OTPA 3N06B 4PTUB 1ES0A 5JA9A 4P3DB 4X6FA 5FGRA 2FEEI 4NNXA 1AQKL 2VWEE 3VXNB 1FPTH 2OTUB 1CFTB 1VKXA 5ICZB 5F8RC 5I2IA 5HGHB 2B5IB 3HNTH 4NSKB 3WDJA 1LO4L 3GBML 5HHOB 3W39B 1WFNA 1FN4A 3WFDL 3FFCB 1PGRB 3S98A 3MA9L 3CFEB 1RY7B 5TDPA 3ARFC 2PNDA 3JV5A 5DUBB 4ZO8A 4M5YL 3UBXI 1DEEA 1T0MB 1WZMA 4WV1A 4WDIB 2NY2C 4JO2L 2A6KA 1DE4A 3MRHB 4ERSH 3A67H 1LO2L 4OIIH 4NWTL 4Y4HA 3STLB 5FO9B 3VRIB 2PYED 4FQIL 4PR5B 4PJBB 3E8UH 4MQTB 2VLRD 5D7KD 1GH7A 1IAII 3KDMA 1SBSH 4N8CH 1HWGB 4GS7B 5E2WH 5F21B 4AT6B 4YC2C 1U9KA 2O61B 3CVHH 4L8DB 1SY6H 3WXWH 4DKFH 1CFBA 4EDWL 3PWUB 3RGVD 1V7NL 2YUWA 3EYOB 4QYOA 4PJAB 5C2UB 1A1OB 2KZ1B 5E2TL 4MDJB 1JZ6A 2GK2A 5CCKH 1FP5A 2VABA 5K9KB 3E3QC 3S88L 1CDYA 1WCBA 1OTSC 2LU4A 1W72L 3SDCA 4L4VD 3SO3C 2AQ3A 4ZDHA 1W2KT 4YNYA 5J1SC 4LCUA 1BJ8A 4P9HH 4RBPK 3T77A 3F6IA 4OFYD 4G6MH 4XBEH 2UUDK 4LLMB 1A7QH 1WV7T 1F90H 1UEYA 1MWAL 4YX2L 4OV5A 1MCKA 2VAAA 4XNZC 1TJHL 3DXAB 3FAWA 5HHPB 3IFNH 1BWMA 3U4BL 1D9KD 2P24A 4ZNEA 3NCEB 3HR5B 1NBVL 1GGIL 3HZVA 5EOQL 1EIBA 3N0PB 2R9HC 4Y5VC 4HLJA 4ZFOL 4GRWB 5BV7B 1SQ2N 2B2XH 1J8HE 4XPBH 3NIGE 1YJDL 2NNAA 3MBEC 2PTVA 4NO5B 4Q2ZB 3V5DA 1FVCA 5C0JA 3CSGA 3VDBA 5FKAA 3HAEH 1U8PA 2AGJL 2W0LA 3ARDC 1KIQA 3B5GA 3VXSA 1H3WM 2F74B 1YEJL 1MQ8A 2NW3A 4XPTH 4ORZC 4Y5XA 1DSFL 4QT5A 5E1AB 3C8KA 4BZ2L 2BZDA 1KB9J 4RGNE 4EI6A 1CU4L 4LLVB 5IV2A 5FCUL 1T21A 1FJ1A 4O2FA 4TVPL 4Y4KD 2A6DB 3SDDB 4OI9A 1YUHB 4UAOC 4NCC2 3BDYH 4LFHG 1X5IA 4HUKB 1HH9B 2X1XR 3QDME 4X4YB 1HHKB 3WJLA 4EIZC 4UI2A 4L3CB 5HJ3B 2FBJL 1T03L 3WN5C 2ZG1A 1HXYA 2I9LB 1E6JH 2CDEB 4ONFL 4WFED 1AGCA 1EUUA 3V4VH 4UQ2B 3FZUD 2VXUL 4Z76A 1CICD 2QHRL 1BFSA 1Q9LA 3DSNA 2ZOLA 1PKQA 4JDZA 1RIVH 1VEPA 5CJQH 3VWJC 3MA7B 4OF6A 1UWEH 2EXYC 1YMMA 4N0UE 4E41D 1CL7L 2JF1A 3GO1H 5MHSD 2GSIA 1DVFC 3RX5A 3QIWC 3T8XB 4ZYKA 2RBLA 5J11C 2VXSL 4QF1A 1RK1A 2P24B 3ULUE 1CQKA 1RZGA 3EBAA 3GMOA 4LQ1A 1U6AL 4FTVB 3STZB 5C9JA 5JXEC 5F7MC 1JN6B 1C5CH 3BXNA 1NMAH 2D3VA 2H3NA 5KZCD 2OZ4A 5D7LA 1JGVL 4LLWA 1TTGA 4Y1AE 2VXQH 4LVOB 1L6XA 4GOSA 1Q1JH 1P4IH 4OF8A 1KIQB 4XXCA 3GSWA 2VLME 3MJ7A 4HGMA 2ESVD 5GS3A 2VLLB 4XNXH 1QR4A 4NUJB 3KXFB 4P5TB 1IGCL 3FQXA 1YPZE 4KK5C 3DVIA 4DUVA 1FJ1B 1UWGH 2BDNH 1BQSA 2H1PL 4KQ4L 2Q76B 3L3HB 4X6BA 5JDJA 2CLVB 2VL5B 4PP2B 4KUCF 4PJ7B 3O81A 1RUQH 4PRIB 2HTLC 5E5RB 1VFAA 1G7IB 4LGRB 1HSBA 3ZTNH 1ZLSL 3DVGA 4UILH 3GGWB 5DWUL 2FIRT 1H5BA 4L3EA 5EIVA 1QLEH 3ZKXB 1G9EA 4CADB 1A7OL 4Z76B 1F3JA 3AMLA 3GSQA 2DKSA 4KUZL 5JDSA 2BVYA 5DVNA 4HH9A 2QADD 3UDWA 1AE6H 2VDRL 4RMVA 2WM0A 3MXVL 1DFBL 5DHVA 5IGXH 3LPWA 4MMXC 5DYOB 1W72A 3REVB 2Z31C 1RZKL 1XIWC 3O2DL 5GGQL 1ZAGA 3PWLA 3U0TA 1ACZA 5L6YL 5HHMB 3WFZA 3RPKA 2ZUQC 3GMOB 3VFPB 1BJ1H 2J5LC 4JB9H 5KVFL 5EFIB 5B4MD 1VADB 4U6XA 4XP1H 5E4IA 1MWAA 4M6NL 3HB3D 5EZIL 3RZCD 4B7IA 4LSSL 4AH2A 4RISH 1I7RB 5L2KD 3CCHA 2F58L 2CMRL 5I6XC 1FHGA 2DKUA 3TBVB 4F7MA 1WFTA 2HKFH 1KV3A 1MI5B 4OCRH 4PGDB 1LE9B 3A6BL 5I8OL 2CH8A 4M48H 1R3LB 1ZHKB 5CD5C 3EO0B 3TCLA 1CFQB 3F7VB 4ZFOA 4FRWA 4FQ2H 4PYGA 3V4UL 1FV1A 3OPZH 3QIUA 1FSKB 4HUWA 1ZT1B 4LCWD 4U1MA 3WUWB 1RV6X 4X6DF 2HVKA 5TE7H 2HLAB 3NACL 5A2LH 3VI4F 1NUNB 4LASH 3P4NB 1OGTA 3MLVL 1Z5LA 4JCMA 3AAZB 4RNRB 2AV1B 3CXDL 5D7JC 1FO0H 2KBGA 3C8HA 2ORBL 1NGZA 3FN0L 4DQOL 4H26B 4KRPC 1WEJH 4FXGA 2OM5A 4IRZL 3SJVE 5A1AA 1QUNA 2QQQA 3CZFA 4G9FD 3PGCA 1YQVL 4XH2B 1H5BB 4BSJA 1J1OL 3VFVA 2I25N 5I1DA 1A14L 1NAMH 2H8PB 4HIEA 3QG6A 4ZD3H 4F9PC 3ZZ1A 1NCUA 5IMLA 1YEIH 4ZG1A 3DMMD 3GNMH 5JORB 4XPFL 1LEIB 3RWCA 3KYOA 1DQLH 1XF1A 4J4PA 2ADGB 2D0HA 4HEME 5SV3A 1QFOA 3AXLA 5DJ6A 4U1LB 4ZPVB 2AK1L 1BQUA 3F7YB 1TENA 3VGHA 2C3WA 1M6OA 3C2AH 5CGTA 4G6AC 1OGAA 4HEPG 2YD3A 2BERA 3INUL 1MY7A 1OAZH 2PO6A 1S9XA 2J8HA 4OKVB 1UZ8A 1U92A 1IM3A 1T0NA 4ZUWA 4JFXA 2D31A 2R56L 3RWDA 4M03A 1WK0A 1WUNT 4K07A 2HH0H 4OV6F 3MPCA 4TNWK 3N85L 4PPTA 1CD8A 4J7RA 1RZJC 1KN2H 1YNTB 3HPJB 4MLSA 4PJEB 5F70A 4KK8C 2WANA 3GIVA 4K9EL 3BEVB 4Y4HD 5F8QC 4A2MA 4L9DA 1A4JA 3O0RH 2CLRB 3H9SE 4ENEC 1I1AA 5TDOB 5I18L 3TH2T 4ZFFA 1NLBL 1JF6A 1PZUB 4XTRD 1KPVA 1V3KA 4G43B 4PJHB 3QCTH 1IFHH 3X12B 3ARTA 1JV5B 5LAXB 4Y16C 3OB8A 1RUKL 2IF7A 4N8VG 3ULVD 1IGYA 3LKSB 2VE6B 2RJMA 4Q0XL 2MSPA 2DM7A 1G84A 3CDYA 3GMMA 4MXQD 3T65A 3U4AA 5MEND 4JN1L 4PLKD 2XNAA 2FZ3B 4HKZB 4KPHL 1B90A 5F9JA 3C2SA 4GXVH 2UWEB 2NZIA 4NQEB 12E8L 3OKMB 3P0VH 4I2XB 3QI9D 4XGZB 1QTYT 1DQDL 1UENA 3F62A 1M05B 3IDYB 5T1DL 5CGYC 5IFJA 2E9BA 4FZ8L 2P45B 3QEUA 3CDFA 5FA3B 5IB2B 3KJ6H 2EDTA 2H2SC 1PW3A 3GMRA 4R3SA 2EE6A 4ZXBA 3QDJA 3UPRA 5K9QG 3ZKSD 1OQXA 3UJTH 3RWJB 3OGOE 1A6ZA 2IJ0C 3VFWA 2DB8A 4FFWD 4YXKL 1JZ4A 3O2DA 4X98A 2HJLA 4C83B 3CMOL 3VXSD 3EGSA 1K5NA 4KKNA 2FSEA 2DQUL 2P5WE 4KROD 1IKFH 2DM3A 1R3IL 3UCRA 5SX4I 5M95B 5GZNC 4CW1A 1QSEA 3IDXH 4P2CG 4FG6C 2Q8BL 1WQVT 1KENL 4F37K 5C0CB 2ZCHH 1OAXH 3ARGA 4PJ5A 4MNGA 1U91B 3OKLB 2NQCA 3G5XA 2YK1L 1IVLA 3TPKA 2ENSA 3FQRB 1B6DA 1NC2A 1GXEA 1INEL 4JM2B 5HYJB 1WBZB 4F57L 3JWDL 4X5LA 1NCDH 4YXHL 4N90D 5ANME 3G6DH 5E94B 2VIRA 3I02A 3KJ4C 1EFXD 2BCKA 4XI5D 3OWEA 1I1RA 1QFWH 4K94L 4E5XA 3BKYL 3MLUL 4KKBD 3MZGB 4DVRH 3V5KA 2BOCB 4D0CA 5ISZE 5DD0L 3U0PB 3O41B 1CS6A 3UO1L 1KN4H 3H0TA 5CEXA 5EU6E 3QDGE 4W81A 3HCVA 4HUXA 3FRPA 1OLZA 4FQQA 2HFFA 2AW2A 3CSBA 1TZGH 5EC1A 5A43C 3A6CH 3HMXH 2D0GA 1A3LH 5I74C 5FUOL 3UROR 3OX8B 5CBEB 4OZIB 1PEWA 1C1EL 3JUYA 3C60D 2PCPB 3HE6B 4ZOCA 1X3DA 3TIDB 3WO4B 2F54D 3G6JB 4X6DE 1AGFB 3VI4E 4DW2H 1AC0A 1L4IA 1I3GL 1ZLUK 1KJ3L 1UXWB 3VH8B 1NMBL 1XGPB 3HG1D 4OQ1A 4L29A 3SGEH 3O9WB 1J10A 4X80H 1CE1H 2XT1B 1JNLL 3PJSB 3P30L 1M7XA 1T22B 4YHML 1MAML 4JG0L 4M6OL 4OZHF 1JWUB 4ZO9A 5IVXF 1EVUA 5DRNA 2X4UB 4M1CD 1CT8B 3FB5A 5MEPB 5EBWB 2GYSA 3FB8A 1YYML 1NCCH 3L3OB 2P8LA 1BLNA 25C8H 3MQIA 4AENA 2ZG2A 1D9KC 2IPKA 1MHEB 3TM6A 1QSFE 2CJUH 1A2YB 3SKOA 4PJIA 4DKEL 4IDLA 5E8OA 5EDXA 4EUPA 3LD8C 5KSAA 5D6DC 1J5OL 3MRNB 1T89A 4WCYH 5KS9B 4UNVA 5C08B 1LDPL 5I19H 2APWA 3DV4B 3GEWB 2BSTB 3MYJB 4OLYH 3AS0A 3TO2A 3OG6B 3IXAA 5EU3B 1S9KC 4U6VL 2HRPL 2IQAA 1PX4A 1PYWB 4XCNB 3FT3A 3MV7E 4LHJB 1LO3L 2DQCL 3GM8A 5F44A 2KQNA 4ZUVB 4ISVB 4M4PA 2VXVL 4JG1H 4QOKD 3U4EB 5HDQL 3IDIA 3LRSB 1SJEA 5FYLL 5JW5B 2ZUUA 2X4NB 4Q9RH 4EXKA 1WAAF 2XQBH 3GSXB 4Q9CA 5J56B 2HT3D 4Y4KC 4EDXA 4NHUB 5HHVL 4ZSOA 3ARXA 1RSFA 5D2NB 1E4XH 4BQ9A 1EHLL 4BQ6A 3QPXH 5FECB 4AIZA 1T3FA 1DQMH 2NY1D 1KSRA 3VFUA 4MSWB 4ZO6A 5ESVB 4GG6B 1BQHG 3B9VA 1CN4A 3BSZL 2GCYA 3PP4L 1Y0LB 3SPVA 4X4ME 1QQDB 2OBGA 1ZT7B 3IVKB 4PRHE 5SWZA 1B0GA 5IOPB 2LTQC 1CICC 3U48A 1CD1B 4D94A 4MS8D 2X4RA 5T3XH 2OL3H 4DKDC 1LD9A 5KANG 4UOJA 4HIJB 1E4WL 3VXMA 4DGIH 5BS0E 5J6GA 5ITBH 3LKOA 1BLNB 1N7ML 5KAQG 3ECBA 3WMSA 3MUGB 5IBUG 5DGQA 4WHDA 4YDJA 2C1OB 4JHWL 1SJXA 4GMSL 3O6FA 3GK8H 3RWGA 3JZ7A 2PXYD 1KC5L 4D9QD 8FABA 1CXKA 5IBLD 5F7WC 2GJ6D 5I1IL 1P84J 4LSUL 4KV5F 1RFDH 2A6JA 5LWYH 1N6UA 4AEIL 2XKSA 4UTBH 4HIXH 3TO2B 1E6OH 4GQPH 1OW0C 1UM6H 2EO1A 4FQXD 4GAGL 3FO1A 4J4PD 4P9MH 4UDUB 3FMGH 2WIIB 3O2VL 4QO1A 3MV9E 4YHYC 3UTTE 1KCRL 4EEEA 3UC0L 3O6KL 3FQWB 4P4KB 1NGYB 4MB4A 4NKOA 2FGZA 1OVZA 4MA3A 5IW1B 1J0YA 2X1WL 5FV1L 1NQBA 2XWJA 1HDMB 1MCPL 3D9AL 1KT2B 4JRYE 4S1DC 2Q6WB 1G7JB 2ICWA 2PTTA 4YE4L 4PB0H 1IMHC 4G9DA 1T83A 3VXTA 3FQNB 2BFVL 4OZFH 2JIXA 1PG7W 1D5ZA 1U2CA 2L7UA 1S9YA 2IFFL 2CDGA 3W9DA 3BQUA 2BNRE 3DROA 1T7WA 1YNLL 5KVMC 3IETB 1BPVA 1AY1H 4RFOL 2J12B 5MI0B 4I9WE 5EO1A 3BPCA 2W65B 5CIPH 2QADC 4JO4H 5H37H 1T4KB 1EEZB 1RUPL 3QUZA 1EEYA 1NPUA 2B0SL 4Z0BH 5C0RH 3O3EA 4UTAL 1CDIA 4EQ3A 3TWCL 1DQQA 4H8WC 4WEUD 5F72S 1QKZH 5C07D 3KYAA 1UQSB 1RMFH 4OM1H 3AREA 4OF5A 3RNQB 1BAFH 4P59H 4X99A 3RZCC 4PREB 2VITB 3VXRB 4QRPE 3L3JA 4J2XA 4TSBH 1MRFL 1FIEA 2WBJD 3GKZA 5KVEH 2CKBL 2KQMA 3FT4B 5D6CA 4R8WH 1L7TH 2HT2D 4GJTB 4LLUA 5TF0A 2FR4A 3CPLB 2VDML 4G5ZH 5CGMA 4S2SA 4GXUN 3QRGL 4E42A 3T0ED 1T7VA 1MPAL 3BN3B 2EDLA 1UJ3A 5FHAL 1I1FB 3N1GC 4MX7B 5ITFA 4JO1H 5MP6L 2HTKD 4OLEA 1U8HB 2Y7QB 2VR5A 3NMEA 4OZHE 2DM4A 4DK6A 5C2BH 2QQLH 4LDLB 5IVXE 1L0XA 4NQDE 4WI9A 4H20L 3QNYA 4GW4A 5E99H 2LVEA 1UCBH 2VXTH 4S1RL 4N1CA 1V8HA 4UB0H 1X5XA 3G5YA 2LQRA 2CXGA 3CFIC 3KPMA 3MRKB 4TVSa 1G9MH 5DEGB 2AK4D 3WNPA 1AQDB 1HINL 3DTXA 4RFNB 3U36A 4TUKL 5FOBA 4D9LL 3HE7A 2X89A 3DMMC 3V52H 3K74B 4PJ5D 4HSQA 5TGBB 4N8PA 5FYJH 1EHAA 4XCYA 3K8LA 1FAIH 3T0DA 4GW1B 4OGXH 1ZGLM 1NBYA 5GISH 3HZMB 1FNAA 4WI5A 4QRTA 3W9EA 2YA1A 3V5HB 1JHLL 5DQJB 2V7HA 4P2QD 3SCMB 2FX7H 3L95B 3OAZK 2CGRL 3PWPB 5KN5B 4XP9L 2ED7A 2R2HA 4M7LH 3QEQA 4Y19B 1D5IL 1WAAE 4KVNH 5EO9A 4HWUA 1CXIA 3GSOA 4KAQL 3HR6A 1HQRA 1B0WA 4NWUH 4WV1C 2OS7A 3L3JB 5DK2A 1RU9L 4JN2B 2WLZA 2HJKA 3IDGB 4UT7L 4F80A 3PQYE 4PV9A 3F12A 5BZWA 3GHBL 1A0QL 4AMKH 1H3PH 1JNNH 1P2CA 2R15A 1NDMA 4Y4HC 3HPLA 4XAWH 2Z8RA 3NCJL 4R26L 4KTYA 1A1NB 3IFPA 1PQZB 1YEFL 2R2CA 2I5YL 2DQFB 2YPVL 1C5DB 5C7XH 4DOHE 3WNOA 4CVZB 1MFEL 3QQ4A 2QKIB 5BOPA 3DIFA 4FOMA 4M6MH 2J88H 3FQTA 1D6VH 1K8IB 3DHMA 2NY3D 4HBCH 1DQJA 3KPSD 4I3GA 1Y6KR 3MV8B 1J1PH 2FWOB 1MFBH 1EA9C 1WTLA 3KLAB 3RX8A 1CFVL 4HG4K 4YDIH 3ULVC 1BEYH 1T7YA 1X5LA 3SE4C 2FATH 3GBLA 1LK3L 4V2CB 2C3XA 4O5LL 2BNUA 4P5MB 4P2OB 3SDCC 1L9NA 1L0QA 2EECA 3IYLW 3D39D 3D85B 4K3JL 4PLKC 3DTXB 2O5XL 3KNBA 5DD1H 5FGCB 1NFIB 1WWBX 3R1GH 5D1QA 4KV5E 3D2UA 1N8ZB 4YK4B 1YZZA 1U8QB 5E70A 2B1AH 5CZKA 3QI9C 4JDTL 4MAYD 4PJ9D 2XN9D 5C70A 1EO7A 5DUPH 3FTGB 3MGOA 1YEEH 4IHOA 2X70A 4OUUB 1S9VB 1Z0NA 2AP2A 2EDHA 1I7UA 1S5HA 1HCVA 3MFFB 3B2UD 4NQVB 4U1IA 3QJHA 4YPGA 2CIIA 1IQWL 5DD5H 5B38B 3OAUL 4BUGA 1ZEAH 5EN2A 3RAJL 2DOCA 5E8EB 2FX8L 5GRUL 4ORGA 4FFWC 1ZA3B 3LMJH 4K3EL 4RSVA 4OD1L 4WUUA 5IG7B 3GJFH 3LH2H 3RUGB 1F4XL 3CX5J 4KROC 1IGJB 1UA6L 3B9DA 3TPUA 3SY0A 1P2CB 4Y5XC 1RULH 2EEAA 1I9RH 5C71A 4JQIL 4NO3A 4JZNA 5FYKU 4BFIB 4Q9BA 3DVNA 3PABA 4LPCA 2CRYA 5AZEH 4RRPA 2NXZD 5FAAA 2FO4A 1XR9B 3K81A 4AG4H 2YD6A 4J6RH 2CKBA 5K9JL 4YDLC 5KG9A 2IGFH 3LKNA 3C09B 3LAFA 3WJLC 2APTA 5KJRH 4FZEL 4Q97A 1N3NA 5F71A 1DBJL 4WNQB 1HQ4A 2VLJE 3WFBL 3EOAB 2XA3A 3ZDZF 4R7NB 4DTGL 3N9GL 4XHJD 2BRRH 3TA3A 3WLBA 4QY8B 4KKBC 4R2GD 1OAUL 4OLXH 1FYTA 2O5YH 3UJIL 3T4YA 2IALB 2XXCB 4NO0B 5IESH 2NXYB 3X14B 4IOIB 3VFNB 3BKJH 3I2CH 2A83B 3BW9A 5T1LA 3AS1A 2FGWH 2YRPA 5D72H 1R0AH 4HMDA 2CK2A 1MQKH 2V5TA 4ZAKA 4WFHE 1LQSR 1TZIA 4NT6A 1PY9A 1I7TA 1Z3GH 1T1WB 1WBYB 3WHE1 5KVDH 1I7UB 2ENYA 5C6TH 4K8RC 2I9TB 3QISA 5JPNB 3C60C 2I07B 2IG2L 1C8PA 3G9VA 5JHDD 2IAMB 2H32B 4G8FA 5F93C 1R5WA 3D0VA 1NEZB 2R0LL 1FZJB 1MCNA 1F42A 4U1KA 4NZRH 3MRCA 1OWWA 4ELMB 3B9KB 3IU3A 3RL2B 4YHLL 4MA8H 1FZOA 2Q7YB 4L9LB 2DD8L 4H25A 4EI5B 1MHCB 3JV0A 3S5LB 1ORQB 3MRGB 4KQ3L 3BGMB 4M1CC 1AO7D 1OARH 3O6LH 2VQTA 5A40E 1J11A 1T2JA 1OB1B 3P73B 4YQXH 1GPOL 3K8KA 2ICES 3X11A 3U30C 2AEQH 3W81A 3BZEA 2DYPA 2UZIH 4C58B 2DLFH 2ICEA 1J9CT 5INCA 1G6RL 3QIBA 3OR6A 1HQ4B 3P0GB 3WBDA 3TNMA 3RQ3A 1JIBA 5TQ2H 3P40A 4C56D 3MRIB 4LPUA 2VR9A 4HKXA 8CGTA 3F7QA 5I1EL 3BHBA 2VTFA 2WBWB 4AEHH 1Q9KA 5CLTA 1KB5H 3DV6A 1AIFB 1WWAX 4L4TD 4OSUL 1HE7A 4HJGA 1VACA 4DUWA 4X6CF 3QEGL 4QHLA 1FDLH 1K2DB 1BD2B 5E7FA 3EDKA 2EKSA 2FEDD 4JGJA 1ZVSB 3V7MA 5IEHA 4R6UA 2HT3C 2V9TA 4IIQC 4XNMA 4HCRL 3ARED 2UY6A 4HHAB 1ZLWH 3RIAF 3BT2L 5EC2B 5F96L 3G5VA 1GC1H 5C0DB 4GFTB 1KCKA 2NY1C 4DFHA 3R0NA 4YXLL 1TQBB 2W9EH 3KYNB 4OIIL 1U8OB 3BVNB 3DYMA 5FYJE 4Z8FH 3OKNA 1I1YB 1EK3A 1SBSL 4YBLC 4F58H 3VFGL 5FO8A 1YJDC 3EOBA 3LKRA 3K4ZA 4MS8C 5CSBA 1JJUA 2AI0H 2WK2A 1KEMH 3KPQA 1MHPL 1BFOA 1JWSA 5AEAA 1P1ZA 3OAYH 3OHXB 3NH7L 4EN3A 4XCCH 3VXUD 4ODTH 5DJ0B 2VERN 4CNIA 4JRXA 1KCVH 4K71C 3C9NB 4GLRI 2O26U 2W91A 4JY5L 3RIFK 1J86A 1LP9B 1SMOA 4Y5YC 4JFFE 1T1ZB 3NN8A 2C3VA 3WSQL 1Z9MA 5IBLC 5EPMB 3DUUA 1JRHH 1TZHA 3SGDI 1XGQB 2R2BA 4UT6H 2QSCH 5D5MB 4PGCA 3OKKA 3RL1B 4R4NC 4FQXC 1J8HB 4J4PC 2MCG1 4BK4A 2FJGA 4Z7OF 4Z77B 4PTTB 1N64H 2YEZB 4PRPA 3WFEL 1YEDA 4OZGB 1S7QB 1R5IA 5JZ7D 4F15B 3BZ4A 2AABH 1S7VA 5I76A 5C3LD 4RGNB 5AZ2L 1R3JB 1FL3A 3TJHC 2YMXH 1G7HA 1UH2A 1MUJA 3MNZA 1LMKA 1RZIB 3BDBA 1JGUL 2QLVB 5F7NC 1J88A 3PHQB 3SKJH 3IAQA 1Z6JT 3D25B 3VW3H 5DVOA 1JZ2A 2PYFB 4QHUB 1ZANH 5DJDB 1A7RL 1YN6B 4GBXA 1EJ6A 1U93B 4A6YH 4U1NA 2VAJA 15C8L 4O2EB 5L2JB 5C0EB 1J0ZA 3ZDZE 3JWOC 1WF5A 1ADQL 2VQ1B 3QUYA 4GRLA 2VDOL 4NQCE 4X5WA 2YN5A 1HHGB 5E0QA 3OR7A 5IR1B 3O8XD 4RIRA 2UYLB 5GS1A 3SKNA 3BP7B 3D5OF 5DD3H 2X1OA 2ZKHL 3S6CA 4LF3A 2EIBA 1U8LB 4MD4B 3MGTB 1E0OB 1XGTA 5E00A 4JPVL 4N0UB 1T6WA 4I77H 2P43B 4LSDA 4OLZH 3DGCR 5B22A 5GJTH 4OAWB 1UEMA 1XCTA 3S36L 5GRZA 2R4RH 2IC2A 2YKLL 3M17B 4ONGH 4NKDA 3MJ8B 4Q9QL 1FFPA 4YHNA 3SDYL 3SE8H 1S78C 3L3GB 4I0PB 4H8WH 1G6RA 1OSPH 4FFYL 4P48A 3LIZL 2WBJC 3QT2A 3I6GA 3M1BB 4XC3H 3O3UN 4OD3H 2UV3A 3MBXL 4TTDD 3GI8H 3S37X 3QHFL 1U58A 5CILL 3BH9A 2RGSA 4PY7B 1KLFA 1C5CL 3T0EC 3GI9L 4KZEH 1MVUA 2EYSB 2Y4SA 3QNZA 5ESAB 1A3RL 2HTKC 4IRJD 4ODHH 1XH3A 4BH8A 4ZXBC 1DP0A 1P4IL 4P5KB 2J4WH 2X10A 3HFMH 5HYQB 1XF5A 3VGAB 4OBRA 4L8BB 4V1DE 3ES6A 4MZ3A 4L4JA 3BPNC 2FECI 1FGNL 2SEBB 3GKWH 1AXSB 4LHUG 4KJYB 4NQXA 2DWEA 1UKQA 5F1KC 5HHOD 4HCRA 4JJ5B 1OT1A 4FFZL 3TO4A 3FFCD 3V6OC 2BDNL 1JHTA 4HF5H 4MCYB 2DQHH 2Z91B 3VMNA 1MCRA 3DO7A 5E8NB 2N56A 2V9QA 2FIKB 4G42A 3WFCL 1JZ8A 1P53A 1DLHA 5EOTA 2XA8H 3SDAD 5E2VL 3GUTA 2EE3A 1N59A 5IEKA 4WFGE 3BUTA 2NX5E 4G6KH 4LOUD 2J1KA 5H94A 1PY4A 4KKLD 3V8OA 4X6CE 5C0GB 4NBYB 5HPMA 5MEQB 2IPTL 4KMTH 3VRJB 3I9GL 5KSBF 1G0DA 4H1LH 4K2UL 1MRCL 3NFSL 1EAPA 3THMH 4J8RB 4OLVL 4OGZA 4CDGC 5E8PB 1UYWH 1JNJA 4HDIB 1F45A 4EZMA 3AFLA 1WT5A 3U2SA 1N2RA 4WFFD 4WO4B 5CEZH 4PRAA 2OLDA 3ULSA 4HPOH 3IFOA 3ILQD 1MCOL 1ZS8A 3SKMA 2NR6D 4TSAL 1HKLL 3IU4L 3GSVB 3ZHLA 1YEHH 4TUJA 4MNQE 5BZDA 3QH3A 4XP1L 2A6IA 1NCWL 1FGVL 3T08A 5J12C 1XT5A 4PJXA 1NGQL 1GVIA 2MOVA 3Q3GB 1JPSH 1GJIA 1RZ7L 3B9AA 3P0YL 5HYSA 1G1YA 3QHZH 5EBLB 2GY5A 2NY3C 5IF0A 5E6IB 3DXAD 4QRSB 2IQ9H 3TN0A 4NJAL 4QHNA 4DGVL 1HNFA 5SWSE 1FFOB 4XHQA 2X4TB 4ELKA 3NTCL 4HLZG 1OSZA 4X5XB 3JVGA 1KACB 2X42A 3NA9L 4PJDF 4IMKA 1B4JL 2IPUG 4GMTH 1ZA6A 3QZWB 4HS3A 1RUMH 1VHPA 2Q86B 1E27B 5C09A 4QRRA 2W60B 3QB7C 4LL9A 5JQ6L 2ERJC 4LLQA 4MAYC 3TYGL 5DD6B 1I9IH 4UOW1 4KHTL 4XNYL 3C5JA 4R96B 3QIBD 4Y4FA 1ADQA 1XR8B 1U95A 3D1MC 2VKXA 4Z7OE 1WBXA 1IBGL 2MKLC 3BISA 1A21A 1NAML 3CVHB 5BVPL 4GRWF 1C7TA 3SDDD 5BW7A 1SYSB 3C5SB 5KSAC 5GGVH 1G7LA 3FHAA 1T89C 5T3ZL 1YYLH 1X5ZA 4DZ8A 4I0CC 1DN0B 9CGTA 1U8NB 4QTHB 2OQJA 2ICWJ 4HAGA 1MIEL 1IL1B 4RBPH 4I0KA 3V0AC 4KXZH 3HC0A 3PWNB 2FX9L 2UUDH 3O6ML 5BRZB 1NAKL 1PFCA 1TJGH 2NXZC 1JCKA 3QFJA 4M7ZC 2PR4L 3LKPB 4NP4L 4Z7UA 3CC5A 1V5JA 1IEAA 2EH7L 2YBRB 3QHTC 4ZUTA 4M93C 5F88B 3KR3L 3Q0HA 3RFZC 2WUCH 3PWJA 1GZPB 3LV3B 2H6PA 1ONQA 2YD9A 5HTSA 3WIIL 1RIHL 1PG7H 3CSPA 4JREB 4PFEA 2VDKL 4O51B 4Q6IA 4XHJC 4FTVD 4JLRA 4MWFA 4R2GC 3HAEB 3T1FA 1UM5H 4LAJH 1AKJA 2K7PA 1T5XB 1BIIA 2V5YA 3KPNB 2GITB 3GBNH 4N68A 2A1WH 3QULB 5EBMA 4ZQKA 4UMGA 4I3RL 5CINL 4QXGL 4ETYA 4J23A 1KFAL 4NRXA 4EN3D 5B3JF 3U79A 2D0FA 2E8YA 5DA0B 2VLKE 3L3DA 5IVZB 2W07A 3ARUA 5C0IA 3S4SB 4P4RB 2A77H 1D5BA 1NLDL 1MF2L 4ODWA 4X9GA 1KCUH 4JKLA 3L7FB 3QXDB 3DUSA 2R1WA 2BSRA 2G9HA 5DS8B 1MREH 1QFHA 2ZPKL 1OQOA 5LGJA 5HHQB 3HKFA 3TH3T 1GSMA 1XGUB 3V9FA 4PRID 3P0VL 4HGWA 4JFEA 1E4KA 3JWDC 1F2QA 4UT9H 1HEZB 3SOBL 3VMPA 4K8RH 3TVMA 3LZFL 3P9WB 5AUMB 1DR9A 5I30L 2OZ4H 4K94C 4G8GE 1A6PA 3X3GL 3ARQA 5C6PB 1NBZA 1M71B 2P5WB 4PV8A 4PJFA 5BXFA 1N5AA 4YBHA 1AQKH 3U46A 4HK3N 3NAAL 4BSVB 4R7DA 2OYPA 4FQCL 2X1PA 2CDFB 1LO4H 1QFPA 1ZHBA 3GBMH 4MJIA 5I8CA 3MA9H 3MODL 3TNNB 2Z0BA 4WGWB 3RKDD 2NY4B 2C5DC 2EYRA 3TZVB 4M5YH 2XQYG 2IH1A 2R1XA 1I4FA 2MWCA 3MLWL 4ZNCD 4GBXD 5HHMD 1KG0B 4DCQA 2ED9A 3EYFA 4JO2H 3DRQA 3UTSE 4ZTPH 5JPMB 3L7EB 1FNGA 4AYFA 5C0FB 4Y2DA 3C8DA 1LO2H 1CLZL 3KPLA 4NWTH 5LKNA 3VFMB 2C7UB 2EDWA 3V7AG 5KSBE 5CSZB 3QQ9D 4PBWD 1EBPA 4FQIH 5ISZB 2X7LB 1TFHA 2HP4A 3VFSA 3QCVL 1G7QB 1TQCB 4YDVB 1Q72L 4GW5A 5EU6B 3QDGB 1MI5D 5DA4A 4WW2A 3KG5A 1S7WB 3G04B 5E9DA 3VFOA 3QEHA 4QCIB 1T1XA 4PGBB 2DRUA 5ID1A 1V7NH 2DQGL 4ODWB 5CS7A 5E2TH 2E7MA 2V5MA 5E08L 3AREC 3WNKA 4IEFB 4IOSD 5FKPB 2AV7A 3S88H 1QACA 2A73A 5DHVH 2QSVA 2WQ8A 1W72H 1JUFB 1GGYA 4LQFH 3LEYL 4HW6A 1A64A 3PGDA 2DL9A 4YHIA 1A7PL 1T5WB 4WEBL 2B4CC 1U8MA 5DMJB 1NAMA 3LQAL 2FYYB 3GSUA 2DWDA 5F89A 4W70A 2UY7A 2BY0A 4U4BA 3H8NA 1MWAH 4YX2H 4TQEL 4N0YL 1NBZB 5BXFB 4ONHA 1TJHH 1FAKT 1QO3A 3QO1A 5DSCA 3U4BH 5GIRB 3QUML 3IB4A 5F7DA 2XZQL 1FFNB 2R29L 1EH9A 4PJDE 4C4KT 1NBVH 1WZLA 2F53A 1GGIH 5EOQH 1OTTD 1RURL 3PNWA 4M61A 3ALPA 4YFEA 1EX0A 1YJDH 5ACZA 4F8TA 4KRLB 1I4FB 4I4WB 3HI1B 4ZO7A 2AGJH 4MYWB 5CEZE 4PJGA 3TO4D 1YEJH 4S0TD 5F1NB 5F6HJ 1QR1A 1NFDA 3HNVL 4RFEB 4JDVB 1DSFH 3KPLB 4BZ2H 4GRWE 1IRAY 3HTLX 1CU4H 2JELL 2E7BA 5FCUH 1NCCL 1ED3A 4NN7C 5T5NF 4TVPH 3SE3A 1A4KB 4P2RA 4LBEA 4MMZC 4FABL 4D9RD 4DN3L 1VPOH 4Q58C 1TVBA 2CKNA 4O02L 1QEWB 1NCNA 3MV7B 4O2CA 5JZ7C 7FABL 3I50L 4WWKB 2LU3A 3MC0A 5GGUA 2FBJH 1FO0B 1UG9A 1T03H 5LQBL 4OLYL 3QFDA 3C87A 5JOEA 5EZJB 3P11L 4ONFH 4OCWL 4TUOA 2D03L 2MQ0A 2VXUH 5D71L 3HI6L 3O3DA 1NAMB 1HXMA 3T4AA 1B0RB 4KHXL 5F1OB 3ZT7A 3RZWA 5DJ8B 2BX5A 1CL7H 4BELD 3PHOA 1AGBB 4RWYL 1X4ZA 1OF2B 4ZPTB 2VXSH 2K9UA 1XF2A 4PRHB 2DMBA 4G6FD 2NYYD 3O8XC 5C0BA 4APQA 1U6AH 4GUPB 4CVWA 5A3ID 4NZTL 1J05B 2RIKA 1JGVH 1I8KB 3MRRB 5JQHC 2VZVA 2NTFA 2ZSWA 3L9RA 5DHYB 5B3JE 2JK5A 5BS0B 3MREB 4KJWD 3DHJA 4ZNEE 5GHWL 5E7BA 1OP5K 1L7IL 4P23A 2HG5B 5T3XL 4JKPL 1SJHB 4I18B 5GGSB 3F7RA 4LP4A 4GRMB 1IE5A 2FH8A 1IGCH 1UGNA 2E9WA 3LDBB 4DN4L 4TULL 4FQPA 3SGJA 2H1PH 3O11B 4TTDC 4JO3L 3RX7A 3VXSE 4QRRD 5D96C 4HX1A 1JGEB 1MH5A 1H8NA 3FQUA 3KXFE 2G2RB 4UUJA 4ZUUB 5DMIL 1BX2B 3MV9B 3BFOA 3LS5L 5C0CD 3FT2A 3QXUA 1ZLSH 1U0QA 1FL5A 4GAFB 1XF3A 5DWUH 2A2QT 3JUZA 1F3DJ 2ZCKL 4TN9A 2W92A 4FFVD 5SWQA 5GRWA 2I60L 1A7OH 5D93B 4JM2D 5HYJD 4KUZH 2V7NB 4EXPX 3O3DB 4H88L 5IP4A 1AI1L 1Q0XH 5TDNB 2VDRH 2HN7A 5HDBF 3MXVH 1DFBH 1F58L 4TNWF 5B39A 4IMLB 4PUBL 2BNRB 1YDPB 1RZKH 5KSUA 5CUSL 3O2DH 4LDEB 5GGQH 1PKQE 2WMPA 5K9OA 3SDAC 1C12A 3UZEA 5KVFH 1YMME 3FKUS 2DF3A 1VFBB 2P46B 4LOUC 5I8KL 1PJ9A 1IM9B 4K3DL 4M6NH 5EZIH 5L7XL 3TBSB 4LSSH 3O3AA 2V2XB 2ATKA 4KKLC 3WUZA 2F58H 3HA0A 2CMRH 1HH6A 3QUMA 5I17A 2A9NL 4DGYL 3OBAA 4OLWL 3WFHA 1MIML 3A6BH 4GS7C 1IC5L 4G3YL 5D7LE 3HE6D 1T66C 3CFKA 1K85A 5DMKA 1AFVH 4PJ8B 3VWKA 4TPRL 4NYLA 4NRYA 3WUWG 4ODVL 2FL5A 2I24N 3KYMB 3NACH 3ILQC 1QRNA 4LSVL 4Z78B 4U1SB 3MLVH 2JTDA 4YHOL 3O9WD 3CXDH 3IDNA 2ZP0T 3FN0H 2ORBH 4UUJB 4KI5F 1CG9B 4DQOH 1K4CA 1BAFL 4YHKL 1MEXL 4IRZH 1VA9A 5JMOC 4QRQB 5F7EL 3G6JF 4YGVB 1YQVH 3FOMA 1J1OH 1A7NL 2BVQB 4R8WL 3T0VA 1A14H 1PG7X 3AB0B 1YN7A 2D7PA 5D1ZB 4OZHB 1RUAL 3KS0J 3PV6A 4Z7VA 2HT4C 5IVXB 3WL9B 4XPFH 1F13A 3CUPB 4NQDB 5HGDA 1WZKA 1DJSA 3IRZA 3E6FB 4L3EE 2AK1H 4XCEA 5BV7C 3KLHD 3INUH 2DKMA 1M7IA 2GUOA 3ROLA 4ODUB 3BP4A 4Y5VA 3ARFB 1U3HB 2ITDB 4CVXB 4JFDA 4E0RA 2ZOKA 5ILTH 1S8DB 3MBEA 1VB9A 1NDGA 4NZJA 1UM4L 1JHKL 1P7HL 2YZ8A 2R56H 4ZS7L 4F37F 3QSKB 3H42L 1L9MA 2IH3A 1MJUL 3QIBC 4LSRL 4OKDA 4AL8L 3RVUD 3ZO0A 2YUVA 2VC2L 4N9GB 4JPWL 1XGRA 3CH1A 1QLRB 1MLCB 4XPHL 3SDDC 1ZLUH 4FNLH 2VL4A 3O2WL 3T0XA 3ABZA 4MJ6A 1RIUL 4K9EH 5HVWA 3OJ2C 5CJOL 2WINB 3MRPA 3HRPA 5HGAA 5GRJL 1AHWA 3ROOB 5K9QI 1F11B 2Y1VA 4TNVK 4YC2B 2R0KL 5I18H 3P9MB 4EVNB 1PZ5B 2MKWA 4EUPH 3WEXA 5E9DD 3MO1B 3IXTA 3CDGB 5I8EB 5DFTA 3KPRB 3HRZA 3WN5A 1CXEA 4OT1H 4NO2B 3IF1A 4Z6AT 4OJFH 2NY7L 1ZLVK 4Y8AA 3SO3B 5CZXD 5JOFA 1FL6B 4Q0XH 5C0AA 4JKKA 1S7RB 43C9A 4UQ3A 3DI3B 3VWJA 3I75B 4JN1H 5HBBA 5DQ9A 4NHCL 2YPLA 1OD9A 4KPHH 3QA3A 4Z7VB 4L3AA 1JPFB 3HZKB 1DVFA 3FONB 3LQZB 4TVPE 12E8H 4D0DA 4M00A 3IDMB 5CBAA 1RZJL 3EFFA 3QAZC 2X9WA 1DQDH 4HFWB 2J88L 1OOAA 5JXEA 5T1DH 1INQA 4WU5B 4FZ8H 2QEJA 3E2HB 4WI4A 2IADA 3CK0L 3DPBA 4HV8B 1LHZA 5HHXL 4NQEE 4EN3C 1KF9B 2C4FU 1ZSDB 6FABL 2P5EB 3PE9A 1J1XL 1GGTA 1UWXH 3ARDB 4HMCA 4M8QA 3VDCA 4PJIF 1OGAE 5LGHL 5DJAB 4YXKH 3BP5B 4P4KD 4HUVB 3CMOH 2MQCA 3CH1B 3WIFA 2VMFA 5EOCJ 4NPYA 2X41A 1QOKA 2DQUH 1AGEB 2IBGA 5J4MA 2J8UA 3B83A 1R3IH 4WI8A 3TESA 4HK3J 5TPWL 2Q8BH 4NKIL 1KENH 3O4LA 1FVDB 1EO5A 2WAHA 4Z5RB 1B2WL 3H7BA 5ENWA 3TH4T 5ELIA 3QCUL 4W6YB 1YEEL 2AEWA 2YK1H 3MROA 4U3XA 4L1HA 4CMMA 3LEXA 2OL3B 3L5WB 3QUKA 3ZKXC 1INEH 4F57H 3JWDH 4NC1C 2AJZA 4YXHH 2YD5A 5HDBE 3NCFB 1SYVA 1OCWL 1WITA 5I1HL 1FNEA 4S1QL 5IB5A 3DYPA 4K94H 3BKYH 3MLUH 4W4NA 3CNKA 3QYCA 3FB6A 4LCCB 5JW4R 2MTPA 3MLSL 3RKDC 3UO1H 2YC1B 4N0CD 3P9LB 3K3QA 3U9PL 1ETZB 3V0VB 4GBXC 4JFOA 3MNWA 1P7QA 3QIWB 5J11B 3LPGA 2P7TB 4XC1L 4HXAL 5DTFB 5J3HD 4LPYA 4XB7A 3QQ9C 4U1JA 3CVIL 5FUOH 1KJMA 5GS1C 1I3VA 5C1MB 3TV3L 3VXRD 4APQD 5HVHC 3REWA 1C1EH 1J12A 2X9XA 2V2WB 1BBJA 3F5WA 4P57B 3E6HA 2GT9B 3CFJA 1QBML 1I8IA 2IANA 3GMLA 5DO2C 4OLXL 4I5BB 2EDFA 5FB8B 3NZ8B 4NM8L 1KJ3H 1NMBH 4KI5E 1RJZA 4OZFB 3VH8G 3QDJE 1Q9WB 1JNLH 1D5MA 1KTDA 1YMHB 3P30H 4X7TB 1H15A 3G6JE 4YHMH 4BZ1L 4JG0H 4M6OH 1EPFA 5JHLL 1BWWA 2BMKA 4EKXA 2BVOB 4U6YA 5F1IA 3GJEB 1WTGT 1B88A 3TBWA 3LN5B 2HFEA 4NQSA 4ZUSA 4JVWA 3MSPA 1G7MA 1QSEE 5CHNB 5CIPB 3WIHL 3BX7C 4MD5B 1BJMA 3IKCA 1T2QL 1GYAA 4C59B 1QNZL 3BO8A 1S9WA 4MNGE 3VXQB 4QRUB 1NUFA 3SDXA 4F9PA 5F7UA 4DKEH 1B6UA 1OL0A 5L0QC 5DRWA 3BIBX 1FNSH 1J5OH 4DVBB 1MFCL 5GJSL 1LDPH 4X0KB 4HZLA 4POZD 4U6VH 2HRPH 2FJFA 3NFPB 2Z31B 4P49A 3TO4C 1XIWB 3PWPD 5F7FA 4I3SL 1LO3H 2DQCH 5I1AB 3IKKA 4F3FB 2VXVH 4Y19D 5HDQH 4YQXL 5FYLH 4YEEA 4ALAL 2J5LB 5C08E 3NABL 2XG4A 3G5ZB 1A6UL 3EJZD 1NC4B 2FHCA 1S7SA 5ETUA 5HI3C 3QDMA 5HHVH 2AKRB 1K8DB 1HHIA 4RDQF 4QXWA 5I6XB 1EHLH 4U7SA 5DJ2A 5F6IB 1UVQA 1D6EB 4OI8A 1A47A 1JGLL 3DRTB 4AEHL 2D4DA 3BSZH 5KW9H 3PL6B 3QXVA 3MCLL 3PP4H 4FXKA 5GSVB 5DURB 3UTQB 3MV8D 1LNUA 1WT5C 2GJJA 5IBTL 1GGCL 3IDUA 4IS6A 3VWKD 3EO1B 2CUMA 3NCMA 3FO9A 5D7JB 4R4BA 1QRND 3W0WA 1UB5B 4GAYB 4Y16A 4KRPB 1E4WH 1LDSA 1JF5A 1N7MH 1VERA 3D3VA 2NYYC 5I1CL 2EDYA 4U1GB 1BVLB 4NNPL 3S35X 4XBPB 5A3IC 3MLPA 4P2YA 4Y1AA 5ECJE 1IGTB 2AJVL 4JHWH 3T3MF 4GMSH 1P7KA 3OAZH 1HYSC 5IMKB 3C6SA 5I1IH 4LSUH 5E1HB 4MA1C 1U8KA 3ZYOA 1TVHA 3HLAA 4X6EB 3IDYC 2BJML 4IDJL 3BUYB 1TDQA 5IM7A 5GGRY 4GAGH 5HYIA 1TJIL 2GTWB 1WCQA 1GZQB 5GSRB 1YPZA 3KHQA 4PJIE 4DWHA 2HFTA 3D0LB 4JFZL 5DC4B 3JSSA 3O2VH 4GSDL 5ADOL 2OSLB 5FYKE 4DEPC 4GKOA 2X4SB 3B9EA 1KCRH 3UC0H 2XY1A 3O6KH 4OCXL 1REIA 1JZ3A 1WSST 4ODTL 2OXHA 4HWBL 4K7FA 4MXWL 3UJJL 2C4FT 1S7SB 4QHMB 1H8SA 4PGEA 5SX5H 1T04A 3NCYS 4XBGB 3D9AH 1MCPH 1ND0B 3BESR 4ZOAA 3MLYL 5HY9B 2VZ1A 5C92A 1QVOB 4L8CA 1FORL 4YE4H 3RDTA 5J1AB 3IJHA 2BFVH 3LSOB 2YR3A 2GIYA 4WJ5A 2IFFH 2FB4L 5BW7C 5DK3A 1QBLH 4ZSOE 3T2QA 3OF6D 4BFBD 2XTJE 4LCIL 4HJJL 1YNLH 3SE9L 4FFVC 4RFOH 3RUGF 2BXYA 4GKNA 4GG8A 4PIRF 4X9HA 5T1KA 1HI6A 4JM2C 3VXOA 1HSAB 1MJJB 1H0DA 1DUZA 3EOTL 4KDWA 1EGJL 1BJ1J 1PLGL 1QBBA 2CLZB 2R2EA 1RUPH 2CIKB 5SWZE 2B0SH 5GS2D 4UTAH 3JTTB 4GKSB 3TWCH 1K3IA 4NO0D 2NXYD 4NQCB 1V3LA 2HJFA 4WUKL 1FVEA 3P4OB 5C0AD 1SVZA 4M62L 4OCLC 4QEGA 1ZANL 3I3BA 1AH1A 4R9HA 5MEOB 4YIQA 3VXME 3LQMA 4A6YL 4CN4A 1U8KB 2XRAL 3MRQA 5FUCC 3WIHA 3IJYB 3IS0X 3OSKA 3G08B 3SGEI 1MRFH 1WFUA 3WHXA 1EFQA 3PF2A 2CKBH 4NGHL 4GKZB 4URTB 1UB6A 4ODXA 4JY6A 4NRZB 1AD0A 2VDMH 2VLRA 1NUGA 3PP3K 1D5XA 3QRGH 3GJFB 3Q6FB 1MPAH 3K7UA 2ICCA 2ATPB 2AVGA 4X7SL 5FHAH 2E27L 1T7ZA 5KVGL 4QXTB 1KGCD 1Y18A 4HFUL 4YHPB 4JCLA 2EICA 5IIEA 4PBVC 3AM8A 3B9KD 3RGVA 4ZTOH 3VCLA 5LCVL 1LEGA 3O9WC 1EBAA 5JLZB 2XACC 3VXPB 3CFDA 3P4LA 4R90L 1NGWB 4H20H 4HWEL 2C1PB 4EI5D 1NJ9B 3GDBA 1NBQA 4L4VA 4QWWD 2ADJB 3B3IA 3PDGA 3ZDYF 3D48R 5IHBA 4JJHA 4F8QA 1P6AB 1EVTC 4F33A 4XC3L 3BEWA 3NIFF 4OD3L 4RMTA 1E4KC 1ZHNA 4ELMF 4PRNB 3IDJA 4OFYA 1HINH 2QV2A 2DLTA 1X7QB 1HI6B 4X8JB 4Z95L 3ZT5A 5IHZA 4D9LH 1A1MB 3JV6A 1DCLA 4V1DB 1QRKA 3NFNA 3DECA 3VE0B 1OAQL 5IMMB 2EEDA 5EO0A 1U2HA 2D4FA 2RHEA 2A0LC 4U7KA 3VA2C 5IFAL 3KLHC 3MRDB 1JHLH 2R23A 3VGBA 1I8MB 3L5XL 2OR7A 3U0WL 3L6FA 2CGRH 5EZLB 1NKRA 4LHUB 4JZJB 2YPKA 1K4DB 2GSGB 3GKWL 2W9DH 5DK0A 4BSWB 4LPXA 1D5IH 4WEMB 4JFPB 5E2UL 1IEBB 5DEFA 4KAQH 3RVUC 2NX5B 4FQHB 2FCBA 4DUXA 3ILPB 2X4QB 1RU9H 5IQ9B 3OJDA 2A74A 4UT7H 4X6CB 2PYEB 3H9SA 1A0QH 4B0MM 5T5FL 2P48B 3NCJH 3CXHK 4R26H 4Y4KA 2RFXA 3FCTB 5DVLA 3FOLB 1CCZA 1DLFL 1AD9B 2I5YH 2XZCL 1RHFA 2X4PA 2YPVH 4O4YL 1HOCB 4FP8L 4LCYB 1MFEH 2BOBA 3MLZL 4WW2C 1R3KB 2VSCA 4RAVB 2GFBA 1SVCP 3BD3A 3LKQB 5INDB 3F58L 1CFVH 2VRAA 4OB5L 5CZXC 4HWBA 2WBKA 4IRSB 1FLRL 1LK3H 4MNQB 3BWAB 2L4OA 5KSVB 2PUQT 4O5LH 2MHAA 4N8VA 4K7PL 5FK9B 5DF0A 4G8EA 5L88L 4HS8L 4XXDB 3R06B 1KPRB 3EYVB 3DO3A 4K3JH 4W4OA 1S7XB 2O5XH 5FYLE 3T3ME 2JJTC 4E41A 2NLJB 2DI9A 3QUXB 2X44D 5A2KH 1U8IB 3RJDA 3BOVA 5DJYA 3VGFA 1KB5B 1D9KB 5F7HA 3IJSB 1QBAA 4JDTH 4UIMB 4LVNB 5SWSB 4Q74A 3EUUA 5JTWA 4RMRA 3MRJA 3LD8B 2EIEA 2EDOA 2JB6A 1QHOA 2HKHL 3O3BA 3WE6A 2BC4A 1J8HD 2D7QA 1IQWH 3OL2A 1E28A 4U2ZA 1EGJA 3OAUH 4MQXD 4U3CA 1OW0A 5B38G 1FH5L 3K4DA 3RAJH 1LP9F 3STBA 5GRUH 2FX8H 5FYJU 3GSNH 2ESVA 4P4KC 4K3EH 4DAGH 1LILA 4OD1H 4RGND 5D5MF 1DDHA 1F4XH 4F7PB 1W0WB 1UA6H 4MNHB 3ULVL 3MRLB 3QEQE 3SGKA 4JQIH 5FDWA 5I66A 3UYPA 1PAMA 2R8SL 4XNUL 4XRCB 1CLCA 1I9JL 3S34H 3KHOA 4OZGF 3SE3C 3QDMD 5GGVY 3RUGE 3O45A 1MRDH 5K9JH 2OJEA 2CK0L 3IGAB 2XKNB 5ANMA 1JK8A 1I7ZA 3OG4B 3DBXB 4FZEH 3EJYC 5MI0C 1T20A 1DBJH 4HK0B 1A6TB 1XCQA 3WFBH 1L0YA 1IAKB 2FBOJ 2KDGA 4YJZL 4DTGH 3N9GH 1RHHB 2CO6B 2CO7B 3BDXA 1CICB 1BECA 3DOSA 3ZKND 1OAUH 4G8EB 4RQQB 3H6JA 4JZOB 4N0CC 1JGDA 1ORSB 3AU1A 3HC3L 3FRUB 4D8PA 4NKMB 4ODSL 1F97A 3S9DB 3EZ8A 4LIQL 3P77B 3LN9A 1KIPA 4F7TB 3U9UB 4JQVA 3ULUD 1NCBH 5J3HC 5CWSB 5I71C 2GKIA 1U3JA 3MRMB 2WUCL 5DC9B 5E6YA 1B9ZA 2NY6B 2K3TA 4I0PD 4APQC 3O3BB 4LPWA 4MA7L 4Y1AD 2PW1A 3WNLA 5ESQB 3CH8A 1KPUB 4GQ9L 2P8PA 4X6DA 4YR6B 1ZHLA 5L2KA 2VLMD 4XWGL 1T7XA 2VISB 3U7AA 5BJTA 1ERNA 2R0LH 3RNKB 3PIQB 1NEZG 3M8OL 4DZBB 4OZ4A 5B8CA 3EJJX 1HHJB 5F97E 2Q87A 4HMEA 4PG9B 4YHLH 4WI7A 4LCWA 1YY8B 4M8VA 3RWHA 3ZDYE 4A6YB 2F19L 2DLGA 3V6FA 3SGJC 1KUMA 2DD8H 4Z0XA 1AP2A 5HYEA 4KQ3H 1RD6A 3NIFE 3ESUF 4WUUE 5FA4B 3S5LG 3BPLC 5FM5O 2Y07L 4ELME 4YFDB 2Z92B 1GPOH 1EJOL 1BOYA 4NBXB 2APXA 1QSFA 3RDTD 3WNNA 3Q1SL 5FO7A 4HWZA 2NW2B 4G8GB 4G9FA 5J8OA 1TCRB 1G6RH 4N0FB 2FJHA 4RFNC 5ID0A 1YQ2A 4D0BA 4WU7A 1IJ9A 4JANB 3GMPA 2W0FB 1JF1B 2CQVA 1KJVB 3DMMA 5I1EH 1IGML 1ZGLB 3BGFC 1NH6A 1SHMA 1JL8A 3U7YL 3RWEB 4YAQA 4H1LA 4R0LB 2PW2B 4WI6A 4KTDL 4POZC 4OSUH 2B39A 4S11A 4LLYB 1FC2D 3QEGH 2V2TA 5HGBB 1BVKB 2ZUWA 1FYTE 3UTSB 1OWRM 3JV4A 3L5IA 3VFRB 4MDIA 5ICYA 4I48B 2E9IA 3EJZC 4NM4L 2JCCA 5DRXA 5KSBB 1G7PA 2ADFL 3LQAC 4WO4D 3I84A 2GAZB 3RZCB 4HCRH 5D1XB 2ED8A 3BT2H 4W6XB 5DHXB 5F96H 3KPPA 1BD2E 4ZTPL 3L3IB 4YXLH 4X4MA 3MNVA 1C08B 1MFNA 1UXSB 5ALCL 4LKCA 4O9HL 5DJZA 4JKMA 3VGGA 2OI9B 1BBDL 1KTLB 3DX9B 3AMKA 5CEYB 3I6KA 2F9BT 1BQHA 4LCWB 1EXUA 3DGGA 1QLFA 1A9EB 2P47B 2OK0L 4J3TA 5E6ID 3VFGH 3QJFB 4ETQA 1P4LA 3V6FB 3VWKC 1NCAL 4Y88A 3RPIA 2DAVA 5C8JB 1OTUD 4F7CA 1MHPH 3EDDA 2Y5TA 1G9NC 2ZSVB 3CFBB 1HILB 1U42A 1WZ1L 3CLEL 3NH7H 2JJVA 3SJVD 3SE4A 3C5ZB 3RGHA 1UACL 3MMEB 3TGXA 3LPFA 4D3CL 5DFVD 2HRLA 4LQFL 3EAKA 1SEBB 4JY5H 5MENA 4YK4C 3WSQH 4LRNL 2YHGA 4OFIA 4MJ5A 4PLJD 4WIQA 35C8L 2C9AA 4PJDB 2NZ9D 4H1LB 5CSGA 2DI8A 3ZTJG 1ES0B 4XB8A 3QI9A 4X6FB 3GB7A 4G7VL 3FB7A 1C16A 1NKOA 2HLFD 4NNXB 4XPGL 1QFWM 1LP9E 4L8SA 3UTTA 3FJTA 1X5YA 1VKXB 1S7TA 4GO6B 4XZUA 3R8QA 5I2IB 3LCYA 5EUOA 3ARBA 1QA9A 3WFEH 4MQ7A 2AEPL 1FN4B 5EUKA 4TTGA 2AJ3A 2RCSL 5D5ME 5TDPB 3EKCA 4F7EA 3OV6A 3BYTA 4JRYA 1F2XK 1G7PB 2KZWA 4R4FL 5AZ2H 1DEEB 1WWWX 1MCQA 4PJCA 4WV1B 3I6LE 4OZGE 3QQ3A 4Y7MA 1JGUH 2A6KB 1CDHA 1DE4B 3LVEA 1LGVA 1FG9C 2AEIT 4Y4HB 1A7RH 2PETA 2YS4A 2NY0D 2UVEA 3H9SD 4UNUA 1SM3L 4RGMC 15C8H 2BSSA 3KDMB 1MFAL 2B1HL 4M7LT 1ADQH 1AHWC 2VDOH 1VPOL 4CKVX 4OTXL 5EU7C 3H3PL 3GMQA 2OTWA 2ZKHH 1LO5A 4QYOB 2X4OA 4PJXF 1MCCA 3FFDA 3CU7A 1KJ2L 4JPVH 2VABB 4LP5A 1EFXA 1IGFL 3ZE1F 1WCBB 4UDTA 3SDCB 1R24A 2NXYC 4ZDHB 3WNMA 3S36H 1RZ8A 4YNYB 5K59F 4LCUB 3SBWC 2YKLH 3T77B 4QRPA 4HKBA 4Q9QH 4J3SA 1LVEA 1KLUA 3SDYH 3JXAA 4JRXE 1W0VA 3QI9B 5J1TC 4FFYH 4OV5B 2VAAB 1AXIB 3LIZH 4PP1C 4U3HA 3MBXH 3ARPA 3H3BC 3QHFH 4XMKL 4KK9D 3K8MA 2ZUXA 3S3PA 5GXBB 5CILH 5FF6A 3HZVB 2V17L 3C60A 5IVNA 3GI9H 5I1KL 3JWOL 1BGXL 2EDBA 2NNAB 2F54A 2QL1A 1A3RH 3V5DB 4EIGB 1JVKA 1FVCB 5LVEA 3B9KC 5C0JB 3MCKA 5FKAB 1U8PB 4KUCD 1HIML 4PRPE 3VXSB 4BH7A 4RAUA 2P5WD 2NW3B 1JP5A 3HG1A 5E4EB 2EIZA 4Y5XB 4L9LC 4U6TA 1FGNH 4QT5B 4EI5C 3C8KB 3BAEL 3OKEA 4LK4A 4QWWC 4EI6B 2YOCA 3DX7A 4HIHA 5IV2B 5D7IA 1T21B 4FFZH 1MHHA 2XOTA 4O2FB 1T2XA 4NZDA 4BKLA 1KOAA 4WHYH 2NY4D 4XNQA 3WFCH 3TZVD 4YDLB 2LFGA 4X7CC 5E2VH 2VWEC 4AQ1B 3U7WL 4FXLA 3ARWA 1BFTA 1U8JA 4PGZA 4Z7UF 3E1F1 4N5ED 3IFLL 3S3SA 1HXYB 1IC4L 3RP1A 4XAKE 3DX8A 4UDTB 3ISWA 2IPTH 1AGCB 5ISZD 1CGSL 3I9GH 2XWTA 1Q9LB 1JPTL 2ZOLB 4JVPA 1PKQB 3OKYA 4K2UH 5H35A 1CF8L 4JDZB 3NGBC 1MRCH 2J2ZA 3NFSH 3QDGD 5EU6D 1CE6A 1CDJA 4HKBB 1Q0XL 1WISA 4OLVH 1AXTL 1QSVA 2Y72A 1YMMB 5JIKA 1JWMA 3PQYA 5FGSA 4KI1A 5CKAA 4QNPF 2GSIB 4QOKA 4ZYKB 1YEGH 4QF1B 2EYTA 4OD2A 1RK1B 3MLXL 1MCOH 1RZGB 3ETBF 2M8XA 5JMRA 4TSAH 3TIEA 4FMKA 1HKLH 4U1HA 5C9JB 1FRGL 3IU4H 4IIQA 3BXNB 4Z7WA 2H3NB 5EBGA 5D7LB 4LLWB 1TQBC 1NCWH 1FGVH 3EDJA 4OLUH 5F3HA 1NGQH 5I9QC 1RZ7H 5D7SL 3P0YH 3GSWB 3MJ7B 1EAJA 1OAYL 2VO5A 2WW8A 5HI5C 5IQ7L 1YNKL 1KXTB 4NJAH 3FQXB 4DGVH 2JKXA 1AFVL 1IKNA 1AC6A 5E5MA 1A02N 3NTCH 1RJCA 1UKSA 2Y23A 3HI5L 3NA9H 4X6BB 4WW1A 1B4JH 4FA8A 5JW4Q 1A8JH 3M45A 2ZUSA 3QQNA 3U30B 4PJFF 5HHNA 5EU5A 3QZWG 1KTKE 1GAFL 2P49B 1VFAB 1HSBB 2FLBT 5JQ6H 1QSFD 3DVGB 3TYGH 1MLBA 4HUUA 4KHTH 1TTUA 4XNYH 2XFXA 4J1UA 4Y5YA 4JFYA 4KVCL 4H5SA 4L3EB 1ZWIA 2ZG3A 5DDHA 2PXYA 1IBGH 5T33L 3MLTA 2GJ6A 5BVPH 1F3JB 1VFMA 2DDQL 3GSQB 3B6SA 5JDSB 3MRFA 3UZVB 4HH9B 4MQXC 5T3ZH 4FQXA 2G60L 1N0XH 5D2LA 1KJ2A 3MV7D 2BP3A 4F15C 5A2JH 2WUBH 4WWKD 5DHVB 1W72B 2Y5EA 3TYFA 3LHPL 1MIEH 1RK0A 3TFKC 3PWLB 1BZ9A 3U0TB 2AXFA 4CMHC 1FFQA 3TBYA 2FX9H 1CXLA 1QFUL 3O6MH 5ILTL 1FE8L 5J6HA 4F2MA 1NAKH 4WW2F 1JNHA 4U6XB 3S37L 2YRZA 2FEEL 1MWAB 3HN3A 2PR4H 3C6LD 4AH2B 3EYUL 4NP4H 3D18A 3WDHA 2EH7H 3CCHB 4P99A 3KR3H 4F7MB 4ZFZA 4FMFA 3T04D 4M43L 1IC7L 4FNLL 5BRZE 2VQUA 4GH7B 3WIIH 1RIHH 2D7OA 1IEHA 3V6ZA 4PRHD 3TCLB 3IS1X 5BMFL 3W5NA 2VDKH 4PJXE 4ZFOB 2JB5L 1FV1B 1EUTA 3QIUB 4HUWB 4NJ9L 4CBPA 2D2OA 3ZKNC 4U1MB 1JZ5A 3ZE1E 5MERA 5TH2A 2HVKB 5FHBL 2DQJL 3BH8A 3HAEG 5K59E 4MQSB 1OGTB 3FAXA 1Z5LB 43CAA 3F6LA 4KFZC 1NGZB 3AC0A 5EU5B 4I3RH 4OT1L 5CINH 4QTIH 4QXGH 1MAJA 4RMUA 1KFAH 4OJFL 1F8TL 4FXGB 1KB9K 3QO0A 4KH2A 2ZJSL 3MXWL 1IAIL 5FEBA 1CIUA 3WO3B 4R97B 5C07A 3CZFB 4M3KB 3PGCB 1XZ0A 4MXVF 5C6WH 4J1UB 4Y5YB 3BE1H 4YGAB 5DRZA 2ADIA 3VFVB 5I1DB 3S4SG 1NLDH 1MF2H 4HIEB 3QG6B 3GZKA 3CDCA 1C7SA 2P42B 3OXSA 5A16A 3U83A 4O00A 4LNRA 5CP7A 2ZPKH 5J06A 5C09E 5IMLB 2Z35A 2MFNA 1BZ7A 3WXVL 2WBJA 3RWCB 3KYOB 4JFHE 5IKCA 3KYKL 1S7UA 3AXLB 1F4WL 2WIMA 4PJGF 5DJ6B 3S3JA 2R1YA 1X5HA 1NFDF 2IBBA 1M6OB 5IB3A 3MV9D 1OGAB 3SOBH 3UTTD 5IB4A 2Z93A 3T0EA 5IHUL 4HIIA 3LZFH 4XMPL 4XX1G 5I30H 3ARBD 3X3GH 2PO6B 4QHKJ 1S9XB 2VNCA 1UZ8B 1U92B 2P8MA 3LB6D 3VGAC 4UZGA 1IM3B 4X4XA 1T0NB 2BSED 4ZUWB 3NAAH 1CGVA 4JFXB 2D31B 2BVPA 4JRYD 4Z7NF 3RWDB 4FQCH 3T2NL 4XX1E 3MODH 1BF2A 1KYOK 2HVJA 2QQNL 3RDTC 1IILE 1VGEL 2YSSA 2BNRD 3GIVB 4G80A 3DURA 3V6OA 3QFJE 1A4JB 4ONOA 3MLWH 3ZL4L 4M9PA 5AAMA 4Z7UE 2AK4A 1I1AB 4I9WD 1LE5A 4QXUL 4RZCA 4ZFFB 1RJYA 1OP5H 3GMNA 5I1GL 3B8YA 2J8OA 3BZDA 1CLZH 2C4XA 4PD4J 1YY9D 1KPVB 4S1SL 1K6QL 2LAAA 3VJ6A 3QCVH 1Q72H 2HWZL 2ITCA 4HPYL 1IGYB 4P2QA 2VOTA 4M3JA 3S96A 3SN6N 4QNPE 5JW4M 3QXWA 1R6VA 1HK6A 4CRPA 3X13A 3GMMB 4LARL 3T65B 3RKPA 3QXAA 2DQGH 1ZMYA 4WHYG 1O7VA 3ZMRA 1N26A 2XNAB 4PG2C 5E08H 1A9BA 1W0YT 5F9JB 4QRPD 4NOFA 1SJVA 1WGOA 3L1OH 3LEYH 1WIPA 2ARJA 2BNQA 1A7PH 1VESA 4WEBH 3WDIA 5IB4B 3LQAH 5IFJB 5FUZL 4MD0A 3GHEL 5E8DL 3QEUB 5DVKA 5EA0H 4TQEH 4N0YH 3J7HA 5E6IC 3GMRB 3HZYA 4R3SB 4ZXBB 3PXHA 1CR9L 3QDJB 4JFEE 3UPRB 1U36A 3QUMH 1OTUC 3U82B 32C2A 1PVHA 3KPSA 1A6ZB 2XZQH 4AM0A 3VFWB 2R29H 4YHZL 1N6QH 3AM8C 3RGVC 4NQDD 4X98B 2F15A 2HJLB 3BKCL 3BPNB 2G5BA 5DUML 3EGSB 2ZNXA 1RURH 1K5NB 2FSEB 4PJFE 1I3UA 3MUHL 5I16A 1J18A 4CW1B 1QSEB 5DFVC 3ARFD 1U3HD 3D39A 3ELAT 4MJIE 2JJSA 3BP6A 4RZCB 3ARGB 4JHBA 4PLJC 1F02I 3HNVH 3ARRA 4PJ5B 4MNGB 3G5XB 2NZ9C 2DLEA 2E7HA 1NC2B 2JELH 4NNYA 4MAYA 4PJ9A 5BVJA 2XN9A 3UTOA 1MY5A 2HLFC 3MJGX 3D87B 4FABH 4WTWA 3UBXA 4NCC1 4DN3H 2B4CL 2VIRB 3I02B 2ZZUT 5E6ZA 2BCKB 4YO0A 4O02H 4G7YL 4FN0A 3BZFA 1ZTXL 2EEBA 4E5XB 7FABH 3I50H 3V5KB 4D0CB 1J8KA 2VJXA 3BIAX 1FNSL 3QXAB 5I75C 4UU9A 3QP3A 3OKDA 3NIDF 3H0TB 5CEXB 4U6HA 5LQBH 3OXRA 3UTPE 3W2DL 3HCVB 3D69A 2YUZA 1KIUA 3P11H 3TBTA 4HUXB 5HDOA 4OCWH 4L1DA 1IAOA 3PQYD 4FQQB 4P9HC 2HFFB 3VI3F 2D03H 2XZAL 1CFNA 5D71H 3HI6H 5EC1B 1WC7A 1MFDL 2NY0C 1INDL 1FZMA 2G75A 4KHXH 1IQDA 2Q20A 3WS3A 1CVRA 4RWYH 2RAMA 2W0PA 1I3RA 4JREC 3ZE2F 4X9IA 2VDQL 4NZTH 3RWIA 1CZ8L 2FHBA 3LN4A 3LY6A 5KW9L 4U0RB 2E7LC 5I1JL 1PSKL 5T3ZE 4L29B 2XPGA 2VUYA 3FZUC 5GHWH 5IMOA 3OZ9L 2B7DT 2OCFD 1L7IH 3MZTA 4MXVE 2NMSA 2F53E 2Z4QA 4Z7VF 4JKPH 5DRNB 4W4OC 3T0BA 2AJSL 3FB5B 5CJ8A 1AGDA 3F65A 3FB8B 4DN4H 4TULH 1WIOA 1BF8A 2P8LB 5H2BA 1K9TA 2EC9U 3MX0A 4JO3H 4AENB 4PJGE 2IPKB 3UBXB 4KK9C 4UIKL 3VG0L 1A6AA 1NFDE 2FD6H 4HH8A 3SKOB 1QSZA 1Y6NR 1GL4B 4PJIB 4MCZA 5E8OB 5DI8A 4EUPB 5EIIA 5DMIH 3ARSA 5KSAB 3LS5H 5JHDA 1FCCA 4P2RE 4JY4A 3TLRA 1ZLVH 3EW3B 5JUEL 1Z9SA 3IXAB 2ZCKH 5B3NA 4OCSL 4WHTA 1JMZA 2IQAB 4Z7NE 1X6NA 3FT3B 2I60H 1QYGH 5T1MA 3DNKA 3DI2B 3IDIB 4H88H 1SJEB 3ARZA 1BQLL 3FO2A 1AI1H 1WFOA 4WRLA 1FG2A 5B21A 2EZ0D 3SGKC 2NXZB 4EDXB 4X9FA 1F58H 4ZSOB 1AO7A 4PUBH 2XTJB 5CUSH 4OCYL 4M93B 1GGBL 2EXYD 3TZVC 3A6OA 4AIZB 1T3FB 5LG1A 5TF1L 3PDOA 3RIAK 2H9GA 1CFSA 3VFUB 1JTOA 2K1MA 4LSTH 2VLJD 4HT1L 5I8KH 2GCYB 1QBLL 4K3DH 3AY4C 3SPVB 3MYZA 3VD7A 5L7XH 4C56A 5I73C 3RWFA 4AK1A 2XPGB 5SWZB 2AJXL 5C0BE 4KGJA 1A6VL 3H9HA 1B0GB 2A9NH 4DGYH 3DX6A 5I1LA 4CU6A 4OLWH 4LLDA 1TQCC 1TTFA 2X4RB 1MIMH 2QR0A 5IJVA 1KIRA 4L5FL 1IC5H 4G3YH 4AIOA 4L4TA 1KBGL 5JO5A 4JR9H 1LD9B 1CLYL 1ZT4A 3VXMB 2YD7A 1KLGA 4TPRH 4WFHD 5J6GB 2R0ZL 2GK0A 3LKOB 2HAZA 4ODVH 4LSVH 3ECBB 4JQVC 2BHYA 2UVFA 4YHOH 1MCDA 4YDJB 3SQBA 5B4MC 3ZYZA 3O6FB 3GSRA 3RWGB 3TJEL 3OQ3B 8FABB 4YHKH 1MEXH 4OQTL 1XF4A 1DL7L 4KK6D 2WQRA 2A6JB 3VFTA 5F7EH 3HB3C 1BOGA 2K7QA 4JY4B 3WD5L 1LEKA 2EH8L 3HS0A 5DR5L 3TT1L 3FO1B 4B41A 1A7NH 3OKOA 2YD1A 1DUYA 1RUAH 3GRWL 4PRBA 5EORL 2IPUK 4CDHA 1CBVL 5B8CC 1NCTA 5EU4A 4NKOB 4MA3B 3BMVA 2XWJB 5IW6A 1NMCB 4ZTOL 2GY7B 4JHZA 4PB9L 2OXGA 2ICWB 3VXUA 1KTRL 2PTTB 4G9DB 3VXTB 1VSCA 2JIXB 3ALXA 5DJXA 2Z31D 1D5ZB 3PV7A 1UM4H 3IAGC 1S9YB 1JHKH 2CDGB 2F8OA 3BQUB 3W9DB 4HKJA 5FIEA 3OAYK 4ZS7H 3H42H 2H26A 3N50A 1MJUH 4LSRH 4AL8H 3DROB 5DXWA 2VC2H 4JPWH 3HMWL 4XPHH 5EO1B 3BPCB 4YDKL 3O2WH 5IB1A 1KIRB 1RIUH 3AUVA 1M7DA 4FQLL 5CJOH 5JO5B 2J7LA 3RTQA 3NIDE 5GRJH 4JPIA 4WWKC 3QUZB 1EEYB 2R0KH 1EERB 1Q94A 5GGRA 3O3EB 1CL7I 5CD5D 3VI3E 3PL6D 1DQQB 2CRIA 3JTSA 3MR9A 4XCFL 4PRDA 5DURD 2Y25A 5DGRA 1VGKA 3AREB 2MPAL 2W9DL 4WTZG 2Q8AL 5J9PA 5J89A 2NY7H 3QWOA 1VCAA 4X99B 2GTZA 3C6LC 1KNOA 5BV7L 4P46A 2YXFA 4XPAL 3OGCA 5CD3A 4KRPD 2ZUTA 3PGFL