1P74A

Crystal structure of shikimate dehydrogenase (aroe) from haemophilus influenzae
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
267
Chain Sequence
MDLYAVWGNPIAQSKSPLIQNKLAAQTHQTMEYIAKLGDLDAFEQQLLAFFEEGAKGCNITSPFKERAYQLADEYSQRAKLAEACNTLKKLDDGKLYADNTDGIGLVTDLQRLNWLRPNQHVLILGAGGATKGVLLPLLQAQQNIVLANRTFSKTKELAERFQPYGNIQAVSMDSIPLQTYDLVINATSAGASVDAEILKLGSAFYDMQYAKGTDTPFIALCKSLGLTNVSDGFGMLVAQAAHSFHLWRGVMPDFVSVYEQLKKAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of shikimate dehydrogenase (AroE) reveals a unique NADPH binding mode
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
molecule keywords Shikimate 5-dehydrogenase
total genus 98
structure length 267
sequence length 272
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1p74A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1p74A01
5A9RA 5BT9A 4JP3A 1I3KA 1P74A 3FN4A 4L74A 4FFLA 2VYND 5TC4A 1B15A 3DZJA 5T64A 2VRCA 4BNZA 4TVBA 2E4AA 3RROA 3PHJA 4OXYA 4YAEA 4CMEA 2CSUA 2Q1TA 4NJMB 4ALKA 2O50A 1X15A 3DHEA 3RBZA 2Q2WA 3G3EA 3U09A 4O63O 2VUTA 2YY7A 4GX1A 5FF9A 1ZJZA 4MVJP 5TF4A 2O7SA 4B8ZA 2WWRA 2YHIA 1A9ZA 2EWMA 4TWRA 1GEEA 4BO2A 2YQ5A 5KOIA 4JIGA 4A26A 4FJ0A 5JO9A 5IN5A 1LDMA 1ML3A 3W8FA 5G0TA 3C3XA 3DOOA 1EZ4A 2CD9A 4W4TA 4PVCA 2X0RA 3WS7A 4WNCA 1EUCA 2ZCUA 4L8VA 4OKIA 4XEHA 2I99A 1HDCA 3G17A 4GAEA 4RF4A 4XYGA 1J6UA 1RM4A 4NI5A 4BIIA 1JVBA 3I9KA 5CEEA 1A71A 1DRWA 5COAA 4GH5A 4JXKA 3JQFC 3RUCA 2JD0A 1VJ0A 3I4FA 4MOWA 2AG8A 4MIYA 2JAPA 4PFJA 1DFIA 3A4VA 2B4TO 5B1YA 4ALJA 1B8VA 3DZHA 1E6UA 3C1AA 4FCCA 4MVJF 1LLCA 3H9UA 3QWHA 3AY6A 3C7CB 2ZB7A 4CL3A 1GQYA 3K6JA 3NUGA 1TI7A 4LMPA 5I9LA 5K6AA 2WD7A 5G0WA 1ZBQA 4D42A 1ISJA 5GZ6A 3VTFA 2J5QA 3JD1A 3V8BA 3NRCA 1DJNA 1PJTA 5T8KA 8LDHA 3DHYA 3HFSA 1X7GA 1SB8A 3G1TA 2PKRA 5B37A 5JCJD 2C20A 4E2XA 1XGKA 4W99A 4OSPA 3D3WB 4FR5A 4ZA2A 3ASVA 3HB5X 2AQHA 4YT4A 4J4HA 4S1VA 1E7SA 2OP0A 4MKXA 2ZQZA 1N5DA 4NBVA 1B8PA 2HMTA 4MIEA 3GZ4A 4N5NA 4CLRB 1DRVA 1NPTO 1YRLA 3IDSA 2NQTA 3PJDA 5JAIA 4ALNA 3OJ0A 3TZHA 1SBYA 2VQ3A 2HMWA 1NPDA 3MJEA 3ZWAA 4CM8B 3SVTA 5FYDA 3MJCA 4WPGA 5JW6A 3ADPA 3GVPA 4OIMA 2VRCD 3QP9A 4PLFA 2WYUA 3L9WA 3W6ZA 2P4QA 3WJ7A 4CMBA 4RPHA 2Y67A 4BKQA 3E03A 2PK3A 1YQXA 5CG1A 2C5AA 3U4HA 3BHIA 1QYDA 4I9NA 4LGVA 4UEJA 1H2HA 1PJBA 2JAHA 1CRWG 2GN6A 1G0NA 1JKFA 1EDZA 4HFNA 4P22A 2Y1FA 1E3IA 3AOGA 3MJTA 4B4WA 3BTVA 4IXTA 1HL3A 4BNUA 3QE3A 2ZTMA 4YRBA 2C5EA 1ZMOA 1Y1PA 2RH4A 4OH1A 3F3SA 2XAAA 4XGIA 3AUSA 4WLVA 4R1NA 2B4RO 1DC3A 3HUDA 2YV2A 4CV0A 1Q0QA 3DONA 4CLDA 3HFGA 4K6FA 3IUSA 1MGOA 1ULUA 3OHSX 1XG5A 1O8CA 5HS6A 4E31A 5KJ6A 1YB4A 4MKRA 4ZQFA 1M6WA 4KTTE 4E2ZA 4UUMA 3BMNA 4ZQEA 3LLVA 2VTEA 4YXFA 2Q49A 3DZBA 4HX5A 2ZTVA 4N18A 4OMUA 1MV8A 4ZRMA 2GRAA 4R16A 4RVDA 1O94A 3VPFA 3F46A 3PJEA 1X0XA 4ZQBA 1IUKA 1DC4A 1VPDA 1LU9A 3QW2A 4E21A 3UCEA 3FNGA 3BMOA 4AJNA 1PJSA 4J2OA 5I9MA 4CODB 3L4BC 4FDAA 1RYEA 2QW8A 2D3TA 3X2EA 3ZWWA 4C7JA 2HRBA 3DOCA 4XCVA 3UXYA 1J49A 3PWKA 4XYBA 4CLEA 3I9JA 2RCYA 3KBOA 1T26A 5A04A 3W4KA 5A1TA 4YJGB 3NEPX 2QIOA 4WKGA 2IODA 2JCVA 1MP0A 2BLLA 3V2UA 3JQBA 2VN8A 2VNAA 1HDXA 3TQHA 1KVRA 4NH4A 4PG7A 4WGGA 5JYEA 1K6IA 1T2EA 2HMVA 3EAGA 4JJFA 5JMWA 3Q6IA 5L9AA 4EJ0A 1T1RA 1ISIA 3DBLA 3O38A 5KKAA 3PWZA 5AXDA 1SEPA 3WGQA 3ZU4A 1LA2A 2EERA 2NTVA 2Y1GA 5KJCA 5U1PA 3OF2A 1GFSA 1KERA 3QA9A 1F8GA 2YW9A 1UZLA 4IJVA 5KVSA 1E1MA 2EGHA 5AOVA 4DPMA 2HCTA 3H9GA 3KSUA 3GDOA 2DTXA 1XDWA 4ROSA 4AVYA 4CMCA 3D7LA 1DDOA 4WLUA 4FBGA 5IFLA 1I8TA 1R4NB 1Z74A 4CMGA 5LDGA 1ADCA 1MC4A 3LYLA 1IZ0A 1B7GO 5EQDA 4CMIA 1U4OA 1UJMA 1R66A 4BO7A 3ROMA 3CXRA 4ZU3A 4PN3A 2DT5A 3DMTA 3CTMA 4BKOA 3V5NA 3HWRA 2DFDA 4GLOA 3E6AA 1X7DA 3OJOA 3DQPA 3ANNA 2AA3A 1I3LA 4X54A 5B4TA 1HE5A 1ZZEA 5F1KA 1OAAA 5JLAA 3CIFA 2HJSA 4UVIA 3INTA 3ZI0A 2GYYA 3D4NA 1BW9B 3KHUA 3NKLA 4EJ6A 2GF2A 4YAIA 2P68A 2ZYAA 3AY3A 4J0EA 4RDIA 4YYZA 3FNEA 1UDCA 2VHZA 3FBGA 4MP3A 3VVBA 5A5FA 1NVTA 4LRSB 4P38A 2V6BA 1N1GA 3IJRA 3AU9A 4Y8VA 2C0CA 2FMUA 1E7YA 3WNVA 1TVEA 5JAMA 2PH3A 4Z9XA 5CFZA 1GDHA 3DDNA 3RBVA 1NTOA 3BHMA 4P8RA 3ZV4A 3KXDA 5C5IA 1VC2A 1D1TA 4WNIA 2P5UA 3GDFA 4NFSA 4ZQHA 3HG7A 2VZ9A 3RC2A 1M66A 4CR7A 2X1HA 3F1KA 1IPFA 1WMBA 1DLJA 1E3WA 4L4RA 4Q3AA 3EVTA 3RKUA 4E30A 1MFPA 3NTQA 1C1DB 4Z9YA 4IDEA 1A27A 7MDHA 4CMJA 2Y99A 2JCXA 1LRLA 3VH1A 3NTRA 3DZFA 3GVHA 3OQ1A 3R1IA 1U7HA 4AJHA 3GUCA 4OXNA 1HDGO 1HT0A 3RWBA 2O7QA 3VPSA 2AG5A 3NDRA 3Q1LA 4DQUA 2I67A 2PD4A 4GKVA 3TJRA 2J3KA 3OIFA 2E48A 1HDZA 2O3QA 3JYOA 5JDCC 3VDRA 4XJSA 3UHAA 3WGOA 2PY6A 4CV3A 1JAXA 3U4CA 2X6TA 4JBGA 4HFMA 4ZRNA 3QRWA 4U8GA 1GUFA 5H81A 1PZGA 1DXYA 3UW3A 4O59O 1NP3A 3BTSA 1FF9A 4J3FA 1Y8QA 3GEDA 4OHUA 2X5KO 1WAMA 1ZEMA 3GLQA 1C14A 2A94A 2G76A 3U3XA 2CUKA 1LSSA 5JC8A 2HDHA 3PHLA 4ZICA 5AXAA 3H5RA 2H1SA 5JY1A 5U9CA 2PGJA 3E8XA 1SPXA 3RFXA 2FPPA 4RPKA 1T1SA 5H83A 4CM4B 1XLTA 1C3VA 1PZFA 3GZNA 4CUZA 2SCUA 4L9RA 1M75A 4JQCA 1ZSYA 3IS3A 4E5PA 1AGNA 5B4UA 3QVWA 5B4VA 5L51A 3ASUA 3KOUA 5G0SA 1GR0A 4YDRA 1NQOA 4NNJA 1E3LA 1P1IA 1T25A 2FZEA 2PZLA 1R4MA 2R00C 1MG5A 3WNQA 1UZMA 3BYZA 3WQSB 3RSHA 3WLFA 2X5JO 2D2IA 4A10A 1DEHA 1C0LA 3LK7A 3OJFA 4GMFA 4GSKA 4P4LA 1RKXA 5IAAA 1XKQA 2W4QA 3EHEA 4Y98A 4IGEA 1E77A 4IDGA 5G0UA 4L4XA 1ADFA 3CMMA 1DIGA 1ZVMA 2X0JA 4RQUA 1AN9A 3CZMA 3OMLA 4OM8A 1CDOA 5DOZA 4E5YA 4CMHA 5CDYA 1NYTA 2F00A 4B4VA 3WFJA 4NU5A 4CMEC 1AUPA 3QWBA 1DIBA 3TFOA 1V0JA 3L6DA 4IDAA 2O3UA 4D41A 1HLDA 3H4VA 4MKZA 3OEWA 4LVUA 1EBFA 1AE1A 4YWJA 2PZKA 4R41A 4RVHA 1GUYA 4CR6A 4ND4A 3D0OA 4NK5A 1WWKA 3M6IA 5A02A 3H8VA 3JQ6A 1DSSG 1WPQA 2JKVA 5G4KA 2WM3A 4FPXA 3GOHA 1T2CA 4XQEA 5COQA 5ITVA 4BNMA 1OC2A 2AXQA 3PVZA 3BA1A 1LRJA 5BR7A 5A4DA 1BGVA 3VVCA 2NUAA 2Y05A 3HJAA 2RHCA 1Y7TA 3LT4A 1E6EA 4IJKA 4ZGWA 4XIYA 1ENYA 4CJXA 3PLNA 4NJMA 3ZNPA 1NAIA 3DR3A 1Q0LA 2CNBA 4RPGA 3HN2A 1P45A 3DBRB 4TSKA 3TZ6A 1EE2A 4NBWA 3RUAA 3D1LA 1NQTA 3CH6A 1EBUA 1I3MA 3I9OA 3ZWCA 1C1DA 1Z7EA 2Y68A 4L76A 3WGYA 2EHDA 3RUFA 3WBBA 3HQ4O 2F1KA 3IC5A 4TZTA 4ONEA 4B7CA 2Y93A 4EDFA 3U4DA 3N7UA 2IXAA 1HE4A 5ES3A 1TXGA 4WLNA 4BNJA 3RQSA 4B4UA 1X1EA 1UXIA 4IJWA 4PCVA 5JPIA 1Q7CA 4ID9A 3H3FA 1HF3A 2QG4A 4AJJA 3WB9A 4DA9A 4E2YA 1DOHA 3L4SO 1W0CA 3ZCXA 1LLDA 2ZB4A 4EBFA 1J4AA 1PJLA 3U9LA 3F4BA 6ADHA 3IUPA 3D4OA 3JQGA 2HRZA 4HFJA 3GVCA 4CM5A 3WGHA 3D5QA 3E9MA 4YJHB 4ZD6A 1KEPA 2X4GA 1H6DA 4PRKA 2VZ0A 2NVUA 1V35A 4WCDA 3LC1O 3H6KA 4YJDA 1T4DA 3D4PA 1OI7A 3LQFA 4B8WA 2BGKA 4RDHA 4KWHA 3QV1A 1Q1NA 1EFLA 3T7EA 1SC6A 1NQ5A 2FSSA 2DAPA 2NTNA 3GMSA 1CQIA 4RVGA 5G4LA 1I2ZA 3RC7A 1UUFA 4PZDA 3KZVA 3ROQA 3AWDA 2PD3A 1UAYA 4NDNE 5C7LO 2Y0DA 1QLJA 3GGGA 2DVMA 5THQA 1BG6A 4R1SA 3B6ZA 3DBHA 1PS9A 4MVJI 1HYHA 3GT0A 1NQAO 1W4ZA 4DPLA 1N8KA 4RPJA 1KBZA 1QKIA 3QWFA 1IY8A 3BHJA 1XELA 4ZVVA 1QV6A 1QR6A 1ZK0A 4QQRA 2EXXA 1QXSA 3GEGA 3MJSA 4GSLA 4J1SA 4CV1A 1HKUA 4G5HA 1LLQA 4M89A 3PZBA 1TEHA 4D46A 4R3WA 5CDTA 1PIWA 3OETA 3VC7A 3HADA 1ZXLA 1KOLA 5C7IO 4W82A 2X23A 5TT1A 3AK4A 5KVQA 4DIFA 1BTOA 1C1XA 1U7TA 4OQZA 4QTZA 4UUOA 3AOEA 3RASA 4EITA 2VTDA 2B35A 2C54A 3FI9A 3FD8A 3QVSA 3GHYA 3HE3A 4P4NA 2PA3A 3OH8A 1B2LA 3C7DB 2JFHA 5TIIA 4NMHA 3P7MA 4XA8A 1DIHA 1O6ZA 1W73A 2A35A 1P1FA 2BELA 2VYVD 3MEQA 4J1QA 3K96A 3SJ7A 4YTEA 4RJTA 3WLEA 1FK8A 1BXGA 3MCVA 4K26A 2X7HA 2EJWA 4YAGA 3GAZA 3H9JA 3JD3A 2EEZA 2FHSA 1QG6A 2QQ5A 2BFAA 2PNFA 2OBYA 2VWQA 3PP8A 1HTBA 1YL7A 4URFA 3TZKA 2FSVA 1VJ1A 5I7SA 3FPLA 1RJWA 1G0OA 4J1TA 3STHA 2PKQP 5IXSA 2D5AA 3PZRA 3ZZNA 1PZHA 3BAZA 1YXMA 1DJQA 3DOJA 1NPYA 3DBVO 4M1QA 5F1PA 1PJQA 3QLJA 2OZPA 3S2GA 3LZ6A 2FY8A 4XX0A 2GR9A 1ZEJA 1T2DA 3MJVA 1JU9A 4BQPA 2EGGA 3WBFA 4NIMA 3RJ9A 3I9LA 3DFUA 1K2WA 4E4YA 3EC7A 4HBGA 4NR0A 4J4TA 3JYLA 3JQDA 2DC1A 5KWEA 2NVBA 4KZPA 1HXHA 3OFSA 3DZKA 5ER6A 5TNXA 3VZQA 4JBIA 5EERA 5ENDA 1ISGA 4F46A 2CVZA 4M55A 3T7CA 4F6CA 5JDIA 4M49A 1ZXBA 4B3HA 5ITWA 1XIVA 1U3UA 4FN4A 4BO1A 2B83A 4PZEA 4JROA 1GAEO 1C0KA 1WDKA 3GC6A 3OSUA 5A03A 1MFZA 2DFVA 1S6YA 3K2EA 2W2KB 2X5OA 4R68A 1SAYA 4XQGA 5L45A 4N54A 2AEMA 4PLGA 1D8AA 3ABIA 3B1FA 3MJ4A 1DO8A 3CE6A 5KVVA 3WTBA 5FI5A 3GPIA 4II2A 4PVDA 3ZNNA 1RPNA 2JJYA 1DC6A 2Y0CA 4KTVE 2RHRA 3JTMA 4E32A 4RLSA 3RI3A 4E6PA 1GY8A 1Y5MA 1OZAA 2P9GA 4JLWA 3U62A 3I6QA 2RBEA 1C0IA 1PGOA 2NWQA 4WLEA 1E1NA 5B12A 1KETA 2VRBA 1XA0A 4FJ1A 4XWYA 2ILTA 3LSYA 2FR1A 3RC1A 1PR3A 2DBQA 2XPCA 1ISHA 4OSOA 4RCVA 3WGTA 4H16A 4D3FA 4F3YA 3RBXA 1UXHA 2LDXA 3HN7A 4RPLA 1KS9A 1IYZA 3AI3A 3KSDO 3SC6A 5I7EA 4Y6PA 4BOYA 3GDGA 3H9QA 1YDEA 1NWHA 1V3TA 3PFFA 4FFNA 3JQFA 1T4BA 3W8EA 5JBIA 1GU7A 2GCGA 2IDZA 1O5IA 3GHHA 4ZN6A 4NG5A 3ICCA 4DLLA 1A4UA 2BMAA 3Q0EA 3ZNOA 1YOVB 2FZWA 1K0UA 3D64A 2QYTA 1YDWA 3OA2A 2Q1SA 3NV9A 1H9AA 4LMRA 1VSVA 4Z9FA 1RWBA 3IJPA 1E5QA 4D3SA 3O4RA 3ZU2A 1YBVA 4XJTA 5IN4A 3U5TA 1BSVA 1HRDA 3VZRA 4D79A 2E49A 2R00A 4NU6A 3AM4A 4IZIA 4R51A 4BO5A 1N9GA 4FFRA 1ONOA 4JK3A 1QRRA 3HSKA 3KLPX 4PLWA 4TVOA 2O3RA 2I3AA 3IMFA 4FFMA 3DTTA 1SZJG 2QYSA 1DHRA 4MO2A 4KDFA 1UH5A 5DN9A 1A72A 5DOVA 1NXQA 3DBLB 4Z0HO 4DVJA 1P1KA 4IQGA 1WXDA 2DM6A 3CINA 4J2HA 3JQBC 2GSDA 1KVSA 4CM4A 4Q9NA 3VPHA 4Y6RA 4N5LA 3P5SA 1HDOA 5EN4A 1KVTA 3KM0A 3P19A 1HSZA 2H9IA 4GL4A 4YCAA 2BGMA 4QSMA 4NJOA 2NU9A 2I65A 2O48X 1RYDA 5ER9A 1VJTA 1DC5A 5CPBA 3RCBA 3GFBA 3SLKA 4LSMA 4PG8A 3I83A 1ENPA 1WVGA 3TOZA 2C2XA 1WDLA 3M2PA 3IKTA 4QO8A 3FSRA 3ETDA 3KO8A 5HBRA 2AQ8A 4XD2A 1L7DA 3RUHA 1QYXA 4M87A 4QFCA 4AJ2A 4DXHA 9LDBA 1BHSA 3WDSA 1Z82A 2J3HA 3A14A 1BVRA 3UICA 5CDUA 3E18A 5TJHA 1WW8A 1TT5A 4TKLA 4U7WA 2Y1OA 1E3WB 1ZUD1 3ONDA 3H9EO 1YO6A 1A7KA 1U3TA 5A06A 4BNIA 1NFFA 1R37A 3S1LA 4BO6A 1NM5A 1FDVA 3AUTA 3UGKA 1K6JA 4U6SA 3RC9A 3JQ7B 4LSWA 4GBJA 4MVJM 2CDCA 1NVMB 1PJ4A 4B7UA 1X7HA 4ND5A 1YBAA 3ZWXA 5FI3A 5KVCA 1JA9A 1AXEA 2RH8A 2ET6A 1BXZA 3CZRA 4XGNA 1CIVA 4JBHA 2UUPA 3PHGA 3R3JA 1EFKA 5U4QA 2NU6A 3PEFA 1Y6JA 3CEAA 4AJ4A 1E0DA 5KKCA 4CQMD 3DO5A 2BKAA 3JYNA 1N9GB 5K0ZA 2DTEA 3WR5A 1DLIA 1CYDA 4A0SA 1Y8RA 3BTOA 1P1HA 1I01A 2W2LA 1TT7A 1WMAA 3Q2IA 2IRWA 5IJZA 4H3VA 2GZ2A 2NACA 2FRDA 2TMDA 4JJIA 5A9TA 4ILKA 4WLFA 4CMIB 1RM3A 3SLGA 4DREA 3LT1A 5DCYA 1E92A 2C7GA 2IXBA 3OECA 4R3NA 1ADBA 1PS8A 4ALLA 4BV8A 3PFWO 1IL0A 1YOVA 5T67A 2R6JA 3EK2A 4DYDA 4N7RA 2OHXA 4IDDA 3TSCA 3ZV5A 3RIHA 2E37A 3BTUA 1F06A 3KEOA 4Q3CA 1R0SA 2QRLA 2AQKA 1YQDA 3PRJA 2EG9A 1UDAA 2UYYA 4QT0A 1ZK4A 4BQRA 3ZGYA 1ZW1A 3GF4A 4K6CA 3WYBA 3DAGA 4OOFA 2P5YA 3WMXA 4E5NA 3COSA 4R9RA 4OYRA 2V6GA 5KJFA 3MWDB 2CDAA 2PR2A 4PLZA 1IULA 2G17A 3L07A 4KOAA 3ZWNA 1T2AA 3EGOA 3JQ7A 3FPCA 3D3WA 3FCOA 3FRJA 5A5EA 1AHIA 1L7EA 3KLMX 4UVDA 3VTZA 4YT2A 4EGFA 3CUKA 2GN9A 4YR9A 1QORA 2X0IA 1CQJA 4W9NA 4KWIA 3WGZA 4ZHSA 3KYCB 1RM5A 2IEDA 1ZJYA 1GTMA 5IG2A 3EZYA 3SC4A 5ENVA 3RD5A 4B3JA 2HMSA 4OGWA 4BO3A 1QYWA 1PEDA 3ITKA 1PQUA 4NBUA 4RLHA 4EW6A 4FB5A 4UVEA 3B20A 1XHLA 1B14A 3WJAA 4DMMA 3FR8A 1ISFA 1EEHA 2W98A 3M2TA 1LSJA 5AVOA 1P31A 3X2FA 2JHGA 2W2KA 3JCZA 4DMLA 4UUPA 5BSGA 4IS2A 4EUEA 4U0JA 1YS4A 3KSZO 4OKNA 1OMOA 3ONEA 3WWYA 4A5OA 1D7OA 5TS3A 3UCXA 2J6IA 3BMNB 3UN1A 4MP8A 1YVEI 4HNHA 4YT8A 4ZQGA 1F12A 5DBFA 4GWKA 2VWGA 5L7WA 5TLSA 2ZTUA 1PR9A 2I5PO 3G0OA 2C2YA 2VHVA 2OP1A 1GZ6A 3M1AA 2DBRA 1U9JA 1LUAA 3KYDB 3ZV3A 1LQUA 3BMCA 4GVXA 3QJ5A 4WUVA 1YGYA 3OBBA 3GMDA 4J43A 3JD4A 4U0KA 2WD8A 1EK5A 1ZO8A 4R5HA 4YQYA 4ALIA 1FJHA 4BNLA 2X9NA 3RFTA 4JP2A 5BNIA 3C1OA 2QHXA 4EEXA 4KMSA 2NLOA 5CDSA 1D4FA 2NTJA 1P33A 3QHAA 3FNFA 1ENZA 1ZK3A 4RORA 4DRYA 4MPDA 4UEOA 5KCZA 4UVHA 3ZW8A 1HDRA 2HK8A 3CSDA 1VM6A 2YZ7A 1QMGA 3ST7A 4PLHA 3QY9A 2HO5A 3TOXA 2GUGA 5HA5A 1PU2A 2QZZA 3WTCA 2ZYDA 1N2SA 3ORFA 3HDJA 3OQBA 3FWNA 1NAHA 2Q46A 1P44A 4MP6A 1XQ1A 3OP4A 2Q99A 4XRRA 3IAHA 1JN0A 3KEQA 4D44A 4CQMB 1Q0HA 4LCJA 1G6KA 3E5MA 4Z6KA 2TMGA 2AEJA 3GFGA 3GGOA 1KYQA 2NU7A 5A05A 4PLCA 1FXSA 4I5DA 2V65A 4E12A 1UP6A 4I5GA 4AJLA 3KETA 2E6UX 2Q2VA 1VLLA 4GQAA 2G1UA 1CEQA 1GPJA 4D43A 1DFHA 1IB6A 2H5LA 4ZJUA 3LT0A 3C24A 5ILOA 3TZCA 2BFOA 5H82A 4GVLA 3S55A 3T4XA 3ZU3A 3PK0A 3DC2A 2VUUA 2OGUA 4J4BA 5G2OA 1E5LA 4BNKA 3BXXA 3EUWA 4JJGA 4XRGA 1LDNA 3JQCA 4PRLA 1BRMA 3WX0A 1LDGA 1E3EA 2HAEA 4LCEA 3A28A 1EUZA 3JQAB 4TRRA 1YONA 1B3BA 4JGBA 3H65A 3KRTA 4MVJD 2Z95A 4BO4A 1LNQA 3I23A 4DTIA 1Z45A 1Y8RB 2DPGA 3E82A 3EDMA 3AU8A 2PLAA 2FOIA 4IQ8A 2OFPA 3EYWA 4RF3A 3BZUA 4D3DA 1V3VA 2HJRA 3DZIA 4TKMA 3P2OA 4YJHA 3ZWOA 3PGXA 4BMSA 3ZN2A 3TNLA 1NBOA 1JDJA 5K6AC 3FBTA 3H3JA 2AMFA 4AJOA 3JQ9A 3RVDA 1PZEA 3PIIA 3W4JA 3ADOA 4BO8A 1MA0A 3ICPA 4NPCA 5I9NA 5MDHA 4L75A 4FQ8A 1CF2O 1K6XA 4C7KA 4Q3EA 3TFQA 2J5KA 2Y0EA 3RJ5A 3VKUA 1Q7GA 1LRKA 5TRTA 3IL2A 1U2DA 2O4UX 1I5RA 3I3OA 4BNVA 1P77A 1ZK2A 4E3ZA 1PWXA 4BGEA 1I24A 2UUOA 3OM9A 1M2WA 5IDWA 5GZ3A 2Q4BA 1PL8A 4Q39A 3K2BA 4G81A 2ZJ0A 5BNFA 3R3SA 1P1JA 3TDKA 4JNKA 3UF0A 2X9GA 2GZ1A 4GMGA 3F6YA 3I5MA 3K8ZA 4YB8A 1H93A 1FDSA 2PTGA 3PJGA 1F0YA 2BFPA 2PD6A 3QSGA 5HM8A 4FSHA 4HV4A 4Z3KA 4FC6A 2Q45A 3Q9NA 3KUXA 3WQQA 2RIRA 1K5HA 4M86A 2BHLA 2WYVA 2V7PA 1Z6ZA 1YBMA 1XEAA 2I66A 2P9CA 2O3TA 3RU7A 3ITDA 3NJ8A 4B79A 3H5AA 4R69A 1NX6A 3ROPA 4IJUA 3W4IA 4BHTA 4FS3A 2YFQA 4E33A 5KJEA 4H7PA 4I08A 5LC1A 1I3NA 2VNSA 3NDIA 5TT0A 3TL2A 3DAPA 1ZSVA 1LSUA 1EUDA 4Y9DA 3GNTA 3JYQA 4BMVA 3D3EA 4YACA 2J8ZA 1E7RA 1BDBA 1DIRA 3PI7A 5JC1A 4RVSA 2EF1A 4YEDA 4CM6A 2ZJ1A 4CM7A 3K30A 5L4NA 1HEUA 2CF5A 1GQQA 3DBHB 2FN7A 4O6VA 1Q7BA 3MOGA 3WICA 1XQ6A 4A03A 4IBOA 1V3UA 3UFXA 3ZHYA 5T5QA 1HDYA 1R4MB 3PYLA 1LTHR 1X1TA 3SXPA 1VKOA 3VH3A 4YRAA 4UREA 3AI2A 1XCBA 4LRTB 2HU2A 3K31A 3I52A 5GZ1A 1DB3A 4BB6A 3QVOA 2CY0A 2IZ1A 4HADA 5AXBA 4DYVA 1JVSA 1U8XX 3R6DA 1A7AA 3KV3O 3OQ6A 4DLBA 1V9LA 1KVUA 1VSUA 4J91A 4I1IA 3JQ8B 1O95A 3HDYA 4IIUA 4I8XA 3F5QA 4KQXA 2NADA 1ONNA 1SMKA 2E82A 4R54A 1JW9B 2EV9A 5L7TA 4HUJA 3JQGB 1I30A 3Q2KA 1BDMA 1VKNA 2PZJA 1YE3A 2P91A 1E1LA 1SCUA 4XDZA 1UXGA 1GV1A 5THKA 4UVGA 5F1OA 5I7FA 1ZNQO 3EW7A 5IDYA 3S2EA 4YQZA 5DZSA 1QSGA 2D5CA 1H0KA 1EVZA 3L4BA 4QXMA 1X13A 4BGIA 4DGSA 5TQVA 1P0CA 3TRIA 1YB5A 1EDOA 2GDZA 3A06A 5DP1A 2H6EA 4WEOA 4CLOB 4A73A 3NAQA 5CAEA 2W8ZA 5JY6A 2Z5LA 2FR0A 3ZHXA 3KYBA 4RF5A 1OFGA 4DIOA 1R0KA 4FOOA 3UKOA 3NT5A 5DT9A 2JFFA 1H94A 3C85A 1H6BA 3PYXA 5CP8A 3PJFA 4MVJA 1RM0A 4Q3DA 2IYPA 3RUDA 3F9IA 2HMUA 5EINA 1YL5A 2DU8A 3GPDG 1E1KA 1WDMA 4IUYA 4BMNA 5C37A 2G0TA 2NSDA 4HWKA 4WCFB 4B4OA 2JFGA 3NYWA 4BNFA 3JD0A 5G4KB 2NM0A 3F4LA 3MZ0A 2B5WA 5BQFA 4R1TA 2X9VA 4J49A 1P3DA 1PS0A 4CQLB 2OMEA 3K73O 2YJZA 1DHTA 1AXGA 1BW9A 1DBVO 4IDCA 2B4QA 1MX3A 4GPD1 1HZZA 5BSFA 3LC7O 1ZSNA 2YUTA 3B1JA 3KVOA 5DBGA 3RU9A 2OBNA 3PTZA 4O1MA 4GLLA 1SEVA 4FOSA 4KQWA 1B8UA 5JSFA 4K28A 1FDTA 1R12A 1MG0A 4PLPA 4HP8A 5IDQA 4FJ2A 3LVFO 1QLHA 2BI8A 5COBA 5IF3A 2IE0A 3O8QB 3TWOA 2D0IA 3GGPA 1GYPA 2O2YA 4Y67A 2Z1NA 1YL6A 3HNPA 2G5CA 2XF8A 3GG2A 4ND3A 4MINA 3Q11A 4Z3DA 1YH3A 3TZQA 2IEBA 2B5VA 2CVQA 1ARZA 1X0VA 4S3MA 3TF5A 4DC1A 1HETA 4QECA 4HKTA 2VHXA 4XGKA 1M76A 5ICMA 1PGPA 2NQ8A 2BD0A 2Q1UA 3I9MA 2BGLA 5EMHA 5JYDA 1B0AA 5L3ZA 2PGLA 3PIDA 5EPOA 5G0VA 2VCYA 5AXCA 3NX4A 2ZCVA 1UXKA 2BI7A 5T57A 5IZCA 1E7MA 2ZYGA 5DDIP 5ADHA 5ICSA 1DFGA 1FDWA 2BRUA 3ZV6A 4ESOA 4M54A 1BVUA 1AHHA 5ILGA 2QRKA 4P4GA 1Y9AA 4D0RA 4IDBA 4YJGA 3RUEA 3S8MA 3WG9A 3AM3A 3H2ZA 3S2IA 3GN2A 1ADGA 2GGSA 1XU7A 4Q3BA 1ZK1A 4TRMA 5HS4A 4OJNA 3HHPA 4M8SA 1HYEA 1PGNA 1D1SA 4WJZA 2GERA 4Q3NA 3ZWBA 4GKBA 4PLVA 1WNTA 1HWYA 2D4AA 4KUEA 2I6TA 1GD1O 3PDJA 2VHWA 4CLXA 4XYLA 3DAFA 3ETGA 3GG9A 3DXFA 1ZFNA 2VWPA 2HUNA 2JD2A 2DLDA 3PXXA 3HB4X 4QX6A 4W7IA 5EJ2A 5JCJA 4IY1A 3W1VA 2NV6A 5GY7A 4N5MA 3BMQB 4AFNA 1GCUA 2DUUA 4I9UA 2O4CA 2LDBA 3C7AA 4CUKA 1IHYA 4A2CA 1GL3A 1T24A 4LK3A 2EW8A 5C3MA 2VWHA 4B7XA 1YJ8A 3NT4A 2P2SA 1GYQA 3F5SA 4PG5A 4JN6B 4O0LA 4R9SA 4BKPA 3I9NA 3L6OO 3OJLA 4Z0TA 1JLLA 2AE1A 2DBZA 5CG2A 4ITUA 4BVAA 5A9SA 4WK6A 1GQ2A 1KY5A 1XR3A 1U3VA 2O3SA 2X0NA 2XOXA 3IP3A 4RF2A 5TX7A 5MGBA 3JYPA 4I9HA 2AHRA 4TROA 4YPOA 1LC0A 5A9SB 5DCWA 1H6AA 1Y9EA 1O89A 1PSDA 1F14A 3D5TA 1NFRA 5HTOA 5CEJA 3LLSA 2DQ4A 3GRPA 4B3IA 5I8WA 5KNLA 2C7VA 3PQEA 3UOGA 3TL3A 1LSOA 2VUSA 3NJ4A 4BKRA 2HK7A 2NVWA 3AI1A 3QIVA 2Y1DA 3M1LA 4FC7A 3GUYA 5JCXA 3JQAA 3FF4A 4NHEA 1VL8A 3OEYA 4KDEA 5TJ9A 2NNLD 1PJ2A 1B16A 2PH5A 1J0XO 3E48A 1LX6A 2J5RA 1IHXA 1LC3A 2AW5A 1U5CA 2CFCA 2OXIA 3WGGA 2WSBA 3GAFA 4NZ9A 3H7AA 2VYNA 3VKVA 4EUHA 3VZPA 1LBEA 3L77A 5L4SA 4CM8A 1TA4A 2ZK7A 5FFFA 1PGJA 1R6DA 3DB2A 4WE3A 3AM5A 2VOJA 3LDHA 4GWGA 2ZTLA 1KVQA 1NWCA 1H2BA 3WQRA 3ZNQA 2X58A 5JDIC 3C8MA 5AYVA 1I10A 1KIFA 4PGFA 2EKQA 1Z7BA 5LDHA 3U4IA 3R0IA 5CDGA 1I2BA 3ZU5A 3PDUA 5IZCC 2JCYA 5KJ1A 4CQMA 4LN1A 2O23A 1NVGA 3VZSA 3EY4A 3K9QO 4GGOA 1KEVA 2GO1A 3IP1A 2CMDA 4QEDA 1LEHA 3AUUA 4RO0A 5HWSA 1PTJA 4BNGA 2Q50A 4HXYA 4AJKA 4G2NA 4YRDA 3K92A 2WD7B 1NR1A 2JL1A 4XKJA 2CVOA 3E9QA 3ENNA 5CPFA 3ZWVA 4GI2A 3JQAD 3FTNA 1YJQA 1ISMA 2EIHA 1W8DA 4BNYA 3BMOB 2HKIA 1SNYA 3O26A 4XR4A 3LC2O 4RL6A 1DIAA 2Q4EA 1I2CA 2OOSA 4QO7A 1JQBA 3H2SA 4XIJA 1K3TA 2WEKA 2RAFA 3PGJA 1A5ZA 1Z73A 3GEMA 4HY3A 2UDPA 4IXWA 3MTGA 1EQUA 1HLPA 1ZIDA 4W6ZA 3NGLA 2J3JA 2GN4A 2I76A 3KYDA 4ALMA 4EEZA 4R5MA 1VL0A 3JV7A 4WCFC 1PL6A 2D8AA 5F3RA 3PHHA 2VHYA 3GVXA 3T4EA 5I8ZA 3RFVA 2OO5A 3GNQA 3E1KA 3U0BA 5BNTA 2I9PA 2CZCA 4TZKA 3ZWPA 4XZ3A 2GD1O 5K9ZA 5L95A 1P0FA 4J6FA 2WJPA 4LW8A 2C07A 2EKLA 3PQFA 3BIOA 1PJCA 4HNGA 4DQXA 4Y6SA 4OQYA 3RUIA 1OC4A 3EMKA 1ULSA 4MVJE 4WLOA 2WYWA 4E0BA 1LQTA 5DBIA 2W2LD 2QX7A 1NNUA 3JQEA 3V2HA 1DAOA 2D59A 1K89A 1ZKMA 2ZIZA 4UULA 1MLDA 4YA6A 2HLPA 3OIGA 1M67A 5JMPA 1EK6A 4BNTA 3GN1A 4FFPA 3VHRA 4RVUA 4FIZA 4JCOA 4PLTA 3LF2A 3L0DA 4XB1A 3AFMA 2Y1CA 4PG4A 1JKJA 3I1JA 4J7XA 3KYCA 1DAPA 1XSEA 1Y5RA 1V6AA 3V1UA 5A3VA 1IZ9A 4NFHA 1IE3A 1UZNA 2PV7A 4W9NC 5F21A 1E3SA 4IINA 3I6IA 4PIVA 1A4IA 2AE2A 5L53A 3GVIA 3JQ9C 3UH1A 1GZ4A 4IS3A 3N58A 3QWIA 4MVJH 3WIDA 4BGVA 4CLRA 1T2FA 4Z0PA 2Z1MA 3JSAA 1LDYA 4K1LA 3OICA 3PPIA 4OOEA 4IQ0A 2YV3A 1KEUA 3U49A 2EW2A 5IXYA 1QP8A 4YVFA 4BO9A 1EMDA 5LCXA 4J9UE 5JXWA 1WZIA 2DKNA 2DUWA 3QVTA 1UXJA 1U8FO 3AY7A 4F6LA 4RQTA 4XR9A 2WE7A 3SX2A 5T8KC 1R16A 4AJEA 3IKVA 3F1LA 5IZ4A 4C4OA 2P4HX 4MDHA 5F5NA 2Q3EA 1GCOA 4BNWA 3PWSA 1BXGB 4MIOA 1R4NA 4CM1A 1PL7A 4J9VA 5EQFA 1NASA 3WIEA 4DUPA 1ID1A 3WXBA 4CM9D 4AJPA 4YAKA 3B1KA 2WMDA 4J16A 4U5QA 4UEKA 5JDCA 1XWFA 1Y81A 1TB4A 3DMTC 4AJIA 3MOIA 1W6UA 4GX0A 1M6HA 2GPTA 1PWZA 1IPEA 3NDJA 1EE9A 3KTDA 2UV8A 2BF7A 1MXFA 2ZKLA 3ZW9A 2JD1A 1EVJA 3I4CA 1YWGO 1E6WA 4IMPA 1CJCA 4WASA 3GY0A 3INRA 3HZZA 1E3JA 3E5RA 3PLRA 4O5OA 1HE3A 2B0JA 3DZGA 4J90A 4BNNA 4D7AA 1S7CA 1EVIA 1KC1A 3ENKA 3ZWMA 1H9BA 1UDBA 2YDXA 4R01A 2PKQO 1ORRA 1BWSA 3VAZA 3WSWA 4QUKA 2YYYA 4BUCA 1OBFO 1U1IA 3HDQA 4E5KA 1DRUA 2Q2QA 1TT5B 2PWZA 2X86A 3ETEA 3DTYA 3FWZA 4OL9A 4TQGA 5DULA 4CMAA 2YQ4A 1A9YA 1SO8A 3ULKA 4I5FA 1J5PA 5I7VA 4DBZA 4DWVA 4CM3A 3LT2A 4FFOA 1KY4A 3O8QA 2NU8A 1JWBB 3ZHBA 1MB4A 3GQVA 2AEFA 1H5QA 1WLYA 3VPXA 2PZMA 3PHIA 2FPGA 3ZH2A 4PG6A 2WTBA 4RVFA 1E7WA 3DMYA 3MTJA 3ZHZA 3DL2A 4DC0A 2DBVO 2OORA 3AW9A 3G49A 1U3WA 2HK9A 3EVNA 3WYEA 4CV2A 4E5MA 1GZ3A 3TN7A 1I32A 4KUGA 3V1TC 1R0LA 3AJRA 4K9DA 4LVCA 2VYVA 4ND1A 2JHFA 1MXHA 2FP4A 3GR6A 3PQDA 1BXKA 2VT3A 4D45A 5L40A 4R1UA 7ADHA 1U28A 4BS9A 2FWMX 3NGXA 3LU1A 3WFIA 4JX8A 5JAZA 2V6MA 3VPGA 2C29D 3G1UA 1F8FA 3A9WA 4WCFA 1U4SA 1ENOA 4XB2A 1HE2A 4BNXA 4YJFB 4TMFA 4NFYA 1LLUA 4G65A 2HSDA 3GA0A 1TLTA 5FEUA 2B36A 1UP4A 3PYMA 1QV7A 4XYMA 1B3RA 4CL8A 5EIOA 4OO3A 5DP2A 4A27A 2PGDA 4DQVA 3NTOA 1GEGA 2A4KA 1QYCA 1V8BA 3L9XA 2Q1WA 1ZH8A 4AJ1A 4EJMA 4NBTA 1NFQA 5F5LA 3VDQA 3DFZA 5BSEA 3BMQA 4XYEA 4WECA 1PQPA 1GYRA 2VT2A 2OUIA 3DBRA 3L6EA 3QWAA 4MJLA 1KEWA 1VL6A 4CM9A 5KTKA 1WP4A 2CDBA 2ZB3A 4NBRA 1LXCA 5EL0A 2YV1A 5GMOA 4DPKA 3ROKA 2H63A 3LF1A 4W7HA 4BV9A 4RZHA 1N7HA 4DIBA 4NQZA 3ANLA 3CPSA 2B69A 4DL9A 5TSDA 4BGUA 2GN8A 2ZATA 2ZQYA 1LDBA 3A1NA 1UP7A 4AG3A 4EYEA 2O2SA 1HYGA 4BL5A 4CR8A 5AQ1A 3SEFA 2B37A 1G1AA 4YBZA 4YT5A 3VH2A 3WGIA 1O9BA 4GX5A 4J7CA 3E9NA 1CERA 5JNLA 1N92A 1XYGA 4L4SA 2W90A 3JQ8A 2GZ3A 1EQ2A 3F47A 1GV0A 3ZWYA 1F17A 1JTVA 2XXBA 3CMCO 5CHEA 2PFGA 1BMDA 2D1YA 4QFDA 2C82A 1D3AA 1DPGA 4IMRA 2UAGA 4CUJA 5JAQA 1SOWA 3WSVA 4BO0A 1P9LA 1SOVA 4E13A 2QZ9A 4A7PA 1VE9A 4FGWA 4IIVA 1I33A 1E7QA 2YHUA 4IM7A 2FR8A 3HDHA 4H15A 3C1TA 3WWZA 4FW8A 1GPDG 4XQCA 2OL4A 3UVEA 3UUWA 5TGDA 4KP7A 2YFHA 3IQDB 4IZHA 4R4JA 1N7GA 4J1NA 4GX2A 4BB5A 4D0SA 3Q9UA 4L0QA 1YQGA 3BMCB 2V6FA 3WYCA 3V2GA 5C7OO 1U5AA 3GZNB 5JS6A 3ONFA 4EI2A 5L4LA 1QYVA 1NR7A 2EKPA 1NHGA 4AL4A 4CQLA 3UCFA 4FD3A 4XDYA 2X22A 1Y8QB 1Z75A 3FNHA 9LDTA 1MUUA 3N74A 3OIDA 3V1YA 3FTPA 4EUFA 3S2FA 8ADHA 4BNHA 3B70A 2WE8A 3AOEC 5DCUA 2YHIB 4UUNA 1IOLA 3MWEB 3OA0A 2BH9A 6LDHA 1PQWA 2VOEA 4I5EA 4RV9A 3TPCA 1GADO 2FPIA 4L73A 4PLYA 3WMWA 3AUAA 4UAGA 3VH4A 2GASA 3O03A 1HZJA 3RAJA 3NT2A 1LDEA 3INGA 1N1EA 1SB9A 4II3A 1P1RA 3IOYA 5HRUA 1ZMTA 2IZZA 1JAYA 1LJ8A 3EZLA 4PZCA 4F45A 3JD2A 4CLOA 3GRKA 3G79A 3DEYX 2AQIA 4OAQA 4AICA 2A92A 3P2YA 2BFMA 2C59A 5DNAA 2HQ1A 5FWNA 1JWAB 3FR7A 1C1XB 1GUZA 2DTDA 4CPDA 2QRJA 4WOJA 2GNAA 1CWUA 3ANMA 1UR5A 2IZ0A 3O9ZA 4DBVO 5J23A 4GGPA 1C0PA 1X14A 3SBOA 3DWFA 1I0ZA 4YAJA 4INAA 1KC3A 5DF1A 1ONPA 2XXJA 5IDXA 5KIAA 2IYOA 4J0FA 4TRNA 1H6CA 3ZDFA 1CETA 1JKIA 4OXKA 4FGSA 2EP7A 1Q2XA 4ND2A 5L7YA 5A3JA 1PJ3A 3GH3A 2VZ8A 4DLAA 1FDUA 3WOHA 1HSOA 4U6QA 3Q3CA 1PX0A 2O3JA 3H5NA 3GNSA 2Y66A 5JFOA 3IIEA 3K5PA 1I36A 4E2WA 1U2GA 1VI2A 2WDZA 1EVYA 3GK3A 3CKYA 4RGBA 3SJUA 4RZIA 1PGQA 3KB6A 3DHNA 1MC5A 2J3IA 4LISA 1FMCA 2ZB8A 1XU9A 4J7UA 2CF6A 2YDYA 3UAGA 1LI4A 2GLXA 4HFRA 2A9FA 2EP5A 4YJFA 3RKRA 2NVUB 3ON5A 5EESA 3FHLA 4TRJA 4BKUA 4KUHA 5T6BA 5JO0A 3AFNA 4MVJG 1NHWA 2EJVA 4EZBA 3QQPA 5CEFA 1ZCJA 4WEQA 1UAGA 4IGFA 2POQX 1L1FA 4XQ9A 2X8LA 4WOKA 2I3GA 5BSHA 4CLHA 1OOEA 2UVDA 4NK4A 5JE8A 3W8DA 1YKFA 3VOSA 1O0SA 2G82A 1R15A 2DPHA 2P9EA 4IPTA 1WZEA 3W6UA 1VRWA 4CMKA 1YB1A 2Y1EA 4IDFA 3OJEA 3QVXA 1B26A 2R2GA
chains in the Genus database with same CATH superfamily
5BT9A 5JEEA 1WVIA 3HCRA 3RTEA 3FMPB 3PE4A 2FMTA 3HN6A 2F62A 1G64A 3HVUA 3PEYA 1SHKA 2B7LA 5TC4A 1B15A 1WZUA 4B76A 2FQXA 1SVIA 1W0JA 4QDTA 5H16A 4DY4A 5HKAA 4BNZA 2G8LA 3RBAA 3ZS8A 5IMSA 3R6LA 3RT7A 2AFIA 1LW7A 2X5XA 3DHEA 3RBZA 1FS5A 3G3EA 3U09A 2G71A 1V5EA 3GWGA 1JECA 1ZJZA 1XAJA 2W43A 2W8BA 2O7SA 3HBJA 3NPAA 2X1LA 4KV9A 2VT7A 2WWRA 1S3SA 4EFNA 2ONZA 4YAOA 2EWMA 1F5SA 2Z2ZA 1SKUA 2MIIA 4UNNA 2BGNA 3L7DA 5JO9A 1ZA2A 5LQSA 1LKZA 4G5GA 2IXDA 1H65A 4WK2B 1RJ9B 2LCIA 3CV3A 3PNLA 1QRAA 2W6NA 3S1AB 2W00A 5KYXA 4HX9A 3TSOA 1A1VA 5K0CA 4D9MA 2ZCUA 4YJ3B 4HK4A 4RTNA 1XD9A 2I99A 2JAUA 3C74A 3QA3E 4AWXA 3GQBA 3ET5A 4XYGA 3LO8A 2ZBQA 1K63A 2C00A 3RWMB 3A2LA 4NI5A 4BIIA 2P8SA 4FQ7A 1JVBA 1TOAA 1QONA 3KELA 4QTXA 1DRWA 1XEXA 5COAA 4GH5A 1HKHA 4X6UA 3JQFC 5C8YA 3RUCA 4RU1A 1A2QA 4E08A 1AC5A 2YINC 2OV6A 2AG8A 1LF0A 1V45E 2RI0A 3I4FA 1G21A 4RX1A 3ZDYB 2OHFA 4L50A 4MIYA 2JAPA 2YZ2A 3RC3A 3PUKA 3CVJA 3A4VA 1M2VA 2B4TO 3NUQA 3DFIA 4PFJA 4IH1A 4RIHA 3DOUA 3MAJA 5B1YA 1JLRA 5LZ2A 3FE2A 1M34A 2CT8A 4F5YA 3T5GA 2JAXA 2OSBA 4EKEA 2HBQA 1WUYA 3C7CB 3P4XA 4M38A 4CL3A 3GFFA 2RGWA 2C4KA 3IT3A 3KFVA 5BWOA 4LMPA 2C7PA 1TI7A 1ZBQA 1ISJA 2ZE6A 5GZ6A 2J5QA 4C0WA 4L5AA 1JSXA 3NRCA 1DJNA 1KI6A 1AKYA 2J9GA 2WPNA 1E5VA 1W85A 4L95C 5T3UA 4CDRA 1RTTA 1EHCA 2FB9A 3G1TA 8LDHA 4I3HA 5JCJD 1M2OB 5FT9A 4W99A 2UYQA 3NO4A 5HQTA 2N75A 5I45A 1TM5E 3D3WB 3TI7A 1BC5A 2I8AA 4RY0A 2QWXA 3V34A 4U7DA 3HB5X 1ULTA 2ZJYA 1NBMD 4L0CA 4J4HA 4NMWA 4S1VA 4Y0VA 1T6BY 3O8DA 3MHPA 4S35A 3ZBPA 1N33B 3OO1A 2GPSA 3F9RA 4FBMA 5E6RA 3PBKA 3BSSA 4CLRB 1YZFA 4REOA 1FU4A 5AO9A 4HQFA 4D9CA 1D07A 1YRLA 2H65A 3JR3A 1H2FA 1A9OA 3BH6A 4P5EA 2V1UA 3MCWA 1PK7A 1FTYA 3IUEA 4U2GA 4UTOA 5HF6A 3W2IA 2RJOA 1U0TA 2CHEA 3OJ0A 3NTVA 3T3EA 4ZHQA 2A57A 1CR6A 4KXMA 2W2TA 2MSEB 5B3JC 2CUNA 1IVSA 1RXEA 2I55A 3NHUA 4GBED 4DCVA 4WPGA 4N49A 1BS1A 5EUMA 4KACA 1SBTA 5KNCA 1U9CA 3QP9A 4L5JA 4NNOA 2EFGA 4PLFA 5I7AA 4IF6A 4GNRA 5I9BA 2P4QA 2PPLA 3BJIC 4H9GA 5F12A 5LUAA 3HL4A 4RPHA 2Y67A 1N8TA 2F8MA 3IPRA 5A4AA 4ARAA 3B1ZA 3U44A 1DBSA 2PK3A 2WF6A 3D8RA 2BMWA 4YNBA 1DJLA 4NMLA 4LGVA 4ZQIA 3MB5A 3CH4B 3ZX5A 2R8PA 3SQDA 5K8LA 4V2UA 3KQYA 1PJBA 2Q8PA 3O1IC 2QJOA 1CRWG 2GN6A 5LQCA 2HTEA 3LIIA 1LX7A 2XYHA 3IHWA 1JKFA 4Q01A 1EDZA 1KOFA 4HFNA 4H1UA 2VP3A 3MJTA 4W63A 4B4WA 5AW4A 3QE3A 2Z3VA 1FJGB 5JCOC 2OCLA 1ZMOA 2L0XA 4EYOA 1M6EX 1Y1PA 2HSWA 1IY0A 3F3SA 3MLAA 2HWXA 3AUSA 5KTNA 2WWWA 4R1NA 1T36B 2B8JA 3GU3A 4JU9A 4MLDA 1RS0A 4Q7KA 1Z4NA 2YV2A 2I6GA 1QDEA 1MB3A 3WKEA 3KHKA 2W6OA 4YRMA 4ZOLB 2ZYIA 3PDHA 4KK4A 4ZT4A 2WF7A 2VJAA 3X1YA 1TQ6A 3IUSA 5CTJA 3KNZA 5KNBA 3KVYA 4HLUA 5ED4A 4IIXA 1UFOA 1HOTA 4HAIA 5KJ6A 1ZVQA 2ENWA 2Y0PA 3M8KA 2FLKA 3O9MA 3SEAA 1KH3A 4E2ZA 1TKBA 1H4TA 2XMZA 4EQ6B 4JD5A 2Q49A 2J3LA 3J7TA 5J3JA 2ZTVA 4HVAA 1FRQA 3V00A 1PUJA 3C39A 3FZNA 5AI0A 3O4VA 3SZ3A 1ZIPA 3F46A 1T0HB 4L6CA 2I0FA 1GCAA 3EMDA 1GTZA 1LU9A 5BMOA 4II3A 3QX8A 3UCEA 3SQXA 3FNGA 1Q0SA 5EYPB 3UH0A 4V0MA 1VRCA 1CLUA 5JAPA 5H70A 2XB2A 3KE8A 5I9MA 4CODB 4EVSA 2QI9C 1U2PA 2PDAA 3IUQA 3NBAA 3KAPA 4FDAA 3UJBA 3ER8A 5K0TA 5EXEA 1NUHA 3IP6A 3IT1A 3RWOA 3H1TA 3HXLA 4UE3S 1EVLA 4C7MA 1R0CA 2ZSAA 3UXYA 3GOQA 3PWKA 4XYBA 3MD0A 3ASYA 2RCYA 1T26A 5A04A 1PUXA 1FCJA 5A1TA 2ICAA 3BDVA 1JILA 3AV0B 1T9GR 1TUGA 4EHNA 2QIOA 2O8BA 3KWMA 2Z58A 4KXWA 5CLGA 3JQBA 4BQSA 1HDXA 1QQ5A 2H4YA 3O90A 5ES4B 4NH4A 1BEZA 2HJHA 5C32A 1T2EA 4EPVA 2QE7A 3EAGA 4KI7A 1GQRA 5KYVA 5JMWA 1EUYA 2WM8A 1ZXXA 2IY8A 2XUOA 2Z6AA 1TEVA 1A95A 1PI3A 5KKAA 1RWNA 3N6VA 5AXDA 3ZU4A 3N0WA 5CLIA 3KQUA 4TYWA 4M0FA 1XPOA 2A5JA 3DOEA 1CJMA 1OZFA 2NTYC 2PS3A 4IJVA 4MRVA 4CF4A 5KVSA 3WO1A 2F48A 2EGHA 1R9GA 3O31A 4YAFA 1NOKA 3K8OE 1U04A 4HGPA 2HCTA 2K2WA 3LFUA 5IFKA 2VQFB 4DR4B 2I7VA 4TSFA 4WA8A 1XI2A 3FHTA 3HKDA 2JVIA 4M0PA 4WLUA 4FBGA 2PE5A 1VIMA 1VMIA 1Y4UA 2WAMA 1R4NB 4XCQA 4U9HS 2IPMA 1EFVB 2NPOA 3PQCA 1B7GO 1A5TA 1EX1A 1RFGE 1RYHA 1B6RA 4JFRA 4A4DA 1UJMA 1YVPA 2EARA 5D1HA 1SUAA 2PRZA 3BB3A 1QAMA 1VHWA 2GD0A 2JGAA 4LXQA 3DMTA 1EZ1A 4TGLA 2Q9UA 3CTMA 3EEIA 3L2OB 3B38A 1I9GA 3WHIA 1JE1A 4OLAA 4GLOA 3RH0A 5BN3A 4FNOA 5JU6A 1EXDA 2H06A 3K9CA 4X95A 5E0KB 5AVVA 2HY7A 1MDFA 3ONWA 1HE5A 1ZZEA 4HHEA 1OAAA 1CC1S 5L8VA 2A3RA 4RMJA 3LXXA 1E9DA 3WA7A 1G5RA 3ZJ4A 1P9NA 1LNZA 3FNEA 3FMFA 4MP3A 3VVBA 3RYCA 1KO4A 1N1GA 3SZMA 1PLLA 3IJRA 4TWBA 1RE1A 2B7BA 4QVIA 3F6PA 5E4YA 2LVBA 2C0CA 1T1GA 1SZPA 3L7CA 3AEYA 4Y1GA 2QMZA 1TVEA 4WHMA 1A98A 1MKYA 1TF2A 4L7VA 3WP1B 1V5GA 5EAIA 4NESA 2WHQA 4YV2A 3HY4A 1KTIA 3DDNA 1ZCZA 1SD1A 3QSYA 5C5IA 1KIAA 1OGYA 3NIFB 2KLBA 2ZBUA 3U2QA 2BEVA 1BJKA 4ZWNA 1M66A 2QE6A 1V25A 2X1HA 3F1KA 3BWCA 3KPWA 2G4LA 2WIFA 4Q3AA 3QTLA 4IVPA 3RKUA 2ATVA 5ETJA 4F4JA 3WO0A 1HURA 4CMJA 1QRSA 2A0UA 4LEIA 3VH1A 1J39A 3NTRA 3UJ3X 1XQYA 3OQ1A 4DF3A 3ZKAA 1U7HA 2WJAA 3Q7QA 3WLAA 5LYJF 4OXNA 3DEFA 2OLJA 1Z8NA 2IC5A 3RWBA 1EXNA 2VDLB 5K0JA 1SRRA 5LZ4A 1AT1A 2AG5A 4H1HA 4JT9A 4UTPA 1RCTE 5F2NA 4BVGA 2QF7A 3NM4A 1S01A 2PD4A 3TJRA 4CNBA 3KIPA 2VSOA 3QELB 5ALXA 2GJ9A 4UOEA 3UB2A 1J21A 4U3JA 3AVTA 2PY6A 4PC1A 4CV3A 4M0EA 1QH8A 4H31A 4JBGA 3UUFA 1CP2A 4HFMA 3W79A 4C5AA 5L3VA 3K0AB 3TD9A 4B85A 4RK0A 4O59O 3UMFA 5KU7A 3PHCA 7REQB 5IKXA 3BA6A 5ALWA 3GEDA 3FUUA 3QMMA 2I2CA 2A94A 2P3QA 3IKMB 3HKBB 4BN4A 2B21A 4FGJA 3EA0A 5HF9A 2CUKA 4C0AC 5JC8A 2HDHA 3I01M 4H77A 3UENA 5AXAA 5KKNB 4A16A 4JI8B 2BBOA 4EX6A 1KO1A 5LP6F 5U9CA 3E8XA 2WVAA 1O2DA 2FPPA 1G3QA 1T1SA 1OUMA 2FMIA 3GRVA 4RPKA 4ZC1A 4CGZA 1PZFA 5CXSA 2PRKA 3S2UA 1FU7A 2L19A 1E2QA 1L7MA 1M75A 1ZSYA 4K3UA 1FFEA 5MFZA 1CVLA 5B4VA 3ASUA 3AEKA 1OVGA 4EHLA 5A4MS 3PX3A 4Z4FA 4YDRA 1Y3IA 1OZ0A 5INTA 1KK2A 2IBSA 1CDZA 4NNJA 4GR9A 1FNBA 1E3LA 1AUQA 1BWRA 1MGPA 1P73A 1T25A 1P1IA 2E4XA 3HUUA 4I3FA 1SCAA 4WI1A 1J00A 2FE4A 2PZLA 4DLPA 2F1JA 1R4MA 1CDDA 2FEOA 1MG5A 2OVBA 2R00C 4UCWA 4D6XA 3OQOA 4CBVA 3HU5A 3WQSB 4JR2A 3PLAE 2X5JO 1XVLA 1DEHA 1C0LA 1A8HA 3QUCA 2W4QA 1I2AA 1Z5NA 2K7FA 5DASA 1W46A 1S2LA 2YVKA 3D7SA 4IDGA 5IVHA 3AF4A 3WXMA 3EBOA 4Y9RA 4P84A 1ADFA 2BJHA 4CF3A 3FTFA 1DIGA 1QIDA 2GJKA 3RRBA 3AX6A 3R5XA 3WK8A 3CZMA 1KJZA 2H2AA 5DOZA 1XEXB 5C8YB 4YMIA 5I51A 2FMFA 3A9SA 3WFJA 2CSXA 3UKDA 5JTUA 3EIUA 3PFCA 1OYYA 3FGZA 4TOIA 1MOQA 1UC8A 4TTAA 2O3UA 2AKYA 1AF7A 1HLDA 3H4VA 1T8UA 5I4BA 2IOHA 3OEWA 3N2KB 4LVUA 3HGTA 5JSHA 4ARZB 2H9AA 2QROA 2ZJ3A 5KHLB 3N2LA 2OHVA 3UJDA 3F90A 1FYXA 4QYIA 5A02A 3JQ6A 1L5KA 1DSSG 1CD5A 1WPQA 4IIFA 1JH8A 5F2KA 5G4KA 3UXEA 4XQEA 4PPGA 3W06A 4CDNA 4RY8A 2QIPA 4HB2A 2AXQA 4OBBA 2OOKA 3O75A 5PNTA 4A2QA 4OJMX 3RVLA 5EPEA 1BGVA 4WFJA 2YY5A 3MF4A 2NUAA 2Y05A 3HJAA 2RHCA 2HQBA 2J0VA 1QCYA 1BFKA 4IILA 1N0WA 4N9WA 3W5IA 1QFZA 5K20A 3PUYA 1MOPA 1AQIA 1I4TD 1W5AA 3PLNA 1C1HA 1WKVA 2IUYA 3ZNPA 2JBWA 3BXHA 5K0EA 4MUNA 3SC2A 3HN2A 4CEIA 4FLFA 5FTWA 3TZ6A 1EE2A 3BMXA 3EULA 3FA2A 1Q0RA 5AKGA 2X0EA 3K0CA 4X3OA 4XIFA 1RADA 3ZY4A 4QJIA 3ZWCA 4W5NA 1DRKA 2K5UA 4AZ0A 3WGYA 4IRUB 4JBYA 2LIVA 3HQ4O 4N03A 2FMHA 5E95A 1L0BA 3S8MA 3IC5A 4CL2A 2ZSHA 2VDPB 4B7CA 3LQYA 1ZHOA 1WVMA 1G7CA 4OB6A 2WSIA 4O4HF 4EL0A 4OIFA 5IAGA 2IXAA 5G1PA 3OF3A 1XRJA 4CKBB 1AO0A 1F2DA 3FGPA 5FNZA 4RHYA 3DFKA 3H3FA 4RSHA 2B1JA 1FNSA 4AJJA 3C6MA 4YCSA 1DOHA 2ZB4A 1J4AA 1PJLA 3ZWDA 1DKUA 5TMDA 1LTQA 2AG6A 3VU1A 3ZDQA 4ETWA 1W1WA 2NX2A 3GVCA 5E9QA 1RCUA 4MR8A 4URZR 1K6EA 1QBKC 3JVVA 5E1MA 4ZD6A 4DA9A 1CR0A 1K97A 4H0NA 4HGOA 1QQTA 2Z8YA 2AUMA 3PC4A 4PRKA 4Y2JA 5FBWB 4LI0A 4X62B 1DCTA 2PX2A 2OAQ1 2GCOB 3WC4A 4MAAA 4WCDA 3ZDAA 1KOGA 4JC5A 2C2GA 3LC1O 1UFRA 4O1IA 1OI7A 4P33A 2AJ8A 2WBLC 2XB9A 3Q3IA 4RDHA 1N8NA 1Q1NA 1XCJA 4RTLA 1ZWLA 3DWEX 2IHTA 1C4KA 1SC6A 2NTNA 3HR7A 3GMSA 1FP4B 1CQIA 5EP3A 5G4LA 3SEZA 3LHKA 4UFOA 3ZY2A 3EDCA 2EJBA 1ZH4A 5EZ5A 3CBGA 2JFQA 2PD3A 3I05A 2WFMA 1E69A 1UBRS 1XDSA 2NVOA 1QLJA 4RNCA 2FMKA 5AVWA 1O5OA 4B9EA 1TYZA 4MHSA 2G9NA 4G85A 5CH8A 1FY2A 3C5VA 1T5HX 1JYEA 2AOXA 4AXBA 1KBZA 5D00A 2DFKB 4G6ZA 4FGLA 2QLJA 1QKIA 1GGFA 3UJPA 1CBUA 2QNIA 1QR6A 1H0RA 1L5RA 4QQRA 2EFEB 3IVGA 1AXRA 5ALYA 3GEGA 2UZ1B 1B4DA 3VZCA 1T4CB 1NDHA 3R3ZA 3RSCA 1MT0A 4C43A 4V03A 1LLQA 4NBNA 3A6LA 3LBFA 2IZOA 3MAGA 1ZOLA 4R3WA 3KXPA 1T5IA 7YASA 1L5VA 2VNJA 3OETA 3VC7A 4PTZA 4BX9A 1PTKA 3BWEA 2XWBF 1HRKA 4DQKA 3T3OA 5C7IO 4JQSA 3E27A 4U7HA 5E3JA 1JHAA 1CZHA 4R1QA 3FIUA 1J2TA 1AQJA 1SCBA 3IUJA 2CCJA 2JKZA 2KLHA 2VYCA 3VX4A 4DE5A 1P9RA 4RKRA 1TQ2A 5BOSA 4QTZA 2Q8NA 3X44A 4KYVA 1LK5A 4ZK2A 4EGSA 3CC8A 5KDOA 4LC1A 3WIUA 4MK4A 2FVXA 4UUOA 2C2OA 3A6HA 4EITA 2RGXA 1QS0B 2QQFA 2P27A 4ZO6A 5IAEA 1UOOA 1JPVA 3F5FA 4OQQA 4CN9A 2H4JA 3RVOA 5ARBA 2OB2A 2XVZA 1YU9A 4WOCA 3QYJA 5JPCA 1B2LA 3KPVA 1XVAA 1L5QA 4XA8A 3E2PA 3R3UA 1TZMA 1YZLA 3HKEB 4YTEA 1XTVA 2AZ4A 4G5SA 1FK8A 4P5PA 5IBPA 4YCLA 3NR2A 3Q98A 2VHCA 4IIHA 3PXEA 2V7VA 2O7NA 3P2EA 4IYJA 4MW5A 2V59A 4HDNB 3GBPA 4JGGA 4YAGA 1XN1A 1RXIA 1QG6A 3CUEF 5FTKA 2BFAA 2OBYA 2VWQA 2V1XA 1HTBA 3Q9SA 5JXJA 3NOQA 1RWMA 2BGUA 1WNFA 2M98A 1UBLS 2UYGA 4DCNA 2Y1KA 3FPLA 3KS9A 4J1TA 5LQJA 3FUXA 2D5AA 3S5UA 1TTHA 1A96A 3BAZA 3R3WA 1DJQA 1D2RA 1U0RA 2OFWA 1U5BB 2QQGA 4HOYA 3QLJA 4M1QA 3DCYA 1EFTA 2OZPA 2PKCA 5E7JA 5IKPA 2IOFA 4RTSA 1Q1BA 2Q4DA 4RULA 3R75A 2NSHA 1OWPA 3YASA 4BQPA 2EGGA 4NIMA 4H2DA 5IK2D 2YN0A 2WTXA 2LE0A 3FSJX 3I9LA 3L7OA 1OTXA 4HDKB 4QFBA 4UHHA 3ZZ1A 4QPCA 4Y18A 3HVHA 2CLMB 4K9KA 3ELYA 2WP8J 3M6AA 4E07A 1JR2A 1K7CA 3OU7A 4KZPA 1ACJA 3DZKA 4RJIA 1SM4A 5TEVA 4OX9Y 3FYUB 1N7JA 1ISGA 2YNMD 3BK1A 4X1IB 3SSOA 4GZLA 1SUDA 1Z56C 3I32A 4M55A 5TQ2A 3T7CA 3ZE9A 2ZJ5A 3ZYZA 1OI2A 1PX2A 2QVBA 5JTTA 2GDJA 4B3HA 2BP7B 2X4LA 4I55F 3WADA 5B1EA 4BO1A 2B83A 3CNQS 3CE9A 3SS7X 4MAFA 1MFZA 2DFVA 4M99A 2X5OA 2QMOA 2Z3ZA 1QFJA 2JCGA 1E9BA 1JT2A 2DFTA 2AOUB 2AEMA 5BW6B 1D8AA 3MT8A 3ABIA 4JLOA 4OAPA 2FP3A 1V4BA 3CLKA 1NTRA 2P4EA 3CE6A 3G0IA 3QVLA 4FOLA 5IH3A 3WTBA 2O2EA 4PVDA 2OFFA 3KJNA 2JJYA 4ESEA 3BQNB 3IXMA 4JJ7A 5EVJA 3TTUA 1Q1QA 1SG9A 4PSUA 4TLAA 1TCAA 2IF0A 2ZZKA 3BD6A 3L8ZA 3AJAA 3L7MA 1M5RA 3FPGA 4RLSA 1MTOA 1BHO1 1Y5MA 4BLWA 2JBAB 4B1FA 1W7AA 2CK3D 2P6RA 3FYCA 1JE0A 1NXVA 2DHRA 2GTHA 1EQAA 3QX7A 5E4TA 1WCV1 4PIPA 4B80A 4PX9A 2PRIA 4PHCA 4WLEA 2QPLA 1V47A 1TLLA 2D2VA 5B12A 1EUQA 2F9FA 3SS9X 4O3MA 3AETA 2ILTA 1O9HA 1FFDA 1PR3A 2DBQA 1FP7A 1ISHA 3KJXA 4HRVA 4XOIA 4DBLE 2IWRA 2JH8A 1TNDA 5DSTA 4BDTA 4RCVA 3WGTA 4MARA 4F72A 4MR9A 1RMTA 5H3CA 5G1OA 3P2MA 2B94A 4H7EA 3H2HA 4PICA 3I92A 3OOEA 2R48A 3L8MA 3UJCA 4BOYA 4KQMA 4O4JF 1TFRA 1JALA 1NWHA 1V3TA 1IHPA 3NONA 1QOQB 4C06A 2RHGB 3FX2A 3W8EA 4UU0A 1OWOA 2B9EA 4J3JA 5JISA 2X3UA 4X6YA 3TL6A 4GBGA 2PH1A 3IIIA 4XWWA 1H3EA 3RW9A 3OPQA 4FXOA 1E20A 2H00A 2O2JA 4PRZA 5H5JA 3P4UA 1YOVB 3M6WA 4L07A 3DCNA 3ZNOA 1TAGA 3H1FA 5JQGB 2QYTA 2Q1SA 4OU4A 2J9FA 4Z9FA 1UPAA 4NULA 3T5AA 3M6FA 1G18A 1GNRA 3PDIA 1U7ZA 1Z6PA 3G02A 1YBVA 1KKMA 1TM3E 3CA8A 3CZ9A 3KOOA 4O2BA 2VDWB 1BSVA 5IN4A 3VZRA 2JIRA 4IX1A 2E49A 2R00A 3ESQA 4IW3B 4TLBA 3ADKA 2DG2A 3G7NA 4CIXA 2WJHA 4UFNA 3IDOA 4FDVA 4IZIA 3KQNA 2YJ6A 2DR2A 4UZSA 2FFRA 3KPUA 4FFRA 1CJTC 5JZMA 1ZN7A 2COKA 3D7KA 4JK3A 1QRRA 3NPMA 4PLWA 1D4ZA 3HFRA 4NX2A 4HGYA 2R6ZA 2P0AA 2PZGA 3NKFA 4JR0A 4MV5A 3HJGA 5J4KA 4KDFA 5DN9A 3CU5A 3MTEA 3DBLB 1JDZA 4NYJR 3FJ1A 2CEAA 1EGAA 3MXTA 1NURA 4IQGA 2DM6A 1NIJA 3OZAA 4J2HA 4LKRA 3SP1A 3TLGA 5KDDA 3U19A 1P75A 4N3NA 4D8WA 3KDAA 4TXJA 3SK0A 1BA2A 2IXEA 2VK1A 3JTEA 4Y6RA 4C5BA 1B0ZA 3Q0IA 4FLMA 4EM6A 1JDVA 1CUSA 2P11A 1KVTA 1BOFA 3KM0A 1E62A 1R64A 2H9IA 2ZIAA 3QUBA 3VOBA 3PNMA 1G66A 2VP4A 4B74A 1MQ8B 3ECCA 3HKBA 4IP0A 4K87A 5CB4B 4DJDC 1Z0AA 2D5IA 4U00A 1BE8A 1JB9A 3GEIA 2PO5A 4OHZA 3O1JC 1YUMA 1DC5A 5CPBA 4C4TA 1Z4JA 4Q7EA 5AUPB 1KWKA 1YTLA 2AFRA 3FCUB 2L42A 4LSMA 3A2MA 1XE3A 3I83A 2WKPA 1ENPA 1QHHA 1WVGA 4MGHA 3M2PA 5BN1A 1FMLA 2GEFA 2P67A 3NXSA 3FSRA 1G7SA 4FX5A 3IKTA 2NV0A 1YB2A 4EBBA 2RG7A 5HBRA 1Z3CA 5BYJA 5TY0A 1KGDA 3IQIX 4IMJB 3VX3A 4EFMA 1DAFA 4QFCA 4M87A 4DXHA 1V41E 1UBSB 1BHSA 1U7UA 3OZFA 2GT1A 1VG1A 1CZUA 3A14A 4JCCA 1KQFA 3LT5A 1PFYA 4PWZA 1TUEA 2AXEA 5EWJA 1JEYB 5TJHA 4QPJC 1J7JA 4E22A 1I6WA 1GQOA 1OJ7A 1TMOA 1HEIA 4V0QA 3ONDA 3H9EO 3WIBA 1YO6A 3PXDA 2JLWA 3N0XA 2OB1A 1NFFA 1ZGZA 1AF4A 1EH5A 4BO6A 4DCSA 5T41A 1FDVA 1VPEA 3LWBA 3OTIA 5AKYA 3H1PA 3JQ7B 5LD2C 2MCFA 1YAJA 1NVMB 4K46A 4B7UA 4JV5B 1X7HA 2ODWA 2PL9A 3TW0A 3K9FC 4WFQA 5B1SA 1YKSA 2XIQA 4UCQA 5CVVA 3WZ2A 2AFVA 1K8RA 1IBLB 1QDUA 4K05A 1PT6A 2JFNA 4BRUA 2ET6A 1J2EA 4HAWA 3VHXB 4XGNA 4ZDKA 1CIVA 4KQHA 2OKGA 1VLMA 3ND5A 1C8VB 3R77A 4ZCIA 2FGJA 3DKPA 4WY2A 5U4QA 4C89A 1OI3A 2W2MA 1Y6JA 2GPJA 2R7NA 1UIMA 1EG7A 3W3AD 4CQMD 2WIDA 3QHQA 1NNEA 3CR7A 3WR5A 3DF9A 6CHYA 1GCGA 3G6KA 3GPCA 1FTSA 2DUNA 4O4HB 4FZRA 1CZKA 2H31A 4PQEA 3Q12A 3BTOA 3PKIA 3QMPA 3OCJA 4B0PA 5ALMA 1QGZA 1SUSA 2W2LA 4E7PA 1V7ZA 2O2CA 2XT6A 2IRWA 2PGNA 1XYYA 5IJZA 1LFAA 4C6RA 1JQ5A 2PKEA 2TMDA 1UEXC 4DDKA 4MVYA 1IQRA 4C0XA 3NHRA 4CMIB 1NW5A 2C58A 1QK4A 4NCIA 3OECA 4P3NA 4R3NA 1JFTA 4ALLA 1RW4A 4W1PA 4EUNA 4QM7A 1TTQB 1MOZA 1LF5A 1IL0A 1GUDA 1QGAA 4ISBA 1YRBA 4L51A 2H7VA 1V6CA 5EC8A 3DZDA 2F3SA 1WB4A 4P5DA 4OFBA 4Q05A 4DYDA 3M4XA 2X6QA 2PLFA 3TSCA 1YGPA 3EWSA 3KXKA 1DX4A 2H1HA 4XX1A 3ZXYA 2E37A 4ZXFA 4E1AA 1OTHA 1BDJA 3K1ZA 3TQFA 2QRLA 1Z47A 1YQDA 4ER0A 2EG9A 4JSRA 4IRMA 5HUHA 1GPMA 2UYYA 1ZK4A 1UMDA 1IM8A 2WSSD 3FWPA 4MUKA 5BMVA 4K6CA 5DHUA 3TLKA 1A88A 1JQEA 2GBCA 1RYMA 1FB5A 3K2IA 2OC4A 3COSA 2PX4A 2PUDA 3U7HB 3DP9A 3CCCA 1MIOA 1MHTA 4XFJA 3NTXA 1V7CA 4UHCA 5KJFA 1FUKA 1U7DA 4PLZA 3HCCA 5E6UA 2P2CA 2YOFA 1IULA 2ZIXB 2EBWA 4HB3A 1ZCBA 4JY7A 5KYUB 4FFDA 5B6PA 3G9ZA 2NZXA 2JI8A 1Y0BA 4D57A 5A5EA 1G98A 4UVDA 3KLMX 5E2IA 1N32B 4YT2A 4EGFA 5AIBA 1H3NA 2GN9A 2NYRA 2QJRA 4BNDA 4DTCA 4YR9A 2F8LA 4KWIA 3TLCA 2Z8YM 3TSYA 3WGZA 4Q3LA 2XMCA 4HLQB 3EJ6A 1QE3A 2HLHA 4BX3A 1GTMA 4F5DA 3H5OA 3EZYA 3JPWA 4NZMA 1TX4B 1W49A 5TEWA 1GILA 2XRFA 4BBJA 3HI6A 2CGEA 2HMYB 1QYWA 1PEDA 2OCDA 3A3OA 3FW1A 4AM8A 1B6GA 1Q95A 1R27A 2P90A 2XA9A 3B20A 1LZKA 3CF2A 3FM9A 4IG4A 3RRZA 3WJAA 1F1JA 1RHJA 1EEHA 2X4DA 2IYFA 3Q7SA 5AVOA 1P31A 1JWLA 5DM60 4LZLA 1R5JA 2P9ZA 5LR6A 1QQAA 4KE8A 1R0YA 3M5PA 2ACWA 2REBA 4U0JA 5EUQB 4BBZA 3A32A 4TMVA 1IEWA 3JALA 2YNMC 2M9MA 1Y7IA 3C4VA 2H5JA 1D4AA 1K6MA 2X7JA 1D7OA 2WY2D 1USVA 1YVEI 2QI9F 1XMVA 3GP5A 5DHAA 3UO8B 3ODGA 4NAHA 4NE2A 1WPGA 3SGLA 5HJ2A 5DBFA 5HRAA 1CSEE 1R3DA 1Y6QA 3BKWA 3KG2A 1VKZA 2ZIUB 3PDCA 1L8QA 3VO8A 1CS4C 3IAAA 2I8LA 2VBIA 2I5PO 2GTPA 2NP7A 2C2YA 1K92A 2XNKA 1POWA 3SIWA 2DXIA 4L5CA 5C35A 3M1AA 1IMJA 5FTLA 4JZKA 1LQUA 3G0CA 1XZMA 3EVDA 4WUVA 1KRXA 1NNLA 2ZE8A 3UAXA 4ENTA 3T9BA 1Y7HA 4A6XA 1LPOA 1E1RD 3MWJA 3WYGA 1CEEA 4X71A 5C2JB 1QVRA 4U0KA 1ZO8A 4N1AA 3U60B 1MO5A 1PT8A 1XV5A 3JALB 4FYHA 4YUZA 1PEYA 5CCBA 4P80A 2QG9A 5SICE 4GF5A 1VPVA 5HSGA 4MUFA 5BSVA 2GXAA 1GT91 1N3YA 5EUBA 2NLOA 2JI7A 3FNIA 1HFJA 5CDSA 2D7JA 2C0PA 5T3YA 1JG2A 2G1JA 3CKLA 1ZK3A 4H59A 2D2FA 1IBSA 5KCZA 4BLVA 1GG2A 5DGCA 4UVHA 5TARA 2DQYA 3DMHA 2J9FB 1LPSA 2A9PA 2YZ7A 4V0NA 2R8YA 8ABPA 4UNRA 3ST7A 1LVGA 5P8WA 1KEKA 4PLHA 1CRPA 2HO5A 3H4MA 2GUGA 3C4QA 1PU2A 2QZZA 2ZIFA 4G8DA 4H7KA 4JL8A 4IIJF 3SZUA 3W2GA 3OQBA 4YPFA 2D1QA 2JFVA 3U1VA 4BNDB 3MAAC 1U8AA 5FQOA 5J2UF 1JN0A 2KBEA 3RABA 1NI3A 1XYVA 2GNPA 4KQFA 4MTCA 2WICA 5JWHA 4ZHQB 4C2AA 3CX8A 4WOBA 5ALNA 1JZQA 4WNAA 1WSWA 1KYQA 1XD8A 4I5DA 2V65A 4E12A 1P6XA 1UP6A 4HH4A 5A4FS 2IK8A 1UPBA 4E03A 2YUIA 3FZEA 4YP5A 4MB6A 5BSKA 1O58A 4Y3UA 2ZSDA 1KXJA 3WDMA 2Q6KA 4HB0A 4LDZA 2A88A 2ZSFA 4E94A 2ZIEA 1GPJA 2H5LA 1QANA 1ZS9A 2VXBA 2ZRCA 2ACEA 5DYYA 5U4XA 4ER3A 2N42A 3C24A 4DV2B 3NI2A 1RLUA 3U3RA 4DHEA 5AJXA 2QTRA 3DE2X 2X1VA 2WVHA 3I01A 3RT9A 5G2OA 1MB2A 4HPWA 2B7CA 3IPCA 2W5UA 3BXXA 2PYDA 3KP1A 4B31A 1RPTA 1Y9DA 4PRLA 2C99A 1FMJA 2GMWA 1GL7A 1P7WA 2AIRA 1N0UA 2XQIA 4TRRA 5A3RA 1B3BA 3KDPA 1V8OA 2BAGA 1CUXA 3H65A 4N3BA 1E5TA 2DQSA 5DX1A 1LNQA 4FMCB 1SCJA 3BXFA 2WPDD 3C6KA 3PNVA 1G5TA 4ZI5A 4ZCRA 1CZRA 2BWJA 3RF7A 3E82A 1KZ7B 2FOIA 4YR7A 3N70A 5DEIA 5BVHB 3E81A 3DOFA 1DKNA 4DVGA 4C4SA 5MHTA 1N6LA 2ZB2A 4D3DA 2ZJOA 4L15A 5C8DA 3PQ7A 5IWCA 3EQZA 3UHOA 1UKVY 3K16A 4LJYA 4N0DA 4F84A 3EEBA 3D8SA 2O1SA 1HOXA 4BMSA 3QFCA 1M3SA 1AIPA 2D54A 3C6BA 2GWHA 1TUBA 5BV8A 1PP4A 2WKRA 2AMFA 3GQBB 4FI3C 4AJOA 3JQ9A 4RFLA 4PBTA 4HDAA 5ERXA 4YJ3A 1X80B 4FUQA 4YCCA 1UMCA 4P53A 3ZQ6A 5CITA 5GGXA 2C03A 2E4UA 5MDHA 1OWNA 2YXPX 1F2TB 3WHPA 1KMHB 1WXWA 3P2JA 2YYSA 3K5HA 3ITNA 1XT6A 3HB0A 4C7KA 1Q3KA 5IUJC 2I4IA 4QHTA 4C30A 3RS3A 1OLSB 3VKUA 2GBIA 1LRKA 2XODA 3ESCA 4C29A 1P77A 4Q4JB 4ZREA 3I76A 2AXNA 4BEVA 1V11A 1PWXA 2H1FA 2RHDA 5AVUA 1I24A 3OM9A 3R4CA 1INLA 1M2WA 1ZM9A 1MAWA 2LV8A 3HMKA 2Q4BA 2NZ8A 2QJTA 1I0LA 3WHKA 2Y6UA 3LUAA 5BQPA 5BNFA 2XNDD 3R3SA 1JKMA 1OA0A 1EK2A 2W6QA 3GI1A 1BS9A 3UF0A 2X9GA 3JASB 1BVHA 5HG0A 3C6QA 4E09A 3R0VA 1ZDMA 1C50A 2I6XA 2Q5LA 3DYIA 3I5MA 3ZGVA 2PTGA 4B3CA 2KSQA 1TVKB 4EMUA 3PNSA 1SBNE 5HM8A 3SNKA 1DI0A 3AVVA 3DM5A 4HV4A 4FC6A 2Q45A 1PW7A 1K5HA 2DR3A 4M86A 3EQ6A 1G5QA 1EJ6A 5ALIA 5F51A 1MVOA 2PUTA 2GRUA 1ULAA 2ZYRA 4HAZA 1TCUA 2PYIA 4X91A 1X92A 4HQLA 1CUEA 3TVDA 2RGNC 4G26A 1NX6A 1GNVA 3ANYB 1NLFA 3QYAA 4FS3A 4NE7A 2A78A 4P3XA 4R2XA 4E33A 1J2UA 5C5EA 4H7PA 4LNHA 3PXUA 3F73A 1I3NA 2QTWB 3TQRA 4PX2A 1ZGBA 2GRJA 3RRFA 3TR6A 3NDIA 5H59A 1MNQA 1RI4A 4A8TA 5CT4A 4Y9DA 4DR3B 3ZK7A 1NN3A 5JNVA 1AGYA 1Q3HA 3JZMA 1Q1GA 2IHVA 1Z0SA 5EEGA 1V8DA 2Z9BA 4MJ7A 4RVSA 4Q4CA 2BMJA 3ESYA 2X8JB 3H9BA 3I2HA 4Q03A 4YEDA 1VPWA 3NTUA 2HHJA 3TVTA 1BJTA 4N5DA 2WC1A 2DYKA 2BEKA 4WZBE 1AH2A 2QMYA 5L4NA 1HEUA 2CF5A 1QVWA 2A0WA 3BGDA 3ICEA 3CWQA 3GEEA 3OE4A 4O6VA 1X1SA 3N7TA 4F9TA 1NUTA 2IUFA 4IBOA 1V3UA 1DKOA 2PVCA 3UFXA 1WF6A 2WJGA 5T5QA 1TIBA 3FHJA 4E1VA 1LTHR 1X1TA 3TG2A 1X74A 1ACLA 2D74A 2IKQA 3VH3A 3LQ1A 4YRAA 3OLVA 5GZ1A 3HS3A 3I52A 1SFRA 4TKVB 1CFJA 1CQIB 2KYRA 2P0EA 1VBMA 2SKCA 3DO8A 3IODA 2XOKA 2FETA 2VAMA 2Z30A 1JVSA 3JRXA 2RGDA 5AXBA 5AESA 2C9ZA 5BUQA 2DEUA 1A7AA 2QM8A 3S1SA 3GJZA 1K1EA 3OQ6A 4F2PA 4MCJA 3IMKA 2XBLA 2RAVA 2VP6A 1QBGA 4MI9A 1MZPA 4RF3A 3O94A 4DMFA 4KQXA 2A8YA 1QB7A 3SM3A 2E82A 2GPNA 3P0RA 4R54A 1USIA 4DBLC 2H48A 2P6MA 2YR0A 1JPJA 1PHRA 2H0AA 4JSYA 4LCBA 1I30A 3I04A 1CE8A 2VATA 3UC9A 1VKNA 2HDNB 3O3CA 4WERA 2EIXA 1UXGA 4MEJA 1U0NA 4UVGA 1Y6GA 4GP7A 4AKGA 1FXWF 4KLZA 3GZJA 3OKFA 1ZNQO 2VPXA 3EW7A 4G2TA 3ZEAA 4M8KA 4R71A 4HNVA 1O96A 3R5FA 1VTKA 4QXPA 4Q3KA 2J5XA 1Z22A 2D5CA 3AONB 4N0QA 4FW9A 2PZFA 3CTPA 1EVZA 5JH7B 4EPXA 2MMCA 1FDRA 3R7WB 1E5XA 4CIDA 1UZAA 4DGSA 2I78A 3FAKA 1Z6TA 3EZNA 5TQVA 1O54A 1I6MA 2GDZA 3A06A 1DX6A 3OU6A 1G3MA 2ZUEA 1FQWA 3ZTYA 1S1CA 4OP1A 4A73A 2FR0A 1KEEB 2MR6A 4PNHA 5J1SB 3KYBA 5DM0A 2CNKA 2GF0A 2SKDA 2XVAA 2VTKA 4ZEOA 4DIOA 3CVYA 1R0KA 1NXPA 2ZOSA 3NT5A 6PFKA 4OBWA 1YR1A 2F7SA 5DT9A 2JFFA 2ECPA 2WUFA 4TV8F 1NSFA 2YQZA 3HC7A 4TMWA 3HB1A 3R7WA 5IYZB 4J2TA 4ZYVA 2HIAA 4LY9A 2CLFB 2REXB 1VMAA 3FZQA 3F9IA 1J0DA 1USKA 3AERB 4OK6A 1YL5A 4CU2A 3L0PA 3B6IA 1F9EA 3M1IA 4UATA 3J7AC 2M6LA 2BCJQ 2J7PA 4EA7A 1QUEA 3ISJA 3BN3A 4H7IA 2PJRA 3TAXA 1RZ3A 4HWKA 4W8OA 4WCFB 3ZYCA 4L3OA 1D7AA 5G4KB 3VR2A 3FSEA 1GPH1 1I13A 2B5WA 4KIFA 5GOTA 4R1TA 1EU1A 1JR3D 2X9VA 3AB7A 3CH5A 2OMEA 2P77A 4HQOA 4J49A 5EWLA 4CQLB 1Z33A 2D1RA 1YDHA 3M6VA 1XZIA 3SJCA 2WNSA 4WOPA 4G9EA 4HDKA 2ZSBA 2QN3A 3VUFA 1Q91A 4DT1B 2G0AA 3RU9A 3DDWA 4JIMA 3PTZA 4ZVQA 1E3TA 3O83A 3QEKA 3U16A