1P74A

Crystal structure of shikimate dehydrogenase (aroe) from haemophilus influenzae
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
267
Chain Sequence
MDLYAVWGNPIAQSKSPLIQNKLAAQTHQTMEYIAKLGDLDAFEQQLLAFFEEGAKGCNITSPFKERAYQLADEYSQRAKLAEACNTLKKLDDGKLYADNTDGIGLVTDLQRLNWLRPNQHVLILGAGGATKGVLLPLLQAQQNIVLANRTFSKTKELAERFQPYGNIQAVSMDSIPLQTYDLVINATSAGASVDAEILKLGSAFYDMQYAKGTDTPFIALCKSLGLTNVSDGFGMLVAQAAHSFHLWRGVMPDFVSVYEQLKKAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of shikimate dehydrogenase (AroE) reveals a unique NADPH binding mode
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
molecule keywords Shikimate 5-dehydrogenase
total genus 98
structure length 267
sequence length 272
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1p74A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1p74A01
1IY8A 4NJMB 2DKNA 2ET6A 1E7WA 4GSKA 1PJTA 4EITA 5DDIP 1U3VA 1FF9A 3FF4A 4GH5A 3QWHA 2BFAA 3RUFA 3G0OA 2GN9A 3D64A 4GVXA 3NJ8A 5JDCA 4Q3EA 3AOGA 4GSLA 2DBQA 3QVXA 4UEOA 4WLVA 4QTZA 1JKJA 4LMPA 4L76A 4BS9A 1BWSA 3RWBA 3KOUA 4CQMB 3L6DA 1OAAA 4XIJA 4EUFA 4JJIA 5C37A 1PQPA 1GU7A 2ZKLA 3D5QA 2G82A 1A5ZA 1DIGA 1PSDA 2EHDA 4XIYA 4J9VA 4BQRA 2PV7A 1PU2A 4PRLA 1ONPA 5IF3A 4KUGA 1B15A 3Q3CA 4AICA 1NVTA 4UEKA 3Q2IA 1ADGA 3C1AA 2ZQZA 4FOSA 2VYVA 2G1UA 3WQRA 3K73O 1K3TA 1ENPA 3DHYA 2AA3A 3FBGA 1EZ4A 4LK3A 3E82A 4ND1A 4R51A 5U1PA 1DRUA 1OC4A 2GDZA 2O7QA 3DBVO 4YTEA 3QJ5A 1HDRA 1EQUA 4Y98A 3PLRA 5L95A 2NU6A 3B70A 4MP6A 1SB8A 2HO5A 4CMGA 4K6CA 3VPSA 4AJPA 2DTDA 1Z82A 3JQBA 4IDEA 1ISFA 2PA3A 1U8FO 3I23A 5KKCA 3S2FA 3OHSX 4RVDA 3H3FA 4AJHA 1PEDA 2YUTA 3BMOA 3C85A 5DP2A 4YYZA 3JQ8B 4ZHSA 4ZU3A 2Z95A 3ZWMA 4EYEA 4XGIA 1U28A 4Y6PA 4B4UA 4CM9A 3PGXA 4CV0A 2VWHA 4IXTA 3WLEA 1O6ZA 3PJFA 1BDMA 1DRWA 1E3WB 1GYQA 3TL2A 3KSZO 1V9LA 4R1SA 2NACA 4PZCA 1UP6A 1BW9A 1Y9AA 2PKRA 5AXAA 5A9SB 2GN8A 1PGPA 4AJJA 4BO3A 2QRLA 1LRKA 3MJ4A 1RM4A 3A06A 4RPGA 3RUAA 3VPHA 4YJGA 2ZQYA 4JLWA 2O3JA 3H4VA 1LQUA 3OEWA 4RVUA 3WNVA 4YVFA 3AOEA 3M1LA 4BB6A 4GPD1 1EK5A 3GDOA 5BR7A 1ARZA 4UVGA 1GD1O 4DLAA 1WDLA 3JQDA 3TNLA 3DHNA 3C7CB 1EUDA 4RVHA 4MVJG 3GDGA 4GWGA 4WK6A 4XWYA 2VOJA 3G49A 2VZ8A 1EVIA 3JYPA 4R1NA 2VYVD 4QQRA 4CR6A 1Y9EA 3FHLA 2EP5A 2OZPA 2G76A 3EK2A 3GC6A 4FFRA 5BNFA 3ZV5A 5U9CA 4IJKA 4FIZA 1P45A 1HTBA 4A5OA 2NV6A 3UFXA 2Q1TA 3VTFA 4TWRA 4IPTA 2JAPA 2VWGA 2DU8A 5F21A 2DBZA 1ZSVA 3RBVA 5L7TA 1DB3A 3NX4A 1NNUA 1AXGA 2Y67A 3O26A 4MVJI 4RL6A 4GVLA 1C0PA 1Q0LA 1R4MA 1UP7A 1CRWG 3JQAA 2V6BA 3U4DA 1C1DB 2NU8A 2ZB7A 4ONEA 1Z75A 2BGKA 4BHTA 5BT9A 1ENOA 1H6AA 1H6CA 1RKXA 4AJLA 4DIBA 1IZ9A 1XLTA 2BRUA 2FN7A 3O38A 3VAZA 3F6YA 3OIFA 2GR9A 3X2FA 4E31A 4TZTA 4P22A 3ETGA 1I36A 3GGOA 1BTOA 2X6TA 3HB4X 2C29D 3TJRA 3UH1A 3ZWOA 1D7OA 2AE2A 4E5KA 1CQIA 1WZIA 3D3WB 2WM3A 1ZJZA 2C5AA 4PG4A 3RU9A 4B7CA 4BNWA 4YT8A 4PLCA 4PLYA 1SPXA 4Z9YA 5KJ6A 5EJ2A 1B3BA 2J3IA 4WCDA 2HDHA 3LF1A 2FWMX 4Z9FA 1O89A 1RYEA 1X7DA 3TSCA 1DEHA 3DTTA 4RF5A 3RCBA 1MG5A 2Y93A 2GN4A 2W8ZA 2Y1CA 3GVXA 3N7UA 2BKAA 5JDCC 4BO2A 2A92A 3RIHA 1S7CA 1ZO8A 3OETA 1YQGA 5G2OA 1QYXA 4RCVA 4ZRMA 4AG3A 2WE7A 4A7PA 2Y1GA 1VJ1A 3H3JA 4AJ4A 4CL8A 4JX8A 3W1VA 4CUJA 3VVBA 5L9AA 4OXYA 2YJZA 1EFKA 2DPGA 5H82A 4IBOA 3OP4A 3JCZA 2A4KA 4E2YA 4AJ1A 1PS0A 4MVJD 3AFMA 4DVJA 1QG6A 4JROA 1WAMA 1DFIA 4ESOA 2R00C 3E8XA 1U9JA 3JYOA 4J6FA 4J2OA 2BHLA 2AEMA 4IIVA 1PS8A 5TX7A 2BFOA 3GMDA 3F5QA 3PHHA 1I3LA 1PWZA 2WSBA 1NX6A 3PQDA 1PQWA 4FFPA 3BMCA 1UZLA 4AFNA 1Z73A 5IDWA 3F4LA 1F0YA 1R0SA 5TJ9A 3GFGA 2QYSA 3HNPA 3P5SA 4WJZA 4YEDA 5ER9A 1VL8A 2OP1A 4UVHA 4PVCA 4B7UA 5A02A 1LLCA 3L77A 2D5AA 1LLDA 4FJ2A 3WB9A 4N5MA 2DTEA 3H6KA 3UOGA 1ZK1A 1E5LA 4DTIA 4J4TA 1P3DA 4PG6A 4R5MA 1OFGA 3ZGYA 3KRTA 4OSOA 4JQCA 4RPKA 5AXCA 3CXRA 1TT5A 1GL3A 3AM4A 3D3EA 2HJRA 4CQLB 5DBGA 3W8FA 3S2EA 4CMJA 1BVRA 3QVTA 4J91A 5EN4A 4P4NA 3CMCO 3LLVA 4EI2A 1AHHA 4KP7A 4M55A 2E82A 3PXXA 4BO6A 4DMLA 1ADFA 4MO2A 3DZIA 4NZ9A 5T64A 2BGLA 1K2WA 2FOIA 3I4CA 3ICPA 3PRJA 2P9EA 4HP8A 4QX6A 4YJFB 4II2A 1ZXBA 3K9QO 1GFSA 4E3ZA 3VPFA 1LSOA 1QYCA 2B4QA 2X0NA 3Q1LA 2PGJA 1XGKA 5LDGA 1I3NA 5CEEA 2EJVA 1ADCA 3WS7A 4ZQHA 3EAGA 3WFIA 3H7AA 1YOVB 4BO8A 1Y81A 2X9GA 3KYCA 4OGWA 3RU7A 4B8ZA 4BIIA 6ADHA 4GGOA 2R6JA 4NK5A 1ZNQO 3ADPA 4U0JA 4ALIA 1E7YA 4FD3A 4LISA 4R5HA 3GVIA 2W2KA 3EZYA 4CMEA 4NFSA 1ISMA 2H6EA 4R1UA 1GQQA 4WLUA 1NVMB 2EJWA 4U6QA 4JIGA 3AU8A 1QKIA 2X7HA 3OICA 3AWDA 4TRNA 3HDHA 4DBVO 3QVOA 3GZ4A 3UCEA 3W4KA 2AQKA 4U6SA 2GPTA 2Q2QA 2Y05A 4FC6A 3LVFO 3WBBA 1V3VA 3OJEA 5A05A 1YH3A 1A7AA 3R0IA 3E48A 4RDHA 3T4XA 1K89A 4QECA 5JC8A 1Z74A 2AE1A 4WGGA 5THQA 2GERA 1FDTA 2HKIA 5IDYA 1XR3A 3GR6A 3ASUA 5I8ZA 1QYVA 3VZRA 4DL9A 5B4UA 2ZTUA 3NRCA 1CEQA 1N1EA 4GMFA 2DPHA 3LT0A 5TQVA 3RUCA 5FF9A 1D8AA 2CSUA 2FHSA 1IHXA 1SNYA 3RC9A 4I08A 4UAGA 5G0SA 5A1TA 2IZ0A 2B0JA 2O3UA 2WMDA 4CLXA 2B83A 1AGNA 3LLSA 3RUDA 4NH4A 5DCYA 4MKZA 3OIGA 4M86A 2VTDA 3MJSA 2VQ3A 3WSVA 5CDSA 3ZCXA 2HSDA 1DDOA 4KDFA 5L4SA 3I9LA 3MOGA 2FR1A 1Z45A 4JP2A 1ZK0A 4EJ6A 4ZN6A 3NTOA 4H15A 3VTZA 3H9QA 4CODB 4EBFA 1ULUA 3CE6A 2ZTMA 3H5NA 1M66A 4WOJA 5JO9A 3GEDA 3LQFA 4GGPA 2C07A 3M6IA 5ER6A 2CDCA 3MEQA 4CR8A 5F3RA 3BMNA 2YW9A 2W2LA 5B37A 4JJFA 2HK7A 1DJNA 5HTOA 1WNTA 4I5FA 3LC7O 5GZ6A 3UW3A 4CR7A 1ZJYA 2D1YA 3NJ4A 3CSDA 3QW2A 2ZJ0A 3ZWBA 3JTMA 1Z7EA 3ASVA 1BGVA 1GUZA 1PX0A 2CZCA 1DPGA 4GX2A 3ZWCA 3O8QB 1ENZA 1TT5B 3GN1A 1CERA 1W8DA 3RI3A 1IUKA 4Z6KA 1E3LA 5A5FA 4F6CA 3KUXA 4B79A 3G1UA 4PLPA 5JCJA 2PKQP 4DLBA 3K8ZA 3GVCA 2B35A 1Y5MA 3KYBA 4FC7A 3PIDA 2AG5A 3QP9A 4O6VA 3UCFA 3FNHA 3JQ9C 5A04A 4RVSA 4RPHA 3LYLA 2UUPA 3GPIA 3OIDA 3RQSA 2SCUA 4IS3A 5JDIA 3KLMX 3D7LA 3SXPA 5CP8A 2NVUA 3JQFA 1KBZA 3BMCB 3VDQA 5G0WA 1HZZA 3SJ7A 2NVWA 3VKUA 1HDYA 2B36A 4NMHA 1HETA 3LK7A 2PTGA 3CINA 5JAIA 3U09A 4M49A 1MUUA 4YT2A 3PHGA 1F06A 1P1HA 1K6JA 2WEKA 1XA0A 3L4BA 1TVEA 4YAJA 1X0VA 1R6DA 4QT0A 4RQTA 4CLHA 4K28A 3R6DA 3TZHA 2Y68A 3HDJA 3I83A 4LN1A 4MOWA 5IDXA 4ALKA 3DAGA 1BSVA 1I0ZA 2FSSA 3HB5X 4R68A 3EUWA 2JKVA 2HLPA 1C1DA 2CVQA 2HMWA 2QHXA 1I24A 3CTMA 3DEYX 5U4QA 5IZCC 2GLXA 3PHLA 3IQDB 4YT4A 3PYXA 3MJEA 3U49A 4E13A 2FPGA 2D3TA 2QW8A 4CV3A 3KSUA 4DQUA 1B2LA 3FN4A 4ZQEA 1BXZA 3CZMA 1HDOA 2VNAA 1PIWA 2CDBA 3GGPA 1UUFA 2EV9A 4HFRA 2X0RA 2ZB3A 2PR2A 1PZHA 3NKLA 4OM8A 2J5KA 3SX2A 3FNEA 4FFMA 1PJSA 2UAGA 3I6IA 1MC4A 4J3FA 5DZSA 5KJFA 5ADHA 2ZB8A 4K6FA 5IXYA 1TB4A 3C1OA 1DO8A 1PL8A 3ZN2A 2HMVA 4CMIA 4CMCA 1SCUA 2D5CA 3S1LA 3RJ5A 2NVUB 4IMPA 1H2BA 1D1TA 2GCGA 1I33A 4TROA 1A4UA 1XWFA 4NBTA 8LDHA 2HAEA 2IYPA 3GA0A 1XYGA 3IP3A 3L6OO 4RORA 1H6DA 1Q7CA 3OF2A 4KUHA 4PRKA 4NK4A 4TRJA 1V35A 4HNGA 3WQSB 5JC1A 3V2HA 4D0RA 1J4AA 2O4CA 3DDNA 1E1NA 1M76A 4B3HA 3B20A 3WJAA 5I9MA 1FDUA 2PGDA 3E5RA 2I67A 1GEGA 1AUPA 2VUUA 5I7FA 4DBZA 3C8MA 1KVRA 5EQDA 5KOIA 1JTVA 4NDNE 4GI2A 4BNYA 4FDAA 1WLYA 5DBFA 3KLPX 5GMOA 2HMSA 1Q2XA 4OOFA 2P4HX 4PVDA 3DO5A 3W4JA 2I9PA 5FFFA 4MP3A 3T7CA 4OKIA 1NFRA 4WLFA 4O5OA 3DMTA 3I9MA 1DC3A 3PEFA 3QWFA 3WWZA 5KVCA 3NTQA 4MVJA 2O2SA 4KTVE 3T4EA 4HWKA 5I9NA 3EHEA 1IZ0A 1F14A 2PH3A 3PJEA 5ENDA 1C0KA 5KKAA 3ZW8A 4I5EA 4MIEA 4CLOB 1R4NB 4BO7A 4HBGA 4F3YA 3KYCB 2XXBA 4YXFA 4L4RA 4ZQBA 4WKGA 2YQ5A 2PZKA 4BB5A 1WZEA 1HSOA 2DBRA 4R16A 2NLOA 3DZKA 2DQ4A 5ES3A 5A3VA 3BZUA 4DIFA 4J0FA 4WE3A 2JHFA 3OJ0A 4YJHA 2GNAA 3M2TA 3EZLA 1N7GA 4Y9DA 1QYWA 1AXEA 4J43A 5IAAA 3TDKA 3VKVA 1E7MA 5LCXA 4NU5A 4G5HA 2X0JA 4XDYA 1EBUA 1Y8RA 1B3RA 1EVYA 1PJLA 3LU1A 3NAQA 3NDRA 2Y0DA 3KO8A 1T2EA 4UVEA 1LLUA 3GOHA 2XF8A 1WMBA 2XOXA 3RROA 2JFFA 3OSUA 4MVJH 2QX7A 2JD2A 1V3TA 3V1TC 4RPLA 4RVGA 3DFUA 2R2GA 4FGWA 3GAFA 1G0OA 1HE4A 1KETA 1UXHA 4Z0PA 5IFLA 4ROSA 1HXHA 4CMKA 2BH9A 4BKUA 2A35A 1PZEA 3L0DA 1HE3A 5L4LA 1LLQA 3KYDA 3Q11A 4O0LA 5FWNA 1X1EA 1NPYA 1Y8RB 1E0DA 4BUCA 2PZMA 4QEDA 3X2EA 4CM4A 4W4TA 5KVSA 3U4IA 1DAPA 3CIFA 1ZH8A 4W9NC 1ZBQA 3CEAA 3DL2A 4BO4A 2WDZA 5C7LO 1HDGO 4BKOA 1HT0A 4R41A 1YDEA 1LA2A 4BO1A 2J3KA 4BGIA 2CF6A 2PLAA 3OJFA 5B4VA 3U0BA 4J1NA 1HZJA 4CUKA 1ULSA 3N74A 4BMNA 1ZEMA 2X1HA 5DBIA 3ICCA 4R54A 5F1PA 4W82A 4FQ8A 5MGBA 1I2ZA 4D42A 3QVSA 1T25A 1YJQA 2DUUA 4HFNA 2O50A 3ZWAA 4E12A 1PWXA 4K9DA 3HSKA 1DC6A 3S8MA 4GKVA 3H9GA 3PI7A 1ZMOA 4JCOA 1LDYA 5K9ZA 3IMFA 1VI2A 1SZJG 5DF1A 1A71A 3DOJA 3H9UA 1U5CA 4NBVA 4E0BA 3HJAA 1E1KA 1GTMA 4JGBA 1B8UA 1M6HA 4CMBA 4BNTA 1ENYA 2HRZA 3BTUA 4WLEA 4ZVVA 1VPDA 3PZBA 5CAEA 2YV2A 5TT0A 4TSKA 1IYZA 3F1LA 3TF5A 3DZGA 2FR0A 4GX1A 4MINA 1ZEJA 4XYLA 1UZMA 3KHUA 4CM1A 4I9UA 1KEUA 2VCYA 1JU9A 1P74A 2O3TA 4FS3A 5T57A 3C3XA 4C4OA 3FD8A 3K96A 4UUOA 2AMFA 3DZJA 5CDYA 1ADBA 1PR9A 3L9XA 4ZJUA 1CYDA 4FFNA 4PG8A 5COQA 2X5JO 1G0NA 3JQBC 4RZIA 1XKQA 3JV7A 2WYUA 1S6YA 1YRLA 2IZZA 4GAEA 5A9RA 5K0ZA 1HDZA 1YB4A 5JE8A 5I7VA 4N7RA 3ZWYA 4JK3A 3GAZA 1UXIA 4DPKA 4BNKA 3DTYA 4KZPA 1ZIDA 4FGSA 1D1SA 4BOYA 1ISGA 1DBVO 1HLDA 3VH2A 3WX0A 2J3HA 4H16A 1U3UA 3RSHA 4BNGA 3BYZA 2W4QA 3A9WA 3ON5A 4CQMD 5EQFA 4IDGA 1NFFA 1LJ8A 2OMEA 3KSDO 3BIOA 5AVOA 1P44A 4I5GA 2X58A 1N8KA 3IJRA 4XYBA 1ZKMA 1GYRA 2Y66A 3CMMA 4RLSA 1DIHA 1L1FA 4IUYA 1X7GA 5HS6A 2Q46A 5T8KC 2P91A 3KZVA 2UV8A 5A03A 2A94A 1EMDA 2UVDA 2X5KO 1PL6A 4L9RA 1VC2A 4QUKA 3NDJA 3SLGA 4NBRA 4ILKA 1E77A 1R12A 2O2YA 4XDZA 4D41A 5IN4A 2I3AA 3B1KA 1XQ6A 3BAZA 2P5UA 5DN9A 4FCCA 4LSMA 2YHIB 4S1VA 3KEOA 1SEPA 4NQZA 4CM4B 4KTTE 1D3AA 5JY6A 1BW9B 1V8BA 3RVDA 1YS4A 4YA6A 1MFZA 2Q2VA 1JVBA 3ZWVA 2IE0A 3I9KA 4GKBA 4Q9NA 2ZCVA 4D7AA 2DM6A 2PK3A 3JQGA 2P9GA 5TS3A 3SEFA 2Q1UA 3TQHA 1YL5A 3CKYA 2OO5A 4EEZA 1MLDA 1U3WA 4IMRA 1A4IA 1E3IA 4J1QA 4RVFA 2DAPA 4EJMA 3ITKA 3OH8A 5C3MA 4Q3NA 2DFVA 3IJPA 4O1MA 5G0UA 5BNIA 3WIEA 4IDBA 4BV8A 5JCJD 1GZ4A 1AHIA 4E5NA 4Y8VA 4IINA 1RWBA 3E6AA 4JBIA 1P1FA 4UUMA 3PVZA 5GY7A 3AI3A 3U9LA 2CF5A 3WGQA 2W2KB 1I01A 4QFDA 5DOVA 1T1SA 5TJHA 1B7GO 1GEEA 1PJQA 3SJUA 9LDTA 4BNXA 4U0KA 4RQUA 2P2SA 4K1LA 5CFZA 5KJCA 1NWHA 4UVDA 3D4NA 5JAQA 1UZNA 2QQ5A 1LC3A 1I2CA 3AU9A 1I10A 3OM9A 2Q4BA 1GZ6A 4HFJA 1HLPA 2Y1DA 2NADA 4FR5A 2Q3EA 1R0KA 1HE5A 3NT2A 3WBFA 2TMDA 4IXWA 1N9GB 3KVOA 5COBA 4LVUA 3VZPA 1E3SA 3JQEA 2I3GA 2PFGA 3DBHA 3HN7A 2UUOA 1DRVA 2OHXA 3WGGA 4Z3KA 4ZGWA 4FJ1A 3ANLA 1T2AA 2EXXA 4KOAA 1A27A 2EG9A 2R00A 3ZU4A 2AEFA 3ZWPA 4D45A 4IQ0A 4U7WA 2I65A 1VE9A 1M67A 2XAAA 3EYWA 5IG2A 2HK8A 2GZ2A 5L51A 2VWPA 1TLTA 5LDHA 1GZ3A 3FWNA 1HDXA 2JCVA 1AE1A 1YL7A 4NI5A 4CV1A 5DNAA 3NEPX 4GBJA 1C1XA 1SOVA 2Y1FA 3AY3A 3QVWA 2HCTA 5TF4A 2PD3A 1D4FA 4MKRA 5K6AA 3JQ6A 3I52A 3WTBA 3DHEA 4IGEA 3LT2A 5BSGA 4MVJM 1JW9B 1JAXA 2WD8A 4OXKA 4UUPA 3PYMA 4WOKA 5HRUA 4MVJE 3ZNOA 1SAYA 3EMKA 3GZNB 2AQIA 2W2LD 1GPDG 1CETA 1P9LA 5G4LA 4KUEA 2PGLA 4BO9A 2X23A 3DQPA 4LW8A 1YO6A 3C24A 3NYWA 3DBLA 1IL0A 4R01A 4H7PA 2QRKA 3GF4A 3NGLA 2ZIZA 2HQ1A 3MWEB 4OIMA 6LDHA 1XU7A 2AEJA 2GGSA 4LRSB 3VH3A 1JKIA 2RCYA 4JXKA 3WGYA 2EEZA 5TNXA 1YOVA 1Y5RA 3QSGA 4UEJA 3R3SA 5H81A 5BSHA 3OJLA 1Y6JA 4XR9A 2OL4A 2FP4A 3C7AA 1U7TA 2RBEA 3L4BC 4TRRA 2VYNA 1FDWA 1PJCA 4AJKA 1YBAA 5GZ3A 1PJBA 4ND2A 4Y67A 2B5VA 4N5LA 2V6MA 4IY1A 3B6ZA 4BMVA 3ZHBA 2IRWA 1YQXA 2DT5A 1LDMA 4FBGA 2GF2A 2W90A 1KS9A 3WOHA 1E1MA 1YGYA 1NAHA 3V2UA 3RUHA 2Y0EA 3MJTA 3NV9A 4B4VA 1C14A 1LI4A 3BTSA 1YB1A 2FPIA 2UYYA 2JJYA 3BHMA 2FRDA 2O4UX 4UUNA 5KTKA 3QWAA 3VPXA 3K31A 1E3EA 4OMUA 4FW8A 3WG9A 1X13A 5IXSA 4AL4A 4B3JA 4XEHA 3ABIA 4BNUA 4OJNA 4BNZA 1DAOA 1NYTA 1M75A 5ENVA 3PGJA 1E6EA 3RFTA 4NBUA 4O63O 4L4SA 5BNTA 2G17A 4X54A 4EGFA 2WTBA 1WMAA 1WWKA 3EY4A 5F5LA 2C54A 3AY7A 3H5RA 3AFNA 4E4YA 4CL3A 5AYVA 4XQEA 3DBRB 1ZK2A 3AI1A 4U5QA 4YACA 4WASA 5AQ1A 3BTVA 3ZH2A 4IZHA 4DGSA 1H5QA 2CVZA 1GQ2A 1ZK4A 1ID1A 2HMUA 1ZUD1 3N58A 1U4OA 3L07A 3S2GA 4E2XA 3PIIA 1Q7BA 5JNLA 1K6XA 1KERA 4KDEA 3KB6A 4MPDA 3UICA 5DOZA 5JLAA 2CNBA 1BMDA 1HF3A 1YXMA 2B69A 1B0AA 1I2BA 1PR3A 3A28A 4IS2A 4XB1A 3OA2A 2WYWA 3SLKA 3G79A 1NWCA 1LBEA 1H94A 3UCXA 3ZNPA 1XIVA 3UHAA 1SOWA 3LC2O 1AN9A 3CZRA 3L4SO 4J7XA 5KIAA 3GK3A 4OKNA 4NNJA 2VRCA 3WR5A 2VUTA 1Q1NA 4XYMA 4R1TA 4XYGA 5I7SA 2I5PO 3WYCA 4KMSA 4BO0A 1PJ4A 3FNFA 4EDFA 4PLVA 1ZMTA 4PLTA 2D59A 1TI7A 3KXDA 3Q2KA 1O95A 1XSEA 2JFHA 1E6UA 1Y8QA 3IDSA 4TRMA 3BMNB 3ROQA 4YJGB 5KWEA 3GVPA 2QYTA 4J0EA 2FY8A 1VL6A 4NR0A 2NUAA 1ZZEA 1MXHA 3LDHA 3RC7A 4YAKA 1LDGA 4A03A 2VNSA 4J2HA 2C20A 4P8RA 3RAJA 3C1TA 4EW6A 4J9UE 3PWZA 4AJIA 1JN0A 1T1RA 1L7EA 1A72A 1H93A 3WGTA 2DLDA 3UXYA 1KYQA 1VM6A 5AXBA 4PLWA 3BHJA 4WNIA 2YY7A 2WE8A 1EE2A 1EUCA 1UXGA 4E2WA 3AW9A 3TRIA 4B7XA 1VRWA 2LDBA 1P77A 2BI8A 3FRJA 4HADA 5JXWA 1J6UA 3GG2A 4E21A 4BGEA 3D0OA 4AJNA 5JS6A 3ETDA 1R4NA 1KVUA 4N54A 2XPCA 1P1KA 4OHUA 3WGOA 4D43A 3OBBA 5L3ZA 3TZCA 3RBXA 2RIRA 1WPQA 3IKTA 3G3EA 5EINA 1ISIA 1BHSA 3MTGA 2DVMA 4FN4A 3FBTA 1X1TA 3HN2A 1LDEA 5ICMA 3ANNA 3UGKA 1H0KA 4PLFA 1SBYA 3HUDA 1DIBA 4HFMA 3WMWA 5G4KB 2GO1A 2JD0A 1VJTA 1XDWA 2O3RA 4NIMA 3RBZA 2EIHA 1LRJA 2Z1NA 3JQCA 2P4QA 3DBLB 3MZ0A 1UH5A 1O9BA 3IP1A 3RASA 3GHYA 4YAIA 1GV1A 2IEBA 3IIEA 4IJWA 1GQYA 2RHCA 3O03A 2RAFA 5L7YA 4RF3A 3UAGA 4BO5A 1IPEA 4Z3DA 4BGUA 5HS4A 4DLLA 1KVSA 3ROPA 5I8WA 1LQTA 1P31A 4CLRA 1HWYA 4GX0A 2PH5A 1I5RA 5A9TA 2VYND 4R3NA 1GR0A 2EW2A 5JYEA 3IAHA 2VWQA 4BVAA 5B1YA 2OBNA 4URFA 1BXKA 4FFLA 1ZXLA 3LT1A 1VJ0A 2ILTA 2ZTLA 3LF2A 5FI5A 1F8GA 3T7EA 1UDCA 1HDCA 1VKNA 1DC5A 1OI7A 5KCZA 1B8PA 3ONEA 1NASA 2X9NA 4ZD6A 4KWHA 1KEWA 5CPFA 4YRBA 2VT2A 2J8ZA 3ZV4A 2CD9A 1YWGO 1U2DA 2B5WA 1XHLA 3CPSA 3VH1A 1W73A 1LDNA 1R0LA 3BA1A 1A9YA 2OBYA 3IUSA 4AJ2A 3Q9UA 1YDWA 3BHIA 4OQZA 1QP8A 1W0CA 2OFPA 1PGJA 4ND3A 4XQCA 2GD1O 3PWKA 1X15A 4RF2A 4OXNA 2VHVA 4J16A 1LUAA 3DXFA 2H1SA 4L8VA 4CM3A 3EW7A 1XQ1A 3PJGA 5BSEA 1GUYA 3UVEA 1WDMA 3K6JA 3ZHXA 2HK9A 3PFWO 4JNKA 4E5MA 4TVBA 4CUZA 2NM0A 1EUZA 1I32A 3MOIA 4F45A 2CMDA 3NUGA 2O3SA 5TT1A 3WQQA 4RLHA 2NTVA 4DRYA 2NNLD 4DXHA 1KY5A 3EDMA 1RM5A 5F5NA 3U3XA 4CLEA 2I66A 3F3SA 1C1XB 3B1FA 2QZ9A 1VKOA 1GAEO 2JL1A 4XX0A 5CEFA 5IZ4A 4HUJA 1YJ8A 4CM8A 3GG9A 2GRAA 4D3SA 3ZWWA 3D4OA 4K26A 5MDHA 1R4MB 4IQGA 5A3JA 1DLIA 2NSDA 5T67A 2X4GA 3ZU2A 1BXGA 3AM3A 4TVOA 4D0SA 2WD7B 4PLGA 2JAHA 3STHA 1VLLA 4ZQGA 5ILOA 4GMGA 4A73A 3ANMA 4J90A 2IDZA 3Q0EA 4WCFB 5EERA 1UR5A 4BKPA 1U4SA 1X14A 2X0IA 3QHAA 3HG7A 4QXMA 2C2XA 4AVYA 4Q3DA 3DOCA 4GL4A 5JDIC 1FJHA 1MP0A 1W6UA 4IQ8A 4C7JA 1TA4A 3PHJA 4L74A 3JQFC 1SC6A 1UAYA 4DQXA 3IL2A 1B8VA 2CFCA 1WW8A 2HRBA 1PS9A 3JQ7B 4XD2A 4DA9A 5IDQA 3S2IA 5A06A 9LDBA 4NJMA 1QMGA 3TN7A 3I6QA 3PWSA 4I8XA 3H2SA 3VDRA 3ZNNA 1Q7GA 2JD1A 2EP7A 3ST7A 4BNJA 1DXYA 1G6KA 4D3DA 2JHGA 2VHZA 4MIYA 4CLOA 4QO8A 1SB9A 4IJVA 4DWVA 3V1UA 3ZU5A 2X5OA 3ZNQA 3DFZA 2UDPA 4HXYA 2VUSA 3INRA 3V5NA 1E3WA 4WCFC 2O7SA 1H9BA 3MWDB 3PZRA 3WGZA 4PLHA 4ZICA 4F6LA 3IOYA 2E49A 4N18A 4XGKA 2EGHA 1IULA 3H8VA 4YBZA 5ILGA 1U2GA 1C3VA 1LU9A 2AQ8A 4ALLA 3OFSA 2Y99A 4GQAA 4HNHA 1E1LA 1GADO 5DCWA 3AUAA 3L9WA 4W99A 4MVJP 4XR4A 2E4AA 3W6ZA 3LSYA 4NJOA 3VZQA 2DBVO 1A7KA 5EL0A 3ZV3A 2ZB4A 2IEDA 2A9FA 2C82A 2WJPA 4ZRNA 3GNTA 2YYYA 3QY9A 5KJ1A 4CM6A 2QRJA 3GNSA 4CPDA 1DLJA 4R4JA 3UKOA 5J23A 5L45A 1R66A 5F1OA 5L53A 3WGIA 1O5IA 3LC1O 3AK4A 3O4RA 3UN1A 1JQBA 3DBRA 5L40A 4WCFA 1J0XO 1EDOA 3GPDG 1NTOA 4OOEA 1JLLA 3TWOA 4BNNA 1ZK3A 3SC6A 3ZZNA 1HE2A 1LDBA 1NR7A 3WTCA 2Z1MA 2C0CA 4NU6A 2OORA 2HUNA 4XRGA 4YQZA 3RFVA 3D4PA 3BMQA 3WYEA 2Q99A 2Y1OA 4YAGA 4L4XA 4XJTA 1TXGA 3FTNA 3WIDA 2BFMA 1RJWA 1DIRA 1U8XX 1IHYA 1NR1A 3HADA 1E5QA 3F46A 4P4GA 3E9QA 2BFPA 4RV9A 1W4ZA 2OGUA 1WVGA 2Y1EA 2FPPA 2W98A 2QG4A 3I9OA 4M54A 1M6WA 3U5TA 3F5SA 4CJXA 4WPGA 1PGQA 1T2CA 1HL3A 4E30A 2P9CA 1SEVA 5CHEA 4G65A 3GZNA 2FMUA 2F1KA 3K92A 3VPGA 1DHTA 4DPMA 4IDDA 1KVQA 3I9NA 3ROMA 4J49A 3KEQA 4XGNA 2WYVA 2XXJA 4R9RA 3WGHA 1FXSA 1DHRA 1Z7BA 1J5PA 4TKLA 2BI7A 3HHPA 4A10A 1HRDA 3JQAD 1ISHA 3FWZA 2RH8A 4EUHA 5HWSA 1F17A 1PGOA 1ISJA 4J7CA 4OH1A 1UXJA 1YBVA 4MP8A 4PCVA 1EK6A 4XZ3A 1MA0A 1BDBA 1PQUA 3DWFA 3GFBA 3E03A 4YRDA 2D2IA 4CMAA 1DIAA 2RH4A 3DR3A 2J3JA 3P7MA 2OOSA 2ZATA 3AUTA 4LCJA 5JPIA 3PLNA 1NQ5A 3DBHB 4QO7A 4BNMA 3WFJA 3DC2A 5CEJA 3BMOB 5IZCA 3K2BA 3QQPA 4YJFA 2X8LA 5ITVA 2O48X 5C5IA 4PG7A 5JBIA 2GASA 3IC5A 2YFQA 3D5TA 3WMXA 1LX6A 2IXAA 1QYDA 2VN8A 4LGVA 4G2NA 2EW8A 2YHIA 3OEYA 2C7GA 3JQ9A 3HFSA 3B1JA 3PJDA 4MJLA 3PDJA 1I3MA 5H83A 4BNFA 2H63A 3EVNA 1K0UA 2NQ8A 3GDFA 2IYOA 1LC0A 2WWRA 3WICA 1JAYA 3BXXA 4Q39A 3WLFA 1JWBB 3TZ6A 4EZBA 5A4DA 2I99A 5CDGA 2CDAA 3MJVA 4INAA 2PNFA 3OECA 4IZIA 4II3A 3GRPA 3GY0A 4OAQA 1QV6A 4E32A 4LCEA 3CUKA 5FEUA 1NPTO 4BGVA 3INTA 3F47A 4WEQA 1EQ2A 1PGNA 3VH4A 3DOOA 1OBFO 5G0VA 1GUFA 1ML3A 4YJDA 1DJQA 1YONA 1O0SA 1R37A 2V6FA 2Q4EA 1P1JA 3ORFA 1CJCA 4PG5A 4ALJA 3A14A 2NU7A 1HEUA 3JSAA 1HYEA 4F46A 3S55A 3Q6IA 3ADOA 2IXBA 2NVBA 2IZ1A 1E6WA 5AXDA 3Q9NA 1NHGA 3PFFA 1RPNA 4RJTA 1N2SA 2BGMA 1YKFA 2FR8A 1GDHA 3HZZA 2DFDA 4OYRA 3TPCA 1EEHA 1LSJA 2J5RA 5LC1A 2FSVA 4HX5A 4E5YA 4BNIA 4CLRB 3HDQA 1Z6ZA 1BG6A 1EBFA 1K5HA 2AG8A 2Q2WA 3GLQA 1NQAO 2DUWA 3DMYA 3PPIA 4HKTA 3GUYA 3GVHA 4WECA 2VHWA 1MB4A 2ZJ1A 2AQHA 3W6UA 4CQLA 1PL7A 3QWBA 5EESA 3D3WA 1LXCA 4R3WA 2PKQO 4O59O 4RGBA 1N7HA 5TRTA 3A4VA 1KEPA 5JAMA 4FB5A 3ZWNA 1EE9A 1YL6A 1OMOA 4DREA 5A5EA 1MXFA 1T2DA 2Q50A 3GN2A 4XQ9A 4YR9A 3M1AA 4CMIB 2DC1A 2VHYA 1JVSA 3ENKA 4YAEA 5DULA 3KBOA 1XELA 1B14A 2V7PA 5FYDA 2X22A 3D1LA 1ZW1A 2CUKA 4W6ZA 4D44A 2RHRA 2O3QA 1LEHA 3IUPA 5JFOA 4M89A 3A1NA 4WUVA 1ZSNA 3GHHA 5TIIA 2HU2A 2YDYA 2BD0A 4A2CA 4ZQFA 4JBHA 2JFGA 3ENNA 1GPJA 1PJ3A 1MV8A 2AHRA 2Z5LA 2PD6A 4J1TA 1NFQA 1DFGA 1UDBA 4JP3A 4A27A 2GYYA 2B37A 3PTZA 1LTHR 3FR8A 5TC4A 4Y6SA 3ONDA 1FDSA 5JW6A 4B4WA 3PDUA 3NT5A 4D79A 2YDXA 1QLJA 7ADHA 2IODA 3P2OA 4I1IA 4MIOA 4DQVA 2NU9A 3GT0A 1R15A 3VHRA 3DB2A 3ETEA 4NPCA 1EDZA 2PZLA 2VHXA 4JJGA 4P38A 3QV1A 5TGDA 5JMWA 3E9NA 4FPXA 2J5QA 1G1AA 1T2FA 4L0QA 4IJUA 2PZJA 4RZHA 1EVJA 7MDHA 3ZV6A 4CM5A 4LSWA 4DC0A 5CPBA 3ZDFA 1E3JA 4KQWA 3GGGA 4NBWA 1T26A 3AM5A 3PHIA 3GRKA 4YB8A 3SVTA 1DFHA 3RJ9A 3EC7A 2V6GA 1I3KA 2PD4A 3TOZA 4I9NA 3JQ8A 3U4HA 1QLHA 3P2YA 1IB6A 4B4OA 4DYDA 3JQ7A 1MC5A 1J49A 1T4BA 4Q3AA 3ZW9A 1KC3A 1LSSA 2C59A 5EPOA 5CDTA 3DMTC 2G0TA 5JMPA 3DAFA 3O8QA 4CMEC 4E5PA 1E7QA 2BELA 4P4LA 4GX5A 3FCOA 3JQAB 5KVQA 1FK8A 3OMLA 4EEXA 2Q1WA 4XYEA 2LDXA 1WDKA 2ZK7A 1RM0A 3JD2A 2BF7A 2B4RO 1VSUA 3R3JA 1BRMA 1P0CA 3V2GA 3OQ1A 3LZ6A 1PJ2A 1CIVA 2NQTA 2YQ4A 3MJCA 3MCVA 3R1IA 4JN6B 4BNVA 1N5DA 1T4DA 3GEGA 4LMRA 4CV2A 4RDIA 1LRLA 3GMSA 4YCAA 4OL9A 1V0JA 1WXDA 1VSVA 4BNLA 4BV9A 4BKQA 1UDAA 3KTDA 3OQ6A 2F00A 1K6IA 3E1KA 4S3MA 4ND5A 2JCXA 3NGXA 4M87A 1RM3A 3AI2A 1V6AA 3FI9A 5DT9A 3GEMA 1HKUA 3QRWA 3ZHYA 1P33A 1YE3A 4GLLA 4DYVA 1NBOA 2CVOA 1N92A 4M1QA 4FSHA 1NPDA 2OXIA 2E6UX 4PGFA 1UJMA 1PZGA 4YRAA 1B16A 3K5PA 3RKUA 4DIOA 1CF2O 1DOHA 1E92A 3HE3A 4CM7A 5JO0A 5EIOA 3RUEA 3TZQA 1SO8A 5FI3A 1DC4A 4UREA 3FTPA 4CM9D 2VZ9A 3PK0A 1U5AA 4IDCA 1QXSA 3W8EA 3FPLA 5TSDA 3TL3A 5JYDA 3ZI0A 4MKXA 2X86A 4I9HA 1KEVA 2ZCUA 4ID9A 4NFHA 4YJHB 2O23A 2YV3A 4KWIA 3RC2A 4RF4A 1C0IA 1L7DA 2GN6A 1Q0HA 3H5AA 3GH3A 1YBMA 2Q1SA 4DC1A 2Q45A 3QIVA 2OP0A 2YFHA 2GZ1A 3BMQB 3GUCA 1NAIA 5KJEA 4WLOA 3TOXA 3JQGB 1GV0A 1X7HA 1FMCA 1KY4A 1P1RA 2VRCD 5KNLA 3PYLA 5EMHA 1LNQA 4A26A 4TMFA 4TZKA 3EGOA 4L73A 5COAA 4EUEA 3RD5A 2QIOA 3JYNA 5JCXA 3RUIA 4BL5A 1F12A 3ONFA 4PIVA 3AOEC 5AOVA 1X0XA 2GZ3A 1LSUA 4CQMA 2EKQA 2I76A 3P19A 3E9MA 4XJSA 4YWJA 4L75A 2NTNA 3DZBA 1YB5A 4GLOA 4D3FA 2Y0CA 4NHEA 4YT5A 1IE3A 4LRTB 3WNQA 1HYHA 3I4FA 8ADHA 2PY6A 5CDUA 2DTXA 3KM0A 5T8KA 1HSZA 1VL0A 1P0FA 3JYQA 1RYDA 1Q0QA 1TT7A 4LVCA 4Q3BA 1I8TA 3AUSA 1KC1A 5G4KA 3VOSA 4DPLA 3BTOA 2TMGA 4ND4A 2YHUA 4A0SA 2EKLA 4XRRA 1ZFNA 4CLDA 3WDSA 2HMTA 1M2WA 1JDJA 3E5MA 4BKRA 4DMMA 3NT4A 1KVTA 4E6PA 3HFGA 2VRBA 1C0LA 2J6IA 1N1GA 4TKMA 1NHWA 3JD1A 5I7EA 1BXGB 3FSRA 3U4CA 3VZSA 5C7OO 4WEOA 1JWAB 1HYGA 2D0IA 1KIFA 1QR6A 2ZTVA 3IS3A 3JD3A 4Z0HO 5JAZA 1TEHA 2H5LA 5IN5A 4RO0A 1O94A 1OC2A 2ZYAA 4Q3CA 2JCYA 5JY1A 4E33A 2QZZA 1QV7A 2G5CA 2B4TO 3V8BA 5DP1A 3W4IA 2YZ7A 1E7SA 4PZEA 4B8WA 5GZ1A 1A9ZA 3RKRA 4GWKA 4J1SA 3TFQA 1ZVMA 1UP4A 2EF1A 3SC4A 2E48A 1QRRA 1XEAA 3ZHZA 2X9VA 1IPFA 1YQDA 3DZHA 3FPCA 4W9NA 2ZYDA 3PQEA 3JYLA 3DAPA 2C2YA 4Z0TA 5TLSA 4OQYA 4G81A 3QE3A 4XQGA 3PP8A 5KVVA 3IKVA 3GNQA 4YPOA 3FNGA 4IIUA 1U3TA 1GCOA 3WWYA 1XG5A 2NTJA 2I6TA 5BSFA 3HQ4O 5CG2A 4YQYA 4H3VA 3WJ7A 1QSGA 3ROKA 3INGA 1Y7TA 2NWQA 4M8SA 4TQGA 2VOEA 1ZCJA 2D8AA 4WNCA 1OOEA 1WP4A 2GSDA 4HV4A 4J7UA 3DZFA 4MDHA 2P5YA 4FOOA 5ICSA 2ZYGA 4NFYA 3SBOA 3WSWA 3OJOA 4UVIA 3WYBA 3W8DA 1PTJA 4B3IA 1E7RA 1R16A 3I3OA 3JD4A 3H65A 1MGOA 1YVEI 2P68A 3GQVA 3TZKA 2E37A 1Y1PA 2VT3A 1JA9A 3QWIA 4AJOA 4XKJA 1F8FA 3ITDA 2C7VA 4HY3A 4ITUA 4J4BA 4QFCA 4FFOA 4QSMA 3PQFA 5HA5A 4WLNA 4E2ZA 3H9JA 1DSSG 4UULA 3V1YA 5JSFA 2POQX 5BQFA 2HJSA 4OSPA 3AJRA 1MFPA 1U7HA 2C5EA 1UXKA 3EVTA 4I5DA 1T24A 4IDAA 4EJ0A 4XB2A 1U1IA 5IJZA 3KV3O 1NM5A 3RC1A 1H6BA 3ULKA 4YDRA 5I9LA 1NXQA 3F9IA 5G0TA 2FZWA 1NQTA 3M2PA 4NG5A 1OZAA 2EKPA 1ORRA 5THKA 1ZSYA 3HDYA 4PZDA 5B4TA 4N5NA 1NP3A 2V65A 4FJ0A 3NTRA 4W7IA 4ZA2A 5T6BA 3KETA 1CDOA 5K6AC 2WD7A 3K2EA 4Z9XA 3H9EO 4ALNA 3FR7A 3I1JA 2BLLA 3E18A 1GCUA 1SMKA 2CY0A 5CG1A 3F4BA 4R9SA 4C7KA 5F1KA 4BQPA 4BMSA 1ONNA 3NDIA 1KOLA 4W7HA 3RFXA 1NQOA 4U8GA 1I30A 4XA8A 3H2ZA 2EGGA 4RPJA 3K30A 2Q49A 4IDFA 2FZEA 4MVJF 5HM8A 1IOLA 5ITWA 2YV1A 1ONOA 3WXBA 3UUWA 3VC7A 4PN3A 3ZWXA 5L4NA 1XU9A 3TFOA 1MX3A 5B12A 4DUPA 1GYPA 3O9ZA 1V3UA 2EWMA 4IM7A 3LT4A 4XCVA 3F1KA 1H2HA 3OA0A 3QLJA 4CM8B 1GY8A 3ZU3A 3C7DB 4Y6RA 3I9JA 3G17A 2PWZA 5T5QA 4D46A 2D4AA 1JKFA 3OQBA 1MG0A 2VTEA 4JBGA 3COSA 1XCBA 1PZFA 5HBRA 5C7IO 1FDVA 4R69A 4AJEA 1Y8QB 1N9GA 4IGFA 3KYDB 5DCUA 4ALMA 1NVGA 2VZ0A 1EFLA 4KQXA 2BMAA 1O8CA 3AY6A 2EERA 3AUUA 3L6EA 2AW5A 5A9SA 1CQJA 4OO3A 3UF0A 1BVUA 3DONA 3QA9A 1H9AA 1QORA 1EVZA 5L7WA 1UAGA 3G1TA 3VVCA 3JD0A 4PFJA 1CWUA 2AXQA 1B26A 2GUGA 4BNHA 1P1IA 3CH6A 3I5MA 4CMHA 2H9IA 3MTJA 3U62A 4PLZA 4J4HA 2OUIA 3HWRA
chains in the Genus database with same CATH superfamily
4EVQA 5A6VA 4G9EA 4FHEA 3VR4D 1E7WA 1U7XA 1TJ3A 4GSKA 4BLVA 3ML1A 4C3ZA 5AOCA 4EI8A 5CYFA 1PJTA 1S1CA 1XF9A 2BKUA 3B1WA 3A4TA 4I4TB 5DDIP 3RVKA 2BFAA 3EVAA 3M7IA 4W9RA 5HFNA 2BL4A 3V4VB 5J1TB 4UXHA 4G4IA 1KNXA 3ILYA 4Q3EA 4GSLA 4RIIA 5L8VA 1QHHB 1AGRA 1UWLA 3DLPX 4L76A 5C31A 1BWSA 2FE4A 5AKZA 6REQA 3U17A 4H08A 2XI4A 3QTTA 4LTMA 4EUFA 1NF8A 1JECA 1LK5A 4X91A 5B6IA 5D8DA 2Z4RA 3SOPA 2K2QB 2VRWA 2ZKLA 3D5QA 2V9ZA 4XIYA 3ZIAA 3FCAA 3G8CA 3MG9A 5CLLA 2QVLA 2I7XA 2WWGA 4BQRA 1WB5A 1ONPA 5IF3A 3GA5A 4DMCA 2QAGA 1H8HA 1T3SA 1FP2A 2NTEA 3KOWA 4JCCA 1Z2EA 4UEKA 1T2UA 3Q2IA 5LXTF 4URZR 4I1UA 3P5BA 2ANBA 2ZQZA 3PQCA 5JNTA 1X3SA 4UPVA 3CG4A 1JIUA 1LPNA 4KSCA 4QXPA 3I92A 1JFLA 3I76A 5BSWA 5CTJA 1B0PA 1OC4A 4FUQA 2KHZA 1JEOA 1TJYA 1NSFA 4LZOA 3ZKAA 1TRKA 2CXUA 4MRNA 3WGKA 4DG5A 1Y48E 2D2FA 3PLRA 2FWBA 1T9AA 4MP6A 3KHSA 1NJ5A 2C4WA 5DSXA 2CHVA 5EJ9A 1EPUA 4K6CA 3OKCA 2X15A 4MWDA 1YZLA 2PA3A 1D0SA 1DG3A 2DFNA 4IV0A 1GRQA 3KZCA 5JXJA 2RHBA 3EEYA 3L0OA 2CJPA 3S2FA 1FW6A 4RVDA 2Z4SA 2R60A 3H8SA 2WT9A 3IAUA 4JBXA 1C8VB 1O9HA 1W49A 1FYWA 3BMOA 4QXOA 1YS2X 2WU8A 4YV2A 4UMVA 5FLEX 4EGQA 1O95D 2ZUDA 2BSXA 4XGIA 4EYEA 1GRVA 3G5TA 4LE1A 4B4UA 4CM9A 2C5BA 3HJHA 2W2MA 3BCSA 2G08A 1IPHA 2YVKA 2G7ZA 2IDJA 1E3WB 1XD2B 2PBRA 2A9QA 2JBWA 5TMBA 1WRBA 1PUXA 2VH5R 1P39A 4UBNA 3FMFA 1BW9A 3P0RA 2PKRA 3R5FA 4MB0A 4MQBA 5AXAA 2GN8A 4F71A 3D7NA 3VGPA 3DXXA 2GHIA 3MJ4A 4R7TA 3OKFA 5K0CA 2IWHA 3WLTA 1EVEA 4DCUA 5IJ0A 3NCTA 4N9QA 3PCXA 3OZCA 1KQNA 4CTMA 1WQ3A 1A04A 4LQDA 4DT1A 4KK3A 3M1LA 4G2TA 4GPD1 1EK5A 4D92A 1I4LD 3NFYA 5LU8A 2XNDA 3AR5A 4REMA 1ARZA 3LWNA 2QLLA 1GD1O 1DDIA 1DRKA 5LQMA 4RVHA 4MVJG 1E1QA 3A0UA 1KJ9A 2VOJA 3G49A 1VE1A 3QEOA 4WZBB 2RBGA 1W34A 3KJHA 1C2TA 3LWDA 3SZMA 4ZGGA 2VYVD 1KI1A 3NEJA 1M1ZA 1YQTA 2IE8A 2WQ6A 4B3FX 5H59A 1PNOA 5CB4F 1Y4UA 2F3TA 3GC6A 2G76A 4OBBA 1O08A 5DLDA 2Y0BA 4IJKA 4TV9F 3PUVA 2JGEA 1P45A 3IVMA 4ENWA 1AM4D 3L06A 3ZW7A 4JT2A 4TWRA 4UJ3A 4D4HA 3QBVA 2YJTD 1C9MA 3NDBB 1DB3A 3E8SA 2ZRKA 3K09C 2P0YA 4EGSA 5BWLA 2FXVA 4Q4CA 1YB2A 3DULA 3PT9A 4PGMA 4D98A 2Y67A 4CIXA 1Y1KE 3OOSA 4RL6A 3W05A 4BQFA 4REOA 4PSDA 2BZGA 4V1CB 1C0PA 1Q0LA 2E4YA 1JH8A 1PAUA 2MINB 3LDUA 4OJYA 2AHOA 3D7MA 4HAZA 1Z75A 5E8RA 3MS7A 4MZXA 5C7OO 1RI4A 1ENOA 5CLGA 1RKXA 4AJLA 4DIBA 4MGHA 1T0IA 1TEVA 3VAZA 1C7QA 3RVJA 2ZUVA 2LIPA 4ZEMA 1N5MA 3UA3A 2F1OA 1I36A 4TV8B 2Y3IA 4NATA 4EECA 5KQLA 3UENA 5SY4A 4EX7A 1W75A 2P4EA 3Q72A 2XB6A 2JIMA 1V1RA 1HE1C 2YHSA 2B8EA 3CNBA 3FMPB 4FCTA 1UJ2A 1ZJZA 3K32A 4I55B 4PG4A 2ZJ2A 3D3KA 3Q12A 4N9WA 4TX1A 4YT8A 5KWIA 1XVIA 1Y3FE 1PSZA 1B3BA 5EJ2A 4Z9FA 2P3SA 2FWMX 1RYEA 2PX8A 3TSCA 4D8VA 1FFEA 1KYZA 5K8CA 1AA9A 2GN4A 3GJZA 3OT4A 4EGJA 5JDCC 3RIHA 1SUAA 3VR6H 5H1YA 1ZO8A 3OLCX 4II7A 3DVQX 2NPFA 3VPDA 1IEWA 3GQBA 3IKLA 4AJ4A 1IZZA 1NSYA 2GAFA 5A1JA 3IFSA 1VG1A 4ZAZA 3U3MA 1U0GA 2ENWA 4RY8A 5HDBB 5LLDA 4DV4B 2R6HA 4EHAA 2Z30A 1G41A 4BIMA 2D1TA 1VL2A 2JLCA 3NNSA 3QX8A 5BY2A 2YN0A 1EFKA 1L5FA 5KNCD 4ZC8A 3FB4A 4JB8A 2FDCA 2A84A 1PS0A 2I2BA 3B6MA 3FLAA 3PNKA 4UE2A 3WWEA 3CRW1 5IYZA 4IGKA 3T5PA 1KK2A 1ULTA 4P84A 1HEIA 1VXOA 3CN7A 4ND7A 3A9CA 1XLTC 2BRUC 4PO9A 3K6RA 1FE8A 1HMYA 2VK4A 1GL6A 3OY7A 1T6NA 3QH4A 1MH1A 4HSEA 3EXEA 3JYOA 4J6FA 3TLGB 3CLUD 3MWJA 4FDTA 1VB3A 2AEMA 1PS8A 2PS3A 5AKYA 4Z0NA 1VKZA 3HNRA 2XCUA 2C83A 2P27A 4LHYA 1F20A 1X19A 4GZ5A 1GNTA 4QBIA 2HZBA 5AHOA 4FFPA 3ZU6A 2HRCA 2P40A 1JFRA 3BMCA 1A0OA 5EXXA 1E79D 2P0EA 2ID7A 4HXGA 2NSJA 1R0SA 4F4CA 1ZD1A 2DFKB 4KITB 2WNIA 3C97A 3QFSA 3ROTA 4PRYA 3HNPA 3P5SA 5ER9A 3KLOA 4B7UA 2UYQA 4U2BA 4EQZA 4MUAA 2WQ7A 4NH0A 1GR1A 1YE8A 2GCPA 2D5AA 4DB2A 4FJ2A 4CTKA 1ZOOA 4N5MA 1Z6PA 4EY7A 1PFGA 1BS2A 1Y6QA 3A9TA 1NE2A 2IXEA 3H6KA 4MRSA 1S8OA 4ISBA 4DTIA 2A78A 5D86A 3TGLA 2LNDA 1ZU5A 1P3DA 3T5BA 4ACBA 5BSVA 4M98A 4JQCA 3QSYA 1UXOA 5DWDA 4L51A 3CVVA 1LBHA 1Z8NA 1ZINA 3FYUC 1VL5A 1ICEA 4F91B 2JZCA 3JX9A 2I0FA 5DBGA 4TSFA 2WWXA 5C2JB 2KMLA 3S2EA 4CMJA 1BVRA 1JRLA 2IYFA 5EN4A 5JVDA 1PFWA 3C6QA 4EW3A 3AETB 2NNWB 2IS4A 4UMDA 5IJ9B 4EA6A 4O08A 5EWLB 1FYXA 4BO6A 4RTOA 1WUTA 3FX2A 2PUDA 1UPFA 1BKDR 1E98A 4NZ9A 2XBMA 2FOIA 4HP8A 2P9EA 3S2UA 2BMWA 3LRTA 3EPJA 1XTKA 4PSKA 4RIGA 3U7QB 4A8JC 4E3ZA 1J0EA 3VPFA 1G20A 1T0HB 1WY7A 3RTBA 2Q5LA 3DL4A 3Q1LA 3HB1A 1C30A 1XGKA 3A1FA 2DR2A 4TKVA 1FXWF 5CEEA 4MTCA 5H9VA 5JXHA 2A3NA 1REQA 3NM5A 4M8LA 1M8PA 3WFIA 1CNMA 1R6BX 1SKYE 1XZDA 2D13A 3LUDA 4GEKA 3UXEA 2A30A 4GQBA 2SKEA 5AKGA 2QSZA 3A1WA 1UBLS 2Y71A 3EXG2 3QKRA 3IQXA 2XNSA 1B6GA 4MUBA 4OGWA 3M9WA 5LA6B 2OXTA 4CU5A 4OU4A 4DLSA 2R6JA 4FI3F 3ZLTA 1KI6A 1T5TA 1ZNQO 2GBLA 4RFVA 4KFCA 1TM5E 4LISA 5KNDA 4W9MC 4KO1S 2W2KA 3EYAA 2G04A 2O57A 1GKIA 2QRZA 4AF6A 1U8YA 2DP4E 2CFIA 3CWZA 3IOEA 5M34A 3IIKA 1XJ0A 4JP8A 5CNMA 1QH0A 1QS0A 4X1YB 1XK6A 2BGWA 1QKIA 3ZCPA 4BLTA 1CLEA 3AWDA 5BPHA 3COPA 3QI7A 2RARA 2WP0A 1TTQB 1DWQA 3C5VA 3CZ9A 3QVOA 2WHXA 4C22A 5IRCD 3GZ4A 1TIPA 2UXCB 1IXYA 1HLFA 3H18A 1TQ6A 1TU0A 1Z7YA 1CV2A 1Z5UA 2ZSJA 3LMKA 3THOA 1A7AA 1NSTA 2PAAA 3KAPA 3E48A 3Q2OA 4IF4A 3SKYA 5IUNC 5CH8A 5J47A 3G0DA 3H7IA 1Z74A 4MKGA 4B32A 1QG4A 2FUEA 2Z2YA 3DV2A 1SWWA 1A77A 2JGJA 4JYAB 3NAMA 1ZMBA 1V8ZA 3A31A 2PXCA 2ACWA 3AKYA 4M38A 4OHVA 1QYVA 4QFMA 4DL9A 5B64A 5J4KA 1XO1A 3AHCA 3FDZB 6YASA 1JQ3A 3PPWA 3SQWA 1XEWX 4WSOA 1RLUA 1RRCA 1P5RA 2DPHA 1CB7A 1JVNA 5ECYA 4MB2A 3KHKA 3RUCA 1M1XB 3TFWA 2H06A 3KJNA 3ACDA 1S1MA 2BE9A 4DJTA 1SFRA 2O8FA 2P35A 1EJ0A 2J0EA 1RCTE 2RGNC 3AF6A 1X1QA 4YP5A 1I4DD 2LVBA 3NP7A 3S2SA 3SHVA 2NXJA 1E0AA 5FADA 2PSDA 3B1VA 1GJRA 3NHRA 5A1TA 5C4MA 5LD2C 2B83A 5K3FA 1GTJ1 1PD1A 5CXQA 1QIEA 5DCYA 2AOWA 4ZCRA 1I51A 3HWX1 3Q5EA 4I4CA 4MKZA 1U0JA 4TTIA 2H5IA 3R4VA 3OIGA 5DE3A 3Q5GA 2O8DB 1NBHA 2RH5A 4R7ZA 3C3WA 3NIDB 1QCYA 5ALRA 4OY3A 3M5DA 3HB0A 2YOFA 2DKFA 3FPGA 1NW7A 1F48A 5DYWA 4JP2A 1Z45A 1JNYA 3BD6A 4DYHA 1OB2A 4ZN6A 4NULA 1NU6A 3B9QA 3A2KA 5KSPA 5T4EA 1M66A 2XJ4A 4OHXA 3PSAA 1LK7A 5LA6A 4OTZA 4X00A 4NCBA 2R751 2ZJ5A 4JLUA 1IBLB 2CDCA 1Q19A 1V1JA 1VMEA 1VYHA 2CJWA 2HY7A 2HK7A 2IX3A 5FA6A 1U02A 3TD2A 4MW9A 1DJNA 2IXDA 5GZ6A 1CK4A 3LC7O 3QVGA 4I5FA 1Z12A 2AFHE 3F3MA 4BFZA 2ZRPA 5C52B 1VECA 3QW2A 2ZJ0A 1SHKA 3JTMA 7REQB 4NKRA 1SVLA 3ASVA 1O7JA 5KTPA 1JHDA 1WNFA 5E1BA 3UIEA 4W5QA 2BM8A 4KN9S 2WYOA 4GX2A 4TWAA 4HK4A 3ZWCA 3TCNA 4X1OA 1L5RA 5HRCA 3PC8C 4FYJA 3T1TA 2WVHA 1Q77A 1AKYA 3T3MB 5A5FA 4F6CA 1NL3A 2L0XA 3R7SA 4G4SO 3N2IA 5G1PA 3P9SA 3WK8A 2W83A 5ALXA 2AG5A 3QP9A 1BS1A 3K9GA 4EWLA 2H5JA 3FNHA 3MBIA 1M1NB 5A04A 4X62B 4W5TA 3OAAD 5FFNA 5HGJA 4RPHA 3LH5A 1SQSA 2BE7A 1TUBA 2Y2UA 5IASA 4X65B 5LL6P 3VZBA 3NAGA 4LRYA 3R3XA 1OXXK 1YB7A 3KLMX 3TD6A 4PYOA 3D7LA 3SXPA 1TQ8A 4DAEA 2QLBA 3C8HA 2BMVA 3H4MA 1F2DA 1KBZA 2XITA 3BMCB 3TW4A 1RZVA 2QAJA 1H0RA 4QNRA 4LNAA 3VDQA 3A58B 1U5BB 3VKUA 2B36A 1ZUHA 4QRHA 1JG2A 2D1QA 4EW1A 1ND5A 3VPAA 1HNWB 2O07A 2ZBDA 1JLLB 3DKIA 4FW9A 5JAIA 3U09A 1TK9A 1GRNA 5ELLA 2I2CA 3DV0A 4IHJA 1F06A 1IRXA 4GYWA 4H77A 1ORIA 1HH4A 3C14C 1X0VA 4RQAA 3SY8A 1SGWA 2I8CA 4DCNA 4DR6B 1UM9B 1YK1A 4WVLA 3HWWA 3TZHA 1DJOA 2Y68A 3GWZA 4AXXA 1L7XA 2VP5A 2QR3A 1HQYE 3OT5A 1PNQA 3LO8A 1PT8A 1DS6A 1QG2A 4LN1A 5HX7A 5BOSA 4KAJA 2A86A 4F8JA 3V7NA 2FSSA 1OTYA 1TPZA 4HYQA 3ZX4A 3EUWA 2XUQA 3MA0A 3K1YA 4MCIA 1UJ4A 1EK2A 3T7JA 2J9FA 2PQ0A 3N8GA 5EXEA 2QHXA 3LSTA 3CWQA 5U4QA 1NV8A 2EHJA 2IU6A 3CT6A 1RAFA 2GLXA 2NP6A 5MN4A 2QTTA 3MJEA 1M5UA 4Z7OB 2DT8A 2FZCA 2NUBA 2BDUA 1CR1A 3LWZA 3PDWA 3CISA 1P0QA 2I7VA 2P1ZA 1XDGA 4IFEA 2V54A 2M32A 3HYCA 1V2GA 4J6EA 4MYRA 4OHFA 4JJKA 3ZBPA 4LHVA 4HWOA 2ON6A 1E9VA 3QKSA 2GJAA 3D2AA 4HBZA 4I3GA 1WB9A 4KYIB 1HDOA 1FS6A 5H9WA 2CDBA 3GGPA 4L2IB 2EV9A 4OL0A 1UKYA 3UT5B 2VK8A 4ZZ1A 4I55A 2QN8A 3CW2A 2C5LA 2PR2A 2X2FA 1IXZA 3MNFA 4JP1A 3E9ZA 4X1KA 5F76A 3FNEA 4FFMA 3SX2A 2UAGA 4OJTA 4J3FA 1NRWA 4IVNA 2AX4A 3TM5A 1ECFA 5BV1A 1QIJA 5FFMA 2PEYA 3ZWKA 3MRSA 4K6FA 2HLHA 4M21A 1SU7A 2BW0A 3VJLA 2P9ZA 4CMIA 1DKOA 4X3PA 3UATA 4CFYA 2K7ZA 1T5BA 4E07A 3MMPA 4LYJA 2ZVQX 5JSZB 2G1PA 2BP7A 3AP1A 3RF6A 4C0SA 1K3FA 1VMAA 2RBKA 4KRYA 3AV0B 4DMFA 1EXVA 2FR8C 1H2BA 4IKEA 1D1TA 1S8FA 2AN4A 1IVSA 4Q9LA 3GJ5A 1P8AA 3PHCA 3PXAA 1XWFA 3DPSA 3JVEA 4V0OA 2IYPA 4YUXA 4P83A 5BXYA 4OK3A 1H6DA 2C3OA 3UO8B 3H1FA 4TRJA 2B6HA 2NZUG 1WXXA 4HNGA 2CFSA 4DHWA 5EXTA 5J2UB 2QD3A 4DMGA 2ZZNA 5IULC 4MAMA 1J4AA 4FOLA 4WY2A 1GGMA 2DERA 3DDNA 5LDDC 2ZSAA 1JFFB 3FVQA 3MHPA 4B3HA 3M82A 4RETA 2IZOA 2WC1A 1YULA 1VIMA 2R8BA 2X2PA 1FDUA 4ZDWA 2I67A 1AUPA 2VUUA 4E7OA 1RADA 1JH9A 1FC0A 4KVFA 2A7XA 1SHJA 5KOIA 1O0CA 5FUYA 4DDKA 1JA0A 2XKKA 3LA6A 4GI2A 4EG7A 3INNA 3TLKA 2EGUA 2ISQA 3I6MA 4QREA 2OQIA 3H13A 2LP4Y 1OCEA 9ATCA 2OBXA 3ZVKA 3CJRA 1VG8A 4OOFA 2GVNA 2P4HX 4FT2A 1KTVA 4RGYA 5HE9A 1QPGA 3AR7A 2CXPA 2H85A 3DO5A 5AJZA 4GZLA 3ELYA 1QP4A 2MDTA 3SYMA 5D3MA 1X7WB 1WBDA 3T7CA 2QR2A 5AESA 2R1VB 2ZP1A 3ZE0B 2VAVA 3EA4A 1NFRA 1HO3A 1Q5PA 4UDOA 4WLFA 5B6JA 3HFRA 4FEGA 2ZRNA 2O2SA 4KTVE 1TKAA 4A3SA 1GNQA 4ADSG 3FOEC 5CD9A 4P0PB 2Q28A 4DUYB 3LVRE 4HWKA 2WR8A 3EHEA 1F14A 3VJMA 2PH3A 2WVGA 1KOJA 1AQYA 2AN9A 4MIEA 5TVGA 4CLOB 1R4NB 3N75A 1Z0UA 4NZNA 5AKJA 4HBGA 4QU0A 3KWFA 1E5VA 3VTKA 3HSSA 4F3YA 3BORA 5A5GA 4I0WB 1GCIA 1O4VA 3LQQA 4WKGA 2OT3B 3OI7A 4QRDA 5AVYA 4BB5A 1WZEA 2DBRA 5F4BA 2NLOA 4EP1A 1SUCA 1N75A 3M3DA 4FHFA 4ZIRB 2ZRIA 2GNAA 3M2TA 1Z4IA 4QUJA 3DO6A 4Y9DA 5CVVA 1SUIA 2WNHA 2WAXA 4ML3A 4J43A 3EZXA 1KSGA 3WWDA 2IS1A 2IIBA 1B93A 5DEOA 3TQOA 3BJEA 4JJAA 4EG8A 2GCNA 1PF7E 2C8VA 4YJ2A 1X70A 4N7JA 1TU3A 3LU1A 5FRDA 1TW2A 4L16A 5GONA 2G5PA 2Y0DA 4WXYB 4RV5A 1ES9A 3PT5A 3RRMA 1JZSA 4O2BB 5JVDB 3VYWA 4HRYA 2QU8A 1YFZA 2GZRA 2XF8A 4MI3A 3RODA 2XOXA 3B53X 3THYB 1PW5A 5HE8A 5CA1F 5C5CA 1WSWA 3TGWA 4RPLA 1G0OA 3RTCA 3CCBA 5EPEA 1NA5A 5E6UA 1ZMRA 4JLSA 2AJDA 1HXHA 3WE7A 4I19A 2FJUA 3RLFA 2Z9DA 4QQ8A 1DELA 1EDBA 3L0DA 4ZAXA 1RT9A 3HP7A 1KE2A 1XMQB 3CV3A 1NPYA 4EI7A 1QMPA 1Y8RB 1CVIA 1L8AA 1QONA 3WMRA 1T5OA 3RGWS 4JASB 5KVSA 3G2OA 1DAPA 2F64A 1RQNA 3IYLW 1HY3A 1MHPA 5KYYA 4ZMBA 3ZD6A 5KBYA 2YJ3A 3EEIA 4GYYA 1CXZA 1GNSA 1OLUB 2ICAA 3FW1A 3K16A 4LDNA 4P3PA 3SZGA 1TDJA 1LA2A 4XM1A 2W9XA 2H17A 1PNVA 1A8UA 2I7DA 3LC0A 4RH1A 1F0PA 2CV2A 2CZQA 2QRNA 4C43A 1XZGA 5LQNA 4UBIA 2W2TA 5K0BA 4CUKA 1GARA 2IYTA 2P9TA 3K4PA 4BVEA 3TQIA 3RU2A 2QN7A 1CJTC 1KEZA 5F1PA 3BFPA 3S5JA 3PXEA 3WGJA 3ILHA 4XVQA 1T25A 2J09A 4LX8A 4AC9A 1TE2A 2DUUA 1WVIA 2HV9A 4HFNA 5EHQA 4C78A 2ROQA 1RQ7A 2YY6A 3OMWA 1QVVA 3HSKA 4HQKA 4LKRA 4IG9A 2Z5VA 5C5DA 4KVGA 1EU1A 1U81A 1ZLYA 3H9GA 4CHTA 1QNLA 5K9ZA 2M6RA 3L1HA 4F96A 3BFVA 4A0GA 1H1LB 1SZJG 4LHSA 4RMIA 1NMZA 3DOJA 2R8OA 3TQTA 1V9SA 1MB9A 1OROA 1Z2DA 3REGA 3NH6A 1RQLA 2ZYWX 1YQWA 4LK2A 5SZJA 4BBPA 3F96A 3ZIDA 1M0SA 1TMYA 3V1MA 3VKGA 2BEUA 3C5HA 1G63A 1YQQA 2F1JA 4JGBA 3VGJA 2HRZA 1KZ1A 4JL6A 2X77A 3L0BA 4FONA 3G82C 4TSKA 5CLHA 2EZ9A 2ZRLA 3R3WA 3F9RA 1ZW6A 3FFWA 2ZULA 4K9SA 3GRVA 3RSCA 2FR0A 4A6EA 5KB3A 3LUPA 2WWTA 4TMZA 1JMYA 1T9KA 4ZI7F 3TAUA 1RWWA 2VCYA 1UMBB 4FS3A 5T57A 3AWIA 3PUIA 1BN6A 4AN0A 2Y4NA 1BMTA 4FLEA 3ZWVA 1ADBA 1YZTA 4G5SA 4DLNA 5ALUA 1VBKA 1MBZA 3ZCRA 4PG8A 2X5JO 3ACBA 1CNEA 4Q7MB 3ONWA 1XKQA 4UNNA 1EP9A 5F3DA 5KAMA 4AYWA 3A8TA 5TV2A 4HDRB 4RIFA 4DWOA 1SCJA 1OYYA 5K3DA 5EKUA 3GZTB 3PE3A 3OURA 1QGYA 4LJSA 3IERA 4LYYA 1TFUA 3HJRA 2W6IA 3WYGA 5U4XA 1AGPA 2RSLA 1UOQA 1IOZA 2ZWAA 3PUYA 4FGSA 2QQGA 4KZPA 4OLFA 1DBVO 3B5IA 3UMFA 2HPZA 2J3HA 2KE5A 1OIXA 1X1SA 4N6NA 2OA0A 3W78A 1TVKB 2VP6A 3A9WA 2G0AA 1ST3A 2HNAA 3QU2A 4PZ0A 1HG1A 4IDGA 4JQSA 4KIUA 5LBIA 2O7NA 3K1JA 5HK8A 1MRSA 1N0VC 1E1RA 3OQOA 1JR3A 1HZZC 2B4YA 4P3XA 1NVKA 3LOUA 5DISB 1FFXB 1JYFA 1Z0ZA 3IULA 1AKWA 1GYRA 1Q3TA 3O3CA 3CMMA 5DIFA 5IU6A 2CLFB 4ISCA 3BK1A 1FSPA 4AI6A 5IKMA 4NZOA 5HS6A 2MOKA 2CUTA 1T4GA 2IYQA 3PQ2A 3GZJA 4S05A 2YH2A 4I1SA 1HTWA 3UG6A 4V03A 2UV8A 3SBOA 3K9LA 4F6RB 5A03A 5H3CA 2WTMA 2A94A 2NSYA 1H1DA 1YDMA 3M4JA 3O8DA 2WZBA 2HIMA 2PQ6A 2B8TA 3PCTA 3NALA 2Y9PB 5AVJA 1C0EA 2FWNA 1Z0KA 4PQGA 4BWGA 1OAOA 1N6IA 1XXHA 3BAZA 3KUKA 3N0XA 4EG0A 1NBAA 1BAPA 3EQ7A 3MM4A 4C2UA 1KJWA 4XWKA 4HEA6 3TGPA 4LSMA 1ZHFA 3SK0A 3SYNA 1OH8A 1BMFD 2KSQA 3RJZA 3NRBA 2X2OA 2XEXA 3I2KA 1SEPA 4EYOA 1ZCAA 3ECAA 1UZUA 2XUAA 1Z17A 2GD2A 2O05A 4INZA 1EAYA 4L9WA 2A0FA 3AY0A 2ZSUA 1MFZA 2GPNA 2Q2VA 4GMHA 4LJ9A 3CWCA 4KFSA 4PSUA 3TI9A 3WIVA 3T9AA 5KYYB 1G5IA 4LJ6A 5C1DA 3I28A 4KFUA 3D8UA 3I39X 2BUCA 4D7AA 3LQ4A 4TTTS 3JQGA 2GVZC 3SEFA 2Q1UA 1FFDA 3NB0A 1Q0RA 4YUYA 3KQUA 2OAQ1 3P26A 3TJZA 1W9MA 5HQTA 3BWBA 5LB2A 4J1QA 2C4UA 5C3MA 1AQ6A 1E5DA 1X2BA 1XRLA 2DFVA 3GEPA 3IJPA 2IEYA 5KNDD 2VNIA 2MTBA 1EA7A 4EO9A 1M2OA 1XHFA 2BM0A 1TAQA 3A25A 5BNIA 1IJKA 1AHIA 2R4UA 1L3CA 1R6TA 1X9HA 4S04A 3BXHA 4J94A 3LGAA 5F77A 3HKCB 3NBXX 4UM9B 3PVZA 4O2AB 1V5GA 5GY7A 5BSKA 3AI3A 3T9BA 4QLAA 5CLJA 2CF5A 2O1SA 5ES4B 4MV7A 5TEVA 2WTEA 4TZ0A 3PV0A 1Y7IA 5E3HA 3V8RA 4YCCA 4QUGA 5I9IA 1II0A 5I7OA 1BWQA 2FJ0A 2H1IA 5JCOA 2GEFA 4YCLA 1OH7A 3BDAA 4GVPA 1DNPA 1NWHA 3LI2A 1R6VA 2CZGA 1UMDA 4DSUA 1O3YA 1I2CA 2GFIA 3GYBA 1Q74A 5GADl 3HB9A 3O95A 3PL5A 5G3YA 4HLCA 3T41A 3NBQA 3ISVA 4FR5A 1BFKA 2Q5HA 4NX2A 3DDWA 2PM8A 5AM0A 1HE5A 1WMDA 3KC2A 4KR7A 4BJ3A 4QDJA 4LVUA 4R31A 4MS4A 3U60B 1E3SA 2GM3A 2I3GA 2NZ2A 2PFGA 4AQDA 1GPKA 3BCRA 4DR7B 1M6VA 1W581 1DRVA 4BTLA 4ZGWA 4YFYA 4YT2A 3N7AA 2EFYA 5CFOA 4DJJA 3DP9A 5D1HA 2I65A 5DGTA 2VBGA 3ZHVA 2XDQB 3EYWA 4RW0A 1RBYA 2HK8A 2VDKB 3CPJB 3MRTA 2GZ2A 3PD1A 5LDHA 2DSTA 3EQ6A 4P32A 1AE1A 5FO0A 1N7JA 2ISCA 3LRXA 2NX2A 1WM1A 1ZJJA 2BR5A 2N1BA 3NEPX 3T3HA 3U16A 3AY3A 1GAQA 3ETJA 3GFQA 3KD3A 1D4FA 3AP2A 4LDQA 4RKRA 2PGOA 2ZSFA 5TF4A 3JQ6A 5K6AA 3H83A 2HU5A 3LT2A 1DOAA 1JW9B 2GBFA 2D2EA 2Q0QA 3BSYA 5K8VA 2HU8A 4WOKA 4FFSA 2SICE 2ERXA 5TMEA 1QHXA 1OW3B 3ZK8A 3ZNOA 4KAAA 1SAYA 3GZNB 5AH0A 5BQXA 1XVUA 5FA8A 1GPDG 2W2LD 1Y7HA 4DBLE 1QWOA 2CNLA 1EJ2A 2A9VA 3KT6A 1YO6A 3C24A 1SBCA 3DBLA 4QD3A 4Z1MA 5LXTA 1DE0A 2QRKA 2CJYA 3JWHA 3TKLA 2ZIZA 1QVZA 3C6MA 1STOA 2QYOA 4HR7A 4REQA 3UV3A 6LDHA 1R0XA 3ZDDA 3VH3A 1CUXA 4KE8A 2P6NA 1I4OA 2LXNA 2DFLA 2L19A 2WKWA 2ZAMA 4QGBA 3L7NA 1OFTA 3QFRA 2C0QA 2P2CA 1MAUA 3EVFA 3B2QA 5TNXA 1YOVA 1MX9A 1QC5B 1XTQA 1NBIA 1TQDA 1VG9B 2VF7A 2ZSHA 4JSTA 3KUDA 5K3AA 3N2YA 1QBGA 4HRXA 1QPBA 2AFIE 3G2KA 4KJZA 3OJLA 3I6ZA 2OL4A 3KAKA 4FXPA 4A2QA 1FTGA 2SKCA 3OLWA 4BFVA 5JBQA 3ZKWA 2RBEA 1KYWA 5FT9A 4TRRA 1PJCA 3QNUA 2B1JA 5JFTA 1YBAA 3HYNA 3OQIA 1HX7A 3ESAA 4Y67A 4B9AA 3AVYA 3C3AA 2FVXA 2V4UA 4P5EA 2XT9A 4IY1A 3OQVA 3B6ZA 2QE6A 3Q8LA 1Z5GA 5A4FS 2V55B 1VLHA 2P3LA 3CH5A 2IRWA 3LHIA 4IKPA 4UBKA 1B8NA 4RTMA 1KI7A 2DT5A 3AB7A 4FBGA 4JR0A 2P67A 5FNVA 4JUBA 5B7QA 2GZSA 3C3PA 1JHPA 2OAP1 3FZYA 3TO5A 3V2UA 3TNFA 1J22A 1D0IA 1OI2A 2I62A 2JGAA 3TTXA 1C14A 1LI4A 4B4VA 3ZHUA 5JUWA 1KZ9A 1ZICA 1MEEA 5C8YB 4UUQA 4PAGA 2QSYA 2GNPA 4Q1CA 4JUDX 4HMPA 3U40A 1E3EA 1ODCA 4OYLA 5EJ6A 1KH2A 2G09A 3DFKA 5FTJA 2AXNA 5KINB 2P2LA 3IXQA 4YRRA 3MYYA 1P2FA 3F2VA 3ITNA 5M3BA 3ZVRA 5J43A 3ABIA 3E9RA 3R3VA 1NYTA 2Y1WA 5ENVA 1RP7A 4V0NA 1DC7A 4Q93A 3WP1B 1GAWA 2B7LA 2FSIA 1CPYA 5CRIA 4BMCA 4N41A 4GOMD 4ODIA 3LLCA 4EF4A 2QN9A 1XMOB 2QM8A 3LUAA 1WUKS 1WWKA 1YGPA 3EY4A 3JRNA 4C7OA 2HT1A 3KR1A 4XVCA 4GEGA 3DW3X 4C87A 1PO7A 3QMPA 4EH1A 4NXMB 5I51A 2FWAA 3N39C 2ZE6A 1PLLA 4U5QA 4YACA 4CCSA 4WASA 1UQUA 3ZH2A 4BVFA 2B61A 2C3MA 3DQQA 1C9NA 1GQ2A 4ZRDA 4U2GA 4UXJA 1ZK4A 1ID1A 2HMUA 3N58A 1U4OA 3O8OB 3S2GA 2AG0A 4DGQA 3PIIA 2ODEA 1CCWA 4JR2A 1MQ9A 2FEOA 3AXSA 4NE9A 3TMYA 4JX9A 1EM6A 2RHTA 5JALA 4X7BA 3MRVA 3ZLVA 4HNQA 3R40A 5AJWA 3SSAA 4EPXA 3CZ5A 4XB1A 4LWOA 5F33A 3TSYA 3BEOA 1VRCA 3G79A 1LBEA 1OZ0A 2NYVA 1ZVKA 1XIVA 3LCCA 1JTFA 4LF7B 2HRDA 2HMAA 2CXQA 4EUSA 2O1WA 1WXHA 3UHAA 4HDCA 1DMSA 3H19A 3L4SO 1ODFA 1Q2UA 1UDWA 1KJYA 4OKNA 2VRCA 1Q16A 2PRSA 3Q8KA 3WR5A 3DGFC 1Q1NA 4EMUA 5J9FA 2CMFA 4YRTA 5DLEA 2B20A 3ZE8A 4GM1A 2GUWA 3L7CA 4UU0A 2CL5A 1EXWA 4OHMA 4P3OA 4PLVA 1QE0A 4Y2XA 2I29A 2FDRA 2YRFA 2D59A 3Q2KA 3KXDA 3A1CA 2WG0A 2HCFA 2XCTB 3A2MA 1OR8A 2A0YA 4FYMA 3CRMA 3IUBA 3VJRA 1IG3A 1Z0DA 3ROQA 3WL5A 3G9UA 4EARA 4HATA 3C8DA 2CV1A 1C4KA 5KWEA 5KEIA 2FY8A 1SVSA 4QYMA 3A6PC 2NUAA 1ZZEA 3SKVA 1MXHA 4BFWA 4KL8S 3TVDA 4YAKA 1LTQA 1XZPA 2C3UA 3H6HA 4L8FA 1U7PA 1QH8A 2AMJA 1S4MA 2ECQA 2NUPB 2PGAA 4ZKDA 5AM5A 2C20A 2XMPA 4JEMA 4TTPA 3MWEA 4AZ3B 4J9UE 3II6X 3PWZA 3ZDEA 4EHLA 2JFNA 5E6SA 1M8GA 4ZCQA 4AJIA 1RHJA 3LBHA 5EYPB 5TARA 1EKXA 2VAWA 3WGTA 1P3Y1 3X2SA 4ZTUB 1FRNA 2ZI4A 3ADDA 1T5DX 3X1MA 3QU4A 2YIVX 5JXGA 5IYZF 5E9AA 4WNIA 2YY7A 2DWQA 3ZZ1A 4O3MA 2OBMA 1MNQA 4D5EA 3LS2A 4B7XA 2JLUA 1YZNA 2C5FA 4TTRA 1W5EA 2BI8A 3BZBA 3FUCA 3H86A 1ZUNA 4HADA 4KN8A 3GLGE 2BY4A 4DA8A 3R76A 4ZOQI 4PZ9A 1J6UA 5CYOA 3VUFA 3LUCA 3D0OA 3KEMA 1QDUA 3LRPA 4N54A 1VJ5A 3B38A 3GEEA 1MEJA 4Y0VA 1WSDA 3RW9A 3SZ3A 2RH9B 1T5HX 2FRVA 3AVPA 3FUUA 2WF6A 2OTCA 3N9IA 3OBBA 4KGXA 4KPGA 5L3ZA 5J2TF 5K03A 2RE8A 1G7SA 3ND6A 5EINA 1ISIA 3HUUA 1G2PA 4RLQA 3Q41A 2JFWA 3LUKA 3S7TA 1T8RA 1R5JA 2Z83A 4GOJA 4BE7B 2JAQA 2HR1A 2Q0SA 2YKGA 1J8QA 3EB9A 3H4IA 3K0CC 3Q40A 3U7QA 4J75A 5FV7A 3ZHRA 3I45A 1Y3CE 4CDNA 3Q8MA 3I1FA 3K1AB 4HDSA 5G4KB 2LD4A 2GO1A 4Q7KA 4JOQA 2O3RA 1W93A 2XT0A 3ESBA 3M1YA 4FI3C 4NICA 3SBXA 1LRJA 2O6LA 2EFGA 4C4PA 4D97A 1ESDA 3PRHA 2A88A 4G0QA 4V02A 2G40A 1TAGA 1E5TA 4PZYA 1O9BA 4Y2UA 3IP1A 3ABZA 3RASA 3L49A 2HIHA 3PFKA 4COKA 1AKVA 4EHIA 2F55A 1GV1A 3NPMA 4MK4A 3L41A 5EEGA 3BRWD 3V46A 5AWFC 3HM9A 1W87A 3IVRA 1L5VA 1GQYA 4OAPA 3M34A 2BFNA 1C1HA 3OLXA 3O03A 3R9IA 1DO0A 2H4ZA 3D8RA 4BO5A 4AF7A 4YJ2B 5CMLA 3PUXA 4D80A 3PEUA 5TPZA 3ROPA 5I8WA 1OXTA 1YA6A 1FIUA 1P31A 1CU1A 1YZQA 2EJTA 2JW5A 2R84A 3K5IA 2PH5A 4MA4A 2W2VA 1II8B 1NI4A 1U2QA 1I5RA 1W76A 2DOKA 2ZS9A 3OTIA 5ALDA 5A9TA 2JEOA 1AB5A 3AMVA 4RS4A 4R3NA 3FKQA 1GR0A 2EW2A 2XH8A 3HYSA 2ZWMA 2VWQA 1U6JA 4Z8XA 3RS3A 3HA3A 3OTHA 4URFA 1SCAA 1BXKA 1P7VA 3FI0A 2QX8A 1ZXLA 2Y77A 3CF4G 3LT1A 1XZNA 5FR1A 1IG0A 2ZTLA 2COUA 3GI1A 1F8GA 3FLBA 1FXWA 3HU1A 5FOXA 4EPRA 4HUQA 7GPBA 2C4TA 3OBIA 4CETA 5TY0A 4DSOA 3NXKA 4XD7D 2PUVA 1VKNA 1DC5A 3DT8A 2FN3A 1NASA 5FWDA 3GRYA 4FLFA 5CA0F 4YRBA 4TN1A 2J8ZA 2EQ5A 1L4NA 3BRSA 1YWGO 1U2DA 1XHLA 1O5OA 2AZ4A 1UBUS 3WJ1A 3KXPA 2OCLA 1X8KA 1Q22A 4CFSA 4YV7A 1MO2A 4HQLA 2C7QA 3GP8A 2OBYA 3C3MA 2RHOA 4C88A 3OOWA 3QOFA 4UAVA 4I2VA 4B31A 2VQFB 1YDWA 4TYPA 1ZR4A 5ALEA 2E18A 2XXAA 1QP8A 2AS0A 1T8PA 2OFPA 4ND3A 3SM3A 1DKQA 4C1NA 2D74A 2IZ5A 3OCJA 4DCMA 2VHVA 1LUAA 3DXFA 4AN1A 1DUSA 1TKCA 2XHZA 2ARKA 3KTFA 5CCXA 2C4HA 1P5JA 1D1QA 3BVPA 3EW7A 3KQOA 1GUYA 1O96B 2BZSA 3TTUA 2PLFA 3DEAA 4IDPA 5K05A 5KQMA 3H9CA 4AX8A 1PWYE 1JX6A 4QGSA 4JNKA 5SYAA 3GUHA 1JB1A 4BLOA 1I32A 2P5SA 2Y8EA 4MW0A 5EMNA 4MS1B 3HCRA 4DRYA 3VHXB 4ITVA 2RHDA 3VYTB 2L82A 5F5NA 4CLEA 4P0TA 4NBNA 1CJMA 4D9IA 1UPUA 4RZ2A 4BZPA 4ZOEA 2G6TA 4NARA 4CNQA 3A70A 5H7XA 2WZQA 1CULC 2JL1A 5CEFA 1FEZA 2FW7A 2QE7D 1A5AB 3SD7A 2OHGA 3GG9A 3VAAA 1V16A 3DVRX 3ZWWA 3D4OA 4MLCA 4AY5A 5J3JA 3F6RA 4WY5A 3D31A 5TGZA 4RU1A 3ZU2A 3AM3A 5CDFE 1B6RA 1NVVR 4G0MA 1A95A 2AZTA 5I7RA 2BHNA 3PVSA 4XPZA 4BLRA 3DLTA 2WD7B 4MV3A 2JAHA 3CLTC 4ZQGA 3T6KA 3DUFA 4Y2TA 1TU4A 1NG1A 1WOMA 3ANMA 4V1CA 3ICOA 4D9FA 3KJFA 4MWGA 1PV4A 1H9CA 1GZ7A 2IDZA 2JLQA 3D4IA 3IIMA 4MULA 4F86A 1Y4SA 4R1QA 1UR5A 2WDPA 1CY8A 1U4SA 2X0IA 3KLBA 3HG7A 4KPUA 4QXMA 2C2XA 3TI7A 1P8JA 2VC2B 4HLDA 2ZSBA 1FJHA 4B3GA