1P6AB

Structural basis for variation in adenovirus affinity for the cellular receptor car (s489y mutant)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
124
structure length
124
Chain Sequence
b'GITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fiber protein
publication title Structural basis for variation in adenovirus affinity for the cellular coxsackievirus and adenovirus receptor.
pubmed doi rcsb
source organism Human adenovirus a serotype 12
molecule tags Viral protein/receptor
total genus 26
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2003-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p6aB00
3MR9A 3K1DA 2AK4E 3MMEA 4FNLL 2F5AH 4R96A 3OKDA 4UTAH 2HT3C 4LEXL 5CJOL 1Q9WA 1DUYB 3IDUA 4HIEA 4R3SB 3H0TA 5F7MC 5I6XC 3T4AB 4PTTB 3I3EA 3P9WB 2OI9C 3LZFL 3SGEH 1CGXA 2XPGA 2W60B 1NANH 3O6KH 2GJZB 3FOMA 2XNAB 3ULUH 3U4BH 1A6TB 2EH8L 1SJHB 4L4TD 4HJ0D 3MSPA 3Q6FB 1JFQL 1F6AA 4OI9A 2J4WH 4LLAA 5E9DD 3R1GH 1NBVL 2ESVE 5BVPL 1M6OB 5DD0H 4R8WL 5IEKB 3CIQA 4ELKA 5EIIA 3I50H 3T77A 4M7JL 4WO4C 2C5DC 9CGTA 1CN4A 4PJBE 1Z9SA 3QCUH 4DN4L 3ZHKA 3SKUD 3AFLA 4GMSH 4UB0L 5DUML 3O6ML 4PS4H 2GHWB 3QQ4A 4QRQA 4G7YL 4O2FB 1KPVA 1YEFH 2VLKD 3DURA 2Y4SA 3QIUD 5DF0A 1J05B 4NNYB 1XGQB 3C8DA 3MV11 1P1ZA 4JJ5A 4P2OB 5E94A 1T03L 1P4BL 4PTUB 1LQSR 5D8JL 1I1AD 1MFCL 2VZTA 3WJLA 3QCTH 1R3IL 3ULVL 3LPWA 1LO2L 4UT7L 5GGUA 4AQ1B 1ACYH 5CBEA 4R7DA 5J1SC 2YRLA 4ZAKB 1LK3H 3KYMB 1SBSH 1EH9A 4PJIF 4XVTH 5CSZB 1HKLL 3KYOB 4GRLC 1IBGH 5FGBC 4FABL 1VGKA 4L5FL 3ZO0A 4F7EB 2DMBA 1LE9A 3B83A 2XFXA 4XP9H 5A3IC 4PJEE 1QO3B 3NZ8A 3V6OA 2A9NL 3ULVE 4AMKH 3OG6B 3SJVA 4HUXB 4BKLB 4AYFA 3O3EB 4HS6B 3U4EB 3N1QC 3BH9B 1Q9KB 2YD3A 3U0PB 3KGRA 1IM3B 1NCWH 1WFUA 3EOAB 4FQHB 5GRVL 3GFUA 3EFFA 3UCRA 1QBLL 4TN9A 3LKRB 4Y4KB 1DBAH 4PRPA 2AJ3A 4NN7B 4PJ7F 3JSSA 5TH2B 1S9YB 4UTBH 4EI6A 5I8EB 5HPOA 4KFZC 2E7CA 4PY7B 2MSPA 3JTTB 2VQ1B 3T0DA 3LEYH 4HS8H 4ZNEE 5D1ZA 2VIRB 4Z7OE 2IH3A 4NNPL 2P8MB 2M1KA 1RU9L 3ZLQC 8CGTA 2PO6D 3WDIA 3LHPH 5I8CB 2HMIC 5JHLH 4PGCB 2BK8A 1YY8B 5DQJB 4PJHF 2DQJL 4KU1A 3F5WB 4NQSA 4X80H 2DBJA 4MNGE 3DWTA 4MNHB 5D1QA 1C5CL 3TZVA 5HHQB 3MRLB 1YEDB 3CGTA 2WK2A 1R3HB 2IMNA 3D3VB 5DFWH 5HGBA 5M94B 2NZ9D 3IJHA 4NO2B 3RZWA 4LNRA 3MRKB 4JO2H 4PR5B 1IGCH 5HVHC 2JELL 3U30C 6FABL 2F54A 4G42B 1KCSL 4X6BA 4ZTPH 2DQTH 3EJZD 1D5XA 1F13A 2X40A 5DUBB 3ARBB 1VFOA 4I0PD 4YWGL 2YA1A 4DVRH 3LKNA 4WEBL 4M7ZC 4U0RB 4PJXB 4OKVA 2VR9A 1UXSA 2X4QB 3NTCL 3HG1D 4LLMB 2Q3ZA 3SO5A 3EOYG 2WBJD 5CMAA 3EOTH 4YAQA 3QDMD 4RIRA 4AJ0A 4DAGH 1S9VB 3DX9B 5EO1B 2AJVH 1IZJA 3EFDH 4XNQB 4P46B 3VG9C 2P5WD 4FTVA 1GOGA 4MQSB 1DSFH 3OB0K 4OZFH 1I3UA 3FQRB 3JV5A 4ZS7L 2HH0H 4OZFB 5TDOB 2EIDA 8FABB 4WWKB 2J8HA 3WFDL 5DRXB 3PWPA 1R5WB 3THMH 5CLTA 4JFFA 4DVBB 1JI1A 1EO8H 5DD1L 1EBPA 3PGDB 1DVFC 5JR1H 3O8XD 2D0HA 4YGVB 4MAYC 2NY0B 3ROOA 1ZT4B 1R5IB 3L7FA 4Y5VB 4P23C 4NZUL 1B2WL 4HXBL 4XVUC 4YHIA 1J12A 4XHJD 3SDAB 3C5ZA 3REVA 4GLRI 1JPSH 2EDFA 4P9HH 2A6DB 2R0ZH 3L3GA 5GGRB 5HHXH 3MNVA 4KMTL 1MPAH 1P53A 4FQXA 3DNKA 1MJ7H 4FRWA 1MQKL 2I9TA 5E1HB 1DR9A 3OXSB 4HFWB 3MC0A 4G6MH 1DBKH 3EYQC 3FQXB 3DVFA 3AB0C 4DN3L 2CKBH 4XPFH 2CKBB 1U8IB 2FGWH 3HR5B 2XZCL 1GOHA 4L8CB 1HH6A 3DV6A 5F8RC 5HGDB 1V5JA 1HWHB 4GRMA 4H8WH 4NPYA 3SKJL 2QADD 4YHYC 5AYUH 4JY4A 1EEQA 3SE8H 3GSRB 3EYFA 3FOLB 4ODXB 5EOQL 1KCVL 4G9FB 5IFAH 3RJDA 2YMXH 3X3FL 2V5SA 1A9BB 4YIQB 1ZT7B 2OSLA 4N1HB 3FAXA 3SQOL 5E8OA 4ZFFB 3RU8L 1FGVH 1RFDH 1G7HB 4PGEA 3IDMA 5L2KB 1K6QH 4FOMA 4UU9B 1FL3B 2X89A 5LKNA 3VE0A 2QQLH 4GUPB 2OK0L 1CLZH 4LPWA 2CRZA 1J8HB 1FH5L 2MHAB 5KS9E 2UWEE 4NQDB 4XVJH 1KLGA 5CP7B 1X4YA 5DC9B 4YC2B 2G9HB 5IVXA 2CDEA 3BDXA 5GHWH 4LSPL 1G7JB 4HC1A 3ZSTA 3BZFA 1I7UB 5FYJU 3RKDC 2FL5A 2ZSVB 3MO1B 4Y4FC 5D1XC 3UJTH 4JM2A 2WSKA 5IQ7H 2HJFA 3OXRB 1IAIM 4WCYH 5DSCB 4KI5D 3WHXA 5B3JF 1CE6A 3BEWB 3PQYE 4I18C 4QT5A 5TQ2L 5IIEB 3QFJA 4RAUB 3BGAA 1JTPA 2ZUQB 2NY4C 3MGTB 4JZJB 4UIMB 1INDL 1OSZB 5DUPH 2GCYB 3IXTB 1RHHA 4YUEL 5J4MA 4RGMB 2Q6WA 2VDLH 5DD6A 1GC1H 2AJYH 1YQ2A 3B2UD 3ILQC 4JANB 3UYPA 5FYLH 3B4NA 3QWQB 4FQPA 3C5JA 4KAQL 3KNBB 2EIZB 3V6OE 4PJDE 2R39A 4B53A 3ZL4H 3Q48A 2E8YA 3ARXA 3ESVF 3SCMD 4HKXA 5KOVC 5B38G 3HTLX 1C08B 3CFJA 4KTYA 4ONGL 1T20B 4N8VB 4ETYA 1CXHA 3VXUD 1QRNB 1LP9F 3UTPE 4EDXA 4WVRA 3CUPA 1I7ZA 3MACL 3GI8L 1NAML 3MRDB 3DI2B 4PRPE 2J5LC 1BLNB 1IEAA 4HKJA 3FO1B 3ECBB 4K2UL 4X6FB 4GKOA 4P4KD 4K3JH 4B0MM 1IQWH 4OLWH 2NTFA 1MVUB 4OV5B 43CAB 1AJ7H 1IM9A 2EZ0C 4U33A 5KSVB 5F21B 1CICB 2ESVD 1TJGH 4LARL 2OTUB 4R4ND 4O51B 2YN5A 4LCCC 5TF0A 4HXAL 3DYPA 1T0NA 1A7OH 2QR0B 3VH8A 3QB7C 2NQCA 4JAMA 1QFWH 4UQ3A 2DDQH 5I30L 1I3RA 1KJ2A 1WTLA 3WYRA 4MJ6B 4PG2A 1IMHC 1SHMA 2NY3D 5IFHL 4HUKB 4KTDL 1OT1A 3HC3H 4GKNA 1NCDH 3HUJE 1MEXH 3TA3A 3LSOA 3MXVH 4PLKC 4GG6E 5DI8A 4OLXL 3UBXA 3IGAA 5A2LH 1AXTL 4MCZB 4MAUH 4ZPTA 5KN5B 3K81A 2BRRH 3MRMB 5JHDE 3D25B 3VDAA 3QCVL 1PLGH 3GSXB 3G5ZB 4R0LB 4PGZA 4XXDB 2HN7B 3KPRE 2VR4A 3ARUA 1ORSB 1UCTA 1WITA 4GAFB 1NPUA 2HKFH 2C4FU 1A0QL 1Z0NA 5HVGB 1YNTA 2BY1A 1WJ3A 5CEXA 1S78D 4P57A 3VGFA 2H32A 3MNZA 2DQFA 3D39B 5D2NE 2Q76A 3PL6C 3QJHA 4UAOB 1CLOH 4MDJB 3QBTB 4WU7B 3ULSB 1H3VA 2A73B 3LB6D 3UPAA 3OAZH 1DLFH 3GSUB 3EGSB 5FM4A 3BT2L 2VITB 1MCQA 3HMXH 4Z7WB 1ONQB 3GK8H 1JNNH 1JYVA 4YHMH 1SM3L 1CZ8H 3RAJH 4OGXH 4HKBA 1LEKA 2Q20A 3STZB 3QUXC 2IFFL 2G60H 3SDCB 4Y4HD 3WUWA 2DLFH 4KHTL 3VWJA 2FECL 4NYLB 3U7AA 3LOWA 1H3GA 4YR6A 3HZVB 3UJIH 1DQQB 2DLEA 4KDVA 3P9LA 2IQAA 2MJWA 3PGFH 3V2AR 3QRGH 3WD5L 2YD8A 2R1XB 5CKAA 3BKML 4UV7L 4RFNC 1J0YA 4OBSA 5C09D 2FX7H 5HHPB 5DHVH 3KJ6H 1MIEH 1I9JH 4TVPD 2YD1A 2CLRA 4BZ2H 5C6WH 2HFFB 4LP5A 4MNQD 3NCCB 3C6SA 5EBLB 5KVDH 3QJFB 4KV5E 5EO0A 1JZ2A 3D9AL 5CEZH 1U8LB 3QUYC 3I9GL 5CZVH 1A1OB 5KSBF 1NJ9B 4P5TA 3MQIA 4F37F 5T1DH 3V8CA 1NSNL 1H3TA 4QXGH 3MV9E 1BQSA 4JZOA 4QY8A 2VN4A 2VDNH 4ZUTB 2XKNA 2YC1A 1F4YH 4K3HA 2AV1B 4M7LT 3WJJA 2F5AL 2EYSB 1HEZA 1UXWA 1F42A 4UTAL 5ERWA 5IB4B 4CUCA 1A3QA 4AT6B 4X83A 4WFFE 1B0GA 3BN3B 1NUDA 2LV4A 5JW3H 2XQYK 5DJDA 3SKNA 5GGQH 5C0BA 1RZFH 5H37H 1X5GA 3RZCD 4LDEB 2CR6A 3O6KL 1JWUA 2H6PA 4G9DA 5B39G 3C2SA 3CVIH 3ULUL 3U4BL 1NGYA 4GT7A 1RZJC 4X4ZA 2H3NA 3OKLA 1HHIB 3B9KD 4MX7B 4ZSOA 1KTKE 4JR9H 2J4WL 2YD7A 3HI1A 4ELMF 3R1GL 1AO7B 1IC1A 2X41A 4FXKB 4KWUA 3RDTA 5EORH 1QSFD 5DD0L 5CGTA 4PJ5A 2D31A 3I50L 2FLBT 3BGMB 3QEQA 3ULUE 3QCUL 2HTLC 2WIIB 3MRGA 4GMSL 3KLHC 3KXFB 1JV5B 4PS4L 4JKMA 2ZCLH 1ZLUK 4FP8H 4ZO8A 4B7LA 4IMLB 3CFDB 4OLVH 4P2OC 4U1LA 2GJJA 3DTXA 1C5BH 3VXSB 5JDJA 1YEFL 4LLUA 3GRWA 4LGPB 3CH1B 4I13B 3OAUH 4QRRD 3WL9A 3DO7B 1VFAA 2EDJA 3AM8C 2VABA 1H3UA 3MV8B 3QXWA 1KPUA 3H3PH 2V2TA 3QCTL 1H15A 4Q9RH 2EICA 1XGTB 2K9UA 1ACYL 4C56A 2QEJA 35C8H 4M6MH 4QRUA 1LK3L 1SBSL 4XVTL 5FEBA 5MERB 5HHOB 3MOBH 4WRLA 1BVKB 5JW5B 3NIFE 2NX5E 5CJBA 5GZND 1IBGL 1JE6A 2FH8A 3OZ9H 4HUMB 1BF2A 3QWOB 2V7HA 4QHKI 1FN4A 3QULB 3SBWA 4H0HB 1HQRA 5GSVA 3BWUC 4IBLT 5ISZB 4XP9L 3S4SG 4ORZC 3A0OA 4AMKL 4RX4D 4PJ9B 2X70A 3O9WD 1HYSC 5CHNB 5F9JA 1PG7W 5C92A 5TE6H 4Y4KC 3MRHB 3FB8B 3DIFB 1NCWL 2ICES 4JFOB 32C2B 1KNOA 2X4OA 4NN7C 2HWZH 2EYTA 1DBAL 1FFOA 3U6RA 4U0QB 2JJTC 1UWXH 2C9AA 4TRPH 1ZLVK 3N1PC 4UTBL 4E0RB 1NFIB 2X1QA 3LH2H 3DI3B 3O2DH 5DK2A 1IQDB 1NQBA 3DVNA 3LEYL 4HS8L 3IXAA 4IIQC 2NR6D 1RHFA 5IGXH 5F44A 3FQNB 1DANU 5D4QA 3LHPL 5F7NC 5JHLL 3IVKA 4LCYA 3Q5OA 4TUJB 4X80L 3FT2B 3RKPA 2XWTB 1VCAA 3AUVA 4KI5F 2NW3A 3RWDB 4ONHA 1M7XA 3OKMA 4K94C 1I8MA 3SJVD 3ZT5A 1FZOA 3H7BB 5D9SA 4JO2L 4V1DA 1IGCL 5ITBH 3QO1B 3VMNA 3IDGB 3RWJB 2IALB 5GS1B 2VH5H 4ZTPL 2DQTL 1OLLA 4GLRH 5L2JB 5T3ZD 4HUWA 1DEEA 4U0RC 5BMFH 3UTQB 4PRPD 1FGNH 1KIUA 4DVRL 4HEME 3D3VE 2BC4B 3BW9B 2FJFB 3HAEA 1PQZA 3BIAX 4KKCD 4P46C 3EOTL 4KKLD 1IC5H 5D1ZD 4DAGL 3TCLA 3FRUB 4DTGH 4N1EA 4MGXA 2AJVL 4YHKH 3SO3B 3EFDL 5BOPA 5D7LA 5HY9A 2DWEB 2JLLA 3NIDF 1XF1A 5EZJA 4BSVA 1PGRB 2XWJB 4WWKC 3V6ZB 1DSFL 4CVXA 1FZKB 2JF1A 2HH0L 1OGTB 3THML 2CDFA 4H1LG 1RJZA 1TETH 5D7IB 1EO8L 5D1QD 1H3WM 5JR1L 3TZVD 5C0AA 2VB5A 4Y5VC 4U3HA 1U93B 4WV1B 2CKNA 4HK0B 4WJ5A 3N9GH 2KQNA 1ETZA 4P48A 5IBLC 1I3VA 3SDAC 5FV1L 5D6DC 3TO2B 1Z9MA 5B8CA 1FO0H 1RIHH 2P8PA 2F54D 2WWMD 4E41E 1ROWA 3D6GA 4KGLA 1ZA6A 4JQVA 4HHAB 1JPSL 4P9HL 5HHXL 2R0ZL 4HGWB 3JV0A 2KQMA 1MPAL 1ZTXH 4G6FB 5CGYD 4QHNA 5EUKA 1MJ7L 4QRSB 3JWOH 3UZQA 3VFMB 2D7PA 3TIEA 2A6IB 1T22A 1WCBB 2BVYA 4G6ML 1AP2B 3RX7A 1FV1A 3HC0B 3EZJB 4MQ7B 1A1MB 1DBKL 3KYNA 3OPZH 1YPZA 3WFCH 1FFNA 4M1DH 3WIFB 4FTVD 1JPFA 5HYJA 2QLVB 2CKBL 4NQXB 2YWYA 4XPFL 5HHME 3W9DB 2FGWL 1JNLH 1YMMA 4JREB 2VXQH 3ARVA 3UTSB 4M1GH 3PWPD 3MRIB 5FGSA 4H8WL 4JFFD 5AYUL 3SE8L 3BIBX 4A6YH 3K4DA 3W39A 3LV3A 3HMWH 5IFAL 4PJEF 4A6YB 2YMXL 1FSKB 4X6CA 1RJYB 5DXWA 3KPNB 5DC4B 4P5KB 3BESR 2NY7H 5D5MF 4LHUA 2GQHA 5MEPB 1FGVL 1QLEH 1RFDL 2BY3A 2XYCA 4LSRH 1XAUA 1TCRA 1K6QL 4OIAA 4PJ5E 2NY2C 3MCLH 2QQLL 3C5ZD 4GQPH 4HUNB 1CLZL 4R97B 5GIRB 5I16B 1KB5H 4YC2C 4XVJL 3G6JB 4PG9B 2ZCHH 2P46B 1KB5B 3ALXA 1HYRC 4FQXD 4ONFH 1MHEA 2FIRT 1IL1B 4LPTA 1M7DB 1G7QA 1S5IH 1BGXH 3MJ6A 5GHWL 1E4KA 5L2KE 3QI9D 3MLUH 1I1RA 2VSCA 4NKDA 3UJTL 3S88H 3TBVB 5IQ7L 4X9FA 4WCYL 5CD5C 4NQDE 2OJZH 5JXAH 3C2AH 2WNGA 1YC8A 1UM5H 2MKWA 3GSQA 4C56E 4LEOB 4UDTB 4N5EC 4P9MH 2CRYA 1P5UA 3P73A 4RGMC 1T1YA 3I6KB 2C4XA 4O58H 5H8DA 5DUPL 1AQKH 2AXJA 1CDIA 1IGJA 1XIWA 1KT2A 4LBEB 1A7BA 2VDLL 1GC1L 2AJYL 3SPVA 2DL9A 5FYLL 3W11D 3UTOA 3R8BB 2B1AH 3ZL4L 4H5SA 4W81A 2BFVH 1K3ZA 5KVGH 1GIGH 4P2QA 4G8GA 1MIMH 1FL5A 4LFHD 2X89D 4ODUB 1U8OA 1CL7I 5HBBA 2LU7A 5JTWA 2B39A 4I5BB 3KJ4B 2XOTA 1NUNB 1PKOA 5F7DB 2C3WA 1MRDH 5FYLE 4K8RH 3E6HA 4YFLI 1MCNA 5IHZA 5DO2D 3V5KB 1CGYA 4K3JL 1QHOA 2PKDA 3L95B 3RVUD 5CD3B 3LD8C 5IB2B 4JM2D 1RAMA 1IQWL 2APWA 5ELIA 2WQ8A 4OLWL 5E5MA 1N6UA 1AJ7L 3MNWB 3ZKND 1KLUA 3QFJD 4Y5XC 1AGDA 3H9SD 4OCWH 1TJGL 2X4NB 1S7SA 5IW1B 4FG6C 2H2SC 3VWKC 1GZPB 2COQA 3QZWB 3MRFB 3ES6A 1T1ZB 3P9MA 2VKWA 3ILPA 1A7OL 2P5EB 4ZO9A 4LCWD 1QFWL 2DDQL 5E4IA 1CFSA 1U3YA 3Q3GB 3V7AG 5EC2B 5LVEA 4JM4H 3VCLA 3OQ3B 5E1AA 4Y2OA 5HPMB 1KF9B 1YUHB 4M7LH 1RK0A 4V1DE 4P4RB 4XNMB 3HC3L 2AEPH 2BVUA 1NCDL 4S1DD 1MEXL 5I1CH 1FYTA 2JIXA 1NL0H 3MXVL 1JWSB 5FB8A 1QG3A 1CDGA 2NXYD 1UZ8B 5E8NA 4MAUL 4K9EC 1OAZH 2BRRL 4R0LC 3UTZB 3MV7E 3LN4A 1PLGL 2BXZA 4OZIB 4QLRA 1CI5A 2BZDA 1PVHA 1IEHA 2VO5A 3ZSSA 5E8EB 2HKFL 1G7MB 1HXYB 5IEHA 3BUYB 3WIIH 3T0EA 3RNQB 5EULV 5EU6E 1YYLH 5SWSD 2OMNA 3RPIB 2ZKHH 2Z93A 5CIPB 4M43H 1IILE 1MI5B 1IM9D 1DJSA 4PV9B 4EN3B 2P43B 5IW6A 1TMCB 4ESKA 1YC7A 3QYCA 1QFUH 4MJIA 5I76B 1MLBB 4NT6B 1CLOL 4NHUB 3CDCA 3MUJA 2G5RA 5BVJB 4V2CB 2R2HA 4TYUA 2R9HD 2XXMB 1DLFL 4Q6IB 2VR5A 1YEEH 3CPLB 5FA4B 5IKCA 3HMXL 3GK8L 1JNNL 2DJUA 5JO5B 4OB5H 4CVZB 2X4RB 2IEPA 3A67H 3WE6B 4YHML 5I71B 1TQBB 4WUUB 4NQCA 4F7MA 2C7UA 5FKPB 1CZ8L 3SDCC 3TA3D 3RAJL 2HLAB 4OGXL 3CAFA 1KELH 5DS8A 5IBUG 1BQHB 2G60L 1MREH 4PBWD 2DLFL 4C57C 5J6GB 5HGAA 5FIEA 4YHZH 3UJIL 4AENB 2H9GB 2G75A 3WIHA 1UADC 5C08A 3REWB 3PGFL 3QRGL 4MA3A 3X3GH 4PJAA 2FX7L 3J8F7 3KJ6L 4WTZA 1YEGH 1YPZE 1MIEL 1SYVB 1I9JL 2HTKC 3IT8D 1TDQA 4BZ2L 3HCVA 1AH1A 1T21A 2Y7QA 4XB7A 5DRZB 5KVDL 3G04A 1RUMH 2UVFA 5DJYA 5K9OB 3MJ7A 4WHCA 4L3EE 5CEZL 1DTUA 1U91A 5IT2H 5CZVL 4KMQA 2AQ2A 5BRZB 2ARJB 1EMTH 1MCCA 3QDGA 4QOKA 5T1DL 2W38A 2J6EA 3MROB 4ZQKA 4QXGL 1BIIB 1DVFA 1ZHBB 5IMMB 2VDNL 2Y25A 1JF6A 5ETUA 4MHHI 3B5TA 1F4YL 2F8XC 5E6IB 3BZEB 5EH1A 4X4ME 2EH7H 1ZT1B 5L8KB 4P23A 5CEZE 2YOCA 1QLRA 1T2QH 3VWJD 2F8OA 1FCCA 5JW3L 3S34H 3IFPB 5TDNA 2CUIA 4LSDA 3VRIB 4OIBA 5GGQL 3K46A 1RZFL 4UZGA 4N0CD 3CVIL 4QHKJ 5J06A 4XAKE 2AERT 3SE9H 3EDFA 4U1IA 3RL2B 4Y2DB 3GGWA 3U9PH 5IG7A 2W92A 2GY5A 4JR9L 1K4CB 4P3DA 3CC5B 5ILTH 3RWEB 1GGCH 5EORL 3TYFA 3D69A 3CXHJ 4X4XB 1WICA 2A74A 2GTWA 4XTRD 4P5TD 3EYVB 1QPXA 3IDJB 2GITB 3O3UN 1HXMB 3DVGA 5DJAB 2ZCLL 3OJDB 2YRPA 4FP8L 4OF3A 4OLVL 1NLBH 4KKBD 1C5BL 2FJGB 1NGWB 2R2EB 1SJXA 3OAUL 1P7KA 2YD9A 4PRIB 1V05A 4HIHA 3VXNB 4EQ3A 4J12A 5HSFA 4NCDA 3VFPB 3H3PL 5I17B 5C6TH 1CGUA 3WEXB 3DRTA 4Q9RL 4FQLH 4Q9CA 3RNKB 3RUGB 1T1WB 2CK2A 4JRYE 5C0BD 5KZCB 35C8L 4M6ML 3VXSE 3GMQA 4NN5B 4BFIA 2N1KA 2AXGB 4G6JH 4Z9KB 2FWOA 1S7UB 3MOBL 1P4LB 3HZKB 3KS0J 4D8PA 3OZ9L 3VXRA 4WI2A 4GFTB 1WAAE 1FQ9C 3O11A 5I66B 1MFEH 4XPBH 3F7RA 2VAJA 3ETBF 1EPFA 4PJ9C 1AFVH 1LO4H 5E4EB 5D1XA 3VRJA 3B5HA 1FG2B 2R0LH 2ZOLB 3TVMA 4F8QA 1FJ1B 3MLWH 4L8BA 5D2LE 3RDTD 4PJ5D 4R2GD 5HHOE 5H35A 5TE6L 4CL7A 3QEQD 5L6YH 5IJVB 2DTMH 4LU5H 1GRWA 3F7YA 2HWZL 5DYOA 5J0BA 4KXZH 4XX1G 5FF6B 1G1YA 3UMTA 3BKYH 3F12A 4HIIA 3P0GB 4TRPL 4UT6H 5J1TC 4FQQA 5GXBB 1RQ5A 1HIMH 1A3LH 5HVWA 4U6XA 3LH2L 3O2DL 4M6NH 2WANA 4HIXH 5ESQB 1SBBA 3LEXB 5J9PA 5IGXL 5ID1B 3P2TA 1T7XA 2ZUUA 4C54A 4GRWB 4DZBA 4NC2B 3EO0A 3M1BA 4FQ1H 1U9KA 1GGBH 3GIZH 4C56D 2PNDA 1N4XH 5GRVK 1B3JA 1P5VA 5GGSB 1WLHA 2YZ8A 4Z5RB 1KB9J 3BDBA 2Q3AA 3PIQA 2YA0A 3T0EE 1QPPA 3HLAB 1S5HB 1HHGB 3L5WB 3MREB 2UZYB 4B5EA 3RVVD 1KTRL 4MJIE 4KV5F 4HMDA 5GS1C 4OLEA 3T0AA 3C8KB 5ITBL 3QPQC 2HG5A 5EU4A 4XBPA 4MA8H 3LQAH 3ARPA 3UX9B 2VH5L 4HK3N 4LCCA 3U82B 5BMFL 4OF7A 3WNLA 3RQ3A 1FGNL 1OARH 5ICYA 4MXVE 3IF1A 3WFEH 3G5VA 4NQVB 1H3XA 3UTTA 1L0QA 4PRBB 4CW1A 1CFTB 2MQCA 3SO3C 4HX1A 3UPCA 3I85A 1K8IB 1IC5L 5MENB 4DTGL 4YHKL 3T2OA 3GSVB 5IB5B 5B39B 2MQ0A 4WEUD 1F11B 2X7LB 3GDBA 3OSKA 4L29B 1SYSB 4NC1E 2UYLA 4RFEA 2PYEB 5C0NC 1T4KB 4C83A 3VXQB 4G8FB 4FFVD 1VEPA 43C9A 1TETL 4PJAE 4JM2F 4RGND 4WV1C 2CDGB 4KK6D 4M8QB 4ORGB 4QCIA 4U2YA 4GO6B 1NKRA 3VFNB 3LQZA 2UZIH 2CUHA 2EDHA 4H0IA 5DJ2A 1TENA 4PP1C 5FOBA 3N9GL 5DEFB 3LKSB 2R0KH 2HJLA 3QNXB 4NOBA 1FO0L 1RIHL 2BHUA 1K9TA 3ULUF 3H9HB 5D7IE 4NO5B 1FZJA 3S37H 3QDGE 4IOSD 5J13B 5CEYA 4QHLB 1F3JA 3JWOC 1ZTXL 2FHBA 4OZ4A 3HE6B 2ZUVA 3PWLB 4QO1A 3JWOL 3S36H 3RA7H 1PDKA 3RWGB 1FAKT 2AP2A 1QP1A 1RMFH 2P49B 1OM3H 2WM0A 3OKYA 5EIVA 1X5AA 2I27N 3B9DA 1XGUA 2ZG3A 4IRSB 5DMKA 2J7LA 3OPZL 3WFCL 4M1DL 5D7LD 1H8SA 2XT1B 3QUXA 4LLWB 2Z35A 4JREC 1KIPB 3MRBB 1SJVA 3VD3A 1JNLL 2D9QB 2IPUG 3NIFF 3S4SB 3S6CA 2VXQL 1S7QA 4M1GL 3BKCH 3OKOB 1EJ6A 2LQRA 3OGCB 4I4WA 2VZUA 3ZYOA 2P42B 3M17A 1D5MB 3OF6A 4A6YL 3HMWL 1TVHB 5C0AD 4X7DC 3C08H 1P2CA 5FKAA 2NY7L 3PNWA 4XXCA 5K9KB 2P8LB 2GUOB 1EUTA 1QLEL 4LSRL 1HSAA 4R97C 1UA6H 2BCKA 1YN6A 3UTSE 5L8JB 2YXFA 4JRXB 5J3HC 3MCLL 2OJEA 3W5NA 4LLDB 1XH3A 3MRRB 1HZHH 4OCLC 5B38A 3QUYA 4OZGE 1KB5L 3D0LA 4PRHD 4F7CB 5HJ3A 4Z7UA 2ZCHL 2OLDA 4ONFL 1QR1A 3TT3H 1Z5LA 2W0PA 1S5IL 1BGXL 5JA8B 1JNHB 4KJPD 5FCSH 1BFTA 3HB3D 3MLUL 3C9NA 5AD0A 1HH9B 4UDUA 5BZWB 1N8ZA 3S88L 4ZODA 4YHOH 2X5PA 3T4AA 4PTTA 3ARRA 3GMOA 3OKEA 5HYJD 5JXAL 2OJZL 3G6JE 1T89C 3BPNC 1QA9A 3C2AL 1UM5L 4NM4H 4QRTB 2BNQA 4J3OC 2DKSA 4P9ML 1YMMD 3UJJH 3S3SA 4OTXH 5EBMB 1T7VA 2GJZA 1WBXA 1KULA 4O58L 1AQKL 1A6TA 1XF3B 4JKKA 5ANMB 1OW0A 1T83C 4HJJH 4R7NA 4MD5A 4X5XB 4AK1A 4PJCB 4M9PA 5DK0A 1RI8A 2VQUA 4ZO7A 5T1LA 1U8QB 3BRFA 2B1AL 4YHPB 1X5KA 3OMZA 1NC4B 2BFVL 5IEKA 5KVGL 1GIGL 3I6LD 3IKCA 1MIML 2NLJB 2UUDH 1LMKA 3KJ4C 5BZDB 4L3AA 4MD4A 3L1OH 3R0MA 4TNVK 5IBTH 1N5YH 1DLHB 3SDDA 4I77H 4KJQD 1MRDL 4K8RL 4O2FA 4H26A 3PHQA 3K8LA 1P4IH 1FL6A 1VFBB 4HKZA 2I25N 4LPUA 5KAQF 4XPAH 2R1WA 4LRIA 4P2OA 2DQGH 1GL4B 3DX6B 4XCFH 1XF2B 1U41A 4H1LH 2IJ0C 3TNNB 2IANB 3AM8A 5F7EH 3BMVA 2HT3D 1NDMB 1KTLB 1ZV5A 3CCHB 1ZA3A 4OCWL 5FYKH 4U31A 2X42A 5FYJD 2ARJQ 3GMNB 2RQ8A 1XIWD 4JFDA 5DVOA 4F7EA 1VEMA 3IU4H 3X13B 1MHCA 2IGFH 1B4JH 4JM4L 1NCAH 3HKFA 4MZ3A 5C0CE 1OB1B 4JN2B 3RGVB 4M7LL 1BX2B 1ZE3C 2JJWA 3MLRH 1A7RH 2AEPL 2FEDC 2H8PB 4G8GD 4P2QD 4C4KT 5I1CL 2R15A 3SDYH 1NL0L 4JFXB 3VU2A 3HRZB 1OAZL 1MCOH 3KPOB 2O5ZH 2P5EE 4Y4KA 1J5OH 3VD5A 4HH8A 4YNYA 4N90D 2BSRB 3C87A 3UTTE 5I8EA 4GJTB 5TF1H 3ZKMC 4RWYH 3LKQB 4JFZH 1N26A 1U2HA 5IROA 5IB1B 3LQMA 1BAFH 3J7HA 4L4VE 2EKSA 3WIIL 4EN3C 5IOPA 1YYLL 4Z7VA 4LASH 2ZKHL 3IAGC 3QA3A 1W2KT 4IIQA 4M43L 5F3HB 3TBSB 5I8CA 1QFUL 4PJIB 3S35X 1YY8A 1A4JB 4UV4H 2A38A 3CSYB 4MCYB 3S96A 1I9RH 4Q6IC 1RURH 3RVTC 3TC9A 3P0YH 3G9VA 1UVQB 5IB3A 3SDXA 1NGQH 2QSTA 4QF1B 3MRLA 5I71C 1YEEL 4U3CA 1R3HA 1TQBC 4Z0BH 3QPXH 4OB5L 1TNMA 3N0PB 3A67L 4M6AA 3MRKA 1GZQA 3BYTA 5A3ID 4PR5A 1B4RA 1JHTB 1RIUH 4G42A 1FYTD 1MHPH 2JIXD 4WUKH 5AG8A 1SEBA 1H9VA 5HHNA 1KELL 3FKUS 1MREL 1DCLA 5DUBA 3DYMA 1T5WB 1FORH 3AREA 2YPLB 2XXCB 3O3DB 4PJXA 5EOTA 4ZOEA 4YHZL 4JLRA 3MBXH 4CDGC 1RZ8A 1XF5B 2GT9A 4JFYB 5AAMA 5T33H 3X3GL 2AV7B 4EI5C 1RZKH 1S9VA 2YBRB 5CKGA 1OTTC 3C6LA 2ZJSH 3T0ED 2F5BH 4P46A 2LAGB 1YEGL 5ENWA 1LD9B 3FQRA 5LAXB 5TDOA 8FABA 1RUML 2VZSA 4PJHB 2HMID 4FMFA 5FK9B 5IT2L 3QIWB 4DVBA 4F80A 1AD0B 3E6FB 3JWDH 3PGDA 1EMTL 4PGBA 1QVOB 1T3FA 2DF3A 1ZT4A 4RBPK 5E6IC 5LXGH 3G5XB 4Y5VA 4NQCD 5EIQA 1AGFB 4F15B 4D9RD 3PP3H 4OZHA 3SDAA 2EH7L 1WWCA 1NBZB 3HZYB 2C3GA 3RWHB 1MCIA 4JQIH 2GIYA 1JGDA 1FNFA 1P84J 1T2QL 3V0VB 1F2XK 3S7GA 4Z7UE 4L1DA 2ATPA 4WTXA 3S34L 3GJFA 2G2RB 2DIBA 4EIGB 4LPCA 1JZ4A 5C08D 4Y2DC 4U7MA 2DLIA 3V7MA 5MHSE 3MUGA 3SE9L 3FO0H 1U3HC 3U9PL 3WN5B 5BXFB 3L3DA 5EB9A 3T4YB 1S7WB 2NNAB 2EO1A 3LS5H 5M95B 3IJYA 2VERN 3BKJH 5I75B 2A9MH 5DDHB 2BNQE 5ILTL 5DRNB 1GGCL 5LGHH 5HGDA 4X99B 5ID0B 1MCWW 4LSSH 2IBZY 3FOLA 1NBYA 4QOKD 4X4YB 5M7QA 4LVNB 1ZT7A 1DVFD 4KPHH 3EYOB 4AIOA 1NLBL 4MAYD 4NRZA 5D7SH 4ZFFA 1G7HA 2P44B 5DA4A 4X9GA 3E3QE 3FRPG 3RVXC 3O45B 1W0WA 2JJVA 4GUPA 4P23D 4B7IA 4XVUD 5C6TL 5C0RH 4NN5C 4FQLL 4X0KA 2VLRE 1FVDA 3EOBA 4QTIH 4M62H 1BBJA 4G6JL 2DQEH 2YPKA 3OGOE 3GB7B 5I1LA 2GFBB 2NMSA 2ZSVA 5E4EC 2OP4H 1A6VH 3VDCA 3TPUA 3P4OA 1AC0A 1MFEL 4XPBL 5C86A 2VDQH 3OXRA 5GS0H 5FA3B 1AFVL 1LO4L 3CFIC 1JZ6A 3JUYA 4RCAA 5KVFH 2O5YH 1U8PB 1T66C 3MA9H 1LEGB 2R0LL 4PJFA 3RUGE 1HNGA 3RWCB 3MLWL 3MGTA 4QRPB 4UIMA 1OSZA 3S3JA 5FDWA 5HD8C 1UZ6E 4LOUC 4JFDE 2CGRH 3SKOA 5L6YL 1F4AA 5D7KE 1K5NB 1M4KA 2DTML 3R0NA 4LU5L 2EDDA 5ESAB 3BKYL 5IBUB 4UT6L 2EIZA 1HIML 3FHAA 4JFEA 1A3LL 3K74B 3VG0H 2SEBA 4GW4A 1KXQE 2X4UB 4M6NL 4HIXL 5J6HB 4UBDD 4N8VA 4ERSH 2OL3H 2ADGA 1CT8A 5T5NF 2PXYB 4J4PC 5HTSA 2NY1B 3JVGC 4FQ1L 5TPWH 4IOIA 3RBSA 1GGBL 3GIZL 1R3JB 2E9JA 3DUUB 3S37X 1N4XL 5LQBH 4GS7C 4NZTH 1QR4A 2CIKB 4OFDA 3FO1A 3ECBA 4EVNA 4U1MB 3S36X 1X7QB 3VXRD 3FFCB 3WDHA 4U1NB 1YPZF 4LAQH 1U92B 5D1XD 3QUZB 4H1LA 4X7FC 4FQIH 1AQDB 1BFOB 1ZVSA 4NOFA 3SKMA 3TVMD 2OTUA 4LPYA 1JGUH 4Y5XA 1U8HB 3T04D 1HSBB 4MA8L 3LQAL 5F72S 2NY4D 5JLZB 2D0GA 3VWKA 3ARGB 3DUSB 2QR0A 3QG6B 3SDXE 4X6CF 1MRFH 4XNZB 2W0FB 3MRCA 4MJ6A 1GGYA 1OARL 3ILQD 5E99H 5IMKB 3WFEL 4I2XB 4Z78A 3O2WH 3EZ8A 3QXDB 4WW1B 4J6RH 4XNXH 1LP9B 1DBMH 4LLVB 5IJKC 3DHJA 1ZK9A 3MRMA 1P7QB 1QSEA 4WHTB 1C12A 4IDJH 4YK4B 3MLTA 5HYSB 2W0KA 3PDOB 3OHXB 3ZZ1A 2RJMA 1YJDC 1UENA 1CD0A 3PWJA 1FVEB 4G8EA 1MJJA 3TH4T 3T1FA 5C1MB 5MENE 1G9NC 1G6RB 3FONA 3VXTA 1FCGA 1E28B 2UZIL 5EBWB 4NCC2 4Z0XA 1N6QH 2R0KL 2BXYA 5IMOA 2PYEE 1BZ7A 4GSDH 4WU7A 2W59A 2EDNA 4L4TB 3ULSA 2QKIB 2A73A 5J13C 4J7RA 4OFVA 4UQ2A 5L0QB 3HE6C 2VITA 3S37L 3GSNA 4FQJH 5E9DB 3LAFA 4Z7WA 4NCC1 5LGJB 2VWEC 4U6VH 3UTTD 5I19H 3NGBB 3S36L 3RA7L 2A0LC 1RMFL 4IRSC 5IM7A 1OM3L 4OZHE 1RZIB 2HFEA 3STZA 2AKRB 2RFXA 3SDCA 2IG2H 2Q8BH 3FQTB 2DKUA 2EDEA 4LKCB 3QIUB 3N1GC 4IMKC 3OKNB 5JPMA 3KPLB 3TBYA 3OWEA 1BZ9A 2CJUH 3BKCL 3NFPB 2R1XA 1UYWH 1F6LL 1P69B 2H1PH 1WVZA 1HOCB 5CJXA 5SX5H 2X4PA 2FX8H 4FQCH 2HFFA 3C08L 3EHBC 5EBLA 5AYQA 1CWVA 3QJFA 1UA6L 1IC4H 1VKXA 5TJWK 5IFJB 5EN2A 2VAAA 1NJ9A 2ZCKH 3WKNA 1HZHL 1KN4H 3GUTB 4Y16A 4OIIH 2ZUWA 1DQJB 3CVHB 1XR9A 3TT3L 1O7VA 1T0MB 2C1PA 3CMGA 2HAZA 5IB4A 2J88H 1JHKH 3Q6GH 4JRXE 4JY6A 3NCMA 1WZLA 1BD2D 1EK3A 4YHOL 1QYGH 3QUXD 2L4OA 4OQ1A 2OM5A 1KG0A 3O6FA 5C0FA 4NM4L 2V2WA 4O5LH 3UJJL 3HN3A 4OTXL 3ROLB 2A6JB 3KPPA 5A16B 2Q1EA 4HJJL 1MWAH 1TQCC 1HHIA 2XA3A 3EJYD 5DJZB 4ZFZB 2V2XB 3QEGH 1HDMB 4PP2A 2BNUA 2VXUH 1YEHH 3QDJB 1XR8B 5E0QA 1AO7A 5EZLA 3DX8B 3V52H 4HULB 1C5DA 4LCUB 1VENA 5KSBB 3L1OL 3BGMA 1X5IA 2FDBP 3RTQA 3QUYD 3VGHA 2J8UA 1MFBH 2YD5A 5DURD 5IBTL 1N5YL 4MXVF 3RIAF 3EDKA 3CFDA 4I77L 5BS0B 4DUXA 4JDZB 4JFEE 1P4IL 4Z76B 2IF7A 4WFED 3VFVA 4MJ5B 3FB6B 1JCKA 4XPAL 1BWMA 1CIUA 2R1YB 2DQGL 4BA8A 1Y18A 3FB7B 1W0VB 4XCFL 2RHEA 1NCNA 3NH7H 3RWFB 4I0PB 1KACB 5F7EL 1W8NA 1NGXA 3B5GA 3BQUB 3QQ3A 4LFHG 4AEFA 4CMMB 2AK1H 2XQYG 5FYKL 4NFDA 1A9EA 1F90H 3HG1B 4XPGH 1OAKH 3BYYA 3QSKB 2FCBA 3QDMB 1BZQK 4PJAF 5E7BA 2XTJB 3MRNA 1HQ4B 1H5BB 4HF5H 3IU4L 1J1OH 1R3KA 2IGFL 1B4JL 3QULA 1NCAL 5SV4A 1A21A 2F8VA 5T1LD 4ELMB 4WI9A 3A6BH 1F3DH 3NIGF 3TJHD 1LO5A 4NNXB 5FO7A 3WS6C 3MLRL 5CBAB 1A7RL 5FYKE 3QWRA 1WIPA 1C7SA 2VL5B 4KJYA 4QHMA 3SDYL 3DXAA 1OQOA 5C07A 3O8XB 1WWWX 4ODTH 1X5ZA 1UB6A 1MCOL 1B6UA 2O5ZL 3ALWA 4ZYKB 5A43C 3BZDA 1J5OL 1F4HA 3L6FA 4I9WE 4QTHA 1ZGLA 2HTLD 1VEOA 3KLHD 4HDIB 1JUFA 2OBGA 5TF1L 3BWAB 4RWYL 4O02H 3CH8A 4JFZL 4P2OD 4POZC 1BFVH 1IQDA 4D9QD 3IDIA 1BAFL 5GJTH 4E9LA 1AD9B 2OL3A 1WQVT 4LASL 2V9QA 1KJVA 2XKSA 1QSEE 4Y1AE 1JGLH 1RVFH 4F9LA 2ZWLT 4UV4L 3PABB 1I9RL 1WK0A 5GGTA 1RURL 4MS8D 3P0YL 2XWTA 2Z4QA 1I4FB 3IFOA 1NGQL 3MJ9H 4R6UA 4W6XB 2AJUH 4U6YB 4Z0BL 3KDMA 3QPXL 1LDPH 5I1KH 1KUMA 2VSDA 1AHWA 4PREB 3VJ6B 1RIUL 3L3IA 1HYSD 1MHPL 4WUKL 3RWJA 3VFGH 4HGKC 4Y4KD 4OLYH 3UTQA 4BH7B 2C3VA 2VZ1A 3MODH 1FORL 4X6DA 4DGYH 3DSFH 4J3UA 3X14A 4JE4B 4Q97A 3BW9A 3ARFA 2FJFA 3BH8A 1CD8A 3M45A 3MBXL 4LL9A 1GCFA 4NRXB 2X6MA 3BD5A 2DN7A 3QUMB 4IEFB 5T33L 1RZKL 5HYQB 3FRUA 2ZPKH 1YY9C 1CXIA 5T5FH 3TNMB 5FXCH 2ZJSL 2F5BL 3M8OH 4JQXC 1QUNA 3RJQB 2BVTA 3GO1H 4UILH 3UBXG 2ZSWB 4N0FB 4PJ7E 2BVQB 4ZS6C 2HLFC 3QIWC 5C0GB 2Y72A 1QQDB 3JWDC 4LRNH 15C8H 2BDNH 4Q2ZB 3CX5J 5GRXG 3JWDL 3U0TB 3S5LG 5JOPE 2BVOB 3MA7A 1NLDH 4Q9BA 1U93A 4WV1A 5JQHC 5DJ0B 4F15C 5LXGL 3OTTA 1BVLA 4C58B 2W9EH 4R4BB 3CFBB 1PKQA 3RIFK 5DD5H 1A8JH 2QQQA 5GRZA 4JQIL 4HGWA 2X9YA 3FHQA 3QNYB 3ARED 3NN8B 4KDTC 3SCMB 4JHZA 1QLFA 4F7PB 3VFMA 1FPTH 3P0VH 4DKEH 3WN5C 4GAJH 1WCBA 3D48R 4FA8A 4UNVA 5D72H 3S8WA 3FO0L 4MQ7A 4PRDA 5ESVB 2BMKB 4P46D 1GH7A 3WIFA 5I75C 2DMKA 3LS5L 1V8HA 1DBJH 1N2RA 3BKJL 3W9DA 2A9ML 2IH1B 4HWBH 4ZUWA 2MCG1 1S9WA 5LGHL 1FNGB 5H2BB 4P4KB 1ZEAH 1G7LB 1ACZA 1MFDH 4LSSL 4L8SB 1NEZB 3IRPX 1DE4A 4K3GA 4LVNC 4LVEA 1J18A 1P84K 5GSRA 4NJ9H 5BO1H 3ORJA 1YEIH 3FQWA 3HNTH 3B3IB 5J12B 3OV6A 2ESVB 2BVPB 4KPHL 5MEPA 5D7SL 3G6AA 2DYPB 4HG4K 3V7AE 5DFVD 5JQ6H 5IBLD 2PTTB 2NTSP 3SDAD 3X12B 2MNUA 4AEHH 2ZG1A 4OJFH 4HAGA 1BMGA 3VGGA 1Y0LB 2ILLA 3STLB 3DSNA 5C0RL 1WWBX 1IL1A 4KRPB 5EPMB 4U4BA 4QTIL 2GSIA 4M62L 2DQEL 1RK1B 2ENYA 4OD2B 1WFTA 3W0WA 3G08A 3LS4H 2OP4L 4FXGA 1A6VL 1IKNA 3PUCA 1G0YR 5TE4H 2VDQL 5GS0L 1U8MA 1Q9OB 1TZHB 2F58H 1NUFA 3BVNA 1UKTA 2O5YL 4W4NA 5KVFL 2DQHH 3OR7B 5J8OA 1JVKA 3HPLB 3MA9L 2UZXB 1T89A 1C16B 2E8ZA 3ZE0F 1SY6H 4GW1B 2CGRL 2Z92B 3F8UB 5SWZE 4PJEB 4RNRB 2BSSA 4HV8A 5E00B 1MWAA 2OMBA 1T83A 3SGKA 1JYXA 5D5MB 4U7KA 3MRPA 5IVZA 2K7QA 3VG0L 1KJMB 2P45B 2FO4A 4QRPE 3SGJC 1OP5H 4ODUA 4ERSL 3BP7A 1ZHLA 2NY1C 2OL3L 5C07E 3DOSA 3MYJA 3DYOA 3TWCH 2NY2D 1IEBB 5TPWL 4DWHA 1KFAH 1U8KB 5LQBL 2VLLB 3Q2CA 4NZTL 3BPCB 3BPLB 1PZUB 3V5KA 1AGCB 3ZKSD 4ETQB 2A83A 3DX7A 3FZUD 4NO3B 3U83A 4LAQL 2FR4A 5F7UA 4KJWC 2FHCA 4F7TA 3ARQA 1ES0A 3SGDI 4FQIL 3RY4A 3FO9B 5CD5D 1ERNA 1Y6MR 2FYYB 3ARGC 1JGUL 4MNGB 1EDQA 3EO1A 3MRFA 3QO0A 2EDTA 2WWKT 2VDOH 2DRUA 4TVPH 1MCJA 1B88A 1B0RA 2IAMC 1MRFL 1XZ0A 3TO4B 4MNQB 3Q0HA 3QXVA 2VLMD 1A22B 5E99L 5E08H 2WINB 3WFHB 2FB4H 4G43B 4XNMA 4Z77B 3CFKB 3O2WL 2EIEA 1JZ3A 2OQJB 4XNXL 4J6RL 1XGYH 5FFLA 3FCTB 1M05B 1DBML 3QHTC 3V6BR 4Z7UF 4YK4C 1CDJA 5EC1B 2JJUA 4KRLB 3ZDXF 5DJ8B 4IDJL 4CN4A 5H94A 4F33B 5GPRA 2MFNA 4M61B 2H26A 5E8EA 1HXYA 1JN6A 3EAKA 4PBVC 5C0IB 4W70A 4M7KH 5F89B 2PW2A 2KZWA 3H6JA 1RV6X 4EN3A 3PJSB 5I1AB 1N6QL 2R23A 1U58A 4H25B 3RZCB 2ITCA 5KVEH 1UKSA 3QFDA 3O41B 4NHUA 4ZD3H 4YBLB 5L0QC 4GSDL 1CD1B 4FG6D 4BH8A 2H2SD 3VWKD 4YPGA 5K9QG 5JUEH 3DUHA 4WW2F 3ARDA 4FQJL 4I9WD 3NGBC 3MJ9A 3O4OB 4IRJB 5JO5A 2WQRA 1WFNA 4U6VL 5I19L 1TNNA 4WUUA 1T04B 3GEWB 2D7NA 3MLXH 4G8IB 2HLAA 4L4TE 2DICA 1QEWA 2IG2L 1PJ9A 1QSED 2Q8BL 4HQQH 1MCFA 4X9HA 3MR9B 5IESH 4G80A 3MMEB 1NFDA 2CIIA 4AM0A 2O61A 4QXTA 3OKDB 4R96B 2NY6D 4AENA 2OTWB 4RZCB 2W9DH 3PG2A 4U1HA 1Q9WB 2CJUL 4HAFA 4HIEB 3IJSA 1UYWL 3H0TB 1P7HL 2H1PL 1JPGA 4I3GA 3HAEG 4EI5A 2FX8L 4FQCL 4AIZA 3TN0C 4XVSH 1AGBA 2PW1B 1F97A 2XPGB 5DRZA 2VLKE 5ACLA 3FOMB 4H88H 2DWDA 1IC4L 1N7MH 1UZ6F 4AQOA 4G3YH 5FCUH 3MTRA 3U4AA 1LE5A 4XAWH 2ZCKL 5JW4M 1F6AB 1NC2A 2VC2H 4PB9H 1KN4L 1TTFA 4OIIL 2AJSH 3RY6C 4FMKA 3RFZC 5E6IA 4ELKB 2GAZB 4XX1E 5EIIB 4JVUA 1IC7H 1QTYT 3T77B 1AIFA 2J88L 1JHKL 4NJAH 3Q6GL 4JO1H 4M03A 3SDCD 1QYGL 3NFSH 4NHCH 2OR7A 3VRIA 3DURB 3O2VH 3BN9C 1S7RA 4O5LL 1HHJA 4JJ5B 5E94B 5GRJH 2D9CA 5EU7C 4LGRB 3V95A 3W0WE 3LRGA 4ZPVA 1MCKA 1MWAL 4Z7VF 3QNZA 1LO3H 4GAYA 3QEGL 5CBEB 4R7DB 2DIAA 1K4CA 1U3HA 1YEHL 1BJ1J 2VXUL 3BPOB 3V52L 1I8IA 1UCBH 4HWBA 2J1KA 4MB4A 5IUSA 1VGKB 2BNRA 3FO2B 1UFUA 3SDXF 1EVUA 5FO8B 1LE9B 5JXEC 3EYVA 3ME0A 4Y16D 2XFXB 1MFBL 3NZ8B 4WDIB 4HWEH 5LGKA 3OJDA 3SJVB 4WTWA 2JB5H 1JIBA 5K93A 2HRPH 1UJ3C 4I0PC 1U36A 3GIVA 5T3ZH 5DJCB 3EFFB 3BQUC 3SE4C 3NH7L 2BOBA 4PRPB 5DMYA 5GRWA 4PJXF 2AK1L 1YEKH 2XTJC 2EXWD 1F90L 3QHFH 4XPGL 3QIBC 5FUZH 1H5BC 1OAKL 1S7UA 2X4SB 4X8XA 3WCYA 1KCLA 1L0YA 2CLZA 5BQ7A 3MGOA 1IAOA 2IH3B 3MX0A 5I66A 4HF5L 2LVCA 1J1OL 2V5TA 1NAMB 1FG2A 3RBGA 3A6BL 1NUGA 1AO7D 1FJ1A 1N5AA 5CP3H 2DLTA 2IMMA 4W6YB 4NQSB 2X4TB 4NO0B 3QDME 4DFHA 5EZIH 4BQ9A 5CGMA 4NKIH 4ODTL 3C60C 2BSTA 4O2EB 2P5WE 3BIKA 3KXFD 5HGBB 3IJHB 3UYRH 4LNRB 5HI3C 1RJLA 4ELME 5I2IA 3WHE0 1AR1C 1U2CA 4O02L 3VI3E 3T0BA 4OZHF 4GG6B 1BFVL 4TNWF 5LG1A 1NEUA 1CQYA 5GJTL 5JHDB 3LKNB 5JNYA 3VRLE 1A6WH 1JGLL 2JCCA 4J4PA 1UXSB 1RVFL 3IDXH 2V7NB 3WV0A 5CMAB 4YAQB 1GVIA 1IGTB 3KHOA 1OAQH 2VLJA 4RIRB 1CG9B 1T6VN 5JOEA 2FD6H 2N4IA 3HLAA 3MJ9L 3L5WA 2PN5A 5ISZD 2AJUL 2Q87A 3VW3H 1NFKA 1LDPL 1CR9H 1QKZH 2DS4A 5I1KL 4KRNA 1MCDA 4M9OA 3C8KA 3PWPB 4CU7A 3QWRD 4JFFB 4F2MA 3TCXA 3DXAD 3CK0H 1JJUA 1S9KC 3VFGL 3ROOB 5E2UH 4RMRA 4OLYL 3LN9A 2XICA 1KIRB 1N3NA 3MODL 4MWFB 2VDPH 4URTB 3RX8A 1S7XA 3CSBA 3DSFL 4DGYL 3NMEA 1ZVYA 3N1FC 4PRBA 4YHIB 1CFTA 2DI8A 3ABZA 1UKQA 4KDWA 3M07A 1YNKH 4S2SB 3REVB 1K8IA 1QRKA 4NUJA 2ZPKL 3L3GB 5T5FL 1S9XA 4LQFH 3M8OL 3VFRA 5CZXC 3GO1L 3LRHA 4APQB 2I9TB 4UILL 1M71A 1OD9A 1JZ7A 1E4JA 1NFDE 4JGMA 3VXQA 4YFLF 3P11H 4KI5C 4LRNL 15C8L 2BDNL 2CDGA 4M8QA 3DJ9A 4OCRH 4HD9A 4PRNA 3VFNA 5BV7H 1NLDL 2B4CH 2BVEA 4PJFF 5KG9A 1MAKA 3DV6B 1OTSC 2E3VA 2W9EL 4NWUH 1WC7A 4L9LC 5DR5H 4GRMB 4JDVA 4ZUSA 4OAWB 4JY4B 1WGOA 3VFUA 1DQTA 3UP1A 3EYFB 5JW4R 5DD5L 4YDJA 2LAAA 3QPQD 3ZE1F 2B20A 1MAJA 2OSLB 3FRPA 1R24A 3MV9B 4HBCH 4QHLA 1PY9A 4PJGA 1I8LC 4M4PA 3PWLA 3IDMB 5A2JH 3ARFD 1FPTL 3P0VL 4UI2A 4DKEL 3VE0B 4GAJL 3GSWA 5D72L 1D7FA 1I3GH 4IRSA 1KLGB 4QKXB 2ZUXA 4DK6A 3KPSA 3PHOA 1OOAA 1DBJL 1J87A 2Z91B 2H2PC 4P4KC 4E5XB 2IPKB 4LCIH 4HC1H 4BZ1H 2CDEB 3U9UA 3FN3A 4HWBL 3VGDA 4QRRA 3BZFB 4L8SC 5FDYA 1F3RB 3KWWA 2FL5B 5C0ND 1ZEAL 4IMKA 1U8NA 1MFDL 4JM2B 3VXUE 3QXAA 3FTGA 1J0IA 5J12C 1D5MA 4Q6YA 3WHXB 5IHLB 4NJ9L 5BO1L 1CE6B 4R4NC 4QT5B 1JF1B 1YEIL 4PLNC 3QFJB 3T65A 3HNTL 5JIHA 1R3LA 4HJGA 5K59F 3NIDE 1KPRA 3NCFB 2ZZUT 4WTZG 5HDOA 5MEOA 4KROB 1OWWA 5JQ6L 2EDYA 1EEZA 1RHHB 5F93C 2C1OA 4IRZH 1JYNA 3UPRA 2BNRE 2WW8A 2Q6WB 5DD6B 4AEHL 4OJFL 4I48A 4A2MA 2WBWB 4KRPC 3C5JB 1JRHI 2AXHA 4G6FD 3W81A 2B8OT 4RX4A 3O9WA 4RSVA 3CFJB 4XB8A 1JNHA 2NXYB 3LS4L 3U1SH 2Y06H 3CUPB 1I7ZB 4IJ3C 3Q1SH 5TE4L 2HT2C 1T6WA 4DCQA 1KYOJ 2F58L 5EO9A 1IEAB 2DQHL 4YO0A 3NZHH 1S3KH 4HKJB 4XPTH 3SGDH 3WFBH 1TTGA 1MH5B 2NX5B 5EBMA 1OF2A 5HI4C 4OM1H 3ULVC 4JFQA 1SY6L 4X8JA 4XRCB 2NTFB 4PJCA 4YDIH 1IM9B 5DMJB 5MP6H 3BP6A 2YSSA 3LB6C 4NDMB 4ALAH 1JGVH 4KKAD 5F9DC 2DLGA 3D18B 1T0NB 4CNIA 2V9TA 3VH8B 5JORB 4JAMB 4N9GA 4UQ3B 1J8KA 1KJ2H 1CLCA 5GZOD 3TWCL 4NN6B 5J3HD 3BPLC 1KFAL 3RGHA 5K9JH 5ALCH 5D5ME 4AG4H 1VFBA 4U1JA 4GBXA 3LSOB 3W0WD 5SWQA 5DI8B 3UBXB 4EKXA 3IGAB 3LRSA 4ZPTB 2DM4A 4HS3A 1XF2A 4YXHH 2IANA 2WBKA 1NDMA 4M8VA 3CCHA 4OF6A 2W91A 3DHMA 2IADA 2JCCE 2APFA 3AC0A 1JK8A 2VLJE 3GMNA 1YNTB 1INEH 3TO4C 2VDOL 2GK0A 5CEXB 4D0DB 5D70H 3BSZH 4P57B 2ERJB 2H32H 4TVPL 3AS3A 2H32B 2DQFB 1WF5A 5I9QB 4PYGA 3E0GA 4IM8A 3GSOA 4U1SA 1OB1A 3QJHB 4X9IA 5E08L 2FB4L 1BX2A 2VZVA 4QHUA 2I07A 2H8PA 2EE2A 4G6KH 5CP3A 1XGYL 4ZDHA 5C09E 1I1YA 3WS6A 5TGBA 4J3TA 1QOKA 1OHQA 1KGCD 4H0GA 4LLYA 4TVPE 3HRPA 3SEPA 4MNQE 3VXMA 2BSRA 3PP4H 1EGJA 1CFBA 5L88H 1ORQA 3RHWK 4F57H 1JBJA 1LEKB 4HKBB 1DBBH 5IB1A 5HGGS 5ADOH 5DLMH 2B5IB 3WUWB 3VWJB 5JIKA 3RZCC 4ODHH 4M7KL 5F3HA 4K71C 2E7HA 5IF0A 4YBLC 1INQA 1W72A 4NKOB 3OKKA 5KVEL 2Y23A 3FN9A 3P9LB 3V4UH 2YUVA 3CSYA 4MCYA 4ZD3L 4JGJA 3DBXA 5JUEL 3O4OC 4IRJC 1W8OA 2CLRB 3SE3A 3CLEH 2M26A 2NW2A 3QISA 2QL1A 4MYWB 4O4YH 2ZUSA 2M2DA 4MXWH 1MCWM 5EO0B 5F7LB 1OT2A 4R26H 4E41B 2Z8SA 1JHTA 3QDHA 3MLXL 3O3BB 4P5TB 2XN9A 3MFGB 2J8UF 1C7TA 4JZOB 2APVA 3FT3A 4QY8B 1HWGB 4HQQL 4NM8H 4E42A 2XKNB 2YC1B 1T5WA 1D9KC 1PD6A 5IESL 1IFHH 3GJEA 3OR6A 4QYOA 2IBZX 2JK5A 1QSFE 1UXWB 3PXHA 5ABDE 3R8QA 5ERWB 3VGAC 2W9DL 4DQOH 5C0DA 1B0GB 3KYKH 3BZ4A 3DMMB 3BXNA 4CKVX 5DJDB 3SKNB 5HHMB 3B43A 4RMQA 4EN3D 4XVSL 4XI5C 3TEUA 3P4NA 3FFDA 4I3RH 2CR3A 4OM0H 2H6PB 2EDLA 4H88L 4QRRE 3L3HA 5LAXA 1NGYB 1N7ML 3QI9A 2PR4H 4G3YL 3B6SB 1IGMH 2H3NB 2HT4D 5FCUL 3MCG1 2WV3A 1AD0A 4XAWL 4ZSOB 3RVTD 1Q38A 2VC2L 4PB9L 1QVOA 4W68A 5A2KH 3ARDD 5EFIA 2AJSL 3HI1B 5I73C 3RDTB 3G5XA 3IU3A 3MOAH 3DLQR 1VGEH 1TZGH 4PJ5B 2D31B 4R2GB 4WUUD 3ELAT 1IC7L 2AEIT 4NFBA 4RAVA 2C4FT 1MCPH 4NJAL 5DQDH 3MRGB 3HZYA 3ZT6A 1WBYA 4JO1L 4P99A 1UM4H 3V0VA 2QTEA 1JYWA 3GRWH 3DTXB 3NFSL 4MDIA 4NHCL 3R06A 5I1IH 3RI5F 3O2VL 2NR6C 3HZMA 3MXWH 3WL9B 1VFAB 4P2RA 5GRJL 2ITDB 4XP4H 1WCQA 2VABB 2YZ1A 4Y19A 1K4DA 4RMWA 1ZXQA 1H15B 1LO3L 2QQKH 4EI5D 2NNAA 4C56B 3BPOC 3E2HB 1L0XA 1RZGA 3WNPA 5EU3A 3S98A 5DRNA 5GGVH 1UCBL 5EWIH 1FNSH 3V6OC 1PG7H 5KSUA 2QSQA 1NC2D 1EZVX 1HQRB 5GSVB 4JKPH 4HWEL 1H8OA 3H9SA 1CFQA 2X70B 2JB5L 3EYOA 5E6ID 5F9JB 2HRPL 5T3ZL 2X4OB 4LCWA 2MOVA 2F53A 3U6RB 1EA9C 4RQQA 4X6DF 3UO1H 3SJVE 3DGGA 3L5HA 1YEKL 4OD3H 3QHFL 1V3JA 3RY5A 5FUZL 3DVNB 3IXAB 1V3KA 1ZHKA 4M1CD 3GNMH 4Y2DD 2VQTA 5T3ZE 5FA3A 5EOCJ 1U3HD 5E5UB 3IVKB 4TPRH 4LCYB 4XCEB 5LJYH 3VDBA 1A2YB 4NZJA 5E7FA 4F8TA 2BNRD 4RGNB 3RRQA 5EZIL 4NKIL 2NW3B 3I6GA 4ONHB 5SWSA 1K5NA 1X5YA 5ESAA 3UYRL 1FZOB 3OAYK 5D9SB 4W4OA 4V1DB 2ICEA 3GMLA 1AC6A 5C6PB 4ZFGH 2X4UA 1MCHA 2VL4A 1Z9OA 3MOQA 3BRDA 1VADA 1DEEB 3RVXD 2C3XA 3MV7B 12E8H 4EDWH 1FC2D 3HAEH 1URLA 1VACA 3QXUA 1A6WL 2EECA 3HAEB 1Q8MA 3IDXL 3U46B 1EERB 1UWGH 1UH3A 4OCMC 1OAQL 2F54E 3TCLB 4KHXH 4U1MA 1X7QA 1SVCP 5D2NC 5EU6B 3FFCA 2FD6L 4U1NA 1NMAH 3JV4B 5HY9B 1I7RB 1G7PB 1U92A 5DQ9A 4NFCA 5EZJB 3PDDA 4BSVB 3LEVH 2YK1H 3VW3L 1ZVHA 4CVXB 3S5LA 1CR9L 1QKZL 3L3JA 3L3KB 4XGZA 3ZYIA 1AR2A 1HSBA 3FJTA 3WLWC 3CK0L 1VA9A 3I75A 4LLQA 3QP3A 5E2UL 5HD8D 3WXWH 1MFAH 4LOUD 4FTVE 2IAMA 1BOYA 2VDPL 4MD0B 3OBAA 5B8CB 5GGRY 3AMKA 5ICXA 4TUKH 4QGTA 1YMHA 4U3XA 3PWPE 1AI1H 4WW1A 4JFFE 2Y5TA 1YNKL 1ZA6B 4TQEH 4BQ6A 1TPXB 3LDBB 3JV6A 1CVSC 4APQC 5E2VH 3I3DA 4F3FB 3QEUB 4LQFL 3KAAA 5HHVH 1P7QA 4QHNB 4WHTA 2FHFA 2W65A 4J4PD 4PY8J 1DL7H 3TIEB 5DFTA 5HYSA 4ZFOA 1XCTA 3OHXA 2XRAH 3P11L 2VLJD 1T22B 4DFIA 1WIUA 1FV1B 4LDLB 1ITCA 3KYNB 1YPZB 4P0DA 1VERA 1BECA 4OCRL 5BV7L 1J0KA 2B4CL 3VXPA 1DDHA 5IMLA 4DZ8B 3BJ91 4XZUA 1YMMB 4O2CB 1E27A 4KY1H 4FQ2H 4NWUL 4L3EB 5DR5L 5I1EH 3W11C 3EUUA 3WS3A 5CCKH 3EW3B 3W39B 3LV3B 4GW5B 1DANT 4X6CB 4HLJA 2FEEL 5DHVB 2Z31C 3GMMA 4QWWC 4HBCL 4LHUB 5AG9A 3CZJA 4P59H 1MJ8H 1XT5A 5FO9A 1TCRB 3D85A 4L3CA 1CFNB 4N9OB 4OUUB 3MJGX 4LVHB 1N6VA 1MUJA 2EO9A 4YPJA 1MOEA 1RZIA 3ARZA 3DPBA 1I3GL 1S7VA 4D94A 5HYIA 1WISA 2F19H 5DO2C 5I0DA 2HVJB 2ATKA 3PP3K 3B2VH 2XTLA 4LCIL 4HC1L 4BZ1L 4UT9H 1LDSA 2I5YH 4P2RE 2DLHA 5D71H 3KPLA 3VGEA 3BP5A 3LPGA 4NKDB 4MVBC 4OFYA 5AUMA 2FECI 2AXFA 1NCTA 5IHBA 4LGSB 3GSQB 4PGDA 4KROC 4YDVA 1K85A 2OI9B 3V6FB 5DA0B 3P73B 5IVXE 3ULUC 1T1YB 5FYJH 2ADIA 4HBQA 3TN0A 1IGJB 4IRZL 1XIWB 1KT2B 2YEZA 5IFJA 5D7JB 1FVCB 1HHKA 4DJMA 3SOBH 4KI1A 3GUTA 2JB6B 3QFJE 1WBZA 3H9SE 1OP9A 1DQJA 4H5SB 2YD6A 4XWOC 3CVHA 1BBDH 3L3OB 3CSGA 4HMCA 3VI3F 1FL5B 1IGYA 3RY6A 4KK5C 1U8OB 1GSMA 5IQ9A 3U1SL 4LCWE 2Y06L 4IRSD 2Q86A 3Q1SL 4L8DA 2F53E 3DARA 1X5FA 3KPSD 5SX4I 4BUHA 4JRYB 4OFIA 3VRLF 5IHZB 3NZHL 1S3KL 1A4KB 4XPTL 3T3PE 3WFBL 4NGHH 4K3EH 1ZGLM 2YA2A 1JP5A 5BCAA 3ROLA 4OM1L 5A16A 2N7BA 4WI8A 4YDIL 4ZAKC 5E5MB 5I1HH 1PBYA 4PYHA 5DJZA 1KLUB 3SGEI 1AGDB 5C9JB 5MP6L 1S7SB 5D2LB 5DGQA 1NANI 3RWIB 2QHRH 5FM5O 3QDJA 1U8JA 5D93B 1I8KB 2R9HC 1BVZA 3DX8A 4ALAL 4KKNA 5KW9H 1SVZA 1JGVL 3ES6B 3EHBD 1EXUA 4JDTH 3P9MB 3ILPB 2D7TH 3O4LA 1KJ2L 1CFSB 5SWSE 3TESA 5CUSH 3G6DH 1KYOK 5E1AB 2VYRE 3V0AC 3AU1A 5K9JL 1RK0B 4QNPF 5ALCL 5BS0A 4J2XA 4AG4L 4JDZA 2R2BA 2YPVH 4LMQI 2ORBH 5FB8B 3DROA 4POYA 5E8NB 1W0VA 4YXHL 3A6OA 2VISA 4HCRH 2V5RA 1UJ3A 3QUKA 4NIKB 5E2WH 1BWWA 3LN4B 3BQUA 4CMMA 4N0RA 3CZFA 1NFDF 2X9XA 1JWMA 2D7MA 2DMCA 1KC5H 1WUNT 1EO5A 1FFPA 4D3CH 4BSWA 1INEL 4DOHB 5ADPH 3T0EB 4YBQC 5D70L 3BSZL 3QIBA 3VA2C 2Z93B 1ZS8A 4XCCH 1A6ZB 1QHPA 5IW6B 1LILA 2A6KB 1WEJH 2EDQA 4XC1H 4MJIB 3QH3A 2MMXA 1YN7A 3VXOB 4NQEA 4G6KL 2VL5A 2KUTA 4N0YH 4HUVA 4HUUB 1G7IB 2OZ4A 3SQBA 5IKCB 3ZDYF 1EHAA 3QEHB 2AJXH 4RRPG 2HP4A 5C9KA 3C60A 4CBPA 3PP4L 2LE9A 4F7MB 5L88L 2C7UB 3KPMA 1CGSH 4GBXD 3NBNA 2W1NA 4F57L 4NKMA 3VWJC 1PSKH 3ARBC 1DBBL 4RDQF 5DS8B 5ADOL 5B21A 5DLML 4G7VH 5FHAH 1AD9A 4V2BA 2IAND 4ODHL 5HGAB 2Q7YA 4N8VG 4MQXC 3WIHH 1JI2A 4MSWA 2G75B 3WO3B 1BF8A 2VDKH 3V4UL 3PABA 1AXSA 4PJAB 3H3BC 5CWSA 2OR9H 1OAYH 4GH7B 1WWAX 4ZG1A 1ND0A 1I4FA 4ZMAT 3CLEL 4C55A 5J1AB 5F1NA 1T21B 2Y7QB 3VI4E 1F6FB 3G04B 3PF2A 4GQ9H 4O4YL 3NABH 4MXWL 4XTRC 4P5TC 3K2MC 3MJ7B 4TTDC 5EUOA 1U91B 4R26L 2NY0C 1KTDB 2XI9A 2I9LA 3QDGB 4QOKB 2J6EH 4MXQC 4HWUA 2XQBH 4ZO6A 1S8DA 4ZQKB 1PG7X 5A2IH 4NM8L 5ETUB 1OY3B 3VXMD 1IFHL 1OAXH 5DD3H 3DGCR 5JDSA 5BW7A 4N8PA 3DMMC 4K7PX 1FO0B 3QUMA 4P23B 2Y5EA 4P9HC 5DJXA 3VFSB 4DQOL 4WIQA 4FXLA 1TIUA 4DUVA 3KYKL 5I8OH 4POZD 1BOGA 2MKLC 3BE1H 4PRHA 5KTEH 1JTTA 4NKQB 5TDNB 3V0WH 2L0DA 2VRAA 2F74A 2CD0A 1GGIH 4I3RL 4M48H 4Y0GA 2XWBA 4OM0L 4LF3A 1QQDA 3MV01 2PR4L 4U1IB 1IGML 3GGWB 3GHEH 2CUMA 2R4SH 2VMFA 1T5XB 3NFNB 1F8TH 3RDTC 2BVOA 2IWGA 4Y5YA 4P3DB 5F7FA 5HDLA 4EIZC 5J89A 5DJ0A 5C0BE 4AEEA 3MOAL 1MLCA 3CDGA 3TYFB 3D69B 4H8WC 2X05A 2AJZA 1VGEL 1TZGL 4Q7DA 1FBIH 1TZIA 4R4BA 2A74B 5D6CA 2GTWB 3K2UH 3MLPA 2XN9D 1S7TA 4L9LA 1MCPL 5IR1A 4OZGB 5DQDL 3VFTA 3DVGB 1U95A 4ZSOE 1UM4L 1AKJA 3CMOH 5JPNB 1Z3GH 3GRWL 1VSCA 2AK4A 3O3AA 5I1IL 4EUPA 2DJSA 1FG9C 3MXWL 4M5YH 4CRPA 3GMRB 1P7KB 3BDYH 3ARYA 4NQUA 4XP4L 4HIHB 2VDRH 2ZNWA 4DW2H 5DRWB 3QEQE 3E2HC 1VPOH 4GKSB 3IETA 3D2UA 2QQKL 4PJ8A 4RA0C 1P6AB 4MHHG 1YY9D 4Y8DC 3TH2T 2JCCF 4KQ4H 1XGPA 1JGEB 2FJHB 4BFIB 4GKZA 2FWOB 2GJ6A 4CVWA 5C0EB 5GGVL 1FNGA 2ED8A 4D8PB 5EWIL 3SBWC 4ZS6D 3VXRB 2YWZA 1FNSL 3O11B 3T09A 4JFPB 4L8SA 1PG7L 2E7MA 2E6JA 1MF2H 2ZUQC 4JKPL 4JPKH 4JZJC 3ZYJA 3TVMB 1D5ZB 3HI5H 4L8BB 3LN5A 5DMGC 1EFXA 3O6LH 1ZHNA 3WNOA 3L9RA 1GC1C 3X12A 4PJBA 3WBDA 2PETA 3O4LE 3L7EB 1D6EA 3F7YB 3NAAH 5DYOB 1Y0LA 3JWNC 4P5MA 3STLA 2J2ZA 4HIIB 2P7TA 4HW6A 1GAFH 1HHHA 3UO1L 2Q8AH 3C5SA 4U6XB 1JMXA 4F37K 4OD3L 3IYLW 2LVEA 1M7IB 1IRAY 4P2RD 5E24E 2FIKA 4Y19D 4XHQA 1NDGA 5T3XD 3UAJD 3GNML 2LU4A 4HZAA 4DZBB 2DM7A 3M1BB 5DVNA 2QJDA 1GXEA 4WEMB 4WO4A 1TZHA 4R4FH 3OR7A 4F9PC 5C2BH 2CPCA 3AS1A 4TPRL 1OGAA 3I02A 4UNUA 1C16A 2JKXA 3CXDH 3PIQB 2Z92A 1CICC 4RNRA 1A1NA 5DJ6A 3PV6A 5C0CB 2LTQB 1V7NH 4J3XA 2GTZA 1NGPH 2HG5B 4HH9A 5DC0A 1KJMA 5EU4B 3LKOB 4WFGE 4ZFGL 2NCMA 2B7DT 5F9AC 4RGNE 2DBLH 1EAPA 2ZNXA 4GRLA 2RBLA 4XMKH 2F53D 4M5ZL 3ARSA 5FGBA 3T2QA 5ICYB 3AY4C 12E8L 4PJGF 1U8KA 3IF1B 4EDWL 3G5VB 4WNQA 3UTTB 1L6XA 4CW1B 1ZSDB 4HX1B 2VLLA 4D2NA 3RVWC 1UWGL 4L4VB 5DEGA 4KHXL 1JZ5A 4U6HA 2CK0H 1NMAL 3MCKA 4HCRA 2UYLB 4RFEB 5T1KB 3LEVL 1JL8A 2YK1L 2IPUK 4C83B 3KHQA 1BJMA 4PV8B 5C3LD 1L6ZA 3GBNH 4QCIB 1KEMH 4JG1H 5E03A 5D7LE 1KENH 4NSKA 3TO4A 3WXWL 1MFAL 5DJ2B 5FOBB 4UAOC 5CINH 5FECB 4CJ0A 1TJIH 5FGCE 4TUKL 2P47B 4G43A 3CFKA 3LDBC 5EUOE 2OQJA 1AI1L 2DQCH 4IS6A 1QFWI 4TQEL 3VFWA 4HLZG 3FCTA 5I1GH 4PRAA 1YZZA 5CEYB 5C0AE 2VUYA 5L9DH 1F3JB 3NA9H 4JCMA 5E2VL 2NY1D 5FUCE 5HHVL 1V3LA 4OZ4B 3HB3C 3PWNA 1MCLA 5EZOH 1DL7L 2D2OA 2XRAL 1J1XH 1RPQA 4M61A 2YS4A 2GSGA 5DMKB 3FFCD 1IAMA 1G0XA 4N0UA 2AW2A 4PRHE 4S11A 4HIJB 5C8JB 3P4LA 7FABH 4K55A 3W9EB 3PJSA 5I1AA 2XACC 4H25A 4HGMA 4KJWD 4KY1L 2HVKB 1S7QB 4FQ2L 4CADA 4RBPH 5I1EL 5HGHA 3M17B 5CCKL 3ARGD 4PJCF 1BM3H 4RFNB 5F1IA 1P9MC 1UACH 5I0ZA 1P2CB 5FKAB 5HYJE 2RR3A 4B50A 4BJLA 4IRJA 3LY6A 4P59L 2IAMD 1A6AA 1MJ8L 2Y36H 2BCKB 1YMME 1IVLA 3SY0A 5JZ7C 4Q0XH 3TBWB 2HJKB 5F96H 1XH3B 5B38B 1EO7A 3QUYB 1XEDA 5JOFA 1Y6KR 5HJ3B 4Z7UB 3T0XA 2F19L 4X6CE 1VFUA 1QR1B 1E4KC 1P7QD 2AQ3A 4ODVH 4S1RH 3B2VL 3PE9A 5BJTA 4MAYA 1Z5LB 3KLAB 4UT9L 2I5YL 1RUQH 2OTWA 3NVQA 5D71L 1D9KA 3I6LE 4RZCA 3C9NB 5AD0B 4UDUB 5E95B 1N8ZB 1RSFA 2UV3A 1EEYA 3GMOB 3OKEB 4DKAA 3S35H 2L7JA 1QA9B 1D3CA 4J3WA 3V8OA 5T1MA 4KK9D 2BNQB 2PW1A 3GMPA 3IFNH 1XIWC 1KIQB 2GJ6E 5D7JC 1WBXB 4XWGH 5FYJL 3IAPA 5CSBA 1HILA 5JA9A 1UWEH 4R7NB 5CILH 4MD5B 1U0QA 1NGZA 4ZUUB 4ENEC 5DK0B 1RZJH 4LSQH 3SOBL 4BYHA 4WW2B 3HS0A 4WY7H 1AY1H 5T1LB 3IDYB 1ADQH 4FFYH 1EAJA 1BBDL 2UY7A 3D85D 3IKCB 2D7OA 2GAZA 4GXUN 4MD4B 2CSPA 5FYJE 4JVPA 3CFEA 3BEVA 1L7TH 5KS9A 2UWEA 4LSTH 3SDDB 3EO9H 2VLRB 2CXGA 1N0XH 2ZOKB 3KG5A 3JUZA 3PHQB 1QBBA 2PYFA 4H26B 1FL6B 4P3CH 4HKZB 4HK3J 5C2UB 3RL1A 4NGHL 4K3EL 1P6FA 2R1WB 3NCJH 4LPXA 3PWVA 4P2QE 4G8GE 3BP4B 1Q1JH 4D9LH 3FT4A 4U1KA 4OFYD 2D0FA 1O5DT 3P77A 4EEEA 3VFOA 5I1HL 3U79A 2QQNH 3PQYA 3BI9X 1A64A 5D93C 1ZA3B 4ZUVA 3IDNA 1W0YT 4KTEH 3V5HA 2OCFD 4N90E 2QHRL 2BOCB 1PZ5A 1FNEA 1OGAE 3TN0D 2E9IA 5KW9L 2FZ3A 4NBXB 3BFOA 4HWZA 4JDTL 4JFDB 5TFSH 3FO2A 3PGCA 2D7TL 1Q72H 1I1FA 1R6VA 1MHCB 5FO8A 3KS0H 5CUSL 4Y4FA 5GRYA 3G6DL 1ED3B 1Q0YH 4WDIA 4PJDA 4I18A 4D0BA 2G5BB 2YPVL 1TITA 2ORBL 4PLJD 4BM7A 1CBVH 5DGRA 5DJCA 4K23H 1PFCA 3HPJB 4HCRL 5E2WL 4HZLA 2D03H 2NXZB 4YNYB 3ZHDA 4AIXA 4G6AC 1OP5K 1ZANH 1KC5L 3T0EC 1XCQA 4M3JA 2X4SA 3MGAA 4JO3H 4LNVA 3BN9D 1FYTE 1J9CT 4D3CL 4DKDC 2EKSB 4NUGH 5ADPL 5IOPB 4YFDB 4Z7VB 3QA3B 4IIQB 4XCCL 2YHGA 3K4AA 3BAEH 1WEJL 1G6VK 1NAMA 4XC1L 1N59A 4AEIH 1BHGA 1ZMYA 2BJMH 3QDJD 1RUPH 3S96B 3UEZA 4JFHD 2X4TA 4NO0A 4RGOH 5IB3B 2Z8RA 4N0YL 3O4LD 3SDXB 4DOHE 1OL0A 2XIDA 4O2EA 2AJXL 2XY1A 1JF5A 4K94H 5JXED 1C8PA 1EX0A 1GZQB 5BS0D 4XCNA 4PD4J 3HUJA 3QQNA 1CGSL 3DETC 4JHAH 4PLOB 4GG6A 1LK2B 1SEBB 1PSKL 5HHNB 4NC1C 4ISVA 4G7VL 5FHAL 5JHDA 4XP6H 3AREB 3BQUD 5EOTB 1UEMA 4TUOA 3WIHL 3KPRA 1D5BA 3WLBA 4XBGA 4JLRB 5JW4Q 3HE7B 1RZ8B 2GT9B 1J0ZA 1CXFA 2V7NA 4NQCE 2VDKL 1IGTA 4TULH 4D9RE 1CG9A 2XTJD 3JTSA 3C6LB 2OR9L 1N0LA 1OAYL 3QIBD 4N0UE 1FZMA 2E7BA 5ENWB 5HYFA 3MBEB 5D2NA 4HT1H 5IVXF 2W0LA 4GQ9L 2NY5H 3NABL 4WFGD 4XP5L 4JZNB 4NQED 5C08E 2P24A 4XMLH 5C3TA 1WZ1H 1EUUA 1MHHB 4PGBB 3T08A 3V4PH 5INDA 5F6HI 2J6EL 1RD6A 1T3FB 5F1KC 1YECH 2XQBL 3U36A 1KIRA 2CXKA 4WI7A 1T1XB 3QZWG 5ICZA 3C60D 4XCYA 4MWFA 1I7TA 1ZWIA 3NIGE 1OAXL 5DD3L 4YE4H 3UROR 4WU5A 5HI3D 4OZHB 1TLKA 3PL6A 2QV2A 2WUBH 5IK3B 5MEQB 4S2SA 1AR1D 1UG9A 2XKUA 1JGDB 1K8DA 5F3BA 5I8OL 4QOKE 3BE1L 5KTEL 2EDWA 4D0CA 2ATPB 3GJFH 5EU5A 3TFKC 3V0WL 3GJFB 3T3PF 4APQA 1K2DA 1GGIL 1T7ZA 4M48L 1HK6A 3MUGB 1MAMH 4KH2A 2OR8A 3GHEL 3L3DB 2R4SL 1OP3H 1VDGA 1BD2A 1QFPA 1F8TL 5ITFB 3IJYB 2X10A 1IZKA 2OS7A 5LWYH 3MRJA 4UNTA 1FBIL 4OAWA 2BHYA 3K2UL 1DUZA 3MRQA 1FSKC 4N1CA 3QQ9C 3MJ8A 5I74B 1NBYB 5ECJE 3ZDZF 1A6PA 1FIEA 5F7KC 3MV9A 2WIMA 3CMOL 1Z3GL 4CU8A 3QG7H 1CDUA 4NRZB 1IKFH 4UBDC 2Z31A 3JBG7 5HDBE 4M5YL 3LKPB 2MPAH 3KPQA 3BDYL 1W0WB 2VDRL 4H20H 4DW2L 2Y6SC 1H0DA 1CL7H 1VPOL 2NY2B 4OFPA 2R56H 4NRYA 4X0KB 5I1DA 1FVDB 2Z91A 3EOBB 3MFFB 3NCYS 4KQ4L 2YN3A 2IPKA 4E5XA 1BBJB 2YPKB 1BQHG 5CZXD 1FFRA 5I1LB 2R69H 5HI5C 1EJOH 1B9ZA 4GOSA 3TPUB 5IP4A 3P4OB 1DUYA 1NMBH 4R3SA 2DJ4A 3V5DB 2PUQT 2W9LA 5J56B 2FBJH 3TVMC 4X7EC 1JF1A 1MF2L 5C0JB 2HA1A 4JPKL 2YR3A 2R29H 3QR2A 4PJFB 3HI5L 1YA5A 2AQ1A 1PYWB 2W60A 3O6LL 5FDWB 3N1MC 2XNAA 1OTSD 1SJHA 3VXRE 3SKOB 3NAAL 5CZKA 1ZLSH 3Q6FA 1AKJD 3L5IA 5JMRA 3O81A 1GAFL 2AK4D 4JFEB 4QGYA 2SEBB 2Q8AL 5C7XH 1M6OA 4GW4B 2ZG2A 1E6JH 3EBAA 1ADQA 1DN0B 3NCBB 3QRFM 2X2YA 2ADGB 1CT8B 3BHBB 3D5OF 3D2UD 2ARWA 4IOIB 2I60H 4PJ8D 4K8RC 5GGSY 5IV2B 3RX5A 3FMGH 4J8RB 2XZAH 4DUWA 4R4FL 5I1JH 2GJ6D 4RDQG 5C2BL 1CTNA 1J05A 1RIVH 4NNYA 1MH5A 1XGQA 2NX5A 1IGIH 4EVNB 2H2PD 3TF7C 4PTUA 4FZEH 3CXDL 3EDJA 3CDYA 3UYOD 2LTQC 4XRCA 5F9WB 4RISH 4H1LB 3U7WH 3LD8B 2DOCA 3VI4F 3TJEH 1F4XH 1PX3A 1V7NL 1ZVSB 1WTGT 3SKMB 4ZAKA 3KYMA 5CSZA 1EFXD 2DYPD 1NGPL 4NDMA 4UMGA 4EBQH 4Y5XB 5KSAB 1R0AH 1G0DA 4ZOAA 3KYOA 3D18A 3VWKB 3MUZ1 5L8LB 5JORA 2DBLL 1ZGLP 4XMKL 3MRCB 4PBXA 2X1PA 1QO3A 4IHOB 4HUXA 2BERA 4KRPD 4BKLA 3O3EA 4HS6A 2A1WH 3U4EA 4Z78B 4JB9H 2UVEA 3BH9A 4BFGA 4S1QH 4EXPX 1Q9KA 3U0PA 1J10A 4X7TB 1IM3A 3B8SA 3EOAA 1FAIH 4FQHA 2CK0L 4R9HA 2EIBA 1JTOA 3F58H 3LKRA 4K9EH 1QSEB 2R4RH 4WO4D 1C12B 1GOFA 4Y1AB 3MLT