1P74A

Crystal structure of shikimate dehydrogenase (aroe) from haemophilus influenzae
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
267
Chain Sequence
b'MDLYAVWGNPIAQSKSPLIQNKLAAQTHQTMEYIAKLGDLDAFEQQLLAFFEEGAKGCNITSPFKERAYQLADEYSQRAKLAEACNTLKKLDDGKLYADNTDGIGLVTDLQRLNWLRPNQHVLILGAGGATKGVLLPLLQAQQNIVLANRTFSKTKELAERFQPYGNIQAVSMDSIPLQTYDLVINATSAGASVDAEILKLGSAFYDMQYAKGTDTPFIALCKSLGLTNVSDGFGMLVAQAAHSFHLWRGVMPDFVSVYEQLKKAML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate 5-dehydrogenase
publication title The crystal structure of shikimate dehydrogenase (AroE) reveals a unique NADPH binding mode
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
total genus 98
structure length 267
sequence length 272
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1p74A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1p74A01
2J3IA 1YVEI 3D4PA 2R2GA 3NTRA 4JJFA 4I5GA 2XXJA 3H8VA 2PZJA 1GY8A 3CTMA 4ID9A 4J7XA 4WKGA 2HMWA 3WQQA 1LTHR 5EERA 5TNXA 3IDSA 4N5LA 1QXSA 2Y67A 5JNLA 3A14A 2QYTA 1N1GA 4DLBA 1U1IA 3NDIA 3DAFA 2ZKLA 2VRCD 5IZCA 4XQ9A 3GMDA 4B7UA 1OOEA 5HRUA 4PLFA 1ZK2A 1DFIA 2R00C 3BYZA 3F1LA 2F1KA 3ZHZA 3FNFA 1EMDA 4AJEA 3AU9A 1FMCA 4WLOA 4MVJI 1Q7CA 1BXGB 1I2CA 4IUYA 3WGGA 4IJVA 1VE9A 3I6IA 4D43A 2ZATA 4KUHA 6LDHA 3O03A 4FFMA 4BO3A 1KOLA 3WR5A 1LA2A 1LC3A 5K6AA 3DBLB 1DRVA 4II2A 1E77A 1VRWA 2JKVA 3DBRA 3C7CB 2VN8A 3O38A 3H3JA 4E21A 4XDZA 2GN4A 3WB9A 4Q3DA 3ZV4A 1FDTA 1PWXA 4AJPA 3Q2KA 1BGVA 5AVOA 3CMMA 4PLVA 2YUTA 1ZW1A 5K0ZA 3PYXA 2O7SA 1CWUA 5IXSA 1E3JA 4PLHA 4XX0A 1PGQA 4ND2A 3L6EA 2X23A 1Y8RA 2J3HA 1K3TA 2VT2A 4ND4A 2G1UA 4E33A 4J1NA 4RLHA 5KOIA 2JHFA 1GEGA 1ADBA 5L53A 4TKMA 2ZYAA 3PI7A 1CETA 4IDEA 2YHIA 3GVCA 4N7RA 4XYLA 4HY3A 3SXPA 2UDPA 1BXKA 5DT9A 1FJHA 2FR1A 4AJ1A 3IP3A 1PQWA 3KHUA 1Z7BA 1NWCA 1RJWA 2LDXA 1PJ2A 1ZEJA 3DAPA 4KWHA 4MVJA 3TQHA 5B37A 1ULSA 2D1YA 3RAJA 4ALJA 1ZFNA 1ULUA 1BWSA 2Z1MA 2GLXA 4QUKA 2DT5A 5KVCA 2O3RA 1LSUA 4JXKA 2D3TA 2WD7B 3HQ4O 4Q3EA 1EQUA 4YB8A 3AU8A 1TLTA 1E7MA 4IXWA 5B4VA 2GNAA 5C5IA 3OQ6A 4BB5A 3VZSA 3D5QA 1E7YA 1SO8A 4W4TA 3JQ9A 4I5FA 2V7PA 4IJWA 1ISJA 1SBYA 4G81A 1D8AA 2NNLD 1KYQA 1CERA 5IDWA 4TRNA 3HDHA 3TL3A 1JKFA 3VZRA 3UKOA 2XXBA 4GMFA 1W73A 4GVXA 4FC7A 4XJTA 3WS7A 3AI3A 5C7LO 2VOEA 2ZCUA 4KMSA 3ZWBA 4L0QA 2PKQP 5DP1A 4ZQGA 5IDQA 4CV1A 3RJ9A 3C7DB 4E2ZA 5EJ2A 4M55A 3ZW9A 1C0KA 3DQPA 2C59A 4BIIA 3JV7A 2FY8A 4OXYA 1ZKMA 3JQFA 1NPTO 4ALKA 3PWSA 3H4VA 3NUGA 4PIVA 3HSKA 1U2DA 2P5UA 3WOHA 5JE8A 5BR7A 4I5DA 5ENVA 2VOJA 5FF9A 4ZQEA 2DAPA 3L07A 4G5HA 1R16A 3BAZA 4MJLA 2X9VA 4YACA 4Q3BA 2DTDA 4Y98A 3DZBA 4IDDA 4NFSA 4D79A 2HLPA 1CDOA 4RL6A 1KIFA 4LMRA 4MIOA 1I3LA 5BSGA 4IIUA 5I7FA 2BFMA 2VYVA 3ZWPA 1HDXA 5JBIA 3GRKA 3UUWA 4I5EA 4XEHA 4BO4A 2H6EA 3UCFA 4CMAA 3AK4A 4DBVO 1A71A 1Z45A 2Q45A 1HE2A 3H5NA 2EHDA 4S3MA 1EVIA 3A1NA 3ZWMA 2NU6A 4NBVA 4MINA 4FW8A 1E1LA 1MG5A 3R3JA 4JP3A 3K8ZA 4HKTA 3TZQA 4UVHA 2PLAA 4W99A 2H5LA 4DQXA 2GDZA 2IRWA 1XDWA 2BHLA 3G0OA 1SOWA 3P2OA 4CMHA 5T5QA 1ORRA 4UUNA 4HNHA 4CMBA 1P33A 3LLSA 3PHJA 3GPIA 3VPSA 1M76A 3HUDA 3DHEA 4DMLA 1DJQA 1LRJA 1O89A 3OICA 5I8WA 4CV3A 2DPGA 4DIFA 1X7DA 5DCUA 4JP2A 4FOOA 1JU9A 2I3AA 3WICA 1FDVA 3R0IA 4BB6A 1WZIA 1A4UA 2EG9A 4JBHA 4IIVA 3BTUA 4R9SA 4IS2A 2AEMA 2O3TA 3RC1A 4RF5A 1S7CA 1UH5A 4RPKA 5I7EA 1G0NA 3TFOA 4R01A 2QX7A 1J4AA 1R0SA 4J7CA 4U8GA 1JN0A 3ANNA 2IZ1A 4XGKA 4YJDA 3ZU4A 4I9UA 1NFRA 2AMFA 2W4QA 3HB5X 8LDHA 3LT0A 1ADFA 3LF2A 4YRAA 1YXMA 4RPJA 1Y1PA 4BNYA 4J16A 4M89A 2ZYDA 2VQ3A 5BSFA 4CM4B 3EW7A 4CQLA 2CDAA 4XQEA 4BMSA 1WVGA 2A94A 2PKQO 4P8RA 4DWVA 1P77A 2EW8A 1EE9A 2FWMX 4BNUA 5IF3A 2WE8A 3VH4A 1HF3A 4BO1A 1I3MA 3JTMA 4RF3A 5TJ9A 3PGJA 1VJ0A 3KYCB 3LF1A 3FTPA 1QMGA 4D7AA 3ZNNA 4YT5A 1XG5A 1GV0A 3HFSA 1EFKA 3RUHA 2W2KA 2YFQA 1MGOA 2VWPA 4ZA2A 2NVUB 1PJQA 3KTDA 4E5PA 3HFGA 4RZHA 3TSCA 3E18A 1H2HA 1ID1A 4A27A 1AE1A 1B8PA 1HE4A 1PWZA 4OHUA 2AA3A 3EVNA 3SLKA 4B8WA 1VJTA 1YJ8A 3BMQA 5GZ6A 4HFRA 3GR6A 1VPDA 1XU7A 3E82A 4LGVA 5G4LA 5EL0A 3VKVA 3A28A 4YBZA 2RH8A 3VAZA 2AW5A 2BD0A 3EVTA 3FI9A 5DDIP 2Q4BA 1GUYA 3KSDO 1MUUA 4BKRA 3D0OA 3NTQA 4RO0A 4MVJP 2OO5A 4S1VA 1ZNQO 2VTEA 2CSUA 1I01A 3QVWA 1OBFO 5A9SB 3AUAA 5TX7A 5CP8A 3OIFA 4E5NA 5K6AC 4NMHA 2BF7A 4WLNA 3BMCB 2FR0A 3DOCA 2HQ1A 4RQTA 1JTVA 2FP4A 2YQ4A 4U0JA 1BDMA 2O50A 1QLHA 3KB6A 2VYNA 2IXAA 3JSAA 2ZTUA 1DBVO 2YV3A 4IBOA 1H9AA 4DGSA 3ZCXA 3QSGA 4N54A 2JJYA 4WEQA 1WDMA 4O59O 4R5MA 2PV7A 5BT9A 1N92A 3KYDB 1A72A 3LLVA 1UZNA 4R69A 2OL4A 4BNGA 3JYOA 4IQ8A 1ONPA 5AXBA 4IY1A 1TEHA 1A7AA 3BXXA 4ALIA 1DC4A 2NWQA 3OJLA 1B16A 3MJ4A 3KEOA 4PVDA 5JAMA 1HLDA 1K2WA 1MXFA 2DBQA 3WBBA 5I9LA 2XPCA 1N2SA 4MP3A 3IL2A 3L4BC 1JWAB 4P4GA 4B79A 3ZWYA 1TI7A 4UREA 4WOJA 1OMOA 1AN9A 2GPTA 3MJVA 2A4KA 4CM3A 3GNQA 1G0OA 4FIZA 4FOSA 4L4SA 3PZBA 4OQZA 2GGSA 1NQOA 4QFCA 4M1QA 3TN7A 4B7CA 1T2FA 1Z82A 3ON5A 2OGUA 3F6YA 2IEBA 3JD4A 1NBOA 3RUDA 1KS9A 5JCXA 4QQRA 2BRUA 3D3EA 4EITA 4JBIA 1EZ4A 3WG9A 4NBUA 3HJAA 5EN4A 3JQ9C 4BGEA 1PJLA 3AY7A 2QZ9A 2FMUA 4ND1A 3H7AA 1YKFA 3DXFA 1NWHA 2QHXA 3A4VA 4ONEA 4NFHA 3UHAA 1B8UA 1IL0A 2IYOA 2ZB8A 4Z9YA 3HN7A 5JAQA 2NVBA 2UYYA 3TOZA 3B1KA 3RROA 2ZCVA 3KUXA 1P1FA 4HFMA 3K96A 4KQXA 4OOEA 1E6WA 2SCUA 3ANMA 3OETA 3EDMA 1UXJA 3FR7A 1KVRA 1Q0QA 5A02A 5HS4A 3IJPA 3PJEA 1N1EA 2CZCA 3WGYA 1R0LA 3U4IA 4J49A 2R00A 1B8VA 1ZEMA 2EKQA 2OP1A 1ISIA 1NVMB 4A26A 4Z6KA 3R1IA 2NQTA 5F1PA 3H65A 3E1KA 5KWEA 5L45A 3GGOA 3GNTA 2C7VA 4ALMA 4NHEA 4J91A 6ADHA 2VHZA 3ZV3A 2P91A 1JWBB 4IPTA 4CV2A 1KEUA 4C7JA 1VL0A 1F12A 1EVZA 2FZEA 2AQIA 1Z75A 5A4DA 4PFJA 1T2DA 1ZXBA 4JN6B 2OP0A 1MC4A 4EYEA 4HFJA 1LSSA 2Y68A 1ZK3A 3V1YA 3QVTA 1Y8QB 4Q39A 3DBLA 1LDGA 2AG5A 3PDJA 4MVJG 3ZU2A 1GEEA 3OJOA 5EQDA 4YR9A 3IJRA 2C5AA 1UZLA 1YDWA 2JD1A 3I4FA 4EJ6A 3WSVA 4CM8A 4FJ0A 5ILOA 1LDEA 1HKUA 1ENYA 2WYWA 4JLWA 2LDBA 2Z5LA 3FWNA 3ZW8A 2OBNA 3QVXA 4GQAA 4PG6A 5JYDA 4AJIA 4OJNA 1MLDA 1DSSG 3NGXA 5AOVA 4DYDA 4N5NA 4E4YA 3H9GA 2YDXA 4BO9A 4DLLA 1GZ6A 4YXFA 4M54A 2V6FA 1VI2A 2PD4A 4TZKA 5CHEA 2RH4A 4FFOA 4W9NA 3WFIA 3QVOA 2G76A 1DIAA 3S2GA 1I2BA 4GAEA 3EGOA 3NJ8A 4NG5A 3WTBA 4CQLB 1I10A 4XIJA 2E48A 3DTYA 3F9IA 4FSHA 2WD7A 2EJVA 1W0CA 3K6JA 4J1TA 4KOAA 3CE6A 1AXGA 5DBGA 3Q1LA 2EGHA 3QY9A 5A1TA 4DLAA 4BGIA 1XIVA 4RVUA 5AXCA 5IDYA 3VTFA 2C20A 4BNVA 1OFGA 1L7DA 4FFNA 3C1AA 1RPNA 1B7GO 5L4NA 2VT3A 3GFBA 3AM5A 4BNTA 3VTZA 1ENZA 2ZQYA 3IQDB 3QA9A 4XDYA 4AVYA 1IZ0A 2PGDA 2RAFA 1NQAO 4J4HA 2O3UA 2BGMA 2Z1NA 1H0KA 1BXZA 3BMQB 3JCZA 3W8DA 5L7WA 1ZJZA 4IZIA 1HLPA 3E03A 2ZB7A 2HRBA 1CYDA 5CDTA 4YQZA 2GN6A 4FJ2A 2GZ2A 3DTTA 4BNNA 3C7AA 1AXEA 4KUGA 3E9QA 2QW8A 2OOSA 2WDZA 3PHLA 4IGEA 1B3BA 1ZSYA 1DEHA 1E7SA 4PZDA 4B4UA 4CL3A 1DC5A 5BNTA 4J0EA 5KCZA 4MKZA 3STHA 4IDCA 2JCYA 2Q99A 3TFQA 1MFPA 1WLYA 2FZWA 4DBZA 1N7HA 4RORA 2PR2A 3O8QB 3DR3A 5TRTA 2P2SA 4EBFA 2CDBA 5ITWA 3GZ4A 4MVJD 4XZ3A 3PIIA 1IE3A 3B1FA 3ZV5A 4IDGA 4BO7A 3K30A 4YAKA 4CL8A 2DVMA 1ZVMA 3QWAA 4BL5A 4XIYA 3P19A 1SAYA 2RCYA 4TRJA 4H3VA 1LNQA 3S2EA 4E12A 2EKLA 1PJ4A 4P4NA 3IUPA 4KDFA 1VJ1A 3GN1A 2JAPA 5JFOA 2V6MA 1JLLA 3EZLA 4HWKA 1U8FO 4ZVVA 5KVSA 5B1YA 1QV6A 4BKPA 2Q2QA 4RVGA 2DTEA 2OFPA 1EEHA 1T4BA 4CLEA 1ENPA 1A4IA 2W2LA 4D0RA 4WNCA 1QG6A 4P4LA 1P74A 2B5VA 5IZ4A 4Z9XA 1DAOA 3WLEA 1Z7EA 4BQRA 3M1AA 4K1LA 1WNTA 2PK3A 2NACA 3KXDA 5FEUA 3GVHA 2I67A 3KLMX 3PQFA 4AFNA 4I08A 4H15A 1C1DB 2D4AA 4ROSA 5HM8A 4WPGA 3C3XA 1P1HA 4Z0HO 1HE5A 3ENNA 4B4VA 1MV8A 4CQMB 3QQPA 2AEJA 3QWHA 4CMJA 3IS3A 3GHHA 2YV1A 1YB5A 1ZSVA 4CMEA 4FN4A 3ZU5A 3ETEA 1F8FA 4R4JA 3I9OA 2GCGA 3AJRA 3I6QA 4MKXA 3Q0EA 3N74A 4NPCA 1B15A 2NV6A 4Y8VA 3ZWNA 1ARZA 4C7KA 2PA3A 2B4TO 3RFXA 4AJLA 3CIFA 4CM4A 3IC5A 3ZZNA 4WLEA 1KERA 4BKOA 2O4CA 3PQEA 5FWNA 4UVIA 4CPDA 2IZ0A 4GKVA 4JIGA 4CLRB 1SB8A 4KZPA 1QRRA 3WSWA 4CJXA 3G79A 3OA0A 2NU8A 1EVYA 2Q50A 2ZJ1A 3KYCA 1JVSA 1H6CA 2TMDA 3MWDB 5GY7A 2DFVA 3OJ0A 1QYCA 3KEQA 1ZZEA 2NVUA 1DHTA 1U5AA 5BSEA 5IG2A 4BHTA 3AI1A 1IHYA 4ZICA 3GPDG 3MJCA 4OQYA 4CM9A 3IKTA 1M66A 4PLWA 4Y9DA 2Y93A 1F14A 5IN4A 3LK7A 4GWKA 2C7GA 2HKIA 1WDLA 2VRBA 3JQ7B 1KVTA 5TT0A 1X14A 2YW9A 2ZQZA 3VH1A 2C07A 5KKCA 4QSMA 3ZWCA 2VZ0A 3JD2A 4RPHA 4BNXA 4WCFB 1KVQA 1PL7A 1YGYA 2GF2A 1CIVA 4D45A 5DOVA 4PRLA 5T8KC 4OL9A 1HEUA 4CMGA 4LMPA 3ZNPA 3U4DA 1DC6A 1B0AA 4WCFC 3U3XA 1OAAA 1C0PA 3UOGA 1LQUA 4EJMA 1I8TA 1LQTA 3AY6A 4F3YA 3H9JA 5JS6A 2UUPA 3RD5A 3ST7A 2Y1FA 3W4IA 3GZNB 1U8XX 4J4BA 4QT0A 5A9SA 1J0XO 3NGLA 2C5EA 2HU2A 2NLOA 3DMYA 4B3JA 1G6KA 3BMCA 4O1MA 4CM8B 1Y6JA 1ISGA 2JAHA 4JBGA 3KBOA 3TNLA 3UAGA 5KKAA 1GD1O 1VSUA 3DWFA 2EWMA 2WSBA 3GF4A 3JD0A 4R41A 4UVGA 2FHSA 4YT8A 1JAXA 3DZFA 3QVSA 2E82A 2VUTA 4X54A 2O3QA 5B4TA 1DHRA 1PGPA 4PG7A 3VPGA 3GG9A 3EY4A 5JDIA 3UF0A 3ABIA 3KYDA 2EGGA 1EBUA 1U28A 4PGFA 4FB5A 4J6FA 3FNHA 3VOSA 3QE3A 3U9LA 1F17A 3L4BA 3AWDA 4U5QA 4DPMA 1B14A 4D42A 3PEFA 1DRUA 4B8ZA 1V3VA 3OP4A 2BKAA 4W6ZA 3PLRA 4O63O 4W9NC 2JFHA 5TLSA 3SJ7A 5G2OA 1YBAA 4GGOA 4WE3A 5G0SA 2PNFA 1P1IA 4XQCA 3CZMA 4CM7A 2Y1GA 3OECA 2B37A 4YCAA 4OOFA 1LUAA 3JQ6A 1UR5A 3K92A 4R1TA 4PZCA 3PGXA 2NU9A 3OQBA 1YBVA 3QWBA 4FFLA 4AJHA 3HN2A 5JLAA 4DIOA 5ADHA 1G1AA 4RPLA 2WYVA 5LDGA 2QZZA 5ICMA 3RUIA 1VL8A 2E49A 3VH2A 2BI7A 3BMNA 1TVEA 1I36A 3UVEA 3DZIA 3LT4A 2PZLA 1ZCJA 3DB2A 3P7MA 4H7PA 1KEWA 3K73O 3KV3O 4FPXA 2DM6A 1AHIA 1I3KA 3VKUA 1XEAA 1YWGO 3GQVA 4OIMA 2VYND 2W90A 4FD3A 1B3RA 1R66A 3HZZA 4Y6RA 3HNPA 1KY5A 1U2GA 3FR8A 5TGDA 4FJ1A 2B69A 3G17A 1E1MA 3WGOA 4LCEA 1GFSA 3JD3A 4EGFA 4GI2A 4D3SA 4JROA 2Q49A 3ZI0A 1EE2A 4DQVA 2X0IA 1X15A 1YJQA 2C2YA 1X7GA 1UXHA 3LSYA 4PRKA 3RUFA 5B12A 3WYBA 3ZWXA 1GCOA 5JSFA 2IXBA 3RC9A 2BFPA 4P38A 5KNLA 5JC1A 3DAGA 5TQVA 1LDYA 4ZQHA 4D3FA 5B4UA 4XYGA 1I32A 1Z73A 4J7UA 4UVEA 1NR1A 2VZ8A 1V9LA 3KO8A 2PD3A 1WMBA 3FCOA 4FS3A 1GYQA 4GSLA 5KJ6A 4XB2A 5KJEA 3RC2A 3VDQA 5A9TA 3GN2A 3RU9A 4JCOA 3ZHXA 5JW6A 3AUTA 3L6OO 4JNKA 2H1SA 2G0TA 4JJGA 2BFOA 3LYLA 3JQ8B 3GUYA 3UCXA 5F5LA 1V8BA 3U0BA 1YL6A 2WE7A 2ZTLA 1Y8QA 3TZKA 4AL4A 3MJSA 4IDBA 4QFDA 3GEGA 5DF1A 3RWBA 4AICA 4YRBA 4BMVA 3ZV6A 4FGSA 2GYYA 3EHEA 1Y9AA 3C85A 3GK3A 3V1UA 3VVBA 3WYCA 2Y05A 4I1IA 1P1RA 2PY6A 4EZBA 1ADCA 1F0YA 1ZK0A 3GY0A 2DBVO 4IJUA 4R5HA 3RFVA 1PL6A 4QTZA 2XF8A 3P5SA 4U7WA 4BVAA 3I9NA 4I9HA 4OMUA 1GQYA 2CVQA 4EI2A 4TROA 3E8XA 1JA9A 3AY3A 1A9ZA 1SMKA 3A06A 4NBRA 4RQUA 3GEDA 1XGKA 2FR8A 3HDJA 4RPGA 3WGZA 5JO0A 2ZB3A 4GX2A 1E3WA 4MP6A 2UAGA 3DONA 1ZO8A 4UVDA 1KVSA 3ORFA 5JCJA 1GDHA 4UEKA 3CXRA 4A0SA 1EDZA 1X0XA 3ITDA 1ONNA 1XLTA 1PU2A 4CMEC 1PZEA 1FDWA 1HWYA 4R1UA 2IZZA 3D4NA 4BV8A 1XU9A 3D7LA 1DIHA 4CM5A 4R68A 1N9GB 4WGGA 5DOZA 4CR8A 2GO1A 2DUUA 4HP8A 4IZHA 1NHWA 3ZWWA 9LDBA 5C7IO 4NJOA 1GZ3A 1U4OA 4RVDA 2FPPA 2O3JA 2AE2A 1YOVB 1U3UA 5U9CA 2YQ5A 2H9IA 2BFAA 2WEKA 3ZWOA 3W1VA 2QQ5A 4R51A 4XRRA 1YDEA 2J6IA 4J0FA 4FC6A 4YA6A 5I8ZA 3VC7A 5CEEA 1OC2A 1EDOA 1PQPA 4J90A 1K5HA 4OYRA 1IPEA 5BQFA 1Q7GA 4CLXA 3AM4A 3E9NA 1SCUA 1T2AA 2ILTA 3SEFA 3NV9A 3EAGA 3ZDFA 5IXYA 1CQIA 3SVTA 1I30A 1ML3A 2AE1A 4XR4A 4E2XA 3F5SA 1PIWA 1Q0LA 3L77A 1GQ2A 3GMSA 3JQAB 5A04A 1ZIDA 4GPD1 3I3OA 2CVOA 3AOGA 3FTNA 4XYEA 2WM3A 3O8QA 2VZ9A 3OEYA 3INTA 1NHGA 4L73A 2DFDA 4NU6A 1CQJA 1XWFA 4U6QA 1ZBQA 3UW3A 1YBMA 3RJ5A 2AQKA 2J5QA 1X1EA 5LC1A 2FSVA 2NQ8A 2PWZA 1J49A 3Q9NA 4Z0PA 1U3TA 4A03A 3DMTA 4MKRA 4OSPA 5JPIA 1NPYA 3GVXA 4EUFA 4NNJA 2Y1EA 1AGNA 2PGLA 1LRLA 1RM3A 4RGBA 2BH9A 3RBVA 3UN1A 5JC8A 4QX6A 1UXGA 5DULA 1N5DA 3GRPA 2V6BA 2Q1WA 2BGLA 1L1FA 3H5AA 1C0IA 2Y0DA 3LQFA 4YDRA 1IOLA 1GCUA 1ADGA 5IN5A 5JDIC 3ZNQA 1EFLA 2D2IA 1XQ1A 2UVDA 2CF5A 1PGOA 3NT5A 1HSZA 3SBOA 2GD1O 4NR0A 2P4HX 4IMPA 1C1DA 5GMOA 3I9JA 3C24A 4QECA 3RC7A 4CQMA 2A9FA 2Y1DA 4TKLA 3QLJA 4EW6A 2X22A 3KSUA 5IAAA 2Q46A 3D4OA 4EDFA 4BNJA 3R3SA 1EVJA 3BMNB 9LDTA 4AJNA 3OEWA 1LRKA 3BZUA 4PN3A 4PLYA 2O2SA 4DPKA 2C82A 1PSDA 3I5MA 3RU7A 1E7WA 4UUMA 3RSHA 4E32A 5IDXA 5H82A 2CFCA 4N5MA 2AEFA 4AJJA 4NQZA 4F46A 2NTJA 1GR0A 3P2YA 1X13A 3PQDA 4DA9A 3ETDA 3O4RA 1DIGA 4EJ0A 4CLRA 2EIHA 1TT5B 5A05A 2UV8A 2C54A 2DLDA 3OHSX 4DIBA 2D0IA 4FCCA 4J1QA 4F6CA 3GDGA 1YL7A 3SJUA 1D1SA 3S2FA 4HX5A 3F47A 8ADHA 1GV1A 5T57A 1NQ5A 3I23A 3VPXA 3LC7O 3S55A 1NXQA 5A5FA 2QYSA 1A7KA 2JD2A 1D7OA 2X7HA 3UCEA 2W2LD 1WW8A 3S1LA 4XB1A 3IOYA 1T24A 3RIHA 3Q6IA 2IYPA 4DRYA 5CG1A 5GZ3A 1XSEA 5F1OA 3JQ7A 3BHIA 4RJTA 4YJHB 1X7HA 5T8KA 1PJCA 4FDAA 1ONOA 2JCXA 1EK6A 5L4SA 2X6TA 3INGA 4Z0TA 5A3VA 1PTJA 4J2HA 1BMDA 2X9GA 4WCFA 1T4DA 3VPFA 3G1UA 1BTOA 3S2IA 1ZMOA 4E13A 4RF2A 4U6SA 2HJSA 1JW9B 3BTSA 1PJSA 1OC4A 2YY7A 3RASA 3WWYA 1DIRA 3BIOA 4BKUA 4M8SA 1SEVA 3MJTA 3OJFA 2WTBA 2X4GA 4Y6SA 2PTGA 4A10A 1LDMA 3CEAA 3GUCA 3GVIA 4NBWA 4YQYA 3TZCA 5EMHA 5KJ1A 1CRWG 1U4SA 3GZNA 3VPHA 2Q2VA 3V1TC 5C3MA 2DBZA 3KM0A 3AFNA 5J23A 2WD8A 3EZYA 1FXSA 3KVOA 3OF2A 2YJZA 3ZHBA 4NJMB 1X0VA 4QO8A 3JQGB 1O9BA 1EUDA 1BHSA 2P68A 3WJAA 1UZMA 1PGJA 1NTOA 3TF5A 1HYEA 1DLJA 1D4FA 1T2CA 3MEQA 3KOUA 2I66A 4B4WA 1F06A 2DBRA 4K9DA 1CJCA 3E6AA 4DUPA 3VZPA 1EK5A 1VLLA 3F46A 1LC0A 2B4QA 1E3WB 3JQEA 4JX8A 3TJRA 1LLUA 2Y99A 4B4OA 2AQHA 2NU7A 5U4QA 1A5ZA 5A06A 4OKNA 2X5KO 4ZN6A 3OIDA 1QLJA 4PCVA 1HE3A 3PXXA 3VZQA 4XRGA 1W6UA 1UDCA 5TSDA 4F6LA 3OQ1A 3D1LA 4LK3A 3B6ZA 3BTVA 5L40A 3LC2O 4AG3A 4KTVE 1ISHA 2QRKA 4ZQBA 3TL2A 3WFJA 1C0LA 1GZ4A 1LLDA 4CM1A 2I99A 3ENKA 4NI5A 4UEJA 1E1NA 1NASA 2CUKA 1P44A 5CEJA 2D59A 1HRDA 3X2FA 3DBHB 2DU8A 1GYPA 1SC6A 3W8FA 4L75A 3FSRA 3GLQA 3OH8A 4GX5A 2HSDA 2G82A 1IUKA 3NYWA 1OZAA 1FDUA 3FF4A 3UGKA 5LDHA 2EP5A 3IMFA 1RYDA 3FWZA 1M6WA 2X0NA 3CH6A 4INAA 1BVUA 5H81A 1D1TA 5G0UA 4NDNE 5LCXA 3ITKA 1IZ9A 2X58A 1DJNA 4FQ8A 4K6FA 2X5JO 4LW8A 2YDYA 3IAHA 1V3TA 3H9UA 1MA0A 3DZKA 1MB4A 4XR9A 1PX0A 5HA5A 4J4TA 5JO9A 3ICPA 2NM0A 4U0KA 1VC2A 1YQXA 1QP8A 3PTZA 1R0KA 4IJKA 4I9NA 5L7YA 3GC6A 4YJFA 3AOEC 3T4XA 2CMDA 4J1SA 4EUHA 3BHJA 1H2BA 2HJRA 1ZH8A 3PRJA 2QG4A 4P22A 4M49A 4OXKA 2HK7A 5A5EA 5I7SA 4PZEA 3PJDA 3A9WA 3EC7A 2HMUA 3FPLA 4WCDA 1V6AA 1C1XA 4D3DA 2OORA 5HWSA 1XA0A 4BV9A 4OGWA 1XHLA 2Q2WA 2B36A 2ZTMA 2HAEA 3TRIA 4FR5A 1GYRA 2ET6A 5F3RA 1Z74A 3DMTC 2XOXA 1QKIA 3JQ8A 1CF2O 4CLDA 4DVJA 4CR6A 3KYBA 4W7IA 4J2OA 4NFYA 3QP9A 3QV1A 3K9QO 4LRSB 3WYEA 2NTVA 2HUNA 3PIDA 3COSA 1FK8A 1S6YA 1YB4A 1WP4A 4LN1A 5DBFA 3FNGA 3KRTA 4Z3DA 4CR7A 1R15A 3LT1A 1QR6A 4DMMA 4M87A 3UXYA 4YEDA 1NM5A 3WDSA 4CMIB 1B2LA 2IODA 1DLIA 4LSWA 1M67A 3FPCA 1U3WA 4OH1A 1M2WA 1P1KA 2R6JA 3CUKA 4YWJA 1SZJG 5L3ZA 4BUCA 2RBEA 1RWBA 3FN4A 3M1LA 3PHHA 3W6ZA 4JJIA 4HADA 1GL3A 4TZTA 3L9XA 5K9ZA 1HYHA 3PDUA 1GUZA 2HK8A 3DL2A 2DTXA 3IUSA 2C0CA 2PZKA 2ZTVA 4GGPA 3RUAA 4HFNA 4HUJA 4LISA 5EPOA 2CVZA 3SX2A 1TXGA 3K2BA 5ER6A 2BLLA 5C37A 5F21A 1MFZA 2Q1SA 2VYVD 1ZXLA 3PHIA 5T67A 1N9GA 4GX1A 2IE0A 2JL1A 4WUVA 5JMWA 1H6AA 3PPIA 3T7EA 3GGGA 3EK2A 4JK3A 3L0DA 4YAJA 1E3EA 3Q3CA 2VNAA 3PYLA 1YOVA 2G17A 5EINA 1VKNA 1EUCA 1DFGA 2EXXA 1CEQA 3QJ5A 1XYGA 3RFTA 1T1SA 3OIGA 4II3A 3JYLA 3OSUA 5F5NA 1P0CA 1DRWA 3FHLA 3NDJA 4DREA 3W6UA 2HDHA 1PL8A 2RIRA 1D3AA 1MC5A 5BNIA 3HWRA 3ICCA 2O48X 4J9VA 1MXHA 2ZYGA 1Z6ZA 1J5PA 1BW9B 3NAQA 1I24A 5G4KB 1T2EA 3H6KA 4WNIA 4CUZA 5IFLA 3OFSA 5EIOA 3ZN2A 3DDNA 1JDJA 3JQAA 5ENDA 1A27A 3SLGA 1YONA 2FPIA 2X1HA 4LVUA 3B70A 5JCJD 2O23A 4B7XA 3W8EA 3TZHA 4YAGA 4BO5A 2P4QA 2NADA 3WGTA 1LLQA 1UAYA 3E9MA 2EERA 4RLSA 3NRCA 4ZHSA 3GDOA 4WECA 2FPGA 3H2SA 3X2EA 4L8VA 4RCVA 4QXMA 1H5QA 3WQRA 4OAQA 4K26A 3RKUA 4GH5A 3GG2A 4YAEA 4RV9A 4UULA 3GAZA 4XYBA 1NPDA 1R4NA 2I65A 4GVLA 2J3KA 2W98A 2GZ1A 4QO7A 4XWYA 4OO3A 3RBZA 1E3LA 1RYEA 1B26A 3HG7A 4NH4A 3QW2A 4BNIA 1DDOA 1IULA 1NVTA 4ZD6A 5H83A 3ZH2A 1VM6A 4CUKA 2Y1CA 4XGNA 1BVRA 3H5RA 5CAEA 2EW2A 1BSVA 3N7UA 5DCYA 4BKQA 5ILGA 2PH5A 3NX4A 4BO8A 4CMCA 4PLZA 3WMXA 1EUZA 2PH3A 1WWKA 4GSKA 3ADPA 2QRJA 3HHPA 4A2CA 2J5RA 1DXYA 1HT0A 4R1NA 4YTEA 3RBXA 2I76A 3I83A 2Q4EA 3H2ZA 3ANLA 4PG5A 2CY0A 3SC6A 2CF6A 4MOWA 3JYPA 4MIYA 2GASA 2GZ3A 1SOVA 2WJPA 3PP8A 4Q3AA 1PJ3A 4JGBA 4YJGA 1HDZA 5L9AA 5KJCA 3DZJA 5DP2A 1PJBA 1W8DA 4XQGA 4ZQFA 5L4LA 1YS4A 1BDBA 3MTGA 2O7QA 1RKXA 5DBIA 4B3HA 4WLFA 1HDGO 2VHYA 4BO0A 3DFUA 2WMDA 1TT5A 5L51A 3CMCO 2JFGA 1ZK1A 4XYMA 4QEDA 2GERA 3OMLA 3VH3A 2PD6A 1U7TA 1C14A 2B4RO 3ONFA 3Q9UA 3WWZA 3ROMA 3I4CA 2J5KA 1MP0A 4IINA 4NK4A 2CD9A 2VUUA 1VKOA 4YJFB 1ZSNA 1O6ZA 1C3VA 1ENOA 3EYWA 3I52A 4DXHA 1LSJA 3HDYA 4ESOA 2J8ZA 3GDFA 2QIOA 5CDSA 4BOYA 3ULKA 4YJHA 4AJ2A 1C1XB 5AYVA 4D44A 1H6DA 1NAIA 1UJMA 2YZ7A 5ES3A 1A9YA 2VCYA 1I33A 1QYDA 3U62A 2JCVA 3HE3A 3V2GA 2A92A 2QRLA 4L4RA 2PZMA 1O95A 2V6GA 3BA1A 3GH3A 2G5CA 4CQMD 1Q1NA 5JDCA 1U3VA 5I7VA 1KVUA 5JY6A 1FF9A 4CLOA 3WIDA 2FN7A 2VWGA 1DIBA 1K6XA 3T7CA 1J6UA 1PR9A 1W4ZA 4HV4A 1U9JA 4TRMA 1RM0A 1NFQA 5FYDA 2EP7A 3JQDA 2D5CA 4F45A 3L6DA 3M6IA 3PJGA 1U5CA 4TMFA 4NJMA 4ALLA 1LLCA 3WNVA 4TQGA 3JQGA 1LSOA 4IGFA 1E3SA 1NQTA 1T25A 3VVCA 3HB4X 4RVFA 3G49A 1PR3A 5KVQA 1KC1A 2GN9A 1R4MB 1QYVA 2GSDA 4MP8A 4O5OA 2Q1UA 1PJTA 1T26A 3AFMA 1KETA 3CKYA 1PS8A 5IJZA 3K31A 2VRCA 4ZRNA 1XCBA 3WTCA 5C7OO 1RM5A 2AG8A 2NTNA 4UUPA 1K89A 3PWZA 2Y0EA 3NJ4A 4WLUA 2B83A 3I1JA 1DC3A 1GUFA 1E5QA 4IQGA 1E6EA 2C2XA 3FNEA 5AXDA 1R37A 4OM8A 1WDKA 2VWHA 3MOIA 3DHYA 5L7TA 5MDHA 1WMAA 3ZHYA 3LDHA 3WXBA 4FGWA 3CINA 5COQA 1AUPA 1O0SA 2P9GA 3I9KA 3RCBA 4CODB 5G0WA 1K6JA 4PLTA 3WJ7A 2Y1OA 1TT7A 3NTOA 5AXAA 2VHXA 2WYUA 3ROPA 2BI8A 3LU1A 1KBZA 1E6UA 1Y81A 5DZSA 5FI3A 4CMKA 2ZIZA 5JY1A 3WGHA 2HMTA 4R1SA 3DBHA 3QWIA 4W82A 4RZIA 4EUEA 3FBGA 4E3ZA 3CZRA 1SNYA 3JQCA 1WZEA 3LC1O 4GLLA 1H93A 2I9PA 4KDEA 1BRMA 5A9RA 3BMOB 4E5YA 1NAHA 4Q3CA 3ROQA 1U7HA 1PS0A 1HL3A 4BS9A 4DTIA 3F5QA 1HYGA 1I3NA 3DOOA 3GNSA 4GX0A 4CUJA 3VHRA 5TT1A 3B20A 3TPCA 1ISMA 2H63A 2Q3EA 3F1KA 1XQ6A 4L9RA 3W4JA 3JQBA 2GRAA 3JD1A 1P31A 3K2EA 5AQ1A 3AOEA 3U49A 5FI5A 3TOXA 1IPFA 4IQ0A 2AXQA 4MVJH 4Y67A 2ZK7A 4BNHA 1P3DA 1DOHA 1YQDA 4BNKA 4L76A 1LDBA 1MX3A 4MIEA 1E92A 3DFZA 5JYEA 2HCTA 4LCJA 4DQUA 1HZJA 2DUWA 5ICSA 3W4KA 3ASUA 5IZCC 1XELA 1OI7A 1GAEO 4WASA 1I0ZA 4IDFA 3L9WA 2F00A 2Y66A 5KIAA 5A3JA 4AJ4A 1O5IA 1Y5RA 3WGQA 3VDRA 4TSKA 5JAIA 2OUIA 1DPGA 2JFFA 1HETA 1JKJA 3DBRB 1M75A 1JVBA 4WLVA 3MOGA 2XAAA 4IM7A 3WMWA 7MDHA 1NNUA 1SEPA 3DC2A 3WNQA 5JXWA 3ZWVA 4KTTE 3JYNA 3MCVA 1R4NB 4ZJUA 3H3FA 4WOKA 5BNFA 4D0SA 1NVGA 2BMAA 3E48A 4KUEA 1GQQA 4PG8A 2X86A 3ZGYA 2O3SA 4L4XA 4R3WA 4RF4A 4E2YA 4BQPA 1VSVA 2I5PO 2GUGA 3GGPA 4BNLA 1NX6A 4YT2A 1Y8RB 1LX6A 3PYMA 3C1OA 4MVJM 4R54A 5F1KA 3S8MA 2BGKA 4Q3NA 1LU9A 2D8AA 1DAPA 4PLCA 1DFHA 1LDNA 4ND3A 1IYZA 2A35A 1JKIA 4CMIA 2YHIB 3D3WA 1Q7BA 3MJEA 5CPBA 2P5YA 1PQUA 4B3IA 1E7QA 1O8CA 4NBTA 4GL4A 1P9LA 4DL9A 4E5KA 2VTDA 3OJEA 4YVFA 3LVFO 1H6BA 4IMRA 1PZFA 3NT2A 2C29D 3WQSB 2DKNA 1M6HA 1UDAA 1UP4A 1EBFA 4R16A 2VNSA 1NFFA 4TWRA 4YJGB 5COBA 1IB6A 4E30A 3ONDA 1UUFA 4L74A 4BNFA 3I9MA 2E4AA 4D41A 1DB3A 1E7RA 1XR3A 3GFGA 3GVPA 4KP7A 2I3GA 4DYVA 1HZZA 4D46A 2OZPA 2O4UX 3KSZO 1ISFA 2PKRA 2NVWA 3CPSA 4OXNA 4NK5A 4M86A 4NU5A 4HBGA 2O2YA 3N58A 3PFWO 4DC1A 4BO6A 3IP1A 3BHMA 3U4HA 1ZMTA 4RVHA 2RHRA 3NEPX 2EEZA 3HDQA 4FFPA 1KC3A 4ITUA 5HBRA 2Y0CA 3G3EA 4E2WA 3O26A 4ZGWA 1YO6A 2VHWA 1TA4A 4XJSA 3U4CA 3ETGA 3TWOA 3D64A 3KETA 3OA2A 3ASVA 1ZUD1 3NDRA 5TJHA 1R12A 3QWFA 4BO2A 3AI2A 1WXDA 5CDUA 3GEMA 4TRRA 3AM3A 2HRZA 4MVJE 5ITVA 4PLGA 5MGBA 1UXIA 4RDIA 3JQFC 5G0VA 1BW9A 5G4KA 1YH3A 3RUEA 4PLPA 4EEXA 4CLOB 2DQ4A 2PFGA 1RM4A 3QHAA 2EKPA 2JD0A 2NSDA 1NYTA 3R6DA 4H16A 4W7HA 2B35A 3GA0A 3FD8A 3PLNA 2P9EA 4RDHA 5JDCC 4E0BA 3RI3A 5COAA 1QV7A 4XKJA 4A5OA 1WPQA 2RHCA 3T4EA 2AHRA 1LI4A 2B0JA 3NT4A 3H9QA 4JQCA 3F4BA 1YB1A 3PHGA 4RVSA 5DCWA 1LJ8A 5KTKA 4AJOA 3U09A 4XA8A 2I6TA 1BXGA 1HDOA 1YQGA 4GBJA 4PVCA 1Y7TA 3EMKA 5JMPA 4G2NA 4MPDA 2B5WA 4Z3KA 2OMEA 4MO2A 2TMGA 3AUSA 3MTJA 4IXTA 3RUCA 4WJZA 2NUAA 3SC4A 4R9RA 4XCVA 3WX0A 3QIVA 3ADOA 3RKRA 4URFA 4E31A 1F8GA 3CSDA 4J9UE 4OKIA 4WEOA 4XD2A 3F3SA 2PGJA 1H94A 4Z9FA 3I9LA 4CM9D 2X0JA 4E5MA 5A03A 4OSOA 3V5NA 3V2HA 2CDCA 7ADHA 3B1JA 1LXCA 1Q0HA 5U1PA 3PVZA 1MG0A 3GOHA 4CV0A 1HDCA 2EF1A 2X9NA 4ZRMA 5KJFA 4E6PA 1BG6A 2V65A 5DN9A 4HXYA 1KEVA 3M2PA 5L95A 2X0RA 3Q11A 4GMGA 1PZHA 4CLHA 5THKA 4ND5A 5CPFA 5FFFA 3D5TA 1JAYA 2UUOA 2YHUA 2EJWA 3GHYA 4I8XA 1HSOA 2IDZA 2JHGA 3JQAD 3E5RA 5CFZA 3K5PA 3NKLA 3L4SO 4BNMA 1I5RA 4ZU3A 4YPOA 4WK6A 3ZWAA 4GWGA 1HTBA 4UUOA 4YT4A 3RQSA 3H9EO 1T1RA 3PWKA 1HDYA 1IHXA 2OXIA 5HTOA 1O94A 1GPJA 1SPXA 1Q2XA 3PJFA 2CNBA 4J43A 4IS3A 2BELA 4K6CA 4YRDA 1R6DA 3GT0A 4ALNA 1E0DA 2GR9A 1E3IA 2W2KB 2YFHA 1ZJYA 1P0FA 4NZ9A 5CDGA 2VUSA 1Y5MA 5TS3A 3HADA 4GLOA 1N8KA 4CM6A 3DZGA 1YRLA 5GZ1A 2ZB4A 1UDBA 1QYXA 3M2TA 5TIIA 1V35A 3JQBC 3C1TA 4ILKA 4LVCA 3FRJA 2J3JA 4BNWA 3LZ6A 2AQ8A 5TF4A 3DEYX 3O9ZA 3PK0A 4NIMA 5G0TA 3PFFA 1KY4A 1DO8A 2YV2A 3INRA 1P45A 2IEDA 1L7EA 1HDRA 4HNGA 4MVJF 4O6VA 5JAZA 4AJKA 2X5OA 1EQ2A 3ZNOA 5EESA 3DO5A 4K28A 1GU7A 1PEDA 1E1KA 4G65A 1JQBA 4O0LA 3V2UA 3IIEA 3AW9A 5CDYA 1TB4A 4A73A 2HK9A 3TZ6A 3DOJA 4BNZA 5BSHA 3DZHA 1LBEA 1GPDG 1KEPA 3MWEB 4KWIA 3E5MA 1V0JA 3EUWA 3UFXA 4UEOA 3WGIA 4DC0A 2W8ZA 1H9BA 2FSSA 1P1JA 2VWQA 2X8LA 1I2ZA 1AHHA 3PZRA 3Q2IA 2E6UX 5DNAA 1PS9A 1UAGA 1NP3A 5ER9A 5T64A 4C4OA 4TVOA 1LEHA 3WIEA 1YL5A 4EEZA 5CG2A 1HXHA 2Z95A 1UXKA 3F4LA 1YE3A 1ZK4A 5T6BA 1N7GA 2GN8A 2D5AA 2EV9A 3OM9A 1X1TA 2VHVA 3KLPX 3C8MA 4YYZA 1K6IA 1IY8A 3D3WB 3DBVO 2DPHA 5KVVA 2P9CA 1R4MA 2POQX 4TVBA 1PGNA 2HMVA 3ZU3A 2HO5A 5I9NA 4GKBA 4UAGA 3LT2A 4LRTB 4FFRA 3QRWA 2OHXA 3DHNA 2DC1A 3GAFA 3FBTA 4DPLA 3WBFA 3ROKA 3AUUA 1NR7A 1V3UA 5HS6A 1GTMA 1Y9EA 2E37A 4IDAA 2Q1TA 2YYYA 5EQFA 4YAIA 1E5LA 3V8BA 3RVDA 2ZJ0A 4LSMA 4N18A 4J3FA 3G1TA 4MDHA 5TC4A 2OBYA 4FBGA 1VL6A 2FRDA 2HMSA 1PZGA 1UP6A 1QORA 4PG4A 3BTOA 5I9MA 1QSGA 3UH1A 2FOIA 4BMNA 1K0UA 1UP7A 4Y6PA 3OBBA 2WWRA 3ONEA 4R3NA 4XGIA 3WLFA 3KZVA 5THQA 1GADO 1XKQA 3TDKA 1SB9A 3UICA 1QYWA 1WAMA 3JYQA 1FDSA 5CEFA 4BGVA 4BGUA 3MZ0A 3U5TA 3BMOA 4KQWA 3IKVA 4A7PA 4Q9NA
chains in the Genus database with same CATH superfamily
3ZKWB 2M32A 4RYDA 4XD7D 4RK0A 2J3IA 4UBMA 2SCUB 1FRZA 1QWOA 4IDOA 2VKQA 1V1RB 4AWXA 2VNIA 1KAEA 1L9XA 2LXNA 1LKZA 2XXJA 3BORA 4ID9A 4J7XA 3FI0A 4KXFB 2WKPA 1N4DA 2KPOA 4P35A 3WQQA 1UINA 3PUWA 4YGYA 3IDSA 1QXSA 2HIHA 3O5AA 5E6SA 1C7FA 1N1GA 5BUQA 5CYGA 3F90A 4KRGA 1UWCA 4M0DA 1R0XA 4KC0A 4PIPA 1J25A 1OOEA 2AZXA 1B73A 4M9UA 1ZK2A 2VTVA 5KYUA 4EMUA 2OAQ1 2X1MA 4GE3A 3KDSE 3ZHZA 5DI3B 1F20A 4F4HA 2FPLA 5ALRA 2AJBA 5IT5A 1D2HA 1NBMA 3I34X 3MIZA 1VFPA 4KE7A 1PSZA 3CWZA 4IUYA 1I2CA 1TC2A 2XIQA 2ZIVB 3KWJA 2GARA 5LL6P 3VTAA 2H08A 2ZATA 1ZOOA 1V71A 3VR6D 1E2EA 4DCSA 1LK7A 4HAZA 3K9HA 1YT5A 4JL8A 2AXNA 2Z3ZA 2E1RA 4OCZA 3DBLB 4IOLA 4PYIA 2JKVA 3O7WA 3C7CB 2BFFB 4PZYA 4UBIA 4RMIA 3RC3A 4E21A 2ZDGA 1CUJA 1V8ZA 2FPXA 3VQTA 2FRVA 1UFOA 2BFCA 4PFSA 1AD2A 4G1VA 3WB9A 4DLRA 3FA2A 4TKZA 4B3DA 2B25A 1FDTA 3HY4A 3L0ZA 3M6VA 5D7BA 5EZSA 2IBTA 4QODA 5K1ZA 3BE6A 3DVAA 2AH5A 1KZ4A 3K9CA 1N6LA 1CWUA 1KA9H 4JT9A 2DHCA 1YQEA 1PGQA 1E9AA 1R6TA 3FUVA 4REQA 3HBNA 1W36B 1Y8RA 3TGPA 5KTRA 2JVKA 4DWJA 5EP1A 1ABEA 4BFZA 1ZJWA 4J1NA 4UATA 4UM7A 2JHFA 3G2IA 4B3BA 2QDXA 1FX0B 5LOVA 2HGZA 4D9HA 1CETA 3VMMA 1W36C 5I4IA 2WG1A 4HH1A 3WYAA 2A5DA 2HM7A 1RI5A 4IZ6A 5EP4A 1FJHA 1HUQA 1SQGA 4PO8A 1NY5A 3H5WA 3PNOA 1THMA 2BGUA 2E0IA 5FO0A 4ZDWA 4BMXA 3IAM1 2EQAA 3NO4A 2PZ8A 2P2NA 1PJ2A 3WE7A 4KWHA 3TQHA 3VYWA 2Z6QA 5GV8A 1ULSA 1YS2X 2QLLA 2W6JD 2YS7A 3KUDA 4J03A 3IUJA 1ULUA 1P7ZA 2HA4A 3BWMA 1HQDA 3IA7A 3X1DA 3GRAA 3HBMA 3BT7A 4XPZA 1LSUA 4JMLA 1OI3A 1WB4A 2Y71A 5IM4F 1T43A 1DTWB 3ZWQA 3PGVA 4EG0A 4R8LA 4G97A 2DFLA 4IMJB 4YB8A 3BB3A 1C4OA 2BEWB 1E7MA 2GNAA 1GZDA 4MQ6A 5DGDA 2E5FA 4C4TA 3JQ9A 1IOWA 2ODQA 5K8JB 3MELA 1ISJA 2VSFA 3FB4A 3QF4B 1SBYA 2A1UB 3QKWA 4TS1A 2HBQA 3V3TA 4UEQA 1O94C 5IDWA 3GMIA 4F8JA 5C8XA 2OAEA 3HWX1 1RQGA 1L5HB 1T6NA 2ZIAA 4WMLA 3TL3A 1WCXA 1JKFA 4HOYA 1C80A 4Q3KA 4EKNB 1VE1A 2WIKA 1OGYA 5C7LO 2PA0A 4EKYA 4IXMA 1EAMA 2Q9BA 3GROA 4AUMA 1JT2A 1JHYA 2PKEA 4MYTA 5DBOA 2PKQP 4IX1A 4E2FA 1G5FA 5IDQA 4O2BB 2C4TA 1EX1A 1OWMA 2ID8A 2Q2OA 1CUSA 4FNGA 4KMOA 4TMYA 4TTRA 1Z0SA 4AKTA 4DW8A 3AVTA 3CUTA 5HNKA 5BW5A 3U40A 2HDNB 4F9EA 2IIQA 2ABWA 3PNMA 4W5QA 2WIFA 3UJCA 1BMTA 3A26A 1C0KA 3L8CA 3OZWA 4M1EA 4BIIA 4EA6A 5BWLA 2K7ZA 1OLXB 5E6RB 3MRTA 4QGGA 2XUFA 4Y2XA 3ZY3A 3IX7A 4XOIA 3WKAA 3LS2A 3AR5A 3HSKA 3CLSC 3DNMA 5THXA 5JE8A 4I5DA 1CUDA 2BR4A 2CC2A 1ZNWA 4ZQEA 1ZM4A 2L18A 4C30A 3ZJYA 3L07A 3RVPA 3U7QB 3ZLUA 4MJLA 4QTXA 1GT6A 4YACA 3NHRA 5BMVA 1U3GA 3M0EA 4MLCA 1G8PA 3PXUA 1NDHA 4IDDA 3RR2A 3SX0A 1E96A 2HJ9A 2YN2A 3SMQA 4BZWA 4D79A 3AESA 4KVGA 3UMVA 4QE3A 4MIOA 1KJ8A 1E4OA 1Z38A 3OQVA 3WLLA 1Z88A 3CPEA 1TNDA 2I55A 1UMDA 3WAKA 5I7FA 2J3MA 2C9BA 4C20A 1PWEA 1TK3A 2A1IA 4HVLA 4XEHA 3UCFA 4MV9A 1HE2A 3MYRA 2ZYHA 4G2TA 1QHSA 2Q4TA 1EVIA 1JLLB 2P6PA 2ZS9A 2OCIA 4FCTA 4S3MA 4XGRA 4MINA 4XJVA 4FI3C 3GP3A 3ZWMA 4DR5B 3KT6A 3DA8A 3TZQA 2G88A 1EFCA 2IOYA 2YINC 4EG4A 3G0OA 1XDWA 4E4TA 4MA5A 1LWOA 3Q5DA 4UUNA 3SKVA 3JXEA 4C4XA 2G0AA 1T8TA 4L5JA 3UG7A 3TNJA 1XVLA 3VPSA 3GLIB 1YI8A 1XI2A 4NYMQ 1XZNA 3DVRX 2DPGA 2XD9A 3TPZA 2XVYA 4JP2A 4FOOA 5M5BA 1YR3A 2OSVA 3AIKA 1G21E 1L1EA 2I2XB 1JU9A 4M2LA 2B8WA 4L5BA 4EDHA 1II0A 4KACA 1T9KA 2G5GX 2PGXA 4BB6A 4YHBA 1A4UA 1YR1A 4WZBB 3LWZA 4JBHA 4UTOA 1CY2A 1RXCA 1G20E 2RAVA 3BTUA 2AX3A 2O3TA 1SK8A 2HJVA 4XVRA 5EFZA 2ZE6A 4RPKA 1Z15A 2UKDA 4GLFA 2QX7A 3KWMA 4X9XA 3ANNA 1CUBA 4F5WA 1E8MA 4YJDA 5C0OE 3C3KA 3O94A 1HURA 4HEHA 4KR6A 2IWHA 1NFRA 4AT1A 1OJLA 1XTPA 3ILXA 1VZ2A 3AXTA 4OF4A 4OH7A 8LDHA 1ZL0A 4ZTUB 4KE8A 2IXTA 4YRAA 4UARA 3AUKA 1YXMA 1Z5VA 4J0IA 1V95A 3ZTTA 4HZUA 3VAAA 4EMBA 4PNEA 1QFSA 4M89A 3VNBA 4DJTA 4HB2A 3ZLJA 3RF6A 4EHIA 3CUYA 3U7HB 3KXPA 1Z25A 3C8ZA 3OCWA 3MS4A 3L0CA 3UMGA 1Q7RA 1M2HA 3LO5A 3W2FA 2UXBB 4DWVA 2EW8A 3B1YA 1EE9A 2FWMX 1TLFA 4U7TB 4BNUA 1VKRA 2WE8A 1AUVA 3OZFA 421PA 4BO1A 4CKEB 3BGVA 2FSFA 4S2EA 5FR2A 3DLIA 2G3YA 2RGNC 5TJ9A 4RAQA 2Q3FA 1SK9A 2O2HA 1T1JA 3U39A 2R0QC 1PVVA 2XEDA 1VJ0A 3MILA 4E46A 4C4ZA 1W0KA 1QMGA 4KW7A 2YRWA 5ALMA 3O90A 4D7AA 1GV0A 4DVGA 2FMHA 2MT9A 1ATIA 2II6A 1Q19A 1RWNA 3TQCA 2ZROA 2NVUB 1BDIA 3TQRA 1HNWB 1U0JA 3K6SA 2GWRA 5ANRB 4LJ4A 5A6VA 4Y9UA 5JH7F 2B2NA 1OJ7A 1V8PA 2XSZA 5DLEA 4EJSB 4OHUA 1VMEA 3EQZA 4U2KA 1CB0A 3EVNA 3SHOA 4MPJA 5F4ZA 4B8WA 1VJTA 5GZ6A 5LMUB 1KJIA 4HFRA 3VU9B 4CEHB 1VPDA 2IPNA 3BE4A 3GJ5A 4CFSA 3DFFA 3A28A 4YBZA 4TT3A 2PUDA 4B0OA 4C2TA 4EJSC 1NT2A 2AW5A 2PPVA 4EUNA 5IRCD 4YJ2B 3I37X 1GCAA 3QH4A 4O4HA 1MOPA 3ELBA 4PZAA 5C1BA 2ZIXB 2NG1A 1Q3TA 1JHPA 1ZLYA 4Q03A 3KSDO 1A2OA 4BKRA 4CQJA 1E0AA 3TR0A 4FQ7A 2D5IA 5KOYA 3NTQA 1NSTA 3ELWA 4MVJP 3RFUA 1SIBE 4QWMA 3ZDXB 1W94A 3JASA 5IKPA 4K9SA 1JT9A 2AK3A 3TJZA 4G0VA 3CE9A 2IOFK 2ACKA 4C7MA 1L7QA 3AR4A 3L1JA 2VTEA 2HHJA 3TLMA 4EFKA 5F1YA 1NZDA 1I7SB 3LQ4A 1T8WA 2ACEA 3GV0A 3OIFA 3ENQA 4IXDA 4NTZA 5FTJA 4E5NA 4NMHA 4UBOA 4F8EA 3A37A 5ALOA 1HG0A 3BMCB 4G6ZA 3I6BA 1U2SA 3RAFC 2OB2A 3DOCA 5IKEA 4R2XA 4B3MB 1J33A 2YQ4A 3S6JA 2QLBA 3TUZC 3IOCA 4R8KA 1FTNA 5EWLA 4LZPA 4DUYB 1LPNA 1NUTA 2HIMA 2BFEB 2YV3A 3GLVA 3N5KA 4DGSA 4N54A 2IXGA 4Z86A 4WEQA 4A1OA 1BDHA 1P75A 1QX4A 2ODPA 1W46A 4JEHA 4QUHA 4K40A 1TU0A 1N92A 2YHBA 1J0DA 3NLLA 3STUA 2AEEA 1UZNA 1RAIA 2QVGA 2X9QA 5GVRA 3RLIA 4WBNA 4BNGA 1FUIA 3DB1A 2ZSKA 1J0BA 1GQSA 1XMJA 4W5RA 4MDYA 4Q9AA 1WDWB 5DLDA 1KFCB 3SE7A 1DC4A 3OJLA 4LY0A 1B0ZA 1U28C 4PVDA 4MMYB 1HLDA 5I9LA 2Z5VA 3IERA 3CLTC 4TL6A 3TEFA 1M7HA 3L4BC 3T9DA 3SC3A 3IL2A 1KJQA 3ZWYA 2REQA 4PPYA 5C1PA 7GPBA 3W5BA 1PLKA 2BGRA 2BWJA 1MQAA 1OROA 1JXAA 2H0AA 2QM0A 1OMOA 2ZVJA 3ABRB 3D0QA 3ES9A 1GILA 1Y37A 3MJVA 4MCJA 3WLPA 3V4VB 1A8HA 2PFSA 5JSKA 4CM3A 2ECQA 1Y63A 2YRFA 4L4SA 1PUIA 4M3NA 3PZBA 3ROXA 1QQBA 1MPTA 5L3VA 1N6RA 1NMEA 4QOGA 1M0SA 1TFUA 2BJVA 3G0DA 3JD4A 9MHTA 3GGDA 4RZSA 2IH2A 5FR1A 4X84A 3D3EA 3F97A 1T6XA 3OZEA 3WG9A 2AKEA 5CD1A 1SBZA 4JJ4A 3UFBA 3AY7A 2W6ZA 4I55B 2FMUA 4LXTA 1IBCA 4XXHA 1RACA 3H1AA 5G3YA 3WK8A 2C2WA 3H7AA 3HO1A 3NHSA 1P7YA 2JGAA 3GYGA 2QHXA 3TQIA 1YASA 5KKNB 2B7BA 2QNIA 1C3LA 5FTKA 4NFHA 1YVRA 2A88A 1QF9A 4EW2A 221PA 3HN7A 2F8MA 2COEA 2NVBA 4HUQA 3UB3A 3TOZA 2OO3A 1W88B 4M83A 1DG1G 4IIJF 4YMGA 1V5EA 5I51A 1OXSC 4MS3A 4Y2VA 1E6WA 1TEXA 2YXEA 3JPWA 2GCOB 3EWIA 3VVMA 3OETA 4CF6A 3FR7A 1YCHA 4DWWA 5KOHB 3HCEA 1Z8DA 1Q0QA 4UTRA 1E8NA 2ORYA 2QE6A 2R25B 5IEBA 1G16A 2RFLA 3ZCQA 2WW8A 2VF8A 3U4IA 1YHZA 3GZJA 1J42A 1XQVA 4J49A 4WWHA 5HMLA 4AO7A 2YQZA 4QT4A 1KU6A 4KL8S 4QGFA 5IF9A 3BD6A 2HA3A 4I2VA 5I6DA 3W2GA 2AF3C 2ZZKA 3AI7A 3BC1A 1U9CA 2Q7XA 4IO0A 3RG2A 2XUKA 3K0HA 4YUAA 2FSUA 5KNBA 3FOAA 2I6SA 3GNTA 2C7VA 3NIGB 4UAUA 3QYPA 2ZIEA 4BASA 1AURA 2F1IA 3H5LA 3ZV3A 2A0KA 2P91A 4CV2A 1E9CA 4C7JA 5IYZB 2NTYC 4OP1A 2FZEA 3NBFA 4IFEA 1NUHA 2AQIA 2NU6B 2PR7A 5EMNA 1NVFA 4PFJA 1KFBB 3THRA 5A4DA 4LQLA 2CHVA 1M6VA 3M83A 4JN6B 2CK3D 3SZOA 4EYEA 1D6JA 1XZ8A 2HHLA 2Y68A 3A1DA 3A6JA 3HNRA 1Q83A 3O1LA 3KE8A 3K8QA 1C9DB 4LWOA 1S02A 1COWA 1LDGA 3CY6A 4F06A 3E22B 1T9GS 4FMDB 4KK4A 3EXG1 3ZU2A 2FSGA 4HB0A 1GLGA 3QVKA 4YRLA 3ZG6A 2MMGA 1Q1ZA 2Z56A 1SCJA 4MS1B 3KKKA 2RGGA 2FFJA 2XCIA 4OLJA 1IG0A 1KDTA 2JD1A 3PS9A 1IG3A 5CA0F 5JU6A 4S0ZA 3WSVA 4EJ6A 5ILOA 1GLVA 2EQ5A 4ZTZB 1ENYA 5IJAA 5FWYA 3RS4A 1G8SA 1P4RA 4COOA 2GN2A 2OBNA 1TECE 4FDTA 4GOLD 4NU0A 2PL9A 4I6GA 1HQYE 4ZVQA 2YX1A 4PW0A 1L6IA 2PFKA 4KN8A 4Q6WA 4N8DA 4B5KA 4P34A 1DCFA 1KMNA 5EMLA 5JYDA 3BIXA 1UAAA 1DSSG 4DG8A 1FE8A 2VBFA 1H2EA 1QQAA 3ETJA 4DYDA 3AHEA 5JYBA 3IUMA 1JU3A 1GZ6A 1IRXA 1ONSA 1U8UA 1W1WA 2V6FA 3GB9A 2OFOA 3E35A 3OIUA 1VI2A 2PD4A 1KSFX 4TZKA 1AS2A 4X45A 5CHEA 3MJDA 8MHTA 4W9NA 4UDXX 1KGDA 2G76A 2GPWA 3ZYZA 5BW4A 3UG6A 4RE5A 5AVTA 5JJCA 2HCFA 1OYWA 4HDSA 2F3UA 4GAEA 3S2GA 2PQ2A 2EQBA 3EGOA 3FROA 4NG5A 2XODA 1XZQA 3IIMA 3LDAA 4CQLB 5TQJA 4O4JB 3ZIUA 5HKKD 5A0TA 1EM8A 3OY7A 4DBLE 2WD7A 4HL6A 5B1DA 1WCWA 1XXHB 2QD5A 3OX2A 1ORDA 2PZAA 2ZRIA 5IDYA 1EB8A 4B81A 5BN3A 4XM2A 1UPAA 2FPPB 1N0IA 3PNBA 3LKVA 4DNXA 3ZBQA 1N8NA 2ZUUA 3HKDA 1L7DA 2Z3WA 2J5BA 3QUCA 3L6RA 2C3MA 4FFNA 3RSLA 3SLRA 1RPNA 4GVPA 1QRUA 5AQEA 1QHNA 3GFBA 1X7XB 3AM5A 3G6KA 2ZQYA 3IQDB 1HORA 4XDYA 5E3JA 2V7GA 5J1TB 1BHJA 2AOUA 1L2TA 1NQAO 2ES4A 3SSOA 4D99A 1H0KA 1ZN7A 3DMNA 4DUZB 2BHTA 2CJWA 1ZJZA 2VF5X 3G8DA 4GOMD 4B71A 4RIFA 2PXHA 1HEYA 1HLPA 1NJ6A 1R5NA 2B4AA 2BTQB 3OZDA 5EZ5A 3TS1A 1CYDA 5DNVA 4LDPA 4FJ2A 2OLKA 3UXHA 1NJ2A 3PRYA 1KFEB 3AGPA 1SXPA 3M6LA 4QQNA 2BP7A 2GZ2A 5LVAA 4BNNA 1NJ1A 3U5ZB 1UJ4A 2J9XB 3PFHA 3E9QA 1D2AA 2QW8A 4KUGA 3NFYA 4MHOA 1FNSA 4M1SA 4U3JA 4BJ6A 5H70A 1M1NB 3KHSA 3KDPA 2Q6LA 2IYFA 1CUWA 1FYXA 4WT7A 5EQTA 1FYDA 1B41A 3FBWA 3UMBA 3RRFA 3E5HA 1E4YA 1Z06A 4B4UA 2A0YA 5BNTA 2P2DA 4OQXA 3R74A 2VH1A 1WV0A 4LWZA 1E64A 1A8UA 1MFPA 4N5HX 3DLHA 3RSQA 3SDZA 4YDHB 4QUJA 3W5CA 2I4RA 2R8ZA 5TRTA 3GAMA 1WABA 1CQJB 4JI0B 5LB4A 3BS4A 3ABQB 3ZGNA 3DT6A 4R84A 2EBFX 1L8AA 4HMQA 4BO7A 2CB9A 2YC4C 2XVXA 4CL8A 5BQXA 1ZVMA 2O14A 1J9GA 3P19A 4QDZA 1RQRA 4GMDA 4L9SA 1R0CA 4TRJA 1KZ6A 1T9DA 4E12A 3QUTA 3NZEA 3MYYA 5SV2A 2R79A 2RK6A 2WKWA 2JAPA 3GN1A 2RCNA 2EEPA 2V6MA 1VPWA 4HYYA 4OJQA 1XJ0A 3UPTA 2JGRA 2QRHA 3OOSA 1EHCA 3PRKE 4KPGA 2QPTA 1II9A 4O8CA 5KVSA 1BQEA 5J4HA 1PNQA 2IU0A 5DI9A 2A4MA 2LV8A 3COPA 1PNOA 3QEKA 5EIFA 1EEHA 4CLEA 3I8XA 3OIWA 1WM1A 3A1SA 1F6DA 1A4IA 2W2LA 4D0RA 4Q3LA 1L5VA 2I1QA 3FZEA 4WNCA 2V5VA 3W5IA 5IU6A 4CKBB 3EVFA 2B5VA 1ZRSA 3I3SR 1U9YA 2PX5A 3WLEA 1ZICA 5D7NA 2Q7OE 4BQRA 4EPTA 4K1LA 2X2FA 5I7RA 5FEUA 1YZHA 2COKA 1V4NA 1J2YA 2HWYA 1GKLA 2YOFA 2G25A 4F1KA 1M54A 2VJMA 3LA8A 4H15A 4HLDA 1KARA 2IF0A 1XAIA 4LYHA 4RHCA 4M0FA 1JEYB 4NCBA 4FXOA 4B4VA 3A6GA 3GJ8A 4Y1FA 4JI7B 4EVRA 2IDMA 3P26A 4PSVA 3DH0A 3QSYA 1CUHA 3IMGA 3PXGA 2FGKA 1GAJA 2YV1A 4GI1A 1ZSVA 3OKCA 3P9PA 3ZU5A 1FFCA 4CT4B 2OV6A 3OLCX 3I64A 4R4JA 5AVKA 4ZJZA 3B3FA 4JWTA 3GUVA 2GCGA 3INNA 3AJRA 3N74A 1I4OA 1IIRA 2HU8A 4KRYA 1OB5A 3WHPA 2V97A 5GJWC 4KXMA 1Z7GA 1JHAA 1EYZA 3WP0A 2XA9A 5BSRA 3CIFA 4WLEA 1KERA 1K3FA 1XJCA 1ECCA 3L0YA 5DPMA 1R6VA 4K6HA 3GFSA 3ZU6A 4CPDA 5KYWA 4JIGA 4CLRB 2HT6A 3B13B 1CU1A 2C8LA 4MB6A 4QU9A 1KH1A 1PJAA 4L50A 1QRRA 4CJXA 1X80A 3OA0A 1S2MA 4YRJA 1OXTA 5FIUA 1K88A 2FEPA 4LQDA 3EPLA 3KYCA 2TMDA 4MGHA 4KGVA 2GEDA 1E5DA 3E0QA 3A4IA 2DFVA 3HA2A 3PD1A 3QLUA 3P2EA 3KEQA 3L8YA 3TNDA 1C1YA 1JR3D 1NMYA 3GO4A 4W7SA 1Y6ZA 4OQYA 1OLUB 2IS6A 2WHQA 3M3DA 4PLWA 1GKYA 1KZ1A 2Y93A 4NECA 1S2OA 2BBOA 4LV5B 2HKIA 3JQ7B 4WADA 4LQ4A 3V2IA 1XKLA 5TT0A 1P91A 1X14A 1GG5A 2YW9A 3NHAA 1A4RA 3T1OA 3VH1A 4FGKA 3T35A 3OF5A 1W19A 4ZC8A 1YQTA 4QSMA 1JP7A 2VZ0A 2AZTA 2GNOA 3FDJA 5F9MA 2AV6A 3M1YA 3TLGA 2D0DA 3UJ3X 4BNXA 4N40A 1O97C 4UDNA 4NAVA 5B58T 3NVDA 2ENUA 1HEUA 3DTNA 4D9NA 4Q21A 3ZIDA 4LMPA 5DWDA 2O6HA 1QDEA 3ZGVA 1GRCA 1FQJA 1TUIA 2D1TA 2LIVA 3AR8A 3D2BA 3FHOA 1RWOA 3K0AB 4TV8B 1LQUA 1NKVA 4F3YA 4ZI3A 5HTKA 3A10A 1IN1A 3Q72A 5JQGF 1QV9A 4INPA 3WAJA 4I4IA 2QQEA 4J4BA 4ZYLA 2WABA 1J0XO 3EPRA 4L6AA 3FUWA 3CNLA 2JK1A 1DO0A 3FJYA 1IIBA 3HB7A 2Q62A 4IJMA 4UZFA 2JVIA 2OXTA 2RGUA 3DE5X 3DMYA 5AW2A 4CM8B 2BSAA 4OI1A 4JBGA 1N2HA 2H1IA 1N32B 2BT4A 3VR2A 2PNJA 1YC5A 1GZVA 2HIGA 5KKAA 1H1TA 1CNMA 1RXYA 1GD1O 3B78A 1TPZA 3DWFA 3I58A 3LPMA 4IEEA 4Y2UA 2BOVA 3DS8A 4YT8A 1W5FA 1DEOA 2W2PA 2OXRA 3U7FB 1MGPA 2NSLA 1I3OA 4QJ5A 2JIZD 1W7AA 2WQZA 2O3QA 2WU3A 4KO3S 5E9WA 4EM6A 2QLTA 1YQWA 4IILA 4EF4A 2ETVA 3KLOA 4RK4A 1DQRA 3RRYA 3EY4A 3VPGA 2JLZA 1E9BA 1THGA 2FQXA 3KKOA 4PGFA 4FB5A 3AJAA 3MG9A 3FNHA 3NFRA 1MRSA 2HSZA 2Y0BA 1UJ5A 3ICVA 3R3XA 4G0QA 3TE6A 2FDXA 3U9LA 3T1QA 3HXOA 3U56A 4KR7A 2CLDX 2ODAA 2Z4RA 3Q3IA 2DKFA 1T9ZA 3BBLA 4HH0A 4S1WA 4WJKB 5FOVA 2BKAA 3H04A 3MRSA 2N9UA 4LYGA 2PSHA 1BXRA 4D4HA 2EKBA 1YBAA 2RB4A 4GGOA 2YNMD 3OBIA 1P9WA 4IX9A 2ANBA 2R751 3DE6X 4CM7A 1BJKA 2FWAA 3I12A 4PV7A 3LRTA 4YCAA 3IEVA 4FZVA 4TZ0A 4MUEA 1X8KA 4OOFA 1LUAA 4D9BA 5C4GB 1SUEA 3K92A 2C04A 1M34A 2ZI3A 3EF3A 3OQBA 3PVCA 3AZQA 4A3SA 1DQNA 2PBLA 5PGMA 2VA8A 3G0CA 1PFUA 4G4SO 2XOKA 1VCNA 4BKMA 5ADHA 2XUPA 3OP1A 3PXEA 4P3NA 4RPLA 3EF1A 3V55A 5EHZA 5ICMA 1J39A 4KU4A 2BVNA 2YJGA 3KJNA 3W3AH 2OK8A 4ITVA 2PYIA 1YIOA 2PJUA 3CS3A 3DZIA 3N2GB 4OD0A 2PE5A 2WWXA 5G40A 2PZLA 1ZCJA 3NBZC 2ZUCA 1DINA 3RWMB 1XMXA 3WNBA 4FPXA 4GKJB 1ZNZA 2DM6A 2QZJA 4N39A 4AZVA 4DCJA 4ME6A 3VKUA 4DV0B 1W29A 1Y1LA 2DMRA 3DDZX 4D0NA 1FXUA 4G8DA 4Q0MA 2QGFA 2CZQA 3FYUB 4ETNA 2HPAA 4K8OA 3BRWD 4WFQA 1M8FA 1RAHA 5P8WA 1F7VA 3IEKA 1CRQA 1U2GA 4V2UA 5HG0A 2WKSA 4RFVA 2I4IA 3JD3A 3Q5GA 4GI2A 1K92A 3FYUC 4DQVA 2LPMA 2LR0A 3FLAA 3N07A 1S1MA 3AR7A 4G3XA 3HPRA 2ODWA 1DAKA 2PDAA 3NBXX 4E5SA 1RNLA 1O6FA 1WOMA 4GS5A 4H9GA 4L16A 4BP8A 5B12A 2XI4A 1E99A 5IVKA 4E5DA 5KNLA 5TQVA 4ARBA 5AI8A 1BYIA 4ZQHA 4ZI7B 4MW5A 1KPGA 4KX3A 4Q1DA 5JHHB 1I32A 2OZLA 1NOIA 2IHJA 2YL2A 3NP9A 4J7UA 3ZZ1A 5JS8A 1YI1A 1YR2A 4GSLA 4GW3A 4P54A 5ECDA 2OHFA 3OE1A 3MBIA 3GA7A 1A98A 4I1RA 2VPWA 4UC0A 4JCOA 2IXDA 4FZJA 3L6OO 4FR2A 4L08A 3BXHA 4JJGA 5EJ7A 3JQ8B 1JLHA 3QVGA 3UW1A 1LB1B 3ERCA 4NJMB 3WKCA 3U0BA 4I7EA 1YL6A 5J1SB 3CKLA 1EG2A 3B36A 3PA6A 4AL4A 2EARA 4R9VA 1IJBA 3UZUA 4OQPA 3ZD8A 4C21A 3ZV6A 3F7OA 4I1YA 2OG1A 4FGSA 3EHEA 3O83A 3KDAA 1GXSA 3V1UA 5CM2Z 3H8SA 1JEEA 1TFRA 4JQSA 1P1RA 4ZEXA 1FQWA 3FXAA 3GY0A 1ZK0A 1GPBA 4IJUA 2EOAA 3F7MA 3SKXA 2X8WA 4RSHA 1OH7A 2ZVQX 1ZHFA 2QIPA 2V6JA 4HD8A 2NMVA 4U2FA 1GRNA 2HHAA 4HDKA 4O2AB 4U7WA 2G80A 3I9NA 4OMUA 1MQSA 2CVQA 3NCTA 4EI2A 1R10A 1Z5ZA 3A3NA 4LXYA 1XFDA 5HQTA 2V1UA 1JA9A 3A04A 1A9ZA 2DH5A 3A4MA 4JI4B 2H8GA 3WLHA 1SMKA 1CRLA 3C39A 3L7BA 3Q7RA 3NBQA 4NBRA 4RQUA 3ZJTA 2B7CA 4X20B 2FR8A 1A9RA 3CZAA 3O3MB 4DMUB 4F60A 2ZB3A 3CN7A 1E3WA 2B6NA 5E8JA 3DONA 1ZO8A 4HQ0A 4UVDA 1KVSA 1HE8B 4IIEA 5JCJA 4RY2A 4UEKA 4V3CA 5JIBA 1DIOB 3DDWA 3IDQA 3SS7X 1E2LA 1MEEA 1ONNA 2CEKA 3A25A 4K87A 3RYHB 4CMEC 4DEXA 4FOLA 4FM9A 1WE2A 1EFDN 4FWIB 1U7WA 2NAPA 3AL2A 3VYSB 1XU9A 2V4UA 1JMVA 4CM5A 4KSBA 1YVDA 4HB4A 4R68A 2ZQ5A 3R6GA 1QWSA 4HVAA 5ADUS 3SN6A 1HQKA 1SOAA 3AINA 2NU8B 3ZWWA 9LDBA 2XKAA 4X8OA 1NC3A 3MWYW 2O3JA 3PGKA 5I5GA 5CX1A 3CLUD 1TL7C 3DO8A 3S99A 1HFKA 4OFZA 4L5AA 5DWQA 4TKVA 1H66A 3N0TA 4P3YA 2JFNA 1NG1A 2AI1A 3U6KA 3EPKA 3W1EA 3HCOA 1ZPDA 3W1VA 4N01A 2OGSA 4EQ6B 2J6IA 4ZK2A 4DR6B 1JMKC 1FVOA 2P30A 1I5EA 4P5EA 2VXYA 3ZXXA 4MSUA 3AF6A 3SHFA 4KSYA 1EDOA 1PQPA 2ZT6A 2MR5A 2C78A 4G8JA 4AZTA 4W5TA 5BQFA 1TO1E 1JJBA 3A4NA 3AM4A 3D4IA 3AP3A 1T2AA 2ILTA 1IH8A 3WV4A 2WJIA 5CW2A 2C4VA 3WA7A 1G5QA 1M10A 5IXYA 1KZ7B 4MGYR 1V8OA 3SVTA 3T4UA 2VH2A 4ZC1A 2WYHA 4MW9A 2P0AA 2IYAA 3ACCA 5KDOA 2G1JA 2BIFA 2PRIA 1Q0LA 5IDVA 1RYHA 3LOUA 1U8AA 1GQ2A 1IM5A 3LQ1A 1IEQA 5A04A 2O2GA 4GPD1 1RTKA 2R7KA 1ZOSA 2RDMA 2RJNA 3BREA 3I3OA 4NJEA 5E9QA 1CS0B 5JVDB 5CFPA 4CEJB 1RC1A 3EG9B 4PYMA 2VZ9A 1JQKA 3OEYA 5HQ3B 4PYJA 3NWEA 3INTA 1Z47A 4NU6A 4FE7A 1EVKA 1ZBQA 1GN8A 2R11A 5B6PA 1YBMA 4B82A 2K87A 2X42A 2QK4A 1U0OC 2J5QA 3CZ9A 1DADA 4B31A 1U0LA 2TRSB 3CW2A 2NQ8A 3HPQA 1OHHD 3MUNA 1EG7A 3COZA 4BE7B 4DCOA 1UC4B 2I2CA 3Q9NA 3SKYA 3AO0B 1V2GA 4EZBA 1FFXA 2E7ZA 2JGLA 4UPDA 4MKRA 2FPGB 4WNYA 4OSPA 2V3WA 4OQLA 5HF5A 1AQJA 2NV2B 5AW0A 2Y1XA 1XROA 1OAOC 2WMNB 3DV0A 3VHQA 5CIQA 2PGLA 3WHLA 2J9RA 2DE0X 4EUSA 4AMUA 5KZMB 2FX5A 1JJFA 1UXGA 3IPAA 1ZD9A 4IW3B 3FCSB 3PUYA 4Q24A 2WAXA 5DULA 1Y42X 1D5CA 4HLCA 5CM9C 3MHTA 1DUIA 4IF6A 3ND5A 1ZXXA 2Q1WA 1JFVA 3B3GA 3A3OA 3ONNA 2VK4A 3KT8A 1L1FA 4DADA 1PDOA 2H85A 1IOLA 2JIDA 4HYEA 4Y6QA 4XDHA 3TGLA 5FOTA 1L7BA 1AQLA 1Y3IA 2XCLA 3REGA 4B43A 3MGCA 4XIGS 1XXLA 3NT5A 4KQJA 1POXA 4G86A 1NLMA 3DE0X 3DQQA 2M9MA 4DUGD 2J0SA 4WIAA 3V8MA 4RA9A 4IMPA 1XTKA 1C1DA 4O08A 3I9JA 1ZJJA 1VBFA 3UC9A 4KR0A 3HKCB 2LZ0A 3MF4A 4P36A 4QECA 2C77A 5KYYA 4DDWA 2WNIA 3MQFA 1QBKC 3ASYA 3L7MA 3CVUA 5E95A 3T9AA 3N2KA 3JVDA 3KSUA 2PRYA 3PC7A 3OPYA 4I4CA 2C2MA 3EXEA 4GR5A 3D6JA 4LOIA 4WN9A 4JKIA 3MWJA 3NBKA 4DHEA 1JHXA 2JBWA 1C7JA 2PKYX 3BMNB 4HLUA 5EP3A 3H16A 3WV5A 4AJNA 5HGXA 3KEMA 5HW0A 4DPKA 1X8XA 1PSDA 3RU7A 4EB0A 2H4HA 4TGLA 4I46A 2QR5A 4E32A 4ETMA 3HKBA 5H82A 1Z33A 4ZVMA 3R9XB 1ZLXA 1OIWA 1IAQA 1FY2A 1PT7A 2B2CA 3B5JA 1DMSA 4JVOA 4KQGA 4DA9A 1X13A 5JAOA 3TMKA 4JI1B 2B1QA 2ZRGA 3IQGX 1VJ5A 3U37A 3TUIC 3AW8A 4KXUA 2P2GA 4TV9A 4P9NA 4U9HS 3DW1X 3QVJA 1XPJA 2P41A 5K3AA 2C54A 2AG6A 3GFOA 3ZXUB 3OHSX 4C0SA 2JH9A 4J1QA 3GDGA 1J8MF 4UXIA 1RJ9A 4KN5A 4QICA 2ZU6A 1EP9A 1T1IA 2JRLA 3SQNA 2Y1WA 3ANYB 2D7CA 3S55A 4BYGA 5C7YA 1IBKB 5IVDA 5JSZB 3AVPA 3FWHA 4KBYA 5LIPA 1A7KA 2OLJA 4RPCA 5K3OA 4KAJA 3IELA 3D31A 4EYQA 3RIHA 2REXB 4M0UA 4NQRA 3Q6IA 4LC9A 2IYPA 3C6BA 4L15A 5GZ3A 4A6DA 1V5IA 4YJHB 1PJCA 4QNMA 1ONOA 2DQSA 2JCXA 5JAPA 5L4SA 1Q0UA 1VMDA 4KCGA 4J2HA 1BMDA 1SXJE 5B3AA 4D9MA 4PINA 1ZQ9A 2VTBB 2OYRA 4E13A 4RF2A 4U00A 5ELXA 4U2BA 3ITEA 1SKMA 2PTHA 1JW9B 3BTSA 3BD7A 4OVKA 3P5BA 4QHSA 3RASA 1MPXA 1JQEA 3BHNA 3KZNA 3OD1A 3IE1A 1O95C 1SEVA 4M36A 4TTIA 3PC3A 4Y6SA 3FPEA 3GUCA 1T35A 2F6RA 3QELB 2WUEA 1RBZA 3JATA 3TTUA 1PAUA 3GZNA 5D5PA 1KQNA 1OH5A 1KI1A 2CKDA 4H0NA 2IUUA 5C3MA 2BUBA 4PSDA 5LBTA 4D57A 3MXTA 3KQSA 3KTOA 3BL5A 4HRXA 3DF9A 4OQQA 1KIAA 5AOCA 1DVRA 3OF2A 5DU2A 5C1IA 1JR6A 1R0ZA 4II7A 3LO8A 3CPHA 3KZ1E 4UHBA 3JQGB 3NQ41 2V7TA 2EFDB 3AEUB 4MKFA 5D85A 5KI6A 4RVOA 2KS6A 1BHSA 2P68A 2PGNA 3GEEA 3AFGA 4WQMA 5AKEA 4YO8A 3OPMA 3U48A 5HKOA 2IHNA 3C5CA 1DLJA 3Q10A 2QPLA 4P5PA 3KOUA 2QTAA 1ZS9A 3N2ZB 4HGPA 1RCTE 4KV9A 1CJCA 4GYJA 1HBJA 4RHUA 2YCBA 1JI0A 4X97A 4JT8A 1F1JA 4BEVA 1X70A 3FY4A 5JUWA 2BZGA 4Q4HA 1CUVA 2C5LA 2HWWA 4HO1X 4JX8A 3TJRA 4F84A 2QMQA 1LLUA 3D6MA 1YZNA 1GG2A 1XZDA 2IF2A 121PA 3GPBA 3O8NA 3JALB 2NU7A 4GXNA 4MGIR 5U4QA 1A5ZA 5A06A 4IVQA 2KX7A 3IE0A 1SULA 2X5KO 5HF9A 2PKXA 1HT2E 3I2YX 1R9JA 4ZN6A 1FEZA 1PKXA 2GPNA 3A3KA 1HE3A 3FDIA 4LJ9A 3VZQA 4LDZA 1YRBA 1M8PA 2RGWA 3D3QA 3T9CA 4FLMA 4F6LA 3TSZA 3D1LA 4X3CA 1H23A 1ZN2A 1R0YA 3S1AA 2QRKA 1JKXA 1LW7A 3AETB 3PB3A 4JELA 1IHOA 3CC8A 4XE5A 4MTLA 4AVYA 4EYKA 2BGJA 1X8JA 1FQKA 4NI5A 2VP0A 3Q9LA 4UEJA 4PZPA 3RHSA 3EBPA 1T8PA 2CUKA 1C8BA 2DCMA 2R6GA 3TZLA 3GDWA 3VC1A 2XZLA 3NIWA 3U7GA 2GVDC 2JI9A 2W83A 3TLKA 5EKUA 1BC5A 5AI4A 4F2DA 2DU8A 4X95A 5BUCA 3HH8A 1GUDA 3QKIA 2RHTA 1BX3A 3FSRA 4GX5A 2P79A 1P7CA 2GESA 2BZ0A 1IUKA 4IWNA 4R3UC 5IM5A 4YIKA 4MW1A 1PZMA 3BGSA 3ZX4A 2XADA 1CUEA 2X0NA 1TYCA 2RGBA 3A1FA 2OV1A 1O57A 5H81A 1KQGA 3C3CA 1SCUB 2C0QA 4FNOA 3ITKA 1GARA 1DJNA 1BEZA 1UBUS 2X5JO 3PFGA 3IAHA 4EG5A 2RARA 3K5WA 3OKPA 4C0JA 5HA5A 5KQRA 4J4TA 1NSFA 5JO9A 3V7WA 3BGDA 1VC2A 4RULA 3ED5A 2WINI 3NBAA 1G3QA 2Y8EA 2JVJA 1WSWA 3PTZA 4RPIA 3UHOA 1R0KA 2ILVA 3AEKB 4IJKA 4C6SA 5K0CA 5KYXA 1W9HA 2O57A 5JRJA 3B6JA 3T4XA 2CMDA 4BE4A 3LUBA 3V7FA 4MQMA 2LKDA 5H3CA 3PRJA 1ZH8A 3UM9A 2AJ8A 4JZKA 5FO1A 3FRHA 5BVGA 2HDWA 3O4JA 4M49A 3RDPA 4S04A 3KQQA 2HK7A 4WINA 5AK0A 2ECPA 3GLHA 3EGIA 5J43A 4K3VA 1V6AA 4WX2B 4GMHA 3TCXB 4D3DA 2GZAA 4DEVA 3NNDA 5BN1A 2W2XA 1QZTA 1KDVA 3OEHD 5BWOA 4UU7A 1D4ZA 3JARB 4OGWA 1Q7TA 2VEOA 5TR9A 1VGVA 1JXOA 1XHLA 2ZTMA 3WNZA 3TRIA 2IT1A 3MAGA 4C22A 3T61A 2BEUA 1G17A 3DMTC 2XOXA 3QPAA 3CUVA 3QUAA 4IMIB 4LGMA 3TRDA 5KMGB 2HF8A 1N36B 3EXFB 3PJRA 2EIXA 4CR6A 3VHXB 5TPWB 1T1EA 2PUCA 3KYBA 2ZVDA 5FUMA 2QI9C 1D2MA 2APJA 2IU4A 5JTUA 1R3DA 2J48A 3KZOA 3QP9A 2BKEA 3K9QO 4LRSB 4NFYA 4F4IA 8AT1A 2NTVA 3W3AA 1FK8A 2IWRA 1IONA 2XBUA 4WKOA 4TSRA 4EG7A 5C2JB 2IOQA 4FNAA 4CR7A 2H16A 2VDNB 3SYMA 1V37A 4OBXA 1JYSA 1UBEA