1P74A

Crystal structure of shikimate dehydrogenase (aroe) from haemophilus influenzae
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
267
Chain Sequence
MDLYAVWGNPIAQSKSPLIQNKLAAQTHQTMEYIAKLGDLDAFEQQLLAFFEEGAKGCNITSPFKERAYQLADEYSQRAKLAEACNTLKKLDDGKLYADNTDGIGLVTDLQRLNWLRPNQHVLILGAGGATKGVLLPLLQAQQNIVLANRTFSKTKELAERFQPYGNIQAVSMDSIPLQTYDLVINATSAGASVDAEILKLGSAFYDMQYAKGTDTPFIALCKSLGLTNVSDGFGMLVAQAAHSFHLWRGVMPDFVSVYEQLKKAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of shikimate dehydrogenase (AroE) reveals a unique NADPH binding mode
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
molecule keywords Shikimate 5-dehydrogenase
total genus 98
structure length 267
sequence length 272
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1p74A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1p74A01
1IZ9A 3DOJA 1R66A 3VH2A 4OIMA 1HYHA 2PGLA 2O2YA 3BTVA 3E48A 2Y99A 3JQ6A 1VKNA 4CMIA 1PS9A 4LN1A 3KYDB 4FC7A 4BGUA 2HAEA 1H6AA 1ZEMA 5TC4A 3KYCA 5DT9A 1E1LA 3VPGA 2I76A 2Q4BA 3DEYX 1KETA 4R1NA 1KC1A 5TT0A 4D45A 1WVGA 2EP7A 2X6TA 2BGKA 4HWKA 1B7GO 2VCYA 4PZCA 2WDZA 3WSVA 1MX3A 2OZPA 3L9WA 3TJRA 3U0BA 3U4CA 5CDUA 3JQDA 5KJCA 4FD3A 1U4SA 4PLWA 2H1SA 2ZQYA 3A1NA 3B1KA 2P4QA 3DBHB 2Y1CA 5DZSA 4ALKA 3GZ4A 3GRKA 4QTZA 3FRJA 1YL7A 3VZSA 4EZBA 1ZIDA 3PIIA 4XA8A 2VWQA 3DZHA 2OBYA 3L77A 5DP2A 3NV9A 4GPD1 5CPFA 3JYPA 4J1NA 1VRWA 3WSWA 2R00A 3PTZA 1JVBA 5TT1A 5MGBA 3QJ5A 3WS7A 1ZH8A 4IUYA 3I5MA 3PWZA 4RVFA 4INAA 5T57A 1NVGA 1UDCA 1I3NA 4EUHA 3JQGA 1YOVA 2EGHA 4YT5A 4YVFA 3GVXA 1R6DA 1LQUA 5ES3A 2GRAA 4J4BA 4MIYA 4CUJA 3MCVA 2HRZA 3ROKA 1DLJA 2DVMA 3RWBA 3WQRA 4QSMA 1HDRA 3QQPA 2VYNA 3L6OO 1P3DA 4AJLA 4D79A 3UW3A 4BO5A 4LRSB 3SXPA 3TL3A 3N7UA 4D42A 4EJ0A 3WBFA 2YQ4A 3JD0A 3DZBA 3S8MA 3SX2A 1Y9AA 4A73A 4DQXA 4ND2A 2EG9A 3LC1O 3Q0EA 1T4BA 4OYRA 2YV2A 3B70A 4LMPA 4WLFA 3V2UA 3CZMA 4DIFA 1QYVA 4A03A 5IDXA 4BO8A 5CDYA 4YXFA 1RKXA 3UHAA 1QV6A 1ONOA 2CD9A 3KSDO 3ZV6A 1Z6ZA 4PLFA 5HTOA 3GQVA 3K5PA 4BNIA 4CQMA 4GWKA 1V3TA 4YJGA 1I3KA 2OP0A 3BTUA 4ZA2A 1J6UA 1ULUA 5EINA 1V0JA 1IHYA 4TRMA 2JCXA 4LVUA 3VVBA 4QT0A 1DHTA 5KKAA 3WTBA 5TJ9A 4CLXA 3QRWA 4IQ8A 4RJTA 1EUZA 3EZLA 5ENDA 1PZFA 1KY4A 4WE3A 4KUGA 1TT5A 2WM3A 3H5NA 4E30A 4IDAA 5AXBA 3RBVA 3RFTA 1P0FA 4I1IA 5A9RA 3WGZA 5HA5A 5K9ZA 3I83A 5AYVA 1E6WA 5TRTA 3ZH2A 3I4FA 4ALJA 1XSEA 3FBTA 3LT4A 1O8CA 2ZCUA 3OA2A 2VT2A 4BVAA 2SCUA 4CM6A 1LC3A 2BELA 3U4IA 5A03A 5GZ3A 1DJNA 1HDXA 4KTTE 1JVSA 4UUMA 5K6AA 1PQUA 3MJEA 5ITWA 2NSDA 3QVXA 3ROMA 1MGOA 4E5YA 4CM8A 3WIDA 1DRVA 1H9BA 4EUEA 4B4OA 3QIVA 2VUSA 2I6TA 4AJ4A 1PJLA 3O03A 1HLDA 2Q45A 4AJEA 5T5QA 2O3TA 2B4QA 2XOXA 3CINA 4MVJI 5A02A 4TRJA 2NVUB 3PJDA 3C7DB 3ZWOA 4WCFA 2GERA 3M1AA 1E7SA 1HE2A 5DDIP 1D1TA 2JCYA 1SOWA 2JCVA 3H9EO 1VL0A 3RKRA 4BNWA 1X14A 2CZCA 5EJ2A 3UN1A 1FJHA 1SNYA 4E33A 1DC5A 4E2ZA 1ZK4A 5L7YA 5K0ZA 1CJCA 1LDBA 3BXXA 1RM4A 2E6UX 4EJ6A 3PP8A 4AICA 3BMQA 3GNSA 1PQPA 2G1UA 2XXBA 4II3A 3TOZA 1ZUD1 3IUPA 4R54A 3VC7A 3GGOA 1JN0A 2BLLA 4ZJUA 1W8DA 3GNQA 3PZRA 3P7MA 5A06A 3AI2A 4IGEA 1GTMA 4UVEA 1GPJA 3IOYA 1Y8RB 1XLTA 1K6IA 4H3VA 4I9HA 2EGGA 2Q1WA 3C3XA 5JSFA 3IKTA 5HRUA 5G0SA 3QSGA 4RO0A 5DBGA 4FQ8A 2VUUA 2I3AA 4K6CA 3OQ6A 4I5DA 3VPHA 1BVRA 3GA0A 2YY7A 4NQZA 4NNJA 2RHRA 2X0RA 4YRBA 1JA9A 2IXBA 2W98A 4CMAA 4JBIA 1M66A 3HZZA 1JAYA 4P38A 4WCFB 1WDLA 1VL6A 3ASVA 3WGOA 4GL4A 1CEQA 1O6ZA 4CMBA 3SC6A 2AEMA 4HADA 3JQBA 3VZPA 3GVIA 3GT0A 1T25A 1N92A 1P31A 1IULA 2VUTA 1HDGO 3K96A 4N5LA 4U6SA 2B0JA 3PHIA 3KV3O 4HUJA 2CY0A 4BHTA 4OQYA 3G1TA 3CEAA 5AQ1A 4Z0TA 1F8GA 4AJ2A 4CM5A 1MC5A 3Q3CA 1WW8A 4GSKA 1H6BA 1YRLA 1YQXA 1XR3A 4IMRA 2EKQA 3OMLA 4EEXA 3PJEA 3KLPX 3F5QA 5CG2A 1NWHA 1UXHA 3MJTA 3OH8A 1MC4A 3BIOA 1HSZA 2WTBA 1V35A 4Z9XA 1KEPA 1Y5MA 4OL9A 4XIYA 4DPMA 4EUFA 2HK8A 2NWQA 3VAZA 1YQDA 4DXHA 2BF7A 3V1YA 2B5VA 4KP7A 5IZCA 1LUAA 1Y8QB 1GEGA 3TDKA 3NRCA 1ISMA 1C14A 5TIIA 2TMGA 4CV1A 1DIHA 1KVSA 4E32A 1AGNA 4R9SA 1O94A 4KQXA 5G0WA 3OQ1A 2Y68A 4HFJA 3D3WA 4ESOA 1JDJA 4OH1A 3IL2A 2VTEA 3LT1A 2HSDA 4FGSA 5U1PA 1LRLA 1JTVA 1T1SA 4YQZA 1PWZA 5I8WA 4MKRA 2O48X 3C1TA 3ZZNA 1FXSA 3KOUA 5KVSA 2O7QA 2PKQO 2OHXA 2NV6A 2ZTUA 4YR9A 2CVOA 1BWSA 1R0LA 3JD2A 1RPNA 2IEDA 3RBZA 1KEUA 5HM8A 3PWKA 1LRJA 1KERA 4EITA 2DFDA 1E1NA 3EC7A 1DC3A 3W1VA 1JU9A 3MZ0A 4M55A 1YQGA 1GUZA 3ADPA 4MINA 5C7LO 3PLRA 1XYGA 5C5IA 4D3SA 4L8VA 2PH5A 5JW6A 1EEHA 1DXYA 1R37A 3PFFA 5KCZA 2J5KA 4XJSA 1VI2A 1YBMA 4MO2A 4YJDA 2VZ0A 4BGIA 4CM8B 3IUSA 5A4DA 3AU9A 1D7OA 4CJXA 1EQ2A 3O8QA 1N9GA 2EW8A 3GAZA 3AUAA 3GGPA 4FOSA 5EERA 2W8ZA 3ZWAA 1Y6JA 1GZ6A 4B8ZA 1R4MA 5IFLA 4HFNA 5FFFA 3F46A 3OJOA 2BFOA 1TA4A 3ONDA 2O3JA 1Y5RA 2ZTMA 1E5QA 5CP8A 3FN4A 5KJ1A 1GY8A 4O63O 2NADA 1QRRA 2X0NA 2AA3A 1GPDG 2I66A 3PZBA 4I5FA 4N54A 3RJ5A 4LVCA 5JDIC 2VNSA 3QY9A 5CDTA 3LC7O 1PL7A 1BRMA 2FRDA 2YFHA 3K73O 1X7HA 4CLOA 3UOGA 4UEJA 2XXJA 4TVBA 1PWXA 3RCBA 3ICPA 4IS2A 4MVJE 4TZTA 5CEFA 2OMEA 4W7HA 2EJWA 1R4NB 4BKQA 1MXHA 1PJ4A 1JWBB 2PKQP 3OM9A 3QVOA 3GN2A 3E18A 1HSOA 4DPKA 1ONNA 2OBNA 1GAEO 2BHLA 3I23A 5JBIA 3DBRB 3SJUA 5CEJA 4G65A 5JFOA 3C7AA 1E3IA 2O50A 2DTXA 4NJOA 3MOIA 1UXIA 1B8VA 3G1UA 2VZ9A 1BG6A 4CM3A 3RASA 2Y1DA 1IPFA 2GN8A 4YJHA 2D4AA 4IGFA 1NR1A 3O38A 1EBFA 4JXKA 1DEHA 1TI7A 5MDHA 2C0CA 4JBGA 1YDWA 4GX1A 2IE0A 2W2LD 2Z1MA 3KXDA 1YBAA 1I24A 3UH1A 4YT2A 1X13A 5DCWA 3CIFA 4BV8A 5F1OA 1LSUA 1RM5A 1ISIA 4MVJP 2HLPA 3DMTC 1SB8A 3D64A 4Y8VA 3TWOA 4IXWA 4NBUA 4BOYA 1AXEA 4ZQFA 2C59A 4CMHA 5EMHA 4J9UE 3AY7A 3F47A 1I0ZA 3ZHXA 1F12A 4S1VA 1B2LA 1IE3A 1LJ8A 1CQIA 1KVQA 3D3EA 3W4JA 1CRWG 2UAGA 4FCCA 5B37A 3MWEB 5BT9A 1DIRA 2HK7A 1LX6A 4FJ0A 4L74A 2FP4A 1EK6A 4FS3A 4URFA 3SC4A 3U4HA 4BO2A 4J90A 2DAPA 4K1LA 2W4QA 3HDJA 3EW7A 2EXXA 1I8TA 2O23A 5C37A 1XWFA 4R9RA 5TLSA 4JK3A 2B5WA 4L76A 3PDUA 5LDHA 5JNLA 2EKPA 4YRDA 5CFZA 1E92A 3OQBA 4F46A 3RC2A 4WCFC 2Y0DA 3B1FA 4YT8A 4NFSA 3EZYA 3AWDA 4MVJG 4WEOA 1IPEA 1ADCA 1GYPA 3HFSA 3JQ9A 4CLRA 4RV9A 3RUEA 3PGJA 4RGBA 4CM1A 3EYWA 4BQRA 3LT2A 2EF1A 4ILKA 3U62A 1M76A 5A3VA 1ADBA 4R3NA 4CM7A 1B15A 5J23A 5FF9A 5JO9A 4MOWA 3RQSA 2Q1TA 1U3UA 2JD0A 3E6AA 2CSUA 4RF3A 2B4RO 3C7CB 1YWGO 4I9UA 1DO8A 2Q4EA 3K30A 3NEPX 2GPTA 4DMLA 5A9SB 3OA0A 2UV8A 4CLRB 4Q3BA 5KJFA 4RQUA 5G4KB 4RVDA 2GZ3A 5I8ZA 4I5EA 1NASA 2CUKA 1LLCA 2GDZA 5T64A 5TF4A 3WYEA 4B3IA 4EDFA 3U49A 4M54A 1AE1A 2F1KA 2RBEA 3KHUA 3I9NA 3FTPA 1DHRA 1MA0A 4QXMA 4WLNA 2J3HA 3PEFA 1NTOA 2VQ3A 1LDYA 4XKJA 3ITDA 5JYDA 1DPGA 2J5RA 4WGGA 3S1LA 4LRTB 2NNLD 3ZU3A 4WLOA 1O89A 3GOHA 5BSEA 1GQQA 2LDBA 2PZKA 1YKFA 2Y05A 4BGVA 4XQ9A 3VPSA 2JD1A 4DWVA 3QWAA 4GX0A 4XR9A 2GF2A 4DL9A 3DZGA 1YVEI 3I9KA 4L9RA 3ONFA 3G79A 1QKIA 1W6UA 4NBTA 1UP4A 1DAOA 1SO8A 3EMKA 1FF9A 3HDHA 1LNQA 4R51A 3JQCA 1Y9EA 3CUKA 1WNTA 4AG3A 3DAGA 1Z75A 1D4FA 3CE6A 2EV9A 3R3JA 4XDYA 2GYYA 3GMSA 4XX0A 2X5JO 3COSA 4XRRA 1HDYA 1B26A 2C2XA 1OMOA 4W82A 3JQ9C 3PJGA 1C0IA 4B3HA 2R00C 2BFAA 3PI7A 3GEMA 4R5MA 2DKNA 3V5NA 1NVTA 1PGJA 2OUIA 3IS3A 3QP9A 4J1SA 4YB8A 3ASUA 4AJOA 4KWIA 2D1YA 2C5AA 4M86A 3CXRA 2D3TA 2ZB8A 3QV1A 1HE4A 3F5SA 1XQ6A 4Y98A 4DTIA 4PZDA 2ZK7A 1E0DA 1E7YA 3CTMA 2Y66A 3WQSB 3KETA 3HB5X 4TZKA 3MJ4A 3E9MA 3L6EA 5JC8A 1C1XA 4TSKA 3ZWNA 2I9PA 1UH5A 1PZEA 3KUXA 3IDSA 3ZWCA 2WYVA 2WMDA 4XZ3A 3W8FA 1DDOA 1MB4A 2C07A 2EW2A 3AOEC 3PWSA 4BNXA 5HS4A 2FY8A 3ZN2A 1GADO 2BMAA 4XQEA 3BZUA 3RUCA 1PJQA 4XCVA 4ZICA 5COAA 4EW6A 2R6JA 2HKIA 3UVEA 2Z1NA 4DC1A 2A4KA 1MUUA 2E37A 3K2EA 3ROPA 1U2DA 2WYUA 3OJ0A 4NIMA 1NYTA 3L4BA 2DQ4A 3U09A 1ZBQA 2NUAA 4N5MA 2ZKLA 3BA1A 3RIHA 3VPXA 2IYOA 1E6EA 2X5OA 1FMCA 1RWBA 4D0SA 2XAAA 1X0XA 3BHMA 4EYEA 3W6UA 4DBVO 4B8WA 3QA9A 1XDWA 2X23A 4ZGWA 3WGIA 3S2GA 2E4AA 5A1TA 2W90A 2WD8A 3DL2A 4J7CA 4BNVA 5L4LA 1ADGA 1ZXLA 4S3MA 3I9MA 3G3EA 4PIVA 2PNFA 4LW8A 4Z9YA 4PLGA 2YW9A 2X0JA 4HX5A 1VL8A 1B16A 2Q1SA 1B14A 1QYCA 1IZ0A 3ETGA 3ZWPA 2FOIA 2Q2VA 3INTA 4FPXA 1OI7A 3ZHBA 3WQQA 4WOJA 1T2DA 1A72A 3R6DA 4H7PA 5IXYA 1P0CA 1UDBA 3NJ4A 4GVXA 1P33A 2VRCA 2Y93A 4AJIA 4FJ1A 5AXDA 1QORA 2VWGA 3K92A 2AQKA 2O3SA 4OXYA 4ZHSA 1MXFA 1XELA 1RM3A 5JPIA 2C29D 2DT5A 2FN7A 4W9NC 4F45A 4L4XA 1AHIA 3ZV3A 1XU7A 4RZHA 1C0KA 1WZEA 1FDTA 3TQHA 4RCVA 3NYWA 1JW9B 3G17A 4LSWA 5JCXA 3LU1A 3NDJA 1PJCA 3JYOA 2JHFA 3KYDA 5I9MA 5DOVA 2BI7A 3E8XA 1PSDA 3MTJA 2HK9A 5JAMA 3KEQA 1ENZA 1JLLA 1BGVA 2YHUA 3M6IA 1L7DA 4P22A 3VPFA 1Q0QA 2X4GA 3RUDA 4DVJA 2PA3A 5DCYA 3I52A 4OQZA 4QX6A 2JKVA 4J0FA 4G5HA 3OSUA 1MV8A 1GDHA 3N74A 4YCAA 3MTGA 5A5EA 5DNAA 5AVOA 5G2OA 2E48A 2Q46A 3ZWBA 3GAFA 4PFJA 4PLTA 4BGEA 4OOEA 4DIBA 2NTVA 2HO5A 1YJ8A 4UULA 1R12A 2UYYA 3FD8A 1U3WA 1UAGA 5HBRA 2WWRA 3G0OA 4XB2A 4E3ZA 4ZN6A 1QLJA 4J91A 2ZJ0A 3H8VA 4IZIA 1CERA 1B3BA 4CR7A 5IG2A 1ZKMA 3ORFA 1IYZA 1O95A 4RLHA 2C82A 1UXKA 3QWIA 3JTMA 4R4JA 3K8ZA 1KS9A 3E03A 2QRLA 1PIWA 3D0OA 5FI5A 3PQFA 4XRGA 4FSHA 3KRTA 1WPQA 4D41A 2B4TO 4HP8A 4BO9A 2AEFA 2I5PO 1I36A 1LXCA 1EVYA 3GDOA 4CL3A 4CM4B 4WJZA 1AUPA 3X2EA 2X22A 3ZW9A 4BNLA 5KVVA 4FJ2A 2ZYDA 1YE3A 4R1SA 1LTHR 3ENKA 2X7HA 1I01A 1M6HA 1NFFA 2GR9A 1BW9A 3T4XA 4MIEA 4CV3A 4KDFA 4HXYA 4I5GA 3QVTA 1Z45A 4JX8A 4E2YA 3VTFA 1EFKA 1F14A 3ROQA 5BSHA 5BSFA 3DZIA 4PLHA 4GKBA 4KMSA 4CM9D 2B83A 3GPIA 3I9JA 2JL1A 4AFNA 1ARZA 1PGPA 2X5KO 3GG2A 3RKUA 4TRNA 4F3YA 4WPGA 3ZNQA 1NBOA 4PG6A 4WNCA 4YJFA 1P1FA 4XYMA 1WMAA 4IPTA 1HYEA 3FR7A 4BIIA 1DFGA 1PL8A 3HUDA 1N1EA 4BNTA 1BSVA 5JCJA 4KZPA 4XGIA 4B3JA 4IIVA 4DREA 4PLZA 4AJNA 4YA6A 3U9LA 4JJGA 1NNUA 2AW5A 4NG5A 4PG7A 2DPHA 3GZNB 4FDAA 3L0DA 4EI2A 4R1UA 4GKVA 1PJ2A 1GU7A 4ND5A 1LC0A 2P5UA 1V3UA 3CH6A 2IZ0A 3DR3A 5B12A 2YHIB 4YACA 4NBRA 4R5HA 3NTOA 3BMCA 4CV0A 1P1RA 1VPDA 5TNXA 4NFHA 1RM0A 3LLSA 3OEWA 5B4VA 1NPDA 4XYBA 5TQVA 3SJ7A 1GQYA 4Q3EA 3DBLB 3GK3A 1FDSA 3JD1A 3QWBA 3P2OA 4R16A 5F5NA 2BFPA 2RIRA 5FYDA 4A5OA 2ZYGA 2GO1A 4ZU3A 1VE9A 2BD0A 4NJMB 1LA2A 3PDJA 4YAJA 5IZ4A 3WIEA 2D59A 2QG4A 1FDWA 1HEUA 2QHXA 3H9JA 4GI2A 4MKZA 4E5MA 1N1GA 1EE2A 4PGFA 4U8GA 3T7CA 5I9LA 5L4NA 4CMCA 3UXYA 1T1RA 1ZNQO 2IEBA 3KYBA 3F3SA 5DF1A 1JKFA 4JP2A 5IXSA 2B36A 1ML3A 2GZ2A 4DRYA 4ALNA 5F3RA 4PG5A 3V2HA 2P9GA 4CM9A 1GUYA 3ZWMA 3ULKA 5IF3A 1YB5A 3DO5A 3LF1A 4MVJD 5DBFA 1EBUA 4NI5A 2R2GA 4TROA 4GBJA 1U5AA 9LDBA 3WLFA 3DC2A 3DHYA 4ZRNA 2IDZA 3VH1A 4R68A 1HKUA 2XPCA 3KVOA 3PGXA 3QHAA 3TZ6A 1M6WA 3M2PA 4K28A 5T8KC 4NJMA 3GUCA 4UUNA 4HNGA 3GF4A 3ZWYA 4Q3DA 2UVDA 3EHEA 3Q2KA 1G0OA 4LISA 3JQFA 1U7HA 2PR2A 2GASA 5IZCC 1TVEA 1A4IA 2WD7B 1A9YA 4QEDA 2BGLA 2VHXA 3H9QA 5LDGA 2EWMA 4CR6A 4FGWA 1X0VA 4WASA 5KWEA 1HETA 2HMSA 3AUUA 5ER9A 1BHSA 1F06A 4W6ZA 5IDQA 2OORA 3QVSA 4J49A 3OICA 4GVLA 4U5QA 1DB3A 1E77A 2CDCA 1P1HA 2FR1A 4J2HA 5A9TA 3GY0A 2AQIA 1JWAB 2ILTA 2PY6A 4AVYA 3WYCA 4IZHA 2FPIA 3A4VA 1EMDA 4HBGA 1GCUA 1B3RA 4MKXA 1W73A 1ZO8A 1T24A 3KZVA 2VOJA 4JJIA 2GSDA 5B1YA 3DZFA 1OC2A 4XYEA 3TNLA 4ROSA 3VKVA 1LBEA 4CMEA 4E0BA 6LDHA 1H6DA 2ZQZA 3GVHA 4Q3AA 1C0LA 5THQA 2VZ8A 4NPCA 1EUCA 1K0UA 4WKGA 4BNHA 3VTZA 3O8QB 1NPTO 3QWFA 5DP1A 1SB9A 3AJRA 3F9IA 3ZV4A 1YH3A 1H6CA 2OL4A 2HUNA 2VT3A 4JJFA 3TFQA 3I1JA 4ALIA 3PQDA 3LC2O 3PRJA 4DYVA 3HADA 5JCJD 5JAQA 1E7RA 5F21A 2VTDA 1OZAA 3WICA 3ZW8A 2C5EA 1JKJA 3T4EA 4C4OA 1NPYA 3ZWXA 3LYLA 3GEGA 1R4MB 4O59O 2Q3EA 1NHGA 4J1TA 2X9VA 1RJWA 3JQAD 3D5QA 4YJHB 3FSRA 1P9LA 4XR4A 2J8ZA 5F5LA 3AM4A 2ZYAA 4BO0A 4OXNA 3Q9NA 3HG7A 4WNIA 3FNEA 1D3AA 1E3SA 1X15A 3AY3A 4NBWA 4DLBA 4B4VA 4DYDA 1LSJA 3PFWO 2PGDA 4DGSA 3E5RA 3ICCA 4YQYA 1PJBA 1GCOA 4GH5A 1NFRA 1R4NA 3GVCA 4Z6KA 1E3EA 1FDVA 3GFGA 4Q39A 3GDGA 5CDGA 3ST7A 1EDZA 4Z0HO 3AK4A 2VWHA 1WMBA 1VC2A 1ZSNA 2AE2A 2VHWA 2QX7A 1EDOA 4UEKA 4BNFA 2HU2A 2NTJA 4AL4A 4M87A 3W4KA 1UZLA 2IODA 2CNBA 4IDDA 4L75A 4M1QA 3VZQA 1WP4A 1EUDA 4Z3KA 3WJ7A 4WUVA 2P4HX 3ENNA 1HRDA 2IZ1A 2V65A 1NQAO 3BMOB 3VDRA 1XKQA 1QR6A 4ZQHA 3PHJA 2B35A 4L0QA 1HL3A 4CQMD 3SLGA 2LDXA 2JD2A 3JQEA 1I3LA 4BNZA 1BXKA 1OOEA 3UGKA 4BO3A 2CDAA 3O4RA 5C7IO 1UR5A 1W0CA 1Y8QA 3UFXA 1ISFA 2PK3A 4WCDA 1Y7TA 4CQLA 3DHNA 3TFOA 4I8XA 4I9NA 1LLDA 1QMGA 1P77A 1T2AA 4KWHA 2UUOA 4LCEA 2Z95A 4QUKA 4YEDA 2G82A 4WOKA 4WK6A 1T2EA 2J5QA 3PHHA 4EEZA 1DC4A 2I99A 5DOZA 5KOIA 4AJHA 2NLOA 4K6FA 1GZ4A 4IXTA 3K2BA 5BSGA 1ONPA 4ZQGA 1HE3A 4E2WA 3GUYA 2JAPA 4CR8A 1ZK2A 5KIAA 3FWNA 1E1KA 2O4CA 1EE9A 1ZSVA 3EAGA 3U5TA 1ZMOA 5A9SA 3BMNB 3IKVA 2C7GA 3PXXA 3GFBA 5IDYA 1F8FA 3M2TA 5L3ZA 3QLJA 3G49A 3Q1LA 3ANMA 4G2NA 4XQGA 3LDHA 3ZHYA 4DQUA 4OXKA 1Q0LA 1J0XO 3PYLA 1GUFA 4IJUA 3BTOA 2ET6A 4J16A 4N7RA 3RC9A 3S2FA 5L95A 1ORRA 2WE8A 3RUFA 3JYLA 4AJ1A 1KEVA 2VHZA 5GZ1A 3TZQA 2J3IA 1K2WA 4BNMA 1Y8RA 5EESA 1OAAA 4HFMA 5G0TA 5FEUA 3FR8A 1SC6A 3JCZA 3KTDA 4TVOA 1MFPA 2CVQA 3ZNOA 4E21A 3ETDA 5F1PA 1J4AA 1P44A 1V3VA 3AI3A 4Y6PA 2DBVO 4Y6SA 8ADHA 5CHEA 3GR6A 4YYZA 4ALMA 5JC1A 5KKCA 1QV7A 2Q2QA 5BNTA 1Z7EA 4YJFB 2ZCVA 4YT4A 5ITVA 5A04A 1NFQA 1XEAA 4B7XA 4BNNA 1S6YA 3FNHA 3D4NA 4W7IA 4IINA 2D8AA 1LSOA 4KOAA 3TN7A 3H3JA 1A71A 3EVTA 4EGFA 4RPLA 3W4IA 3JQGB 1N7HA 2DPGA 3ZCXA 2YV1A 4TKLA 4XD2A 2RAFA 1SBYA 4YAIA 2W2KA 1Q7CA 4BNYA 5U9CA 1EQUA 2H6EA 3I9LA 5COQA 5JS6A 3WG9A 1WZIA 2ZB7A 3BTSA 4Z0PA 3VHRA 3IMFA 2CF6A 3ZNNA 2QRJA 4KDEA 3INRA 1KVUA 2NM0A 2ZTVA 3C1OA 3NKLA 1XG5A 5DN9A 4ZD6A 3MJVA 1I2ZA 4DMMA 1L1FA 3WBBA 1ENPA 4K9DA 4IDGA 1K3TA 4ZQBA 1DFHA 2HJSA 4IDFA 4MVJF 3NT2A 3DBLA 3B6ZA 5TX7A 3H2ZA 4O6VA 1UXJA 1E1MA 1YBVA 3DZJA 1ZMTA 3Q2IA 4PLCA 1N8KA 1JQBA 1LDNA 2POQX 1BDMA 4Z3DA 3CPSA 1VM6A 3PPIA 2ZB4A 4MVJA 1I2CA 3DB2A 2HMVA 4GGOA 1PGNA 3EUWA 3PHGA 1KVRA 5DBIA 1KVTA 3WGGA 4H16A 3DOOA 4QO8A 4I08A 1LDGA 3BMQB 2V7PA 1U8XX 1UP6A 1HF3A 3TZHA 3INGA 1IHXA 2RH4A 4Y67A 4DC0A 4PN3A 4M49A 4XIJA 4IM7A 1ZFNA 3QVWA 4DPLA 5G4LA 3ANLA 1PX0A 1HE5A 1TB4A 1TXGA 3UF0A 3ZGYA 4NZ9A 3MJSA 3WR5A 3DTYA 5HWSA 4ND1A 4YRAA 1HDOA 1YL6A 1E3WB 4WECA 3WWYA 3OF2A 1CYDA 2PLAA 5BR7A 5ILGA 2V6MA 4XYLA 3RD5A 3WJAA 3O26A 2HMTA 2ZTLA 2WYWA 5DCUA 3UCFA 3HHPA 2EJVA 5L51A 2FWMX 1SEVA 2GN4A 3EGOA 2ZATA 4R01A 1I5RA 3E5MA 1GEEA 3GN1A 1T26A 4U6QA 3DHEA 2YV3A 3OEYA 4E31A 4UVIA 5JYEA 3KM0A 1BW9B 3OIGA 4RPHA 5TGDA 2PD3A 4YJGB 4BB5A 1H0KA 3OP4A 5JAZA 3GG9A 4XWYA 2C20A 5L4SA 2NVUA 1VKOA 4KUEA 4MP3A 5H83A 2JFHA 4IIUA 4Q9NA 3RJ9A 1YDEA 5JE8A 3KEOA 3NTQA 3R0IA 4FC6A 1DBVO 3N58A 4J1QA 2Y1GA 4IQGA 2D5CA 2PD4A 2E49A 3WB9A 3AOEA 4J3FA 3ETEA 5CPBA 2FPPA 2UDPA 4YAKA 3HB4X 5IN5A 4GX2A 4BQPA 3JQ7A 4HY3A 5KNLA 1Z82A 3Q6IA 4CQMB 4BV9A 1L7EA 3IQDB 1ZK0A 2ZIZA 4DUPA 3VH4A 1X7DA 2AHRA 3DBRA 4FN4A 4LK3A 3ZWVA 2UUPA 3D7LA 4CLDA 4IDCA 3PLNA 3MOGA 4D43A 4C7JA 1ZW1A 3HWRA 4ZRMA 3CZRA 2FR8A 4BO6A 5I7SA 1DC6A 1LU9A 1R0KA 3NX4A 3C24A 4QQRA 4R1TA 1IL0A 4EBFA 4U0KA 3AOGA 4RPKA 4CUZA 3BMOA 2G5CA 4OKNA 3TPCA 3W6ZA 1DJQA 1TT7A 3F1KA 2G17A 2YZ7A 5EPOA 3JSAA 1PS8A 3GDFA 3DBVO 3RAJA 1LDEA 2F00A 1LI4A 2A94A 3I6QA 3LF2A 1DLIA 3HSKA 3GLQA 3STHA 3NDIA 2EIHA 1NQTA 1FK8A 5LCXA 3AU8A 5F1KA 1NX6A 4TMFA 4D44A 5L7WA 4OAQA 3PYXA 1I3MA 2J3JA 1VLLA 3JQ8B 1VJ0A 5JDCC 1IY8A 2PFGA 4K26A 4JIGA 3GVPA 3PK0A 3NGXA 2WSBA 4JQCA 2IXAA 3P5SA 4HFRA 1ZXBA 2H63A 2JAHA 3KLMX 3OHSX 1EK5A 2PKRA 1A5ZA 4LGVA 2OOSA 4MP8A 4ZQEA 1E5LA 1Q2XA 1WLYA 5CAEA 3ABIA 2YDXA 2BH9A 1TEHA 5JMPA 2AMFA 2HJRA 2AG5A 2HQ1A 2X58A 3C85A 1PS0A 1YOVB 1YB4A 3GC6A 1Z73A 2Q50A 1K5HA 4MP6A 4GLLA 4XQCA 2A35A 1U28A 4JROA 1OFGA 3ZU4A 1UAYA 3WFJA 4EJMA 1QSGA 1YONA 1U3TA 2B69A 1U3VA 4XYGA 3OETA 2RHCA 3NT4A 4PG4A 4CMIB 5BQFA 5KJEA 2I67A 3L6DA 4Y9DA 4HKTA 4F6CA 1G1AA 2VYVD 3AI1A 1HZJA 2HRBA 5IAAA 3DQPA 2DUUA 3LQFA 1P1IA 2BGMA 4IJKA 3ZDFA 3VH3A 3OECA 2FSVA 4UVGA 2O3RA 3D4OA 3U3XA 1U8FO 1ZSYA 2JHGA 1ENYA 5HS6A 2IZZA 5T8KA 3H5RA 2D2IA 2PD6A 4P4GA 1ISGA 4XB1A 1NR7A 1N2SA 3R1IA 5TSDA 1GR0A 1NQ5A 1MLDA 1XU9A 2X8LA 1A27A 3KYCB 1PTJA 4F6LA 3WLEA 1H5QA 2PZLA 4AJJA 4PLVA 3WWZA 3E1KA 1N7GA 5H81A 3ZHZA 3LT0A 3SEFA 3O9ZA 3LZ6A 4P4NA 2VWPA 1E6UA 1HZZA 1RYDA 3DFZA 4RF5A 3JQAB 3IJPA 4CODB 4R3WA 4PLPA 3X2FA 1X1EA 3LVFO 4ND4A 4D0RA 2NQTA 4FB5A 1ZZEA 2J3KA 4II2A 1TT5B 1M2WA 1QYWA 2FZWA 1MG5A 5A3JA 1YXMA 5B4UA 4RQTA 3GZNA 1F0YA 1GFSA 3ON5A 3HN2A 1X7GA 2I65A 3WOHA 4A26A 3L4BC 2O3UA 1A7KA 5ER6A 1YJQA 4RVSA 4J4HA 4U0JA 1DIAA 1U4OA 3OBBA 2C2YA 1K89A 2YYYA 4O5OA 5GMOA 4OHUA 1PJSA 3LSYA 2CVZA 4E5NA 3IP3A 3AUTA 2Z5LA 3RROA 4CUKA 3H9GA 3AFMA 4OO3A 5T67A 5ILOA 2OO5A 3I6IA 4XGNA 4L73A 4QECA 2OGUA 5JY1A 1ZJZA 1XHLA 1M67A 4IBOA 3WYBA 1I2BA 3QE3A 5ICMA 1ID1A 2BKAA 2NACA 2PZMA 4Z9FA 3EDMA 3A14A 1ISJA 1YL5A 4WLEA 1NAIA 2QZ9A 2PGJA 3WTCA 1E3LA 3V2GA 3HDQA 2W2LA 1HXHA 4NBVA 3V1TC 1A7AA 1T2FA 3BHIA 2X86A 1UJMA 3EY4A 2VYND 2PTGA 5BNFA 3ONEA 3PIDA 3BHJA 1SAYA 1U7TA 2DTEA 2X9NA 4HNHA 3GPDG 3OJEA 2O4UX 3AUSA 4E12A 4QFDA 2C7VA 2WD7A 4GAEA 5EQFA 3TZKA 2Q2WA 3EK2A 1UUFA 4PVCA 1CIVA 2ZB3A 2GGSA 3RC7A 3NTRA 4GWGA 4XDZA 2YJZA 1PGOA 1QXSA 1UZMA 4XEHA 4NK5A 1WAMA 5JY6A 4BKOA 4YWJA 4IY1A 3FNFA 3S2EA 1KEWA 2NTNA 2EKLA 3DBHA 4B7UA 4FFLA 4JLWA 1PQWA 4FFMA 1GV1A 1EZ4A 5EN4A 3WMXA 2NU7A 3FPCA 1HT0A 1C1DA 1O5IA 4X54A 5KTKA 1NXQA 3OFSA 3FF4A 3H7AA 3F6YA 4J0EA 5L9AA 3KBOA 3PQEA 1I30A 1UP7A 2D0IA 3Q9UA 3AFNA 3VVCA 1I10A 3SLKA 3AM5A 2DU8A 3CSDA 3MWDB 3KO8A 4IS3A 4UVHA 1P45A 4DIOA 1U9JA 4BO1A 1CQJA 3IP1A 4JN6B 4B79A 2XF8A 4FW8A 2JJYA 4PRLA 3A28A 1Y81A 1CWUA 1VSUA 1SEPA 1YS4A 3AY6A 3H9UA 4YBZA 4DLLA 3PVZA 3H4VA 3NJ8A 2FR0A 4UUPA 2AQ8A 3HJAA 2DFVA 1IB6A 1Q7GA 3OIDA 1SZJG 1KY5A 3TOXA 3VKUA 3UCXA 1ULSA 4YTEA 2O3QA 4MVJH 1D8AA 1LQTA 1KIFA 1BMDA 3DTTA 4B7CA 5GZ6A 4RORA 4BB6A 4NH4A 1NVMB 1XA0A 4GGPA 4MVJM 1ADFA 4D46A 3BMCB 3R3SA 2G0TA 2HDHA 3JD3A 5DULA 4DA9A 5L40A 3I3OA 4OSOA 2QYTA 4PLYA 3JQAA 3ADOA 2E82A 3HQ4O 5I7EA 1ZVMA 4PVDA 3NT5A 2X1HA 3IIEA 4RVHA 1HDCA 1OC4A 1CDOA 5TS3A 5C7OO 2DBQA 3DOCA 3RUIA 2HMWA 2PH3A 3FBGA 3IAHA 5I7FA 4W99A 4ITUA 4ND3A 1EVIA 1PJTA 3VDQA 2PWZA 3WNQA 1BXZA 4IDEA 5T6BA 3JD4A 3RUHA 5AOVA 4RLSA 4BS9A 1YGYA 4BKUA 3PJFA 3TF5A 4E4YA 3V8BA 1LLQA 1C3VA 2GN9A 4FFOA 1V9LA 4CV2A 2RH8A 2AXQA 3DXFA 1VSVA 4NFYA 2WJPA 1AHHA 1JKIA 4RVUA 2EEZA 1BXGB 1VJTA 3F4LA 3L9XA 3ZNPA 4NMHA 2DTDA 5AXCA 4J4TA 4KTVE 5K6AC 1E3WA 4FIZA 5CDSA 4JGBA 2DBRA 2NVWA 3WMWA 1I33A 1JAXA 1QYXA 4OMUA 3C8MA 4BUCA 1XIVA 3SBOA 3JQ7B 3T7EA 7MDHA 4BNJA 4MDHA 5ADHA 1LLUA 1IOLA 2NVBA 1UDAA 4GQAA 2X9GA 4OOFA 2FSSA 8LDHA 1R16A 5L45A 1GQ2A 2O2SA 4XGKA 2NQ8A 3RI3A 1C0PA 3B1JA 1U2GA 1P74A 4BNKA 1DRUA 2A92A 3TL2A 5JDCA 1PR9A 3E9QA 4TWRA 2J6IA 3DWFA 4RDHA 1CF2O 4GMFA 4L4RA 3NAQA 1M75A 3DZKA 3F4BA 1PGQA 1WXDA 4U7WA 4CMKA 4ONEA 4A7PA 4BMVA 3KSUA 4BNUA 1VJ1A 1N5DA 2C54A 4PRKA 4YDRA 4QO7A 4BO4A 5JDIA 1Q1NA 2V6FA 3L07A 2QIOA 2VNAA 4H15A 5C3MA 4QFCA 1KYQA 4J2OA 4CMEC 2YHIA 3QWHA 1AXGA 1E3JA 1CETA 3BAZA 3GH3A 4TRRA 1A4UA 2BRUA 5AXAA 1GL3A 4G81A 1NWCA 3F1LA 3H6KA 2WEKA 2YUTA 1ENOA 1O0SA 3W8DA 3BMNA 2NU9A 3S55A 2DLDA 1DSSG 2VHVA 3ITKA 2NU6A 4UUOA 4KQWA 1PR3A 4MJLA 2X0IA 4WEQA 3ZI0A 2RCYA 5ICSA 1GYQA 2QRKA 4D7AA 2GN6A 3IC5A 4BMNA 1QG6A 5KJ6A 1QYDA 3V1UA 4BNGA 1Z74A 1NM5A 3GHYA 1V6AA 4IJVA 4BL5A 1UXGA 1D1SA 3E82A 5COBA 3W8EA 4O0LA 3RUAA 3GHHA 2GD1O 1R15A 5G0VA 1O9BA 3JQFC 4E5KA 1GV0A 1F17A 1NAHA 1Q0HA 3MEQA 5I9NA 1QP8A 3ZWWA 1SPXA 4IJWA 3FWZA 4JBHA 2AG8A 4MIOA 4FR5A 2BI8A 4GSLA 4ZVVA 1DOHA 2Y67A 3FPLA 3A9WA 1SCUA 4Q3CA 5CG1A 4LSMA 3WDSA 3LLVA 2AEJA 3RU9A 2DUWA 5JXWA 3PYMA 1LDMA 4CPDA 1W4ZA 5THKA 3ZU5A 1H2HA 1H2BA 2O7SA 2VYVA 5EIOA 5H82A 4BO7A 3OJFA 4J43A 1S7CA 3HNPA 3GNTA 3D3WB 3CMCO 4PG8A 1Y1PA 2A9FA 1PJ3A 4NK4A 2VN8A 1P1KA 3I9OA 2YQ5A 1NQOA 2DC1A 1YB1A 2AE1A 2QQ5A 1E7MA 1SMKA 4RF4A 5CEEA 5ENVA 3SVTA 4OKIA 2P2SA 2Q99A 5IDWA 5JMWA 4CLHA 3WGQA 1T2CA 3FHLA 3I4CA 3WX0A 1ISHA 1X1TA 5L53A 1LRKA 2I3GA 1IUKA 3CMMA 3HDYA 1DFIA 3ZV5A 3TSCA 4GLOA 3JQBC 4E13A 3E9NA 1DAPA 3NUGA 2V6BA 4FFNA 2CFCA 4OGWA 1LSSA 4YAEA 5GY7A 2W2KB 1YO6A 1G0NA 3OIFA 2QYSA 3EVNA 4M89A 2FMUA 1GZ3A 3JQ8A 2FZEA 4JP3A 3FI9A 3UAGA 4RDIA 3P2YA 3WXBA 3FNGA 1HLPA 4PZEA 4XJTA 2VRBA 3M1LA 5JLAA 2QW8A 1ZCJA 2YDYA 5B4TA 1B8PA 1B8UA 6ADHA 1MG0A 2VRCD 4RPJA 4R69A 3TZCA 4BKPA 4RF2A 4CQLB 5A5FA 3KB6A 1K6XA 1V8BA 2Q1UA 4CL8A 1NP3A 3RFVA 4YPOA 1ZJYA 1Q7BA 3VZRA 3HN7A 1NHWA 4JNKA 4NR0A 4OJNA 3RU7A 1PEDA 3WFIA 1KBZA 1PL6A 3AW9A 2DBZA 3GEDA 4N5NA 1KOLA 4M8SA 3UKOA 4N18A 5IJZA 1ZK3A 2TMDA 3C1AA 3D1LA 3H5AA 5FWNA 2GLXA 4IMPA 3B20A 3RSHA 1BTOA 1ZK1A 4NDNE 4RVGA 3PHLA 2D5AA 3CKYA 2Q49A 1K6JA 2EERA 3DMYA 4RZIA 1B0AA 2OFPA 4E6PA 1U1IA 4GX5A 4CMGA 3D5TA 1C1XB 4LCJA 4A10A 4ID9A 4HV4A 2YFQA 1H94A 1AN9A 4ALLA 2V6GA 3A06A 3FTNA 2EHDA 3GRPA 3HFGA 1XQ1A 3JV7A 3P19A 5EQDA 3WGTA 5G4KA 2Y1OA 2GZ1A 2VHYA 3DFUA 4NHEA 5FI3A 2B37A 4DLAA 4AJPA 3S2IA 3OJLA 4FOOA 5L7TA 5JAIA 5IN4A 1T4DA 3K31A 2PZJA 5KVQA 1RYEA 1LEHA 3BYZA 3UUWA 1BVUA 1ZEJA 1I32A 1WWKA 1OBFO 9LDTA 4NU5A 4DBZA 1WDMA 3JYQA 2OP1A 4J7XA 4JCOA 3DMTA 1HWYA 2P9EA 1BXGA 1C1DB 3Q11A 1UZNA 4FFPA 2FHSA 3TRIA 3DAFA 1J49A 4MPDA 3UICA 1GD1O 4AJKA 4NU6A 2Y0CA 3FCOA 3D4PA 4IQ0A 3GMDA 2P9CA 2P68A 1H93A 3DONA 1XGKA 1SOVA 3H2SA 4FBGA 2CMDA 1GYRA 4A27A 3K9QO 2H5LA 3AM3A 4O1MA 1HDZA 4TQGA 3ZU2A 5I7VA 4E5PA 4YAGA 1EFLA 4TKMA 4P4LA 3U4DA 1HTBA 3JYNA 4OM8A 4B4WA 4CLEA 5BNIA 2ZJ1A 1DIBA 4UEOA 2IYPA 1E7QA 1E7WA 2GCGA 2GUGA 3NGLA 4FFRA 3VOSA 4J6FA 1DRWA 4WLVA 1MFZA 4A0SA 3IJRA 3LK7A 1Z7BA 2HCTA 5A05A 2H9IA 2AQHA 2Y0EA 2JFGA 3K6JA 3RVDA 2JFFA 4CMJA 4Q3NA 4KUHA 1WDKA 2WE7A 2IRWA 2NU8A 5EL0A 3MJCA 3UCEA 4UREA 1HYGA 1R0SA 2FPGA 2OXIA 4C7KA 4E2XA 3GGGA 3H3FA 4RL6A 1PZGA 2VOEA 3L4SO 4PCVA 4CLOB 2EP5A 3RBXA 3RFXA 3RC1A 1BDBA 4J9VA 5TJHA 1XCBA 2DM6A 2Y1FA 4W4TA 4UAGA 1DIGA 5U4QA 5JO0A 3WGHA 5KVCA 4A2CA 1PU2A 3QW2A 4IDBA 3DDNA 2BFMA 4UVDA 4W9NA 1H9AA 1EVJA 2G76A 5LC1A 1U5CA 3HE3A 1QLHA 1N9GB 4BMSA 4D3FA 1PZHA 1P1JA 2GNAA 4P8RA 1FDUA 4R41A 4OSPA 4CM4A 3ANNA 4RPGA 1KC3A 4B4UA 3WGYA 3DAPA 4LMRA 1EVZA 4WLUA 2CDBA 3WNVA 2HMUA 1A9ZA 4BKRA 2CF5A 1TLTA 1J5PA 3KSZO 4Y6RA 7ADHA 2P91A 5G0UA 4DQVA 2PV7A 2Y1EA 1MP0A 3NDRA 2P5YA 4L4SA 3H65A 4D3DA 4J7UA 2QZZA 1G6KA 4GMGA
chains in the Genus database with same CATH superfamily
4I1YA 3F71A 3LG2A 4WFJA 3NHUA 1B23P 4KYVA 4L4YA 1QGED 3PUWA 3VH2A 3H2BA 2I1QA 2PGLA 3KJIA 4S2EA 2O2YA 3BTVA 4CL0A 1VKNA 2QNRA 2YYSA 3HJRA 2DRIA 4LN1A 2MYTA 3RVQA 3E58A 1H6AA 1Z6XA 5TC4A 3KYCA 4MDFA 1E1LA 4YHBA 3VPGA 4DDHA 1SVIA 2QP9X 3HH8A 3M6AA 5LYJA 5F78A 1PLKA 2BGKA 2VCYA 1MDBA 4JEHA 2JI6A 1AK2A 4RACA 3JQDA 4QU9A 4B6RA 4FD3A 1MKYA 2QX6A 2IGBA 4PLWA 5AM0A 3B1KA 3MUEA 3SZ3A 1TJNA 4POOA 4QOJA 3NRBA 2O8BA 1JIUA 4EKNB 3X43A 3FRJA 3AL2A 3QZUA 4DAOA 1BN6A 3UM9A 1ZIDA 4XA8A 4X1IA 3R0ZA 3VYTB 2ONYA 3DPIA 1TAQA 1FUIA 2C0PA 3R3XA 3D5EA 1A9QA 2QLBA 4GPD1 5CPFA 4DCPA 1CRLA 2JF0A 5EC8A 3PTZA 1FYDA 3UB4A 1ESNA 2AI3A 5DI3B 3GCGA 2IW3A 2LD4A 2QLTA 2QTMA 2AVNA 2X1MA 4ZOAA 3L7LA 3MJHA 2ERCA 3CNOA 3KSRA 3PKJA 3K20A 5TT1A 3W2HA 4YPVA 1A2BA 4C03A 3IPLA 1C7RA 1NF8A 2BFDA 1P61B 2HPVA 5T57A 3T7IA 1X9IA 2QEQA 3WIUA 3QBEA 3K0CA 3UWSA 2EGHA 1SIWA 4F71A 1KZ1A 3ZDZB 1C8BA 1LQUA 4X85A 3TH5A 3QUQA 1YF3A 3CH5A 2GZAA 4J4BA 4RAQA 5DN6A 4HB4A 3MCVA 3ROKA 3WQRA 3L43A 4KRYA 3FHCB 2VYNA 2ODPA 1KDOA 3U80A 3SR3A 1ZN2A 4WA8A 4D79A 1DADA 1JR3D 1KAHA 2ZSIA 3LY5A 3PT5A 4IQFA 4N8EA 1WMEA 1G291 2QMHA 3SXPA 3TL3A 1TO1E 3SKXA 1U8AA 1FYWA 3KZXA 1YQWA 2YQ4A 2PUHA 3P4YA 1ORTA 2MHCA 1Y9AA 1Q17A 2VYCA 4YRMA 1AGYA 4C29A 1HY3A 4HRAA 5JCOA 2HNBA 1NLYA 2VQSA 3OZCA 5I7RA 1LS6A 1PX2A 2NXEA 3V2UA 1PZMA 2IXDA 3CZMA 2IYNA 4A03A 4DLPA 5JD5A 4K6HA 3COWA 4BO8A 4R1OA 4YXFA 1HEIA 2O7VA 3UHAA 4EHKA 3ELUA 3G9UA 4RS4A 5CLFA 1RXUA 2NSLA 4AMZA 1X19A 1AV6A 5MF6A 1ZH2A 3KR1A 2MR5A 3HJBA 4PLFA 3K5PA 4CQMA 3DKKA 1MR3F 4DA0A 4IXMA 4IOKA 4YJGA 2OP0A 5IHPA 2JGDA 1YRBA 3TDNA 4H7IA 2H0QA 1C29B 1JRLA 1N32B 2O8DA 5HFNA 3G7SA 3MILA 1TUIA 3GFOA 5IJ9A 2DYKA 1V0JA 3FUWA 1IHYA 1BD3A 2YXDA 2OO3A 4F5WA 1B0UA 5AESA 5K0TA 3S2UA 2J7PD 1KAGA 4IQ8A 3LQQA 4QIHA 3G85A 4F5ZA 3EZLA 1UADA 1I7NA 1PZFA 1RWOA 2GX6A 5EXDA 5DTRA 3NZEA 4E3WA 4DR7B 1UMCA 2FNAA 3FWPA 3RG2A 4FMDF 4IL5A 2BTQA 1VFPA 3I53A 3RBVA 1SVMA 3G0BA 5A9RA 1AZSC 1P0FA 2B6HA 4I1IA 4AN0A 4D25A 3CNBA 2AMJA 2ESRA 3ZH2A 3W0LB 4NJEB 4ALJA 1G21A 2P9YA 2O0KA 1D07A 1KFCB 3H13A 3LT4A 3N2YA 3QKRA 3QKSB 1E99A 4NBNA 1YR2A 1O58A 3RHFA 4M0FA 1FTYA 2K7FA 1SC9A 3U4IA 5BOSB 1PV2A 4HLDA 5A03A 5GZ3A 1HYQA 5AM5A 1DJNA 2QLJA 2ZEJA 3CF6R 5HJ2A 1W581 2O5RA 5K6AA 3K3PA 5ALOA 4ZYUA 1VRVA 3L8YA 4NCAA 2BUBA 3L8ZA 4F2HA 1KEEB 2ZYUX 4ZZ0A 2I9KA 3Q3HA 3UMFA 4M1TA 1OZGA 3WIDA 4BB9A 3D8RA 2I7VA 1GPBA 2VUSA 3BM5A 5D5HA 2OCKA 4HDKB 3O03A 3A2KA 2UVPA 3AX6A 5ANRB 2JJQA 2XOXA 1VPEA 4TRJA 4DMKA 1YOBA 3JTEA 3SIRA 4KIUA 3M1AA 2IYUA 3RRFA 1E7SA 4RD2A 1HE2A 3VR1A 4EO7A 3T7DA 1VI5A 2JCYA 4AS1A 1WUIS 2CWDA 3UN1A 1SNYA 1CUEA 3WKBA 1REQB 5LNK1 1MAAA 4Q6BA 5D00A 1XQVA 4FZ3A 3T7RA 2IQIA 5K0ZA 2VT6A 1RM4A 1UK7A 2A1IA 4EJ6A 3V8VA 1F8YA 1P6UA 2GBCA 3ANYB 1YA6A 1PQPA 1P19A 2QZJA 2XXBA 3O8LA 5JD6A 3UHPA 3VC7A 4UPDA 3QXGA 4GFDA 4LOLA 3UHFA 2PX0A 3PZRA 1NE2A 4MA5A 3I05A 3RS9A 1YACA 3AI2A 4UVEA 2NIPA 5GADl 3S81A 4UZSA 3IOYA 5D01A 1A4XA 5JD4A 4W8GA 1IXKA 1RRPA 5HRUA 1T29A 5G0SA 3RVMA 4RO0A 3A9VA 5DBGA 3ZHTA 4C08A 3PD1A 2JIBA 4AD8A 5DO9A 4I5DA 2Q21A 2I29A 2Q3JA 4NNJA 4U6NA 5D2CA 3VPHA 2X0RA 4LKOA 3OT1A 4C14A 3AF6A 2V7XA 5KMGA 4B3GA 2RHOA 3EXEA 3LCRA 1Z5NA 4D8UA 2W98A 1EM8A 4GBMA 1UPUA 1M66A 3K5HA 1TCBA 2Q3LA 4UMDA 2AZ4A 3PV0A 2BMFA 1OFIA 3A4IA 1VL6A 2VAVA 4MCAA 3WC4A 4P82A 3WGOA 1CZHA 1FNNA 4F7WA 5FUQA 2XB6A 4O4IA 2ONJA 3F73A 2UXBB 6ABPA 3QU2A 4G0WA 4HADA 4R2IA 2WQZA 3GVIA 3VZPA 1N77A 2Q8NA 4DV6B 3I0MA 1P31A 3WISA 2H7XA 2VUTA 3IQWA 3K96A 3ONVA 4RKEA 2GK7A 1M54A 3JR7A 2I6GA 3PHIA 2CY0A 2G9ZA 1RQLA 3HXLA 2Z09A 1WB6A 3G1TA 3KR9A 5AQ1A 2DUMA 4RENA 4C4TA 1F8GA 4AJ2A 1MC5A 4N3CA 3THYB 2YBEA 3PJRA 3NV7A 1YRLA 2P41A 3EFHA 3P9RA 1U94A 3DULA 3QHPA 1N75A 2V7QA 1ECCA 2WHYA 2Z98A 3KAQA 3L8GA 4WZAB 1LI7A 4EEXA 3TSWA 3OAAD 1NRXA 1DDGA 3T5CA 2GB4A 1XZBA 2Z9BA 5LN1A 3AM1A 1EAYA 2I4IA 4JKOA 3JZMA 3TAXA 3JAWA 1P7CA 3ETJA 5B6PA 3GJTA 4AO6A 4Y7CA 4C0HA 1L3IA 1L4MA 3HYSA 3P26A 4LV6A 4E14A 3IEPA 2AG6A 4CF4A 4RS3A 1W85B 2XGSA 4CIWA 2F48A 3JPYA 1GG5A 2B5VA 3V1YA 4M0EA 2G5TA 3B5JA 1Z6QA 5EWMB 3TDKA 1IM5A 3NRCA 1ISMA 3L02A 4HTFA 4IF4A 3DB1A 3HRIA 1C14A 3PITA 4JDUA 3O8NA 1GN8A 4X7RA 5IM5A 1DIHA 3VV2A 4CV1A 5HKAA 2XMCA 4LXUA 2L17A 3OQ1A 3GEEA 4RFLA 4UCXA 4CCYA 3RVRA 4YCMA 1DC7A 2CHQA 3BB3A 1OXBB 2VTEA 3OFNA 1SQSA 4KXYA 1U8CB 2Z8ZA 1N7JA 3I01A 3KKOA 3B2EA 3QGMA 3VM6A 4YQZA 5JALA 2C61A 2O48X 3C1TA 2PSDA 4H77A 5KVSA 2J0QA 5CJJA 1C3OB 2RGRA 3ISVA 4JP5A 1X39A 4MVYA 4UHBA 4LQ4A 4UW9A 3RBZA 4XJXA 2PX5A 2OECA 2Q4OA 1LRJA 3SZLA 3RJMA 2P79A 4LE1A 3JWIA 3HEBA 1LTKA 2QJWA 3EC7A 5GJWC 5LZ8A 2RH9B 4QOEA 4TV9B 1RLIA 2DOKA 4F1WA 4ARCA 4Y6QA 2YJNA 1VXOA 5H3LA 2IY9A 5KQPA 5C5IA 2QN2A 4F3TA 4RZXA 3M9WA 1XI2A 5BUCA 4K9LA 2J5KA 2A3RA 2Q5EA 1PD0A 2WAAA 3MYYA 1YBMA 3PC6A 4TN5A 5KYYA 1JIXA 3OBIA 3WMFA 3JAMA 3EPRA 2XVZA 4MWSA 4BGIA 2WLTA 1V8ZA 1VL1A 4Y7DA 1WX1A 5I8PA 1NI4A 4ARSA 5ALSA 3D0KA 4N49A 3C4VA 3EEOA 2N47A 4FOSA 4GP7A 2JIQA 3AF1A 3IGFA 5IAKA 3OVMA 1BFDA 2NYRA 4B8ZA 2RGNA 2BFOA 1SKBA 1TA4A 3OJOA 2O3JA 5B3JA 5K05A 3SBEA 1E5QA 5CNIA 3HXTA 3T12A 2EOAA 4KBYA 3ILHA 4N54A 2AA3A 1GPDG 1GTVA 3FH0A 1J06A 4LVCA 5DH9A 2VNSA 3QY9A 4TTVA 4PPQA 2QUKA 2WAXA 3HC7A 5TDHA 4E70A 4JT2A 3T8YA 2FRDA 4CLOA 1JH9A 2V59A 3UJPA 2QBYB 1TADA 4MW9A 3BRSA 2VJOA 3LUDA 3QE2A 3QXCA 4RH1A 1GWNA 2DECA 5DLYA 4TLEA 4FEYA 4Z9AA 3ICPA 5CFOA 4TZTA 3NALA 4YV2A 4LF8B 4OHMA 3AEUA 4HWTA 2HLDA 5KMGB 1MXHA 1PJ4A 3IDAA 1I7DA 3MT7A 3QVOA 1DX6A 2Q1YA 5I9TA 1ONNA 3TUJC 1GAEO 2BHLA 3CV3A 3IERA 4DDWA 4RA9A 5CEJA 2ZDHA 4F72A 3SXJA 1YZKA 3UJ8A 5JNRA 2P67A 4QG7A 3D6MA 4WXEA 2IHUA 1UXIA 1B8VA 1ZDMA 3G1UA 3OX3A 4HN4B 4UM9D 5A1JA 3QNWA 1BG6A 5KB3A 3L04A 5AKYA 3OE5A 2CXNA 5DEOA 4LG1A 1JJBA 4DCVA 2QX8A 3NH6A 4MIKA 1R27A 3PSAA 1BCSB 1IZ8A 1OFUX 4ZI5A 4IGFA 3O38A 1NYRA 3BXHA 1MX9A 3OCUA 2Z3WA 2V7QD 2XWJI 2C0CA 2LXNA 3CISA 4JBGA 4V0NA 4WN9A 1F3LA 4GX1A 2GAFA 1VKZA 3LA8A 3FJOA 4QPNA 5ISMA 1QZXA 2Z1MA 3DMFA 1K2VN 3MLBA 1NATA 1YZ3A 3UH1A 3WLHA 4PYKA 1X13A 2PN1A 2NUPA 2WIKA 3V9PA 5DCWA 2W6JD 3K4PA 5EPEA 1JDSA 5K3DA 5CB4B 4KXQA 3VPAA 4LYEA 3DMTC 4Z0NA 3W6PA 2C2WA 2QDKA 1O6BA 1SB8A 5TGZA 2GFHA 4IXWA 4JA2A 4NBUA 2AFHA 4R2KA 4ZQFA 4OI2A 1DZ3A 4D4GA 4YUAA 1NZDA 4CMHA 3O4FA 2ZSHA 1KWGA 5AJWA 1P2DA 1KR2A 2EZUA 1FZQA 2HGSA 5J2TA 3QFHA 5DMXA 3KTAB 2ZXUA 1SUEA 1U2PA 1CJUC 1ZRSA 1B2LA 2COEA 2A58A 2H2FA 4OBWA 1KVQA 4JD5A 1POWA 1Y5NA 1RI5A 3D3EA 3EEFA 1RJEA 4R1MA 3W4JA 1CRWG 3VU0A 1JNYA 1JZSA 2DPXA 3NBAA 3GLIE 2E5LB 4LJ7A 4UBJA 1THGA 2GBPA 4H0CA 4LQDA 2ZI9A 2C42A 5F2OA 3SC4A 3HGQA 2Q3CA 4RULA 4TYMA 4LX0A 2W4QA 3MTEA 2R0QC 5DWDA 4R9RA 2YNMC 3U44A 5LDHA 4L76A 1HUQA 3UZUA 4ETNA 2ZUEA 4UE6A 3AGPA 1Y3AA 3OEHA 3P9IA 4YP0A 4R6WA 1XK6A 4UAUA 1EGVB 2FWNA 2OM6A 2VDPB 3IP5A 4G0QA 5AI9A 3GPLA 3EZYA 3I1IA 2B78A 5E1DA 1XXHE 4DWOA 2D54A 3WL4A 5JS2A 1ECBA 1I9GA 2JIZA 2QMZA 4L5IA 4RGBA 2XJ4A 2WYOA 1IFXA 4MXDA 3U62A 2Q7XA 3W5VA 2ZREA 1CHDA 4F3NA 5JS7A 3HVKA 5JO9A 4MOWA 4CCSA 1F7VA 1YR6A 3D1VA 4S05A 1Z34A 2ZXEA 3A1CA 4KU4A 3EXG2 1IQRA 4L95C 2GPTA 5C31A 3TJZA 4DMLA 2RMKA 4Q3BA 5KJFA 2IPXA 2ODBA 1VB5A 2H1RA 3B1WA 1GPAA 3CXUA 2O2ZA 3DG9A 1DQRA 1LLCA 1UQUA 2ZPUA 4I5EA 5LXTB 5T64A 3WYEA 3AF3A 4EDFA 1A2QA 4Y2YA 5D1NA 1SCIA 3KHUA 4G63A 3OEEA 4ZVTA 1ZUHA 3V7YA 5FBQB 5E3JA 1CB7A 2PQMA 3K1AB 3I28A 4QDUA 2P2ZA 4QXMA 4BLWA 1WZ2A 3PEFA 2VQ3A 2VPYA 1CP3A 4D74A 5FH9A 2LNDA 1PNOA 1KPIA 2A30A 3ACCA 3DGEC 3ITDA 4OB7A 3L49A 4RMNA 2BEWA 1XNJA 2NNLD 4C5CA 3RFUA 3I58A 4MR9A 1O89A 4L6AA 2OFFA 1CHNA 3C3PA 1AURA 1LGYA 2FPLA 4RABA 4QDKA 5HR5A 1XV5A 2FDXA 2O0JA 4D98A 4IV0A 4GX0A 4DL9A 2GF2A 5ADWA 2X77A 5K8UA 4Q16A 5DJ5A 5LOVF 2VYQA 1S7GA 2NO7A 1OT3A 3VVMA 2XQGA 2QY9A 3G79A 1UP4A 1DAOA 2DGDA 2WSMA 2ZAMA 3AR8A 1BCRA 2L82A 3B7GA 4FZJA 1LNQA 1Y9EA 1A0OA 3CX6A 5TQ0A 2QA5A 3DAGA 2IY7A 2RG1A 1G5TA 1SY7A 2NV0A 3DLTA 3DOFA 4HNSA 3UK6A 2QU8A 2CDNA 2XYHA 1ZCBA 3B13B 2GYYA 4LJYA 3LXRA 4E51A 5A3QA 3WA7A 2J3MA 1ORIA 3CC8A 2ZIFA 3EAFA 4IMIB 2ANCA 3ZHSA 4AX8A 3PGMA 2C8VA 3SSMA 4RM2A 2EJTA 4S24A 1C0IA 4LYHA 3E2MA 4B3HA 1JEJA 2AYZA 5K51A 3DTVB 4RZSA 1G3UA 2IVZA 3GEMA 2B61A 1JHRA 1T5TA 1A8PA 2CUTA 5KQGA 1NULA 2VSOA 2HRDA 3WK6A 4H3HB 4YB8A 1XL0A 2LP4Y 2XCUA 3ZXYA 2ZWIA 3IXQA 3ZE7A 1K3UB 3LXXA 1X42A 1E8MA 4X93A 2D3TA 2ZB8A 1HE4A 4G5FA 4DIKA 1I51A 4I4TA 1E0DA 4K1XA 3VMFA 4NH0A 3ACDA 3SJBA 4DM4A 4OMDA 4TZKA 3JAKB 2PT9A 4XI9A 2AFHB 2QZSA 4NYJQ 1XEWY 4C4AA 4HWGA 1RQXA 4NBSA 4TSKA 1G5IA 2I9PA 4UBNA 4JQOA 4CG3A 2QB5A 2XUIA 4Y2GA 3ECAA 3KJNA 4XM1A 4GRIA 1T0BA 3K94A 4BNXA 4FQ7A 3NM6B 3QPDA 5JIBA 4XQEA 2YYZA 3DEJA 1FJXA 1DAIA 2ECOA 4MVWA 4RVOA 1PJQA 2BGGA 1SCDA 1ZGZA 2PWBA 3BRCA 1O97C 4P5PA 4V0OA 3GD5A 2B2XA 5COAA 3GJ8A 2HKIA 2F9MA 4DC1A 4DILA 1XMSA 2A4KA 1JJIA 2CB9A 1DKMA 3K2EA 4BVGA 4IDHA 1U2DA 3TFWA 1TYDE 1S2GA 4AKSA 3ZQJA 4M53A 5JHGB 1KHHA 4HDKA 1TZMA 3ZCQA 2C9BA 1NYTA 2WJVA 5J40A 4DEYA 3L79A 4NNPA 4ZOLA 1YR1A 3Q8MA 5A3SA 3QF4B 5LQSA 3WGJA 1F7UA 1AM4D 1V2GA 3D6JA 1E6EA 1EIZA 1FMCA 1RWBA 4PSVA 2FSPA 3D3JA 4D56A 2F3PA 4DM7A 1SHTX 2D5LA 2EBFX 3BHMA 4IWYA 1C30A 1GHTA 1BH6A 1S9HA 1ICEA 2W37A 4ZVUA 3TXYA 2HEIA 3QA9A 4DE5A 4JOBA 2R8EA 4ZVQA 4ZGWA 1ZD5A 2I4RA 3S2GA 3COPA 1U3FA 1QBKC 2YV4A 5DX0A 5KNDD 4NCJA 1U2SA 2W90A 4EYGA 4L9WA 3AXSA 4Z4IA 1GL9B 3C7TA 4EZEA 1ADGA 1H23A 1ZXLA 2QR2A 1XC7A 1Z0AA 2W48A 3B6EA 4S3MA 4BMDA 3G3EA 3IODA 3AF2A 2YN4A 3E9EA 3K32A 2IUYA 2NQ2C 2VP6A 1KDZA 2YW9A 1HMPA 1TC2A 1RD4A 3JY6A 4WFIA 1BROA 3QPBA 1B14A 1QYCA 1IZ0A 3ETGA 3R7SA 1EZ1A 1DWUA 2C4KA 2NV2B 1JDNA 1Q1AA 2B4AA 1BMFD 5E6RB 5DK6A 4GE3A 4WOJA 1A8UA 1A72A 5ELMA 3RSGA 3M1YA 3WQQA 4UZEA 1E0AA 2FSIA 1P0CA 1ATIA 4N7JA 5L3VA 3ST7A 4EF6A 2V3WA 1XUOA 2XHEA 3CRRA 2XUFA 3WFZA 4YMLA 2ZXFA 5LMCA 3QI2A 4X3PA 2XCSB 1OUMA 3AEXA 5E2IA 3IBFA 2VWGA 1Z6YA 3T9EA 3NP9A 1O0CA 3GLIB 4IHJB 5HPYB 3EEIA 5E2AA 4ZHSA 2XGGA 1U3GA 4MGIR 3RTDA 4IH4A 1XELA 1YMVA 3M6UA 4JSYA 5CLHA 3VC2A 1IIRA 4W9NC 4F45A 1AKUA 3R8CA 4AP6A 1GAQA 3EUFA 1Z0JA 1XU7A 1RTKA 1RXCA 3HI6A 2H1VA 5FO0A 4JLNA 4XX1A 5LQCA 1QGDA 4QNNA 4C0LA 1Q1BA 3DMPA 3K1YA 3N87A 3LU1A 5JCXA 3NDJA 3KKPA 4JLVA 1VQ1A 2PKCA 5E0KB 2BE7A 2BI7A 4UHEA 2KPOA 3R24A 4LKRA 1JJAA 1A1SA 1PSDA 3OZTA 2JZOA 4JDPA 4EHHA 4ENTA 2YZ2A 3OZUA 3KEQA 2AL7A 2Y9MB 3EJ6A 2XUPA 1MU0A 3RARA 2IOQA 2ATCA 4Z54A 1BGVA 5HXAA 1HFJA 4QRHA 1VLMA 2BFBA 3A6HA 4PCUA 5EEGA 1NMSA 4ZANA 1L2TA 1Q0QA 4HYEA 1NXOA 2NYVA 3OT4A 4AQDA 1B73A 4BMCA 5LSAA 4DRXB 2FN8A 3I52A 5JG7A 3NBQA 3DFIA 1XCOA 3IP7A 4LJ6A 4CCYB 3PXEA 3TIIA 2G8NA 1LH0A 2WKSA 5JJCA 5A5EA 1CIJA 3HR8A 4U2KA 2QDXA 5G2OA 3CLSD 1NJ5A 3IVGA 1KKUA 5B55A 4UFNA 3DKVA 3WJ2A 4MI6A 3TQTA 3FD8A 1YKSA 5K8JB 1X7XA 1X1AA 2WWRA 1CDZA 4IILA 3C43A 4E3ZA 5C1PA 5LQDA 1IWOA 1T3ZA 4C4RA 5ALZA 2I54A 1YI8A 2QSZA 5TV2A 2JIPA 1SURA 3KE9A 4GOXA 3ORFA 4WN9B 5IG2A 1SKMA 4MQ4A 1IYZA 1O95A 3OKPA 2IYVA 4L9AA 4YNBA 4Q4CA 1UXKA 5DXAA 5M2QA 4R4JA 1XCLA 2VJMB 3TLEA 1KS9A 4EQ6A 2VP5A 3ZLUA 3V4FA 4AURA 1VPWA 4MS4A 2BGIA 1KFBB 5DU2A 4D97A 1DE0A 1LZKA 4PRZA 2ZJ8A 4D41A 5LIPA 4HP8A 4MV6A 3N8NA 4BO9A 4LF6B 4JBXA 3P9NA 5FOQA 1FUKA 1I36A 3GDOA 1EVYA 1JIKA 2EZ9A 3HKBA 2NX2A 4TYWA 1YJAA 2YNMA 3FAZA 4ETMA 5IU6A 3E81A 4X7BA 4HNAB 1CY1A 2D74A 3CWCA 2VAWA 1QG0A 2QMUA 1COWD 1M6HA 1UMBA 4TT8A 1Z2CA 1Y33E 4EF4A 3T4XA 5D6NA 1JMYA 4KDFA 4HXYA 3FROA 4I5GA 2WSYB 5EP1A 2WHRA 3PL1A 5H5JA 1EFKA 2P0YA 4ZAGA 5LQNA 2CNDA 4TTRA 4MX8A 2COKA 1G20E 3R09A 4HS9A 4HVTA 4PLHA 4QYIB 4AMYA 3AR6A 1V16A 4IVPA 3TO5A 3FUXA 1DJOA 1ZQ9A 3G2LA 1X9HA 3IBCA 1PGPA 1D0VA 2X5KO 2MSEB 1SG6A 2CKDA 2XUDA 4TRNA 1NSTA 1X6VA 4WPGA 4F3YA 3SQDA 4D45A 5HTKA 4YJFA 1EDDA 1G8YA 5FUVA 3BRWD 1VDMA 5ALRA 4KPUA 3BL5A 4TTSA 3SDZA 3AEUB 1YS9A 2BGNA 1ZINA 2VJKA 3ED5A 4GR9A 4IPTA 4RKYA 4BX8A 1EINA 1PL8A 4V02A 3HUDA 2VZLA 5CDFE 1FB5A 1IEVA 1FP4B 2FZGA 3S3TA 1ZOSA 2EP8A 5K0NA 3W90A 3O31A 4XGIA 4XOUA 4PQEA 1Y1KE 4TXNA 3HPRA 3HJTA 4HH3C 1Y7IA 4UMFA 1EVKA 3U9LA 3C5WP 3V7NA 1NNUA 2ZJ5A 1T8UA 2GJAA 5HVNA 3TTXA 1E1RD 3G9ZA 1FFHA 1PDVA 3EOZA 3OZAA 1PJ2A 1VMAA 1GU7A 2D1QA 2BZ0A 2HXGA 2JA2A 2ZR8A 1QGYA 3C70A 4DLXA 3PSHA 1OAKA 3THXB 2IZ0A 3ZCUA 4P3OA 3OQVA 4Y6LA 3EOAI 3GGJA 2O8EA 4RK7A 4MI3A 1ODFA 1BWPA 5CA1F 3LVBA 3R23A 4PSDA 3T99A 3TNYA 2FW0A 3GFPA 4F93B 4GKJB 4C22A 1N2IA 4C3OB 4TXHA 5BWMA 1SZPA 2FEPA 1V39A 2PWYA 3PG5A 4NFHA 1RVV1 3OEWA 721PA 3A25A 5CFRA 1GQYA 1XWWA 4DDKA 4PQGA 3QWBA 3P2OA 4R16A 5CM9C 1H69A 3WWEA 3CNLA 3AJ8A 2FG6C 2WFMA 1E4VA 5FYDA 1RXIA 1AKNA 1VE9A 4L28A 4CDNA 2BD0A 1VIAA 3WADA 1E2KA 4CKCB 4NJMB 2Z57A 1DUSA 1IN5A 2HT6A 4LQLA 4YREA 2VK4A 3VJMA 3HJFA 3HO1A 4LBWA 3WIEA 2VEDA 2EFDB 1FDWA 3H9JA 4MKZA 4PGFA 4U8GA 2ATXA 2G0AA 2ZI3A 1SUAA 4RXMA 3T7CA 1KYIA 4XFKA 5L4NA 2PH1A 1V8FA 2ZRDA 4A0FA 3L92A 2ETXA 1UEIA 3FLAA 2VDOB 4P53A 5FWXA 5DF1A 1JKFA 1IZYA 2B36A 3MJRA 1U11A 1N5MA 3H75A 1RWKA 1KEKA 2PCLA 2FWBA 1MCZA 2PPLA 5F3RA 4LY0A 1UT8A 3SYKA 4BWGA 1XJ5A 2ONCA 3V2HA 4DJTA 3ULKA 1AD2A 1HX7A 1AHNA 3GROA 3V32A 4DLZA 1JALA 1Q95A 2D5BA 4LXYA 3TTUA 3N70A 4GOLD 5DEIA 3CVVA 1GQRA 5EZSA 4GDFA 1H5NA 1SHJA 4NI5A 4TROA 4GBJA 5EI5A 1GKLA 2WAOA 3DHYA 3L1JA 3OEED 2IDZA 1WNFA 2E3JA 4UD2A 1Y34E 1L8QA 2AOTB 4QXOA 4D9BA 3QHAA 1NMXA 2KX7A 3TZ6A 2A1UA 5E3HA 3HU1A 4GE0A 2ZWAA 2PL5A 1J2EA 3RJTA 5EJAA 4GD3Q 1HA3A 4Q3DA 1G0OA 2E1RA 1ZD8A 3CJRA 4MR7B 4TXJA 4ZAWA 4ZVMA 1YTUA 2PANA 4LISA 1IN6A 2VPQA 4OBXA 3LSTA 4Q7MB 1NMQA 1U7HA 2H48A 3F8WA 2AGVA 1KI7A 5IZCC 4LE0A 2IS6A 2SNIE 3EC1A 3ZBPA 1Z2PX 4PHCA 1X70A 3G2MA 1XLWA 1FLAA 1W48A 2VHXA 3FDXA 4R1QA 4L57A 1AF7A 2AMVA 2EWMA 3VHLB 5KQSA 1WS6A 1PYDA 4N40A 4WASA 2HMSA 2G08A 1Q1ZA 4HR7A 2N1BA 4D1YA 5BW8A 4J49A 3NBZC 4BX9A 4NEQA 1M7BA 1P1HA 1UZAA 3L93A 3K0AA 5A9TA 2OHVA 4RZUA 3GY0A 3N86A 3RNOA 1ZJWA 1ODSA 2PZ8A 2AQIA 2YMLA 2ILTA 3R3YA 4FOTA 4WAUA 5DM1A 4AVYA 3KWFA 2FPIA 2DWCA 3A4VA 1EMDA 2GKOA 1SG9A 3C0KA 2K2WA 1B3RA 1EK1A 4FFBB 4F21A 2VOJA 3FTCA 3U3OA 5K4GA 1M34B 2XVAA 2VAXA 1TGYA 4JEIA 4PYQA 4RL4A 4XYEA 5EP3A 3GJ4A 4ZQCB 4EPVA 3FZYA 1LBEA 3PFCA 3VKVA 4E0BA 2B25A 3PC7A 3L1KA 1U2GC 8OHMA 3OZDA 3SR4A 3AR2A 3OJWA 1UKZA 3BXGA 4GLJA 2VJPA 4PWZA 4WKGA 3LL7A 4OLAA 2AK3A 4M60A 3O8QB 4HGQA 2K2QB 4Q9HA 2XMSA 3QWFA 2DFPA 1QZZA 3COZA 3SKYA 2C92A 1LLFA 3RYFB 3ZV4A 3QJGA 4CDGA 1SJ9A 3GX1A 2NO5A 2GF9A 1QFYA 2F6RA 2VUHB 3G2JA 3ZD9A 2VH2A 2QIPA 3TFQA 2H3EA 1C7ZA 4RTLA 1RKUA 5K6RA 4RA6B 3HADA 3Q8WA 5JAQA 5JJKA 4EJSB 1CR2A 4KH0A 1VB3A 1ZNZA 2JFZA 5F21A 5EE1A 4BX2A 4DHWA 4HH0A 1IOWA 2FU5C 2Q27A 3ZW8A 1JKJA 3EGCA 4UTZA 4C4OA 1TIPA 3LYLA 4Q01A 3B1ZA 4OBBA 1Y4AE 4X66B 4TSFD 5KEIA 3D54D 2ADFA 2PIDA 4MRNA 1QCZA 1QJ4A 1WG8A 3ZJTA 1OWLA 2YCLA 1RJWA 3VVLA 1TMKA 1SXJB 4YJHB 4PSKA 3KKZA 2IHBA 1T0IA 1E0SA 2WIGA 4OQDA 4BO0A 4OXNA 1F2VA 3HBJA 4PC3A 3Q9NA 2Y6VA 4MNTA 3VKFA 3GL9A 1KP9A 3HG7A 4MQFA 5KYXA 1RRGA 1X15A 3A6FA 4L15A 2X3YA 5K8VA 2KQUA 2VVTA 3KJGA 3PT9A 2ZKIA 1I0IA 1EFDN 1N8TA 4UNSA 1MD9A 4V0QA 4YRSA 4NBWA 4B4VA 4IUBS 5C80A 3BD8A 2TSYB 1Y9ZA 3UC9A 1T3HA 3K35A 2C9OA 5ED0A 3UMGA 1CUSA 3SU8A 2V3CC 3E5RA 4GRAA 2D0OB 1JHDA 1QZ3A 4WXYB 5DHAA 5I9BA 3RYTC 2GK6A 3T52A 1UF9A 2CMHA 3QM1A 3RVPA 1WBBA 5E6UB 5J58A 3T95A 1GJRA 3T5MA 4UE3S 1EGMB 2X9QA 4EW1A 2O0HA 2ZOSA 3N0XA 2I3BA 2CL5A 3AK4A 4OI1A 1Z29A 4JUBA 2YZMA 4ZAYA 1WMBA 1VC2A 2AE2A 4UEKA 5C4IA 2QX7A 2I2AA 1KPHA 3LD9A 3THWA 2V98A 4BNFA 4EF5A 2JGDB 4KXVA 3QLUA 1G4UR 5KREA 3RW9A 3LFUA 1FLVA 3P1JA 4Q7JB 1XRQA 1JPNA 4IDDA 4L75A 2ZBGA 4EA6A 2HGZA 3RH0A 1CUWA 2R96A 3VC1A 4WUVA 2P4HX 1W2HA 2MIIA 2PL9A 3F96A 4D3XA 1EK0A 2I1VB 1D2MA 1C81A 2GK4A 3ORSA 1RE1A 3VDRA 4WIAA 1VHWA 4Z7OB 1EWRA 1JLKA 4QGGA 2A1UB 1RKVA 2B94A 3SLGA 1PG2A 2OV8A 3LRPA 3O0TA 2I22A 1YV9A 1SA0A 3ZCVA 2CDAA 1JAIA 2GCOB 5C7IO 2UUBB 4HX2A 4MYHA 1Y8QA 1JDBC 1G55A 2YWRA 2VRWA 4NDZA 4WCDA 2V03A 1TK9A 2XTAA 4CQLA 1R18A 1X7XB 2HV9A 2NG1A 3V55A 1KDRA 1XD2A 1LLDA 4PHHA 1P77A 2UUOA 2C8KA 2AV6A 4P5EA 4QUKA 3RB8A 7AT1A 4H08A 2G82A 4YRCA 3L1VA 4C6TB 1JE0A 4WK6A 1L3BA 2J5QA 5HKKA 1H8HA 2QROA 3VR5D 1H2RS 1X7WA 1QVVA 3PNYA 4JX9A 1NSFA 5F2KA 4BJ5A 5JNTA 5KOIA 5KU1A 4XGQA 4IXTA 1N2ZA 4PGGA 4NG4A 3SXUA 1ONPA 4ZQGA 1SUPA 1RXYA 2E85A 1UKVY 3GUYA 3QK7A 3DE7X 1Z37A 2FUKA 3OTWA 4MWTA 4C1BA 3TR0A 2OAQ1 4MAFA 1IEWA 3TQQA 1DGQA 4V24A 1LWNA 1ZSVA 1Y9JA 2GETA 3SIPA 5CDHA 3BMNB 3U5TA 3LAWA 4RKWA 2AKEA 3PXXA 3K70B 4FYVA 2WB2A 3K15A 1F8FA 2ISCA 3M2TA 3V48A 1XTRA 3MTQA 1WMSA 3T0FA 2Q3DA 4IDOA 1UJCA 3V1KA 2IUFA 3FLBA 2AD5A 2ZDGA 5KNCD 4FCWA 2WSSA 4G2NA 3FMOB 3JVVA 4DMUB 1Q0LA 4HB2A 5FV7A 3RSZA 2C7PA 3DEKA 4HAUA 4HH4A 4ENPA 3HYTA 1TTPB 1GUFA 3L05A 4L9SA 3GUZA 1OSNA 4N7RA 5EHGA 2PBLA 2YKGA 3KXPA 5C4GB 1UINA 1ORRA 2WE8A 3QXSA 2XUOA 1URPA 3JYLA 3RUFA 2ZYRA 4K3UA 3OKAA 2JLZA 1KNQA 2J3IA 2QQ0A 4EBBA 2BHTA 4MUJA 1Y3HA 3ZH9B 5EG5A 2KBEA 3ICEA 3P0FA 2MTBA 4HFMA 4ZOCA 5G0TA 2AD1A 5FEUA 2JH9A 3KJZA 3FR8A 2P2LA 3M8KA 1SC6A 3FY4A 3RRNA 4FS8A 1I1OA 4EELA 3KTDA 3O92A 2JLBA 4JC5A 3ANXA 2GHRA 1LV7A 2YWGA 3OQIA 4AY4A 5JAOA 3KTOA 2W42A 5TMPA 4B6PA 5G1OA 3VNRA 1V3VA 3P9PA 5AKHA 3DOHA 4BECA 1VJRA 1JDBB 4Y6SA 1JFLA 2EBWA 4YYZA 2JDIA 1XZQA 2FG5A 2FPPB 4RMGA 2H51A 3PC4A 4ZAZA 5I9SA 1XZHA 2PQ0A 4RSGA 3K71B 1O4VA 1VFNA 2BYTA 4XWGA 4GOMD 3K9LA 4IV8A 1Y5LA 4FEEA 3U19A 2UZ4A 4BNNA 3FNHA 2DHDA 5DSTA 3D4NA 2RC5A 2CV2A 2A9JA 2FP4B 2XUAA 1L4HA 3EWSA 2D8AA 3C5EA 5EKDA 2RHMA 5ULLA 2G1AA 1SZDA 4WXMA 1A71A 1A7UA 3DAHA 1PJZA 4BFSA 3N07A 4DMCA 4LTDA 2WTAA 3PD0A 3RS0A 3ZVLA 5ALEA 4JI4B 2DPGA 2JI8A 1QONA 4YRKA 5IJ9B 4JYPA 1HQKA 4EQ6B 3OX2A 5JWOA 2RAFA 1SBYA 3SQMA 5B1IA 3MS4A 3KKEA 4A23A 2CGEA 3L8EA 4AN1A 2ODQA 5KX5F 3FVTA 2MSCB 3IR5A 1WZCA 3AHEA 3I9LA 3N0VA 1YI1A 3WG9A 1S2OA 5HQTA 4MPJA 1NN3A 3C3EA 4BJ1A 4U02A 2VP3A 1GG2A 1L8LA 3R7FA 1QHNA 1X1CA 5JASA 4KDEA 1B6GA 4LZOA 2I80A 2O8CB 1XG5A 3IJEB 3MJVA 1RPJA 1C9EA 1E98A 1X7ZB 2HF2A 4I6GA 3TLGA 3WLPA 5JLJA 2NW6A 4H27A 5F7OA 1A5TA 1K3TA 2LE0A 4IDGA 4DLYA 4DJDC 2YIDA 3REOA 2NMVA 4DSAA 2AF4C 3DBLA 3B6ZA 2A9VA 1Q14A 2H1HA 1JQJC 3JWJA 4PBRA 4DEVA 1UXJA 4N4AA 3KKQA 5CW2A 3LY9A 3DZJA 1ZMTA 4PLCA 2X4LA 3KTFA 1KI6A 4HNUA 1N8KA 2P6RA 5CB6A 3CCFA 1JHOA 3F2VA 1JQBA 3WL7A 3Q7PA 3LA6A 4YJ3A 4YAFA 1UKCA 1BDMA 3P8ZA 3CPSA 2OCAA 1VM6A 4FMCF 4GOOD 3EIXA 1EXDA 2Q5CA 5DWQA 5HQJA 1GZ7A 2HMVA 3LUAA 3Q0TA 4G3XA 1IDN1 1QYIA 2QW1A 3AVPA 3BS4A 4EHBA 5AOAA 2FKAA 1XKXA 1KVRA 3K1JA 3TI7A 1KVTA 3WGGA 2RJ3A 2V4UA 3WK5A 2DETA 2V7PA 3PUHA 1HR0B 1I2MA 5GGYA 3I6BA 3TZHA 5ARBA 4OGFA 1UEXC 5CBPA 2PZBA 5IT4A 4WNAA 4Y67A 1NY6A 4TT3D 3R7AA 3TVDA 4M49A 4I3HA 4F91B 4XIJA 5AM1A 2AX3A 4IM7A 3HSYA 1JEYB 2QTNA 3ANLA 2PXCA 1HE5A 1SUIA 1V7QA 2QRHA 3AONB 3ENZA 3OZIA 4JI1B 3WKEA 5KNDA 1TD1A 1YZUA 4S1OA 2R7AA 1XKLA 3FOBA 3HBMA 5HWSA 1OX6A 3KJEA 4YRAA 4WECA 5BR7A 3ZXXA 1ZU5A 3ZLTA 2P2GA 5DVZA 2LKCA 4H60A 3H84A 4Q7KA 4ACAA 2ZTLA 2GPWA 3B2NA 3NIDB 4YS6A 1P9OA 3HHPA 4I1UA 5L51A 2ST1A 3UC5A 2CSXA 2QTTA 2NO1A 2ZATA 4R01A 4V0MA 1I5RA 3GN1A 2ZT6A 1WVIA 2R79A 3SM9A 3EOBI 3H2IA 3PDWA 2X4IA 4E31A 4FLEA 5JYEA 1J7KA 3KM0A 4RPHA 5EKTA 1VXRA 2VLBA 1GN9A 5IBRA 3T61A 4AUKA 3COJA 2RE8A 4YJGB 2J0SA 1XDBA 3FFAA 4MGKR 1ECGA 4C06A 4ZKEA 2JCBA 1OYYA 2Z8YA 5H83A 1AO3A 1QIMA 1X1DA 3ZLBA 7MHTA 3RJ9A 4WD3A 1PEAA 1H8EA 1BU8A 4PZ9A 2Q7OE 1RXWA 1QIDA 3EY9A 1MIOB 2WKPA 3TM4A 2CNOA 1HT2E 3N58A 2GBFA 4NS4A 4EECA 5JSZA 1WHSA 1OJLA 1F4VA 1GL7A 2E49A 2XODA 3WY9A 5FNZA 1RHJA 1SCUB 4ZVPA 3LWNA 4ER3A 4JJ4A 4LAFA 5ADVA 1SXJE 2FPPA 1CIPA