1P6UA

Nmr structure of the bef3-activated structure of the response regulator chey2-mg2+ from sinorhizobium meliloti
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
129
structure length
129
Chain Sequence
MSLAEKIKVLIVDDQVTSRLLLGDALQQLGFKQITAAGDGEQGMKIMAQNPHHLVISDFNMPKMDGLGLLQAVRANPATKKAAFIILTAQGDRALVQKAAALGANNVLAKPFTIEKMKAAIEAVFGALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structures of the Inactive and BeF(3)-activated Response Regulator CheY2
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Signaling protein
molecule keywords CheY2
total genus 30
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1p6uA00
2E4XA 3HCWA 1Z15A 5KI6A 3JPWA 3GA5A 4DN6A 1BVHA 1CYEA 3LUHA 2GKGA 3O1IC 3ROFA 3VNAA 4NQRA 3DBIA 3RVSA 3DLBA 2PE5A 5CNMA 4MQEB 1M5UA 4LE2A 3LUJA 4FE4A 1A0OA 1UDRA 3ILHA 4YV7A 2H0AA 2JK1A 2VK2A 2LIVA 2A9RA 4FE7A 4XAQA 4KPYA 2QW1A 1AB5A 4N03A 4W5OA 4ZJPA 1EFAA 3NNNA 2V0NA 4W5QA 2E4YA 4G0QA 1JFTA 4QPJC 3F6CA 1LBIA 4RV5A 3K9CA 4P1ZA 3OO1A 2FLKA 4KRFA 3D02A 5GQSA 3JVIA 2MSKA 5BRAA 2B4AA 2HSGA 8ABPA 4F3TA 5TQJA 3KLNA 3DLHA 2FSPA 2J48A 1JF8A 2QXYA 3HZHA 4H60A 4IMJB 1E6LA 1RZRD 4RSMA 3TD9A 1E2BA 5IC5A 5C5EA 2FTKE 1RXIA 3QLVA 4OG2A 3QEMA 1QKKA 5EWMA 3S99A 1P2FA 4LX8A 2OQRA 1Z17A 3OQMA 3EJWA 1E6MA 3H6HA 2LPMA 4H3HB 3KLOA 3T95A 2GBPA 3QX8A 1DP4A 3RVKA 3T8YA 1U8TA 2WMYA 1EHCA 4DQDA 2IPNA 2VUHB 1OXBB 4ZYLA 1MIHA 3LFTA 3RH0A 1JHZA 2E4VA 4OLAA 1W25A 2PUGA 2FN9A 1CEYA 1JYFA 4EUKA 2KYRA 1VKRA 3CU5A 2FMIA 3B2NA 4WXMA 2IPLA 4MLCA 4MQFB 4QYMA 4EY3A 2LP4Y 3JPYA 2JCGA 4ZPJA 1URPA 5IUJC 3EODA 4LZLA 2PUDA 5B3JA 3H5VA 2A9QA 1XHFA 3OLXA 4PICA 5JNUA 1GUDA 2I6FA 1DCFA 2L18A 5E3JA 4KVFA 2BGGA 3GT7A 4HNSA 3O1HB 5HM6A 5BQ3A 3UUGA 3D8UA 4RXMA 2CHEA 4ZMSA 5FWXB 3EGCA 2MSWA 1K66A 1NXOA 3EDCA 3KHTA 1NXSA 3R0JA 5KC8A 5JNVA 1USIA 3GRCA 4ETMA 1S8NA 3CLKA 5CNJA 5BR1A 6ABPA 3OQNA 1PHRA 4WXEA 5CNKA 5TPZA 4M88A 3CS3A 3IPAA 4XLTA 4EYKA 5JNRA 3E3MA 3N0WA 2R25B 2MYUA 3F73A 2JBAA 3SG0A 3C97A 1DBPA 4IMIB 3N53A 5EWJA 4F12A 3SQNA 3C3KA 1GCAA 4JASB 4FB4A 2GI4A 4DADA 1H9CA 3CTPA 1YVUA 4MR7B 3GYBA 1D1PA 3MA0A 3F6PA 5TPWA 4RK5A 4Q6BA 1ZVVA 2CWDA 3N6VA 1FSPA 3JS5A 3M6MD 4MYRA 5D2CA 4D6YA 3H1GA 4YGXB 4MR9A 3KTOA 3RVQA 3URMA 1LJUA 3JTEA 3Q9SA 1MVOA 2ID9A 2FMKA 5C5CA 3LKVA 4YLEA 1QP7A 2QSJA 4NCAA 4KK4A 2R4QA 3W9SA 3GV0A 5TQ0B 3LMKA 5TE9A 3TO5A 4E7PA 2E4WA 4RXTA 4S05A 1FFSA 5HQJA 3H5WA 5DGCA 1P6QA 3UK0A 4Z4GA 2QR3A 1NXWA 3OO0A 3HVRA 3NHMA 5T7BA 4YWHA 3IP6A 3MIZA 3N8IA 4MS1A 1P6UA 4F11A 1USKA 5FBHA 2R48A 1RXEA 2PUAA 4W5NA 5TQ2A 3QLUA 1YIOA 1RPJA 1DC7A 3FGZA 5HSGA 2AYZA 3OMWA 4LDZA 1APBA 3H6GA 2FEPA 4JP1A 4GNRA 5EWLB 3SY8A 4JOQA 4Q7EA 4O5AA 2WJAA 3NHZA 5TPZD 1ZDMA 3HM9A 3LUCA 1JLKA 3RVRA 1NXTA 1NXXA 4PE5B 3CRNA 2NT4A 4RDCA 4LDAA 1QP4A 3FFTA 4RZSA 2A9PA 4OBBA 1T34A 1QO0D 4PEVA 4Z4CA 1B00A 1PNRA 3SAJA 3M9XA 4EYGA 4RKRA 4KQCA 5GOTA 2HPHA 1YMVA 2NUBA 3RVOA 2NT3A 4HNQA 4LE0A 4MS4A 3IDOA 2H3HA 2Q5CA 1CHNA 3CZCA 2YHBA 4PYRA 9ABPA 1DZ3A 3G1WA 1W9HA 3LUGA 1ZGGA 1Z12A 4E7OA 2QVGA 2QV0A 1D1QA 1EWVA 2O20A 4YP9A 1WETA 3RQIA 1P8AA 3I5AA 1ZH4A 4MRMB 1ABFA 1M5TA 5FWYB 1KGSA 1ZGZA 1AB6A 1ZESA 2OENG 1NATA 2GX6A 4IRXA 1JDNA 5T3YA 2FVYA 2JB9A 5KWSA 5IBQA 3VNBA 3EQZA 4UHJA 5F64A 4RWEA 4MS3A 4JA2A 1Z18A 4N0PA 3H5LA 3MYYA 4N47A 2FMHA 4KK3A 3KG2A 3MM4A 1HEYA 3KS9A 3QLUC 4P98A 4MR8B 4IGAA 2LUOA 2RJOA 1SRRA 3LKBA 3OLVA 3OLWA 1DCMA 3FMVA 1FFWA 4G0ZA 4YO7A 4XXHA 4YCSA 3LUFA 5HKOA 1A2OA 3Q7RA 2JVIA 4G97A 3DZDA 1J56A 1YS6A 5CNIA 3ROTA 3K4HA 3Q41A 1DRKA 3BILA 3EQ2A 2X7XA 3NBMA 3CG4A 4W5TA 2ID7A 1GUBA 2P4UA 3HS3A 4Q6WA 1D4ZA 1E6KA 1MAVA 1D2AA 3OM0A 4O1HA 5JS2A 1PUXA 5JNTA 2FQXA 1F51E 3HXMA 1Z2EA 1TM2A 1DBQA 1L5ZA 4PZ0A 4QICA 4Z4EA 4EVRA 3M9WA 3OQOA 1PEAA 1JFVA 5IUKC 1VRVA 3MQ4A 1DCKA 4W5RA 4EGSA 3C6QA 3O21A 2IPAB 1QQBA 4NCBA 1DBWA 1Z26A 3TB6A 1YK1A 1DJMA 3O2JA 1ZITA 3QELA 3T38A 2F8TA 1TVMA 2RDMA 3QEMB 5EWMB 3N0RA 4XASA 1YS7A 2FEWB 4WWHA 1BDJA 3KYIB 4LE1A 2N9UA 2L17A 3GBPA 2CHFA 4RS3A 4Z4HA 4MGEA 3HJFA 1VPWA 4EYQA 4QYWA 1JFSA 2PUCA 1F4VA 1EWTA 1M2FA 2LBPA 4WUTA 4MQEA 1JH9A 3CZ5A 3QEKA 3L49A 2F8SA 2P9HA 1R8JA 2HJ9A 1SXHA 2FQYA 4Z4IA 3H75A 2QVCA 5JNSA 2L19A 4TMYA 5CHYA 4OTZA 3OLZA 4MQFA 1RZRA 4KMRA 4RK4A 2WB4A 2FEKA 3DGEC 3A0UA 3BRSA 2XDYA 4YR7A 5JS1A 1LBHA 3JY6A 3H1EA 5BRJA 2PAFA 4F8JA 3A10A 3HO1A 3LTEA 3OLYA 5IX8A 1JX6A 2FQWA 3L6UA 2QZJA 3I09A 3QLTA 4YRZA 1ZHHA 1VLZA 4RKQA 3CFYA 3H1FA 2ZWMA 2B1JA 3RVLA 4KNYA 5FWXA 3HDVA 2JVJA 2DRIA 1ISRA 4TLLB 2WJWA 2M98A 4OLBA 2PL1A 4N76A 2W42A 4Z9BA 3IPCA 2PLNA 4KQ9A 3IP5A 4TLMB 4JB0A 3O2SB 4Z0NA 2JBAB 5KQGA 3EULA 2HQBA 4F06A 2PUEA 3KSMA 4Z99A 5EWJB 4GPAA 1L5YA 3RVMA 3FFXA 3O2QB 3QLVC 4MR7A 4ETNA 4H3KB 3TX6A 4ZMRA 5I4CA 5DKFA 1QO0A 2QU7A 4G0OA 4MLDA 5TPWB 3O1JC 4UHKA 4NICA 3HDGA 2VYCA 3CG0A 3IP9A 4HNRA 4N0QA 3GL9A 1QMPA 3MMNA 1DRJA 4MPTA 1YMUA 1Z25A 1NXPA 2MYTA 2FMFA 2IPMA 3BRQA 5DTEA 1BDIA 4KV7A 2RGYA 1XHEA 1KMIY 2YHAA 4JAVC 5DLEA 1MB0A 4EVQA 4RK1A 5TQ0A 4RK7A 2NZVG 3LUDA 2PUFA 5KC9A 1GLGA 4IILA 1ZY2A 1M2EA 1PEYA 3I42A 2PJUA 3A3KA 3Q7SA 2MSLA 4WZZA 3HUUA 2NZUG 1QNLA 4RY0A 4TN5A 1BDHA 7ABPA 5PNTA 4G0YA 4MS1B 2VUIB 1KRWA 2PUBA 4O1IA 4G86A 3O74A 4YS6A 3HV2A 3C3WA 1SXIA 2WY2D 4Z4FA 4G0PA 1Z13A 4RY8A 4IF4A 5KQMA 2FXIA 4Y9TA 4L4UA 3HK2A 3H5TA 2FLWA 4RXUA 2FW0A 2PL9A 3KJXA 6CHYA 1ABEA 3Q7TA 2CD7A 1BAPA 3CNBA 4ML3A 2L2QA 2IOYA 4MR9B 5FBKA 5DCLA 3F7NA 5ABPA 3OM1A 2RJNA 5IULC 1QP0A 2MYPA 3HUTA 2FKAA 1U04A 3LOPA 1EWKA 1YK0A 1QQAA 1SD5A 2HQOA 1Z16A 4MS4B 3E61A 3ILYA 4RK0A 1ZN2A 3KYJB 1XWWA 4JB2A 4KFCA 4RU1A 5IEBA 4KZKA 4OATA 1PNTA 1ZH2A 3GWGA 4HYEA 4KREA 1RNLA 3TMYA 1YTUA 4G0XA 1TMYA 1LK0A 1C4WA 4D6XA 1K68A 3HSYA 2GWRA 3UKJA 1BA2A 2WRZA 5TQ2B 3N75A 1D5WA 1JYEA 1JL3A 4ETIA 1EAYA 4RK6A 1OXKB 3CHYA 1GCGA 5EWLA 2MYNA 4Z9AA 4EYOA 2PMCA 4MAAA 3H5IA 1KRXA 2WWVD 1ISSA 1U2PA 5IUNC 4RY9A 1NXVA 3MF4A 1MB3A 3QX9A 1USGA 2IYNA 3LUAA 1ZAYA 3SNKA 1DG9A 3LUKA 4EVSA 5KQLA 3P9YA 1QPZA 1IIBA 3IP7A 2A9OA 4N41A 4S04A 4CBVA 2IDMA 1TJYA 5ED4A 2R47A 2JRLA 2E4ZA 3FDFA 4XFKA 2ZAYA 3Q15C 2IKSA 3C3MA 5B3JC 5JNWA 2TMYA 1DC8A 3BREA 2M1ZA 3A0RB 3DGFC 4L85A 3RVJA 3SM9A 1FQWA 3KKEA 1SXGA 3FFWA 3I45A 1Z2DA 3H5OA 3NNSA 4NV3A 3KCNA 4MRMA 1TLFA 1U2QA 3N0XA 5FWYA 1I3CA 1C0EA 3OMXA 1Y1LA 3RVPA 3JVDA 5KQPA 3BBLA 3CKMA 4LRQA 4G0MA 2E4UA 4B09A 1U0SY 2JVKA 4MS3B 3RVNA 3NNDA 1FFGA 4XARA 2AYXA 2HQRA 3QELB 3QK7A 1LJLA 3G85A 2PKXA 1NY5A 1NTRA 3GBVA 1JBEA 4WT7A 3EAFA 2FN8A 3HEBA 1JDPA 3O75A 1JWLA 5IEJA 1A04A 4MR8A 3T6KA 4D74A
chains in the Genus database with same CATH superfamily
4B4VA 1PSWA 1DQYA 3IPXA 4QBIA 1FFYA 1P91A 3JPWA 3VZRA 2MMGA 2VL7A 3EMKA 1J8FA 3LCVB 1IB0A 4P4TA 3UHJA 4GBJA 5K6AA 1PG0A 2ORWA 2P0EA 3IQGX 4Y2PA 4CTOA 1MRSA 4LVOA 5KBYA 4EB6B 2E5LB 4YV7A 1EQUA 1AZSC 1OLXB 2IU4A 3EVNA 3P2JA 4NBKA 5H9VA 1M75A 4FE7A 4QUGA 2Y1EA 5KNCH 2VT6A 3LO8A 4JC8A 1P18A 4CQNA 1FTQA 1XTPA 2CNKA 2CK3A 3FNBA 4MUIA 3NKLA 3RG2A 4MH0R 3SX2A 3GEDA 1HDEA 1JPVA 9LDTA 5DWDA 4S0XA 5FT9A 2YVKA 3WV5A 1HLPA 1V5EA 2I9PA 3DR3A 3I8SA 5DM1A 1TCAA 3ZJ5A 4Z2YA 1N9KA 2CC2A 4BWFB 1JHVA 2XUKA 1FNCA 4F3TA 4QFMA 4KWCA 4BGEA 2HJRA 5JI2E 1L1EA 4DQVA 5C5EA 2FTKE 4DIUA 2VWQA 1F1JA 1NIPA 2A9JA 3EDMA 1VYVA 3EXIB 1XV5A 1Z17A 3CRMA 2ZI5A 1WLSA 2ZRPA 4NHEA 3T95A 1JPUA 1DC5A 2JFQA 1D0SA 2IEIA 1GUAA 3F3SA 4JWKA 1AXGA 5IW8A 3JD2A 3ZY4A 2QYHA 4ASUD 4TV9B 3ABIA 2B0CA 3CEAA 3VVBA 4CT5A 2X6RA 3QI2A 3SZRA 3F9IA 1MIHA 2YJTD 1XJWA 2B8EA 3L7CA 4BZXA 2X9NA 1A1SA 3BAZA 3M1IA 2XGOA 4ND2A 2NYRA 3IV9A 1SUFA 3R3YA 4QXQA 5C1IA 1Y6ZA 3AP1A 3FSGD 1AE1A 2VUSA 3NOVA 3ZLBA 5B1EA 3A6HA 2EIXA 2Q3FA 4NG5A 5COAA 3ROXA 3QLEA 4AI6A 4FTWA 1CUYA 1X7HA 3ECAA 1T0PA 5JD6A 1HT2E 3EY9A 1TEZA 4QQNA 3CPJB 5BN1A 1RQNA 3KVYA 5B3JA 3EVFA 5J2TB 4XVUA 2Y77A 1D6NA 4PYLA 1VIDA 1DOHA 4W8OA 4DDUA 3AETA 4TOIA 1P81A 3G88A 4RFVA 1VL2A 1Y9JA 4Q21A 1LBQA 2F8LA 2RB5A 4EB8A 1VE9A 2HMAA 5ALQA 2EJWA 3NI2A 4TM8A 4JSRA 3JYLA 5FUBA 5BQ3A 5AM4A 2Y0CA 3SE7A 1OAOA 4K9QA 1O0CA 3CPHA 3KT8A 1MGPA 1I4LD 1RWOA 3JQAD 3MJVA 4FPXA 4M7OA 3OEED 2DH6A 1QCDA 1V5IA 4ZMBA 3AJEA 3IQIX 1TCUA 3D0RA 3TNJA 3W6NA 5A5GA 1ZP6A 1II8A 1D2RA 2V9CA 2Y1WA 3ADKA 1H9AA 3CMCO 3DA8A 3RNOA 1UL1X 3TXXA 4URVR 4ZCIA 5DOZA 5C1PA 2YV5A 4MGKR 4NCIA 3BE6A 4JEHA 3H3JA 4X90A 4Z86A 2C07A 1C3OB 2H7XA 2IHYA 2XUAA 3M3DA 3RRYA 3M34A 1H9CA 1ZIDA 1U6IA 1MENA 2E1PA 4KYUA 1FQJA 4JENA 1Y37A 4MUJA 4MDEA 4LNAA 5DK4A 4PGFA 4CDGA 1VE1A 3RC3A 2GF9A 1R8QA 3CYFA 3EMVA 3JARA 4G5XA 3GZNB 1JN0A 2Z83A 3KPVA 4EA8A 3RS8A 5L51A 1JQLB 1ZVVA 1BS9A 3M6MD 1AGPA 1J0EA 5BQ5A 1EHIA 3BWVA 4U00A 4PFSA 1Z75A 1MC8A 1MOPA 4ZK6A 3SVTA 4JQOA 1GQRA 2EJVA 1SHUX 3PK0A 5K3FA 1BHJA 3HVHA 5KNBA 1YDEA 3PIIA 2PWAA 1HOTA 4KFUA 4MV9A 4C7KA 1IBCA 1ZIXA 1QGYA 2R4QA 4P3KA 4R5MA 3UW3A 3DHEA 4OM7A 5TQ0B 1I32A 3LCJA 3LMKA 3EF3A 5A3JA 1D2CA 3DKVA 5EJ7A 1J8MF 4IWYA 1NN5A 2ODPA 4K1LA 3HU3A 4M38A 1YCDA 1ZOLA 1XRRA 1O95C 4C06A 4PV7A 1SOVA 3W04A 1AF4A 3K5PA 4DF3A 4HYYA 3F47A 3HYTA 3NO4A 4RWZA 4YJGB 2B8WA 3VYVA 1K08A 1UBMS 2D1TA 3UB2A 4ZVKA 4G84A 1N77A 2DY1A 4DJTA 1WMSA 3IOEA 3PNKA 4IVPA 3RSZA 3P9KA 4XGQA 5FWDA 4FT2A 1U0RA 4GU5A 1R6AA 1RAEA 4KB5A 4B33A 4DZTA 2EP5A 2BUCA 1Z4LA 4XRRA 5CFNA 5C8YB 3JQQA 4N5MA 4XUEA 2QVLA 2HQ1A 3A9RA 4GWKA 4DLPA 3PHIA 4J7XA 1NG1A 4G2NA 1Y3BE 5TPZD 1BOFA 2GHTA 3M4XA 4HQ0A 5K0ZA 2SECE 1GAWA 2X13A 3FPBA 3V8EA 3AOGA 4L5IA 1D2MA 3HCPA 2OTCA 4J07A 3V48A 3GUUA 2B0JA 5CEFA 1ZUWA 2AJCA 2J4FA 4B0OA 1A7JA 1M0SA 1M8GA 1H4SA 2YNMC 1QO0D 3LT5A 5DHPA 1CUIA 3UBTA 4K9NA 3VTKA 4F4DA 2NO0A 5E4FA 2JH3A 1L4NA 1RC0A 2NT3A 2WOOA 4R2MA 2AHRA 5G40A 4TYYA 3DEYX 3UK6A 2H2DA 3DJYA 4AD8A 4Q9NA 1ZGGA 3AP3A 3IA7A 3VC7A 2NP6A 3FZEA 2JJ1D 2Q07A 1WETA 4YAFA 1Y34E 4TTPA 5IVIA 4Z3DA 4FFRA 3UUEA 1YSCA 3I9OA 1E2DA 2BFEB 1ABFA 2WG2A 4CLRA 3AKDA 1VXRA 1AB6A 1HEUA 1JBQA 4I2VA 4BZPA 1QPBA 4JXXA 1MHPA 3EOBI 2AR0A 2NTEA 4XGIA 1EJBA 2O1EA 3LECA 3A32A 5IBQA 4LDRA 3TQFA 4C04A 3PNBA 3GLFE 3DBRB 4XWWA 1FP1D 3DZFA 1XTTA 3BXXA 4EA7A 1N6LA 4O4JF 5KYWA 3A4VA 3CLHA 3W7BA 2XWSA 1RYDA 3KG2A 2XBUA 2Y1KA 3QLUC 4GR5A 4I9HA 4AO6A 4EKDA 3JZFA 1MVLA 3E18A 4F1WA 1OYVA 4YTEA 3OLWA 1KF0A 4LYJA 2I2WA 2GAOA 3NHSA 3INNA 4IGFA 1UBKS 3LUFA 4Q34A 4RPLA 5I7HA 1N9GA 1A2OA 4TV9F 4URXR 1HWYA 1W5EA 2Q1YA 2PBRA 2UZ1A 3B38A 3HM2A 3HU2A 1IL0A 3LKZA 1XR3A 2IRWA 4IRMA 4Y2YA 1WZIA 3C7KA 4TSRA 3BILA 3MJCA 1C3JA 2H4XA 2HDWA 2IGTA 3BE5A 2VQSA 3ET4A 2Q5OA 4LRUA 2C7RA 4C01A 3HS3A 1W8DA 3VR4A 2UXCB 2BMDA 3KAKA 4N8SA 1A50B 3MFYA 4A0RA 3BICA 4EFNA 5B7GA 1FQKA 1PJ3A 3N2ZB 1RCUA 3MQFA 3Q3VA 1PDWA 2C5LA 2BHTA 1Z29A 2P6UA 5CH3A 2IV2X 4C22A 4HX2A 3W3ZB 1DV1A 2DBVO 4E13A 5BW8A 2P6RA 3SI7A 3CVJA 2YCBA 1PEAA 4U9IS 5ECWA 3WA7A 4CYMA 1HZJA 3TXAA 1KGDA 2PH7A 1KZ7B 2AUNA 1XYGA 2FW8A 4UHBA 3VU9A 3FZQA 4HJXA 4EF4A 2RHRA 4HPJB 3U40A 1Q44A 1Y80A 4JX8A 5HE8A 5JARA 1XTRA 5KEIA 3HV0A 4ZAVA 4C21A 1DFIA 1RVDA 5F2EA 2VCEA 3DNPA 1M2KA 3K31A 4J0JA 3X1JA 4D97A 2PZEA 5IVPA 1SU6A 2CHFA 5JJBA 5JXWA 1BE1A 1D9XA 3HA2A 1C1YA 5K0NA 5JZBA 2WIGA 4OIMA 2Y27A 3GAFA 3IPYA 3WBBA 3HJFA 3ESZA 2Q9UA 3OHMA 4AB1A 3ZV6A 3UQYS 3T3IA 1UBEA 3E1SA 2FPSA 5FHQA 2QD1A 1LD3A 3OPYI 4MQEA 4RTOA 3TR5A 4S35A 4DIFA 1E7RA 4JT8A 4CM5A 4X92A 3TPFA 2BKEA 3U9LA 3LL7A 2ZRBA 3VKWA 1H2ZA 1T0BA 3DTTA 4J03A 1P60A 2QTVA 2W00A 4HZIA 4MQFA 3ANTA 4FW8A 1YRWA 5KNDH 4GL4A 3VKGA 2IU6A 4M21A 3HXOA 3GARA 1N3IA 4REMA 3RJTA 4PG4A 1NMEA 3FZGA 1IQRA 1KR5A 3AR2A 4J0GA 5ES3A 4M8IA 5JQGF 5LVAA 3FUCA 2Q3EA 1E8NA 2ZR7A 3QPUA 3H1TA 5LQSA 2F1RA 3JTMA 3QFSA 3PQEA 1RZUA 2PBFA 2PMFA 4RA6B 3HLYA 1KWKA 3EFBA 4PG7A 1RWWA 3TEJA 4CQMA 4EKNB 3NPAA 5M34A 2QZPA 5DNEA 2BMVA 2K7ZA 3KRTA 1Z45A 4TLLB 4NOLA 5DBOA 5E1MA 2OGUA 4RZIA 2HUPA 4H1TA 5D3QA 4IDAA 1Y1KE 3ZBTA 2QBYA 4MV0A 1X9HA 4BC0A 5AUNB 3HWX1 3IPCA 4FYYA 2W11A 2OCAA 1EDEA 4TLMB 4QYSA 3UN1A 1SZJG 1R0WA 1IOVA 1BKDR 4UUMA 2PUEA 4YAIA 3M5DA 4PC6A 1L5YA 5KYNA 1A9QA 4CR8A 4PBSA 1KU6A 3T15A 1Y3CE 1XZQA 3A8TA 3N2NA 1TEHA 4V1CA 4G0OA 3UV6A 2QP4A 1UC5B 3CTMA 5ECGC 3NYRA 4HC4A 1JEDA 1FYXA 4HQRA 3NP7A 3AETB 3LCCA 2AEEA 2EFDB 4N0QA 4XWAA 3UAXA 2B5VA 5C8ZA 2XKKA 4DM4A 2PGNA 4BZWA 2PLFA 5JDCA 3KB6A 1CIJA 1JB1A 2BV3A 2O2IA 3TG2A 2EKBA 5CT8A 1JAHA 4KR9A 1MNQA 4RK1A 3W6UA 3ZWMA 2W37A 3K20A 2ET6A 1IM5A 4XFDA 2V5AA 2VF7A 3ESYA 6NULA 3UGJA 2MIIA 3L1KA 4IUBS 5KC9A 4EY7A 1UK7A 1ZY2A 3JALB 1M9NA 3HYSA 5TVKA 2IZ6A 2WMDA 2FP4B 1UZNA 1TYBE 3ORQA 2A4KA 4NFYA 1EX9A 3KQSA 1EFCA 2P0YA 1HT3A 2WAMA 5M5BA 3O4HA 3WQQA 1CJVC 4IRUB 4OSPA 3GRAA 6GPBA 1U1CA 1R8SA 2P8SA 3IO3A 4G0YA 4MVJA 1X80A 1QO7A 3H0KA 3K0HA 1N4AA 2OD7A 1RYMA 4X1IA 4KSYA 4MINA 4NU0A 5DHSA 1XLTA 3IEUA 2ZYTX 4L27A 3RV3A 1KBZA 1XF1A 2BONA 3WJAA 3C3CA 4LCBA 1HQCA 4XDHA 3C3WA 2FPIA 1EFDN 4IDOA 3VPCA 5KWIA 3UEOA 3NV7A 4AN0A 5E6SA 3RWBA 4PC1A 4ER5A 3F5DA 1MJGA 3QUSA 5A3QA 1FYWA 4FC6A 4UQPA 4XWYA 4HG2A 4ZQGA 7AT1A 4JI8B 3HB1A 1QLWA 1GR1A 2JFYA 1RAFA 3OM1A 1VG0B 2COKA 5FI1B 1Z33A 5GPBA 3DLCA 3OECA 5J1SB 3TDMA 4BNDA 1YK0A 2B5OA 2B5WA 3EXHA 2EQAA 2DOKA 3CSDA 4I8DA 1G5IA 4L15A 4EZIA 4FYXA 5K0FA 1FRVA 2G3YA 1J5XA 2MMCA 4FFBB 1L9XA 2HK9A 3DE4X 4S1TA 5DX8A 3U9SA 2I55A 5EZ6B 1YF3A 4A6XA 1DCTA 1N5MA 4GC9A 5F9FA 5FTLA 1EFPA 2ZRMA 5D6NA 3OG9A 3EPRA 3QVKA 1L7XA 2GCNA 1HYQA 3VYSB 3PGLA 4WOKA 3VKUA 2DLDA 4D6XA 2UZ4A 3ZU6A 4QG7A 4OLJA 2DTEA 1QC5B 2O0LA 3H11B 3AEZA 3AHIA 4PZPA 2RBGA 1JL3A 2Y4OA 1RYZA 2ZW9A 4AIIA 3QENA 2VUTA 4Z4QA 5FNVF 3FCUB 2EDCA 1IUKA 4MROA 1X7WB 3MPOA 3WIOA 2ODQA 2PT7A 3RF6A 4AECA 4MICA 4UBMA 3HBJA 3MWKA 2QXTA 1G3MA 1EH5A 4DV3B 5FORA 1YOVB 1BJKA 1KYYA 1P7PA 2F1KA 2OHGA 2ZKIA 4JUDX 4XDYA 5BR8B 3BGVA 4YREA 5KQLA 2XY4A 1GZ4A 3IJPA 5KQPA 1J5PA 2E1RA 3H3XA 4AJKA 2O2XA 4CBVA 2ZRKA 2I0FA 3FTQA 1K7CA 4TS1A 1WL8A 2ECKA 2WSSD 1SC3A 2PKYX 5ED4A 4TMWA 3X1KA 1SOAA 3W4KA 4DIEA 3HUFA 4DPLA 3MGBA 4X9XA 3JQCA 1W36B 4RV9A 4A15A 1NVEA 1PI3A 3UMGA 4ECEA 5D3KA 2NU9A 5CR9A 1ZZEA 1ZH6A 5HRAA 3AF0A 3I0MA 4KVZA 5TF4A 4P36A 3JQBC 3LYAA 3UHPA 4D5GA 4F8YA 2K2QB 1QH0A 1KEUA 3I8OA 1SCIA 4N3AA 3N2LA 3VI3B 5DEOA 3ZE2B 4RVCA 5I4KA 4QPCA 1NMYA 2GSWA 2ZXUA 3MLAA 4XPZA 5JSKA 4B3XA 3BMCA 4C7XA 5A2GA 3PXEA 1BVRA 3ZCUA 4Z0PA 3L40A 2Z3WA 5FUVA 2F1OA 1Q21A 3ECCA 2K87A 1DRWA 3OX4A 1BWQA 4WFQA 1VB5A 4JDUA 3ZWAA 4E03A 2HRCA 1UBUS 2C4KA 1HE8B 1SURA 2E49A 5K3EA 4HXEB 3BAFA 1Z2CA 2PUVA 1BGVA 3P9RA 5F7ZA 2Y4NA 5BSGA 3W1VA 2ZRDA 5HXAA 3OX3A 2W2NA 2VLBA 4RYDA 5L3QB 4UMFA 1L7PA 2D0PB 3EEOA 4MVYA 2A14A 1IEVA 3E9MA 3LUJA 2B20A 1GG5A 2JAUA 3EVEA 3OU6A 5H80A 5DYNA 3SBOA 4DC1A 4N39A 4TT3A 3C5CA 5A3RA 1RQLA 2A9RA 2ATXA 2ZXFA 3H65A 3OZTA 4MWGA 3ZJUA 3CX7A 4X8MA 4H4CA 3T4PA 5CVCA 3C6KA 2AXQA 4J16A 3EPKA 3F6CA 1HE1C 2AEJA 4HNUA 3ZDRA 1MX1A 1AUQA 2QL7A 2RGNA 4NPHA 5EUCA 1T1IA 4OXRA 2ZSAA 5FKJA 5CX1A 1NI4B 4OI1A 3ZCPA 3RIXA 5F35A 2CZQA 2J48A 4H60A 2W8ZA 1J7KA 2Z6VA 1YHNA 3AOEC 3HA5A 2C2ZA 1DE0A 2VG8A 3AY3A 3SX4A 3W5UA 3W6OA 2JJMA 1RXIA 1B6GA 3PGA1 3Q5DA 4UASA 3PFHA 4Y2VA 2HPZA 3TEFA 2XUIA 2D1FA 2XCLA 1VJGA 1S1MA 3KDPA 3SS7X 2XF8A 2ECPA 2WMYA 4LFCB 4EUHA 2O2JA 4IX9A 4EABA 3ZHTA 1CC1S 1B0PA 1SBCA 1ZONA 3O5AA 3QYJA 1XXHE 5ARCA 4D57A 2E4VA 2GVZC 2OBYA 4M89A 4OLAA 1HNNA 1GKUB 3DTVD 5AKGA 4LIPD 4CHTA 4EUEA 1A4XA 3IV7A 1PU2A 4N4AA 2ZE7A 3F5SA 1PD0A 4DFDA 3UJ8A 3UMJA 3BSFA 3BCRA 4ERXA 4B5LA 4MYHA 1EM6A 1M6NA 1RJ9B 2P5SA 2GR9A 4ZOLA 3O93A 5IDXA 1Z6YA 1BGWA 1SULA 1XHFA 1IRIA 2KS6A 3HKBA 3C3JA 3ORSA 4OL0A 3TOCA 4JHLA 4LZAA 4YECA 1F3OA 1UJ4A 1NFRA 5HS6A 2HD4A 4IBOA 4B3RB 3MINB 5A3VA 4BKPA 1NDHA 5FWXB 1S0UA 4K87A 1ZUHA 2C59A 4MUXA 4WNIA 5EPOA 4KPEC 3W2FA 4LSZA 3HLTA 4HB2A 1PHRA 3GT0A 2E89A 3IE2A 4MXDA 4WXEA 1R2QA 2ZBUA 4DLXA 5K4GA 1FP4B 2QBYB 3ED5A 3GQBB 3PR3A 3GC6A 3K0FA 5IHXA 3JSAA 2LRHA 2O8DA 4Q9KA 1E9SA 3SHOA 3S1LA 1P5JA 3CLTD 5DJ5A 5F73A 1XRNA 3CWQA 2BGUA 4M99A 5D86A 3SNHA 3AG6A 3MZ0A 4D3FA 2ZVPX 2IHZA 1VPTA 5EWJA 2YKGA 1K88A 2N47A 1JQ3A 1I1OA 4XGNA 4XUGB 1CZHA 4EATA 4P33A 3CH4B 2QORA 2XECA 4B3FX 1UPTA 5KJ1A 3E8XA 2JPDA 8MHTA 4D3DA 3BIOA 1OW3B 2FWJA 1U9ZA 1QNFA 3GLSA 3LC7O 1BXGB 1P44A 3KYDA 4FUTA 1OPXA 3FBWA 3JS5A 4Y6PA 2Y1DA 3LL4A 2OHOA 1X1QA 2CDAA 4K6OA 1A2QA 4C7BA 4Q1DA 2RG1A 2BP7B 1P39A 2OBMA 1G2PA 2JAQA 3B2EA 3BBPA 3UUWA 2ZIFA 4KBYA 4PC3A 5DNVA 2DKNA 3OE4A 4X1KA 3C1AA 3VSAA 4AJ4A 4CL8A 4BQEA 1LJUA 3RAEC 4QU9A 4GRAA 4WKNA 4CEHA 2Y0BA 4L74A 4A6EA 3VPXA 1NN1A 1TKCA 4BNTA 1RW4A 4K3UA 4DG9A 1P1KA 3GV0A 4BBJA 4FDLA 5IT0A 4OKNA 2V6JA 3ZE6A 1B41A 1XC7A 4TYMA 4S05A 2DLNA 1V2GA 3WJ1A 5HQJA 1ZJZA 3BJEA 1JLMA 1XDBA 5AQEA 4QM7A 3AM1A 4AQDA 3DF9A 3DAYA 1X87A 2NNLD 4Z4GA 1Y6FA 4IWXA 2GSDA 2CE7A 3FSGA 3OE5A 5KWVA 4CZ2A 4KACA 1BQ3A 2AOWA 3EWNA 2B8TA 1KAEA 2EGUA 2V65A 1M66A 4OHKA 5D51S 5EKUA 2O6HA 1TZ2A 2QAGB 2F43A 4FUQA 3ZDYB 5L4LA 3EHDA 1K27A 5TS3A 1T9AA 4EK9A 3UJHA 4D8UA 1NYLA 3LVBA 5EERA 3M6XA 4R2LA 3WJ2A 4BE9A 2WHPB 1KSGA 4CKBB 5DIFA 5C8XA 3SY8A 4MHTA 1QVWA 3GLFA 2WJAA 1PIWA 4GM0A 1Q3KA 1JLKA 4M9CA 3RVRA 3IR6A 5BQFA 1WVGA 4PE5B 3ZXIA 1XZ8A 4RDCA 4ONEA 3WKAA 1K3FA 1HMYA 5I7UA 5DGXA 3QW2A 4YJHB 1E59A 4G5RA 3OC6A 2DHCA 5GJBA 3D8TA 2UYHA 1FDSA 3SSNA 4UFNA 1B00A 1DLJA 3AKYA 4CNQA 1EDBA 2A5GA 1GQQA 4CGYA 1IXRC 3K94A 2HIAA 1TGYA 4JJ6A 2HWWA 1M2JA 2CNNA 3PFKA 4GUAA 3HHEA 3STHA 2O8EB 2OZKA 3U4MA 2A92A 4D7AA 4MQLA 5MGBA 1CB0A 2QRHA 3UATA 1U28C 1WUJS 2B3TA 2NXJA 1C9NA 3L7IA 2F4NA 3KHKA 4KQMA 1U98A 4IIXA 1NW6A 3T54A 3TQTA 3ZZMA 5B4TA 3LQKA 1PQ4A 3DL0A 3MD9A 3SLRA 1P1FA 1VL0A 2HZBA 2WM3A 4ZI7A 2O14A 1XZKA 1TFRA 4JX9A 1M5TA 1UMDA 1ZGZA 1W85A 4BZZA 1GQYA 1A9TA 1J9GA 1UANA 3G9ZA 4EPWA 4WCFC 2AG6A 1P0IA 3A3OA 4IOJA 1REQB 3E4DA 5THXA 3U3OA 1Q1QA 4WN9B 3FNGA 3VDMA 1I5RA 4ZT2A 3ZYZA 2G9QA 3LBFA 4B4WA 4D44A 5K6RA 3UWSA 2H9IA 4ROTA 1Q91A 6REQB 1RFGE 3E35A 4YNBA 2G5PA 4GEGA 4EKIA 5TB5A 1W34A 5K0JA 1R9MA 3L0IB 4JVNA 2LUOA 2RJOA 1CJKC 5T4HA 4K05A 3DL7A 3OLVA 5HF5A 3HB0A 3WL8A 4HH1A 2O8CB 3MXTA 3STTA 4FYKA 4DXDA 2Z2JA 2J09A 3QG1A 3SR4A 2WVJA 3JQGA 4YCSA 4RKYA 1QAQA 2NTVA 3DZDA 4YO8A 3PUVA 2BZGA 1KY4A 1KMQA 4FSXA 1L4LA 1CV2A 4ZO4A 3NYIA 2HB6A 3OU7A 2D8MA 3G13A 1Z0AA 1I33A 4Y0NA 4R4JA 1S2MA 1C7IA 1MB4A 1M10A 2REQA 3IL2A 3DFMA 4YMLA 1EG2A 1QRUA 1D2AA 3TL3A 3IRVA 4O1HA 5MFZA 1PUXA 1KAQA 1EFHA 2NV0A 5TMDA 3WGJA 2I1QA 5AW9A 3W1WA 1F1BA 4Z4EA 4E5UA 4YXWA 2HK7A 3B20A 2JFPA 2OXCA 5AVZA 4CM4A 1LDNA 3G0DA 1PZHA 3JWHA 2PKWA 4JITA 1LRLA 2IPAB 5ICCA 2GPBA 2VWGA 4KCGA 3R7AA 2JKVA 1J33A 2VIIA 1K1EA 2RDMA 1D2NA 2W90A 4YP5A 3K35A 4YRTA 4DS3A 7REQA 3A6LA 3TGLA 4DUPA 1Z8DA 2WD9A 2WJGA 5K03A 3Q3CA 1G5RA 3RFTA 4H59A 3TLGA 1J07A 1TZCA 3FDXA 2FE4A 5DN9A 4NCKA 1IK4A 3ZH2A 4HZUA 1P3Y1 1XCOA 2J6IA 2GYWA 3P9QA 4G8DA 5KS2A 4K2HA 4OB7A 5AM1A 2HADA 3LSYA 1M6YA 1EK6A 2ZIXB 4JUCA 2NO1A 3I23A 2PMDA 1XNGA 1Z6TA 4R8LA 5EMLA 1KY3A 3EQ8A 4H3VA 2HT1A 1T6ZA 4WECA 5KWEA 2IBSA 2OCDA 1J1IA 4OGGA 5JJKA 2CE2X 2HJ9A 3VBEA 4QULA 4PY2A 2WQ6A 1PW7A 2H2HA 2ZB7A 4DXHA 3AV3A 3OLZA 2C96A 1N33B 1AM4D 1QGDA 1UEIA 4KMRA 4ZHSA 2GS9A 4QL3A 1R6TA 5JS1A 4AC9A 4AMYA 3MT9A 4ER0A 2XQGA 1OYWA 1THTA 2CUZA 1VCOA 2BFBB 2OP0A 2RGBA 3Q2IA 5HF8A 3RHFA 5DM60 2Z1NA 3NWPA 3LTEA 4RSRA 3S2SA 4R01A 1Y0BA 4LBYA 4ZI5A 4HX9A 4KR3A 1D04A 3C8UA 4GXQA 4YXWD 1O57A 2VTEA 3I09A 2QT9A 3SJZA 1L1FA 4MV1A 2J3LA 1GEGA 3B52X 3FNHA 5CH5A 3AERB 3UV7A 1C7ZA 1J4AA 1Y42X 3KKQA 3R23A 3MEQA 4IGIA 4W1QA 4OU5A 1JHQA 4XM0A 1Q17A 4OKIA 2IGBA 1AMNA 3WFIA 5JRDS 2ZTMA 4CF6A 4KDRA 1RWXA 3DAPA 2QB5A 3LHKA 3NHWA 3Q9LA 5D6OA 5C8YF 1GSIA 2GEBA 1Z35A 1RPNA 4TMTA 1AT1A 4UTOA 2QTTA 3RRXA 1PGQA 3DYIA 3E0XA 3HHPA 4B3BA 2PBZA 1P72A 3GB9A 1K63A 3H04A 4PQYA 3L84A 2HQBA 1FFCA 3FMOB 5C5DA 1ZEMA 4GDMA 1JR2A 3I76A 3GH1A 4M8NE 1LX7A 1WXHA 2GAAA 3DUFA 4XEHA 1JR4A 4TSKA 3UPUA 5HIJA 3BD7A 4CFSA 3WK9A 3H4MA 2R79A 1U3VA 1VECA 4Z1MD 1QRDA 4AJHA 3GZNA 4D3ZA 2Z6QA 5FBQB 3HBFA 3RUPA 3K05A 4JOBA 3VDXA 4D9CA 3NGLA 3ULKA 4DV6B 1FCJA 4AZ3A 2XE7A 3S2ZA 4DQ0A 1IN7A 1JE1A 3LFHA 1PQYA 4P7KA 4JJ4A 4R41A 4D42A 3Q1LA 4U6SA 2DGDA 1EM8A 1KETA 5KYXA 1P2SA 4DV0B 3GEHA 8LDHA 2Q6IA 1CQIA 5LN1A 5GZ1A 4B47A 4O4IB 1ML3A 1DC3A 2O8FB 1XCBA 2RKBA 3A3KA 2JA1A 4MNTA 4CIXA 4WZZA 3FOCA 3PHJA 3D3KA 3G2KA 3T12A 5EJ4A 3EPJA 4BJ6A 3I92A 4AZTA 5LMUB 1I4TD 3AWIA 3OIYA 2WFLA 3H87A 3AZOA 3TI9A 2CXNA 1EUQA 3S28A 2WWIA 1RQPA 2VUIB 4G5GA 3E5HA 2FWIA 4KQ6A 2A9FA 2AW3A 2PGIA 5A03A 2X8JB 5DTQA 2YWDA 4IDDA 4LN1A 4BGUA 3LPDA 1FNNA 3MK31 1XNJA 4NENA 3GFGA 4LXHA 5EYPB 3S8MA 4RY8A 4B48A 2C4UA 1FXWA 2R1TA 2JLAA 3P0HA 4AY4A 2VPQA 4A8JC 4B4UA 4RGBA 3COVA 3FGOA 2GVDC 2VNIA 4XM1A 5AVJA 4AQ7A 2I7CA 2P7IA 2Y2VA 2P7HA 5G0SA 3V4RA 1KPIA 5DCWA 5ABPA 2IVZA 1NLFA 3KALA 3PDWA 4GPTA 3L4BA 4BGVA 2HA6A 3DBVO 4OQPA 1MJHA 3L6BA 2J3JA 5EP2A 4FFNA 2AJBA 5A6SB 4ALJA 4NIMA 4EB0A 4FJ1A 1KVUA 1FTSA 3DP9A 4JSTA 4QJ3A 1IQ0A 1Q0RA 1JJ7A 5K7SA 4DKXA 1J8YF 3RUEA 5AVTA 4ZANA 2JGDA 3GFTA 4F5YA 1KS9A 1GGHA 5LQNA 3N8GA 1QB7A 1RRGA 1WB5A 1XRMA 2A5YB 3ZQUA 3ZD6A 4GUDA 1Z7GA 4E12A 3PC8A 2CVQA 1LK0A 2C04A 4ENPA 4CFYA 4LFBB 1GT6A 4JT9A 2GWRA 4WNYA 2HJVA 4BC1A 4DWOA 1K5DA 1K6IA 2XTAA 2N0SA 1WB4A 4J76A 3W5CA 2AXPA 1K4KA 1R5JA 1T8RA 3EC7A 3J7AC 1OXKB 5LPNA 2XVYA 4ZCQA 1UP6A 5EJ2A 5IN5A 1LH0A 2PMCA 3DNMA 3H5IA 1G1MA 3EBPA 3SYNA 1DC6A 4YQEA 3SC3A 1MB3A 4MW5A 5IS2A 5ENVA 2WTAA 1WMEA 5AW7A 1Q1NA 1VTKA 1W94A 2ID4A 2Y71A 2YFQA 4QPPA 1YB6A 4XQEA 2JI4A 3EWSA 4DCMA 3SC2B 4JBXA 3QWBA 4RTJA 1TTHA 1E4OA 2NSDA 3SFVA 2IDMA 4QEDA 2JI7A 4IINA 4ZOEA 4CV0A 4G5HA 1G4HA 2JRCA 2VSNA 1GZVA 4LGVA 5K51A 1Q0LA 1UQUA 3FDFA 4EGFA 4XFKA 1SMKA 1Z0ZA 3HP1A 3SEQA 9GPBA 1D5CA 4Y7DA 4TLBA 1K0UA 2MR6A 3E2IA 2MSDB 3ICWA 4WK0B 1YB2A 3DGFC 4GLBA 1LQUA 5A5EA 2WIFA 2X4IA 4JOCA 4CQLA 2ZZNA 1OV6A 3LQYA 4AG5A 1WULS 1MOSA 4I2NA 1JAXA 1L4BA 2WZCA 2FEAA 3OJWA 2AOUB 4IOLA 3IUMA 4UUPA 3RYTC 1YVPA 2F1JA 3HMQA 2HHAA 3OMXA 4YRPA 1L4UA 1ILWA 5A5VA 3D1VA 1UEJA 1KDYA 3VHRA 3R40A 3GNQA 3LPAA 3GG9A 4XQGA 4GM4A 3VU9B 4RUKA 4BBZA 1V1MB 1IJEA 3DDWA 4FMDF 4YRBA 4YONB 4EUSA 5BV1A 5LR6A 3RVNA 1CFZA 3NNDA 1FIUA 3GZ4A 2BRUA 3QELB 4OBWA 1G20B 2Z2YA 2Z2IA 1CP3A 1F2UB 3IHTA 4U5XA 2C4TA 1A4IA 1PF7E 3D6MA 3EAFA 1W7AA 1U7OA 1JWLA 3K16A 1LPMA 3LF2A 5FPPA 4MEAA 5BSUA 4JOSA 1DQPA 4UARA 4CT4B 4Z3OA 3G02A 1P61B 4GX5A 1PBNA 1ZNWA 3V1YA 4E5KA 5JECA 3BXEA 3USCS 3FCXA 3PEUA 2XXAA 1HRKA 3RVSA 3FVQA 4ES6A 2WYOA 1XZNA 4JQYA 4GBGA 4LE2A 3IUYA 4B7AA 4F6CA 3COZA 2X0JA 2VZ8A 2VNSA 2YQZA 3GPIA 3ND6A 2OOKA 3C85A 1X86B 3OD5A 4GGPA 3DQQA 4GECA 4V03A 4ER6A 4RJTA 5K99A 3ZU2A 5J4YA 2NW6A 4Y6SA 2IHNA 1ZRHA 4RF3A 3VKFA 2P9ZA 4M1MA 2QTVB 3QU2A 3IQXA 3ZGVA 3VR6A 1A5BB 2E4YA 2WINI 4DB2A 2EAUA 4NF2A 5INTA 3L6RA 2JCXA 5HF6A 2JGLA 5A7GA 1QHNA 3C7TA 1A8PA 3FUXA 4KLRA 4DIMA 1OFTA 2I7XA 2ZSUA 1JLLB 1P74A 3IJ5A 5EPUA 121PA 1QU3A 3L7NA 1NPDA 4RFLA 3FNRA 3GCZA 2MWMA 3OX2A 1EFKA 4KGXA 1F9EA 3TSOA 4E1AA 1QKKA 3S99A 1X8LA 1U8AA 2J0SA 1X14A 2PUWA 4LGCA 5KOJB 5E8RA 4IIGA 3TZKA 4JD5A 4AZ0B 4DM3A 3QFCA 3ZXUB 1XT6A 5JAUA 2X5XA 3K4QA 5E95A 4XX0B 2QRPA 3O94A 4KQJA 3U0VA 3CSSA 4O4HF 2P9EA 3CKLA 2OCYC 3G0GA 3H9EO 3QKIA 4QQFA 2QE7A 4S1WA 2CXPA 1ZC4A 3DP7A 3ZE1B 3WGNA 1CVLA 3V7NA 4R68A 4N6GA 2ONYA 3I1FA 5ENDA 4XCQA 3CJQA 4YUAA 1LPOA 2IYWA 3P2YA 5HTKA 4JI6B 2BEUB 2E6UX 3NORA 2F9FA 1VSBA 4XSHA 3D8NA 1IZ7A 1Z06A 2RAUA 2VZLA 2VJPA 3H05A 1Y3HA 3ANMA 4QRIA 4BLSA 4Z7JA 3C3DA 3N3BC 5BMVB 3ZK7A 1G8YA 3DL2A 4ZD6A 4FLMA 4HNSA 4K6KA 1TT5B 4L9AA 2ZSFA 4DDVA 4RD1A 5JH7F 4QDZA 3QOWA 2BGKA 1V16B 2XQKA 1YDFA 4KX5A 5AI0A 1NXOA 1BHO1 1JLSA 4CCAA 1TTTA 3BL8A 3PXCX 5JALA 1QH8A 3S2IA 3LV8A 2C57A 2H1CA 4BX8A 2GBLA 3K53A 1T6BY 1M8KA 1BN6A 1ULBA 3HRKA 2ZDQA 3F97A 1K97A 3E7XA 3N9IA 3ND8A 4HDRA 1E61A 4IO0A 4WOPA 1QIDA 4ZEOA 2HGSA 3LC1O 1E64A 1QHFA 1ZH8A 2MYUA 3DBHA 3ZEAA 1Y8RB 5JAMA 1XKTA 3IA2A 4II7A 4WK2B 1L7EA 4MP8A 2PYDA 3GNSA 1E1MA 5FR1A 2VKTA 1UMBA 2Q7OE 2HR1A 1Q7CA 3QX3A 2ALJA 3L4KA 1KWGA 3DUFB 1Q1EA 3KXPA 3D43A 2I3AA 2ZJ6A 1E1DA 2I4TA 1KMNA 3EARA 4TQUS 4A0FA 1U7WA 4B6PA 2OZEA 1Q16A 4TV8B 1LPBB 4M49A 3ZIDA 4QGHA 2EXXA 2K2WA 4QVGA 3LHDA 2R0QC 2V9PA 3STYA 1MJFA 4XSGA 1AVTA 2OG2A 3WSWA 3KTOA 2LTAA 2BHNA 2ZSEA 2YHIB 2AN3A 3SHFA 3URMA 2J67A 2RH4A 3IOCA 3O9MA 4B32A 1EDZA 2FMKA 3UPDA 2PX3A 5EJFA 1OLUA 1TU3A 3QMVA 3RO7A 1ETUA 4BNDB 2JG3A 1QGED 4DLYA 3RAGA 2A3NA 2RCNA 1OPRA 5JD5A 2P4HX 3H5WA 4BFTA 4I1VA 3R0ZA 1JDZA 1AGNA 1I30A 1KXZA 2FN3A 3BHIA 2VSQA 1Z5NA 1N5IA 4YI5A 1NL3A 3PD7A 1CXZA 1YJ5A 2Q99A 2VHCA 4OHZA 3GELA 5D7BA 4ODIA 3S2GA 3OOJA 4OMDA 2RHWA 3L6EA 5DHRA 5G4KB 4F92B 3RC9A 3FOZA 2C3PA 2D3TA 1C3LA 1JHAA 1N2IA 1RQGA 2X8JA 3KBBA 1LC0A 3MSCA 1YIOA 4OH7A 5DBIA 5ALGA 1QC5A 3H11A 5LM3A 3OMWA 5EYPA 1QVVA 4LDZA 5CDUA 1XI2A 2FKNA 1T9DA 1PS9A 1TU0A 1YE3A 1XRQA 5U4QA 1QDUA 3LBHA 2D1QA 1ND6A 3T99A 5EJGA 2ZIVB 1CY4A 1VCHA 2EJCA 4L0QA 3ABQB 1BD4A 4KL8S 3ISVA 3CW2A 1SO8A 4D9IA 5BNTA 1E99A 1Y98A 1CWUA 4E21A 3SAJA 5IXJA 1ZINA 3CUSA 3BD9A 4PO1A 4D92A 4R6XA 4LJRA 4ZICA 3ICOA 1H4QA 4B4OA 4ZN6A 1ULTA 1P5HA 1ZW6A 2B36A 4OQMA 3A4NA 4RIHA 5AHOA 4ZAGA 5UKDA 3SFZA 4OGKA 3CBGA 2DQKA 3C3BA 4KIJA 3A27A 4WCFA 2HHHB 2VOJA 1NX9A 4FFOA 4YMWA 1Z12A 4DUYB 1JKJA 2V7QA 4P3OA 5CBKA 3QUCA 2P3OA 4RHCA 1P8AA 2ZBVA 3OZVA 3G2HA 5BOVA 4CXMA 1IWOA 2FU5C 1ECLA 3I30X 1G8AA 2JGAA 3CNLA 1Y4AE 3IPLA 4FYPA 4F97A 3HJTA 1U7HA 4OF4A 4ZA2A 2B61A 1XL1A 3ZHRA 2O0HA 1NW4A 1E62A 2P2CA 4R69A 4Q4AB 5AJHA 2H00A 4E4TA 1Z18A 5DT2A 1AQNA 3H5LA 4ETWA 3FTFA 1O6ZA 4E5VA 1YQTA 1IFXA 3UGTA 4RD3A 1U3WA 2FYTA 2VHEA 5JXGA 2CB0A 5L45A 5H4GA 1FVFA 3FPHA 4BYMA 3IYLW 4OQNA 3ACDA 4JVSB 4ZVOA 2P78A 5DCUA 2GPAA 1XQ9A 1AN0A 1DEHA 5EG5A 4JI1B 1Y6JA 2WQZA 3W8NA 5MF6A 1JECA 1XTQA 1GEEA 4MGYR 1LCIA 4OQLA 3A1SA 5K2OA 2QIPA 5F23A 4DR1B 4UAGA 2HMYB 2ZRFA 4R7ZA 3CA8A 2ONCA 4L3OA 1KO7A 3WMGA 2OILA 2BM1A 4ARUA 3R7DA 3BKXA 3EQ2A 4MW9A 4BXOB 5JSZA 1SQGA 5F98A 3PIRA 2YZ2A 1HTBA 2BGLA 2GZDA 3OESA 3AO0B 1LKZA 2V0CA 3FIJA 4QOEA 4AJJA 4AAYA 4TL6A 1A9SA 4C0QC 5C7IO 1OFHA 2ZYSA 4LY9A 1OI2A 1B26A 2RIPA 1SC4A 2J9XB 1C2YA 2VSYA 4U4AA 2CXSA 4N3NA 2IU3A 1USUA 5CX1B 3IVAA 3V33A 2BKLA 4L02A 1MJ5A 2MT9A 1O6BA 2FG5A 4WE3A 2B9EA 4LBWA 1PS0A 2QMOA 3UMCA 1GGJA 2TMGA 5DXAA 1NUAA 1OIVA 1F2UA 4A91A 4GXRA 5GY7A 2FEWB 1LF5A 4KGZA 3WNBA 3ABRB 4WWHA 3ZGXA 4EW1A 5IDYA 4JL8A 4DLNA 2ZE5A 3L18A 1LSSA 1F2TA 2I2FA 5CM9C 4D82A 4YRMA 2I2AA 2VHXA 4WESA 1XJ0A 1VP3A 4D4IA 4EI8A 1PV4A 3T1YB 2BMEA 4D02A 5KMGB 5CK4A 4F2PA 1YL6A 4LXQA 5F76A 4YRAA 3IUJA 4IFTA 2OV2A 1RWPA 3II6X 4M0KA 1DQRA 1Z5UA 3KJGA 1YQXA 3O0DA 1O08A 3QIAA 3RFVA 2XIJA 5C4MA 4HDKB 2CWWA 3GAAA 3K32A 3R5XA 4N3BA 1ND5A 4LS3A 1D7AA 3GGCA 2WDZA 1ZD2P 4ZAWA 1U7XA 3EZFA 1WHTB 4UDXX 4WASA 5C5IA 3MT8A 5E2AA 2BIFA 1ECFA 1C29B 3BTSA 1GYPA 2FUG1 2ZETA 4D4LA 4U7JA 4BQFA 2XIQA 5EIAA 3WX0A 4ZC8A 3EVAA 3FOAA 3UAZA 1UBGA 5DM4A 3TIVA 4BMNA 1AOXA 1ZS9A 5LFAA 5AKHA 1YFJA 2P68A 3R5FA 2OCLA 2UAGA 4Q18A 2ZE8A 2FCAA 1M2OA 1RBQA 3MAJA 2OLJA 5JO9A 4C4XA 1TUBA 2DFPA 2XA9A 4X24A 4B4KA 4E88A 2HY7A 3IKLA 4G8JA 1NFQA 4KNYA 3K6SB 4EL5A 1KK1A 3HCNA 2VYFA 3OTQA 5IC6A 1E7QA 4EG4A 3OHPA 5CAEB 2Q8QA 1NAHA 2FX3A 1JIJA 4L9SA 3K0AA 3SKXA 2W42A 4GOJA 3F2IA 2ZITA 4M7PA 4NH4A 4TRNA 3I04A 4XX0A 5BY2A 1WZ2A 2Y1XA 4UD2A 3KYCB 2KLBA 2CMGA 1JG2A 1JW9B 2YXEA 2QZ9A 2PXCA 3W9BA 4X0EA 5KYKA 5LL6P 1BXRA 3GY0A 3HFGA 4ARIA 4DIDA 3LK6A 1C0KA 3PQ5A 4MR7A 1NSFA 1V0JA 1PJSA 2BFDA 4I55A 4TPKA 5LA6B 2H52A 4INAA 4EFMA 4MRSA 5AXAA 5GV7A 5GTDA 2H48A 1PKXA 2FZ5A 3O8OB 1CIPA 3A2MA 2OOSA 4K03A 4WD3A 2X8WA 1QM5A 2P9BA 5BSTA 4A8JB 3RHSA 4LXTA 3I5MA 4XD2A 4HEHA 1UPXA 5BMVA 4BPRA 4FXPA 3VOSA 3EYWA 2IYTA 3N07A 3LY8A 3T1NA 1JNXX 2YNMD 2C94A 1VKHA 3RLIA 2SHKA 2YASA 4RH3A 1KMIY 3LSTA 4HFJA 1KEKA 2BZSA 2KBEA 1V16A 1WLYA 3ANLA 4KQ1A 1T4CA 4QT0A 4C43A 1A82A 1LVGA 2P9FA 3ORHA 3SICE 1NMXA 1QH8B 2EX1A 1V7QA 5FULA 1GLGA 4TKZA 1FSSA 4QHTA 3RSFA 3TNLA 5AM3A 3I42A 1FEZA 4D9JA 2YJ6A 2IOFA 1L5SA 2ACWA 3I9V6 4ZGBA 2M32A 1ZN7A 1VLHA 3D5TA 2Y1GA 4Z8XA 1MB9A 1JG6A 2WUFA 3G82C 1YZUA 3PJEA 5BXYA 3Q9UA 4M9XA 4ER3A 1G1AA 2EYUA 5J23A 2CJXA 1UMBB 4RIFA 1KU0A 2NZ2A 3DT6A 2IY9A 3I53A 4INJA 2IXFA 2JANA 1JHUA 3DJFA 4WKBA 2WY2D 3VSDA 1BO6A 1KPGA 1AG9A 1A72A 4ND1A 1T2CA 1OBHA 3C48A 3VOAA 3SR0A 4L4UA 3PI7A 3H5TA 2I3ZA 1U3FA 1Z4OA 1J8VA 2PL9A 3KJXA 1XFDA 4CUJA 3CNBA 4U7WA 4XD7A 1TYDE 1ZD8A 4C7OA 3R8XA 2XXBA 3GJ5A 4QARA 2RJNA 3RREA 2C9CA 4ND6A 3EUFA 2HSDA 2A1TR 3IR5A 4B6EA 1KVRA 2QUHA 4CDRA 2Z2KA 3HYCA 4LJKA 4LNUB 2EP7A 3D5EA 4XJXA 1G66A 1YUBA 4HAYA 4Y9UA 1BX3A 1DAHA 1YUNA 3OZUA 3AI3A 4RK0A 1C30A 5LBUA 3TL6A 4D9KA 4Q1CA 1RI4A 4ITVA 1U7PA 4RU1A 1SKBA 4KZKA 4ZCLA 5HKKD 4EEZA 1WKCA 1Q12A 3GWGA 1ZLXA 3GA7A 5IANA 1RRKA 2G80A 3CJTA 1V7ZA 1LVUA 3PNMA 4YX9A 4IIJF 4HNGA 5CVEA 1YTUA 3JQ9C 5G4KA 2QTZA 1OB2A 5KX5A 2QEQA 1S01A 2HMTA 3QKUA 3KEQA 2WRZA 4F2WA 5IRCD 3IUQA 2LDXA 2VXYA 4R40A 3VVMA 1JYEA 3WDKA 3LE8A 4Q00A 4W5HA 2REBA 4BEJA 3NEPX 5LB2A 1RFLA 2CXXA 1Q1AA 4R8KA 1PBTA 4OHMA 2J0UB 5H59A 3N2GA 5BSWA 4RD2A 3CLRC 3ENWA 4LXGA 4BFVA 3CZRA 1E5XA 4H0FA 2V3CC 3W7AA 3LRTA 3PFCA 3DZIA 3BL5A 3FF1A 4IVNA 2R6R1 2HU5A 1CIVA 2GTHA 1W36D 3LUAA 3KSZO 1J0BA 4RCZA 2O5CA 1QZ3A 2PEYA 1ZAYA 3RR2A 3MJTA 1KI6A 4P8RA 4B6OA 4C4RA 4FU0A 1T6NA 3SXUA 3TLKA 5C32A 4JQSA 3PC8C 5EQFA 5JS6A 4O63O 1KZGB 4XVRA 2D0IA 1DX4A 2OM6A 3D4LA 5SY4A 1I0ZA 1ZD5A 1T8PA 1SIOA 4F3KA 4DSAA 1S8OA 1XX6A 2X5OA 1CZKA 4D9BA 1CF2O 2GEJA 4EHHA 3MS7A 1J0CA 2AVDA 3BREA 4ZXFA 4EO4A 2REQB 2M1ZA 4ESEA 2DPHA 1DZIA 1ZOOA 2XJ9A 3TW8B 1FZTA 2DSTA 1Z2DA 3KCNA 4ZCPA 4D3XA 3U9TA 4BIIA 3AR9A 2YVUA 3OOEA 2Q49A 4CLRB 3A1UA 1ETHA 4A8TA 1JH8A 1CDZA 2NADA 3HKCB 4HXYA 5CDHA 3L46A 4PRLA 1SC1A 1TMGE 2HK6A 3IE0A 3D9QX 4GI3A 1VBKA 3JVDA 4EG6A 4LRQA 1Z4QA 5BUZA 2E4UA 2JD1A 2JFNA 1U0SY 3MBKA 3K71B 2QW0X 5L3SB 3U60B 2IDJA 3G85A 1H2AS 3AUAA 5JATA 3E8SA 3BORA 2OESA 5CW2A 2AFVA 3HEBA 2I3BA 1A04A 1L5FA 1GNSA 1J24A 3N39C 1GRQA 1W2GA 2HCTA 2HNKA 3TBKA 4NJMB 3FYTA 4OP1A 3PGMA 2PX4A 5EJ5A 4MDFA 4K6GA 4D41A 1N9GB 1PZGA 2GKGA 4WBNB 1UK6A 1HOXA 4P80A 2IC5A 1KRHA 2Q28A 9MHTA 1M5UA 1I0LA 4FE4A 4KVAA 4L4RA 1MQSA 4C0WA 2PRZA 5CLLA 4RLFA 2FOLA 2HHJA 1C14A 2WG0A 4ZGGA 1E18A 1CEEA 4HS4A 2AZXA 2G1KA 1J2TA 3Q7IA 2OBFA 3HA3A 5FOUA 5ES4B 2QX6A 5ALOA 4M0LA 2UVPB 1LBIA 3NQ41 3IOMA 3GRZA 1ONNA 2HO4A 2IUSA 4E2FA 3NEJA 4ZVTA 3MCUA 1T5LA 2QSYA 3EY4A 3X2EA 5JSHA 1IH8A 1L7MA 1TOAA 3JVIA 2MINB 1N0VC 2VT3A 4K81B 3EPPA 2GDJA 1XQ1A 3M33A 3NT2A 4KPGA 3DW3X 4GZLA 4I4TB 4RCYA 2P9TA 1HE2A 3I83A 1A7KA 1EZZA 3BWDD 1QCYA 1H69A 3FHCB 3QEMA 1GITA 4XYEA 3CB2A 2E3JA 3JVEA 1KO1A 1SU4A 2ESRA 2LNDA 1CCWA 4KQKA 2C5HA 2QY9A 3TDNA 4U9UA 1U8TA 4DC9A 4RPJA 4TVOA 2ZJFA 3BD6A 4O2BA 4MLPA 2OHIA 1P1HA 4X1YA 1R88A 5DI3B 3RS4A 3L4EA 4ALIA 4IJVA 1OXBB 5J47A 1Z3IX 1NQTA 1WCXA 5KHAA 1F5SA 4DMKA 1AQYA 3M81A 5BV0A 4OHBA 4EGJA 3VYTB 3HR8A 3G2OA 3DEHA 3S4YA 5EP1A 1JP7A 2R6ZA 2PANA 4I6EA 4MW0A 4FEAA 4WXMA 4HNHA 1VM6A 2IQ5A 3JPYA 3ZE0B 1LDYA 1FK8A 2JCGA 3UJ9A 5JCJD 2H9YA 3OUUA 1VBNA 1YDGA 1O5TA 3VZDA 5TMBA 5CCXA 3FCAA 3DF7A 3KAPA 4I6JA 2WU3A 1PR4A 3UFXA 1A98A 5E3JA 4RA6A 3OZSA 4BV2A 1PJ8A 5IYZA 2B9VA 4XIFA 4A2PA 2IH5A 3BTOA 3R1IA 3IUNA 4CQMB 3ZKWA 4FFSA 3K70C 3A6JA 1I2MA 3OICA 1T8SA 1K66A 1E0KA 3G7NA 3JZMA 3NHFA 2WAYA 5JNVA 1YGYA 4JWTA 1RYHA 4FHGA 4LYDA 3D5QA 2PFGA 5CAEA 2QVYX 5IASA 2UUOA 2WIDA 3EW7A 1KMCA 3OEHA 3TW4A 5JJ5A 1CFJA 4HGPA 3EWIA 3LC2O 1XWIA 3K09C 4IEEA 3WGTA 1AJEA 2ZQZA 1X3SA 3F6EX 4UXIA 4PHHA 5AVQA 4IIJB 2G36A 3DE0X 3S7TA 4LHSA 2WD8A 3C97A 5FCDA 3HCBA 2BGNA 3FTDA 1GCAA 4DSTA 3L7JA 1ZM2A 2QSZA 2N1BA 2XV1A 1YVUA 4HFRA 5G3YA 2EBUA 3U4DA 3CXRA 2O59A 1AKQA 1KJYA 4MSUA 4DRZA 3AUFA 4Q6BA 2GN4A 5IK2D 1P2TA 2WVAA 2H1OA 3DOJA 4JUBA 3PF9A 5D1NA 3IVXA 3RSOA 4OJTA 3KR1A 4KWIA 3GGDA 1K8ZB 4XB2A 3DUWA 2GOYA 2IHBA 4IWNA 4MWBA 1IBLB 5FRDA 5IK2A 1YA8A 3ONVA 1P31A 1N6RA 3IMEA 4JSYA 4EI9A 4YLEA 2YV2A 3DB1A 1WHSB 3W5SA 1WXWA 1IUOA 1T4CB 3E82A 3I4FA 3M3PA 1MNAA 1UM9A 1A7UA 1SVIA 2LV8A 3OY2A 1EUCB 5K3SA 4EO7A 2ZWAA 3L8DA 1XN1A 2A88A 3NGXA 5CB8A 1F06A 4NYJR 4V0NA 1LTQA 1OXSC 3HBLA 1UM8A 4KPFC 1UT6A 3SJCA 4CEJB 2IOHA 5LKRA 2GZAA 1WXFA 1PJRA 2H92A 1G9SA 1CTQA 4I1IA 3N8IA 1FFXA 3WKEA 3NANA 1CQPA 5BV7A 4DDMA 1GFWA 1W5TA 5LQUA 2IEZA 2PUJA 3A4TA 3RRBA 2WT8A 5K5EA 4GWLA 4MV4A 4B3SB 2AI3A 2FEPA 2J4DA 1CB7A 3N7AA 4X85A 2IDKA 4XM2A 1DIAA 2YY6A 3NP9A 1G6HA 4G0WA 1ZQ1A 1T8UA 2I8CA 1C7QA 1SFRA 4QVKA 2FSHA 1E77A 4NDZA 3FB4A 1MO2A 4AG6A 2CBXA 2FZVA 4IZ6A 4BVAA 4JS0A 5EP4A 2XNJA 3BIWA 1GGMA 2ZDHA 1YACA 3CISA 2Z3VA 4Z4CA 4KR7A 1M54A 1RU3A 1GA1A 2FVXA 2GVNA 2Y8EA 4N6OA 1VRCA 3PI6A 2J9ZB 5EE1A 1YMVA 1JMVA 4AKTA 2O1WA 4EG1A 3L8FA 2WT4A 4J29A 3N5KA 4FFBA 4X97A 3H86A 3ZWCA 2JIDA 5JFTA 3P0JA 4NX2A 5LUBA 3A1VA 4MO2A 3S5JA 1T6YA 2O19A 2FX2A 5SICE 2WWYA 1FX0B 3CEJA 1W4CA 1WUTA 3JQFC 2IE0A 4Q37A 5KX5B 1CD5A 3E48A 5BW6B 1G3RA 3JQ9A 3M4NA 1U0FA 5BQPA 3SKYA 4OX9Y 3TNFA 2J87A 2B83A 2YFYA 2WILA 4S1NA 2Q27A 5MN5A 1OAAA 1FFBA 3N2GB 4F4UA 3ZWYA 2XUQA 3UG7A 1VDMA 3AUSA 3JYPA 3V97A 3PUYA 1P29A 3UA4A 2OB1A 4I3GA 4LQDA 3QPAA 2X2OA 3O9ZA 1SR8A 5H3LA 3OVMA 3JRXA 1HZZA 3WYDA 5IJAA 2WOJA 1QCCA 5FXMA 5F12A 4N48A 5IF3A 3UICA 2W93A 4F8EA 2EFGA 4P98A 3TW6A 1KYTA 2WWHA 2ZGVA 4EHFA 3LKBA 4KG7A 5AYVA 2I5PO 2ZANA 2DUMA 4G0ZA 1MUUA 1ONPA 4L76A 3L8EA 2UVDA 2JVIA 5I7FA 1P9RA 4D8TA 4R5HA 1K9SA 1PSZA 1NWHA 1DIOB 3DPIA 1J9EA 2FN4A 3K4HA 2TS1A 3DOIA 3Q41A 4FMBB 4J94A 1IC6A 4M7RA 4MVJE 3OAAA 4PNPA 4IV0A 4RGQA 5HCUA 5BYKA 4J1SA 3ADOA 3KUUA 4H08A 4X20A 4J6EA 3WK6A 4CTNA 1OTXA 4Q6WA 1SU7A 2CFOA 1UK8A 3F49S 4HWOA 3KTAB 4S3MA 4CKZA 1CRWG 1Q7RA 2B4TO 2IY8A 1EG7A 2A8YA 1HT1E 1MO5A 4PHTA 2XUZA 1I94B 3C2QA 1XBTA 1CUBA 1QXSA 3GK3A 1M83A 3E3AA 3W9UA 4TS3A 1WSAA 2VK8A 2O0MA 1OVGA 2O06A 1V4VA 3E7FA 3IEIA 4OP3A 3TRJA 3V7YA 4DIBA 4EJ0A 1WG8A 4DW8A 3GMIA 3BMCB 3AB3A 1QF6A 3GVIA 1J5EB 4EY5A 3DTNA 2I6XA 1A8SA 1B43A 3NWBA 3VO9A 4L73A 4YASA 3ELYA 1JXAA 3H0CA 1RJDA 1DARA 4O2RA 1BDJA 4KYVA 5DFAA 3SHTA 2HQSA 4ZHQF 5KOJA 3TG8A 1A5AB 4UCQA 2RGUA 2QJTA 3EGWA 3K9HA 1E5TA 1YIAA 2FEOA 2Q45A 3B1WA 3L8HA 2X42A 3MAAC 1C7JA 1U1DA 4MVCA 2G7ZA 3GLVA 1R3UA 3A4LA 4NXNB 2XMPA 1JA0A 1YAJA 4FWBA 4XEUA 4TS4A 4WUTA 5GJWC 1GTZA 1LPSA 3CZ5A 2EWWA 3HUEA 2OM2A 3KNZA 4QO8A 1V3QE 1YZHA 5IC5A 4ZKDA 4HNVA 1ECJA 5IJ9B 3ELUA 3RB8A 3RCBA 4OLHA 4D5EA 2OAGA 3EEBA 1T2UA 1QDLB 2CGEA 1G19A 4EI7A 2H4WA 1B14A 5AO9A 4ARVA 5CDYA 1N5RA 3NTUA 4GQIA 1U2DA 2W58A 5EHGA 2WAXA 3QU7A 3U4IA 2B99A 3L93A 5BRJA 2PAFA 5FV4A 2PEZA 3A10A 3HO1A 4J0CA 4WGGA 3OZFA 4H1VA 3ZG6A 3HCRA 3D2AA 1JEQA 1BIFA 1DG1G 1M1NB 2H29A 2XADA 4YRZA 5F3WB 2W9XA 1OAOC 1ZZGA 5CGQB 2HTFA 1J2RA 4GOOD 3G0IA 3L79A 4GRDA 4I81A 5LZ5A 4X7PA 4M98A 2PWPA 4B87A 3EOAI 5HE9A 2V7VA 5JMPA 5DHAA 1Y6QA 2WDPA 1H8HD 1TVKB 1KQOA 3HCCA 3I0NA 3PC7A 1DXYA 1QYRA 4ZT5A 5B2FA 4N76A 4KQEA 3CIOA 1GZ7A 3U7FB 1N6KA 4Q3LA 1L5LA 2F1IA 3E9NA 2KJQA 5DN6D 4F06A 5M3BA 1L1RA 1ZMOA 2NSYA 3WGHA 3VU0A 1ZIPA 1C3OA 4GP9A 1ULZA 3DCIA 4WAUA 2ACEA 5IVHA 2XOKD 1RXSA 1Y3FE 1ZSYA 1QO0A 4FC7A 3RAPR 1SEPA 3AW8A 3EVTA 1XMQB 1FP6A 3KOOA 3AEKA 1GTG1 1YJCA 2PZGA 4OQ4A 521PA 4BBPA 1K92A 2YR0A 4I50B 1R0SA 4ALNA 2VJDA 2WZDA 3AF5A 5DU2A 3HYRA 2G76A 3Q8XB 4RH1A 4Q1BA 4EG8A 1U9IC 3VMFA 1E1KA 2ISQA 2IYRA 3M9LA 5DTEA 5JZOA 2RGYA 5LU9A 1MPTA 2XUDA 1UJ5A 1SVWA 5AKEA 4F93B 1HFEL 2ZBFA 4A8HA 3A25A 4YCLA 1ICIA 2QP3A 4RK7A 4EL0A 3G3EA 1LFDB 3Q10A 5H9WA 4BNZA 2C20A 1D4OA 1PX0A 2QYTA 2KLHA 2XVXA 4QDXA 1D1SA 3HWWA 3BKWA 5D84A 4BRSA 4HFMA 2VATA 5KKAA 1OYOA 1MAHA 1H93A 2OFPA 4XRGA 2O8DB 1WUIS 5C51B 2FWBA 1D9ZA 3LS2A 1HNWB 4IIJA 2VPWA 3AWDA 3LG2A 1N0WA 3N8DA 5IAOA 2ZDGA 5B7NA 1E3SA 3L7YA 4YPOA 1ZISA 1E9RA 3U13A 2A84A 4ZQIA 1QB8A 1NR5A 3R6GA 2JDIA 4DJAA 2KM1A 1U9CA 3GP8A 1QRSA 4TTAA 1ISHA 5KOYA 3QMPA 4DUZB 3HK2A 1T36A 2AH5A 1NLMA 4N1AA 3O31A 4LVNA 2E82A 2W6PA 2AGVA 3KOXA 2BP7A 2H0QA 5AJWA 2D5AA 2JAOA 4NE2A 1OD6A 5EGSA 3E15A 3VYWA 2COUA 2C98A 2A4MA 2YRFA 1XCGB 3P5BA 5JVDA 2EWVA 4MYTA 1DC4A 2NUPA 3T3DA 2XTJA 2SCUB 1HFJA 3TJZA 4AK9A 4TTSA 4GKKB 1Q20A 3FPGA 1MQ8B 3AI7A 3CRQA 1J8QA 2VSFA 1SD5A 1G20E 3B85A 3HEAA 3I05A 2VQEB 4I19A 2O3JA 2WJIA 1TA4A 1EP2B 1ZN2A 4KWHA 4OXIA 4X63A 4XPIA 4DZZA 4QOFA 3UW1A 5IDQA 1RHKA 1N2CB 1ONBA 1XVIA 4U2BA 4MVJP 2QZSA 4XIJA 4ZVMA 3TR0A 3G5UA 2JBHA 1IOLA 3SDZA 3T4XA 5A62A 1QUFA 4D0LB 2VPZA 3TR6A 1UK9A 4HADA 2QDXA 2YYZA 3OZEA 5FPYA 4EAAA 2ZRQA 1Y1PA 2ZCUA 2QGNA 4MA4A 1IZ9A 3NS7A 4HHEA 4IHJF 4RTPA 1KI2A 1GTMA 1RC1A 5TQ2B 1FF9A 1D5WA 2WNSA 4NJEB 3TKYA 3T06B 4A5OA 1HE5A 1T2NA 4Y2TA 3N87A 5LNK1 3ETHA 1VL6A 1QYDA 4ZFNA 4BN4A 1DMSA 3T5MA 1LBEA 3PQ8A 3GLFB 1U2PA 1PR3A 3ETCA 4RY9A 1VG1A 2UDPA 3P0EA 5MGNA 1YQEA 4NY1A 2AZ4A 1TFUA 1N8TA 4YJHA 3W06A 3ZGLA 2OSBA 2P2LA 2V3WA 5DVZA 2WSSA 1I1HA 4RCVA 4YIHA 3HB7A 4KAXA 3HVIA 5I9LA 4N49A 2P3QA 1GVHA 2UV8A 1OX4A 2RJ3A 1KP9A 5F3DA 3M6IA 4BWYA 2UZ1B 3IAXA 4L5CA 2OGTA 4QZVA 4OJQA 1IPHA 2RCYA 4OYLA 3IOBA 3Q15C 4F5DA 3AFMA 4JLAA 1KMMA 1U2TA 2IKSA 2WW8A 4M9QA 3IAUA 1TQ4A 2SKCA 4UU1A 1P8JA 5FR2A 3W2IA 4MJ3A 2C2MA 3PITA 1XROA 1KZYC 3KKEA 3OA0A 3SIRA 1F4LA 1XXHB 1TLFA 3N0XA 3NM6B 2QQGA 1JKIA 1GPKA 3OZBA 3SLKA 4HLNA 3AZQA 1E2KA 3BWCA 5U4XA 5A02A 5CD9A 2ZE6A 4RKFA 4I9GA 4G0MA 3V1TC 2IS1A 1Z83A 4CMIB 4TM7A 3PXXA 1TZJA 4PO8A 3ROGA 2DB3A 1Y8AA 3KJIA 3QK7A 3QWAA 3D6NB 5DGTA 2ZTVA 2N42A 3S2UA 5LDGA 4E2XA 1ZJJA 2PU7A 4YVFA 4AKSA 4D74A 4M87A 1UKCA 4W6QA 1HYGA 3DONA 1K8XB 2IELA 5HKKA 1HL3A 1NVKA 4F91B 2IEAA 1Z15A 1CYEA 3MOGA 2AQHA 4TXNA 1KJ9A 3ZPXA 4IL5A 2AI2A 3SHVA 3F74A 2BFMA 1GLVA 2PE5A 4FR5A 4YP1A 4QDUA 3ELBA 4WLVA 3TL2A 1SQ5A 2WKSA 1RMTA 3JYHA 3O4GA 3UM9A 4X20B 2TYSB 3OF2A 3OIDA 3WP1B 2XE4A 1WHTA 3D4OA 3HO8A 3AKZA 1LI4A 3NHKA 2A0WA 3SEAA 1VCIA 2R66A 3QWFA 3FUVA 3NT4A 2OK7A 2H65A 3CUKA 5FI3A 1ZI6A 2W4IA 1ITZA 1SUAA 3P9XA 4OFBA 1CQXA 4RV5A 1OZHA 2N3ZA 3FMPB 1PX2A 4KI7A 4C2TA 3HKDB 4R1QA 2IYUA 3KQMA 2HDHA 1KZHA 4PZDA 4GIBA 3L77A 1JF8A 1UFQA 2VT7A 3ABOB 3IURA 4KE9A 5HDQA 3TD9A 4EMUA 4KKVA 2GXAA 4I8IA 3E0QA 3TRIA 1N5LA 2OQRA 3AC0A 5F7OA 3ZKAA 3WMFA 4B81A 1NVWQ 4QU8A 1JR3A 4B31A 1XZBA 2GBPA 2BR4A 1EQ2A 3QBTA 5M7EA 2QT1A 3B60A 3FYDA 3DMTC 1IAQA 4J4HA 4U7PB 4Y6OA 4DQDA 4ITRC 1ESDA 4H7DA 2HJSA 4ZQCB 2P30A 4P08A 5AFSA 3OLQA 2VAPA 3BWBA 3NUQA 4MUMA 2NTYC 2P9YA 1F8XA 1GZ3A 2FFJA 1JHDA 1O94A 3GGJA 3NM4A 4RVHA 3TAXA 5DSXA 5FA5A 3W3AH 1YKSA 1EKXA 2DT8A 4MPDA 5IJ9A 2GA9A 2QTMA 4E46A 4GP6A 5HTOA 3IT2A 3UGKA 1QS0B 1NZJA 1IBMB 3V2UA 2XMQA 3B2NA 1O8CA 2CHGA 2IPLA 5DCYA 3HVUA 1U65A 2BFDB 4I55B 5C52B 2CCJA 3KXIA 3BCHA 2ACVA 2EHDA 5HW0A 3OZGA 2FPLA 4BO6A 5K8TA 1HDXA 5FWNA 1EP1B 4CG2A 5AW3A 2V59A 2PKRA 4OXKA 5GWXA 2I6FA 1Q0QA 4YPVA 4RD4A 4KVFA 3RTAA 4CM7A 3H4IA 3MCVA 5DULA 3V8RA 4J7UA 1OI4A 1E3DA 3F6RA 2DQZA 3HRIA 2YYYA 2QG6A 3EUWA 2EGHA 1N0HA 4E5NA 4ZODA 1E2MA 3KKLA 3K1YA 2FZWA 2WYVA 1U5BB 3IDQA 4BE4A 4MUKA 2I6GA 2PU5A 3WNVA 4IDBA 2QMUA 1DUSA 2WJ3A 2ZBEA 4KN5A 3PB3A 4FSHA 1OSNA 3R74A 3CVUA 2R8BA 1NONA 1TYAE 4RZHA 4F9FA 5BWOA 1JHPA 3K4PA 3E7DA 4O08A 4LJYA 1UODA 1G7SA 3GYBA 1JQKA 3KOUA 3KOYA 3O0TA 1C4OA 4YA6A 3D7KA 3F6PA 3QA9A 2HIGA 4NI5A 2B25A 2VWPA 1FSPA 1W9MA 2ES4A 3C7CB 2IHJA 4NS4A 1T1SA 4EG3A 5DNCA 3RIMA 3BH6A 3AGPA 4QOJA 2NGRA 1EUDB 1OFIA 1R1DA 2FSVC 2ID9A 4FIDA 3LKVA 3Q40A 4NCAA 2FPGB 5ERYA 3ZZ0A 4BB0A 1RS0A 1CR0A 5K45A 2GTPA 4K5QA 1KOJA 1XLVA 4QC2A 3RDPA 1XKLA 4JBIA 5F4BA 3EIQA 3EAGA 4UMVA 3ZCQA 4YMGA 3FYHA 3OIGA 3AR7A 1OF1A 1SOWA 3NGMA 1AUOA 4WADA 4AS2A 4US2R 3DULA 3F46A 3OZIA 5ILQA 3NHMA 3OWOA 4LBZA 3VO1A 1VJDA 4CNBA 3BIFA 1E9DA 1OA0A 2HT6A 1AKRA 3EB9A 4IDPA 5IVKA 4JB8A 4A92A 3QMMA 3OCUA 4GXNA 2AT1A 4KOAA 1I2BA 1T5SA 3ET5A 2VDLB 5GVRA 5EWLB 2X14A 3DE5X 4JXKA 1X7WA 5AOVA 3AR4A 5CDFA 1GTSA 4UOQA 2NVUA 1RM4A 3EMBA 1IG0A 1NXTA 2VAXA 4QGFA 3DFZA 2H9AA 4YI3A 5BR4A 2I91A 1EK0A 1HO3A 1L5WA 4OUKX 1QP4A 1OWOA 3V8MA 2HLNA 1KDOA 2BFNA 4HN9A 1U94A 1L6RA 4AICA 1GFSA 2WNHA 3ZJYA 3W8FA 2AEMA 3PKZA 3Q2OA 4INOA 4OUDB 4L28A 4PLCA 3NATA 3RUHA 3CY6A 5JCPA 2JEOA 2Y1CA 3WLMA 4A36A 3VR1A 1NAIA 2AF3C 3AFNA 3DMGA 2XQFA 4XE5A 3PQDA 4B7ZA 1XZLA 3TTSA 3WHIA 5H3CA 3UAGA 1AK1A 3SQWA 2YXDA 5EKSA 3S8YA 4WN3A 1Q6YA 2JZNA 3I5AA 3LGSA 3QVSA 4ZO8A 4B6SA 3HPQA 3OZRA 3LTNC 4OEHA 2DR0A 1UMKA 1ZSNA 1DAEA 1Y7IA 2PGAA 2HA4A 2QZZA 3HKCA 3ROZA 3DNFA 3KPYA 3WKBA 5FTWA 3ZQ6A 5KPJA 4JKOA 4RDXA 1Q57A 2TRSB 3VNBA 5ICMA 4M3NA 3KHSA 1DT3A 3IIJA 4L9WA 2AMYA 3U49A 4IJKA 3SIXA 4P3NA 3OKAA 3UXHA 1W88A 4BO9A 1GY8A 4HVCA 4BEWA 2AG8A 1OMOA 1T25A 1GG2A 2BFCA 2HTEA 2C2XA 4NONA 3MYYA 3LIPA 3UAYA 4DIKA 3CINA 1M73E 3OZCA 5KTKA 3GLIB 2GUWA 2ZSJA 3NR2A 4IHJA 4B17A 1ODLA 5CA0A 3R3SA 4QNRA 4CL3A 4FZ3A 1IVNA 3EQ7A 5AD1A 5DNAA 4F2GA 1HX7A 1O94C 2JK0A 5HCIA 4J0HA 3F78A 5DH9A 3BF7A 4BYGA 1XA3A 3D7SA 5FNVB 3DFFA 4DA9A 1O95A 5LXTA 5L3QA 3PNVA 5ECDA 2J5RA 3B5IA 5I3ZA 2GZ1A 2XWBF 1XAHA 1DRKA 4AULA 4YMUA 2XUJA 2FZCA 2X7XA 1EE9A 2PK3A 3UK7A 4ZRDA 4BNLA 4YWJA 3HC7A 4PXSA 3RIGA 2W2MA 1GO2A 1E2FA 4OV6B 2H1LA 4P7JA 4Y2XA 2I22A 3L43A 4O4LF 4X6XA 1CUZA 2ZS8A 1CZRA 3IAS1 1F51E 4RO0A 4ZQBA 4EW6A 2PPVA 1Z2EA 3FVTA 4KWTA 3TVYA 2VDNB 3KJEA 1L8LA 1PT8A 2D2EA 1CU1A 2Z5FA 3M9WA 4S24A 5IAKA 3RV4A 3VPBA 3VYRB 4DG8A 2IX3A 2HXSA 2UUPA 3C6QA 4HDSB 2AN4A 3SMQA 5CD1A 1P7CA 4CTMA 4PR3A 4EHAA 2B8NA 1DJMA 3TB6A 2XOEA 3QELA 1LDMA 1P2DA 1USWA 1ZRMA 4MDHA 4U39A 4I46A 2OCGA 1GTJ1 2NZYA 4BNXA 1VBMA 3OKCA 4LV8B 2IS6A 1X8KA 3F3KA 1F8UA 4ARSA 2Q9BA 3RSLA 3S2YA 4EWLA 1JQEA 1MU0A 2E55A<