1P74A

Crystal structure of shikimate dehydrogenase (aroe) from haemophilus influenzae
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
267
Chain Sequence
MDLYAVWGNPIAQSKSPLIQNKLAAQTHQTMEYIAKLGDLDAFEQQLLAFFEEGAKGCNITSPFKERAYQLADEYSQRAKLAEACNTLKKLDDGKLYADNTDGIGLVTDLQRLNWLRPNQHVLILGAGGATKGVLLPLLQAQQNIVLANRTFSKTKELAERFQPYGNIQAVSMDSIPLQTYDLVINATSAGASVDAEILKLGSAFYDMQYAKGTDTPFIALCKSLGLTNVSDGFGMLVAQAAHSFHLWRGVMPDFVSVYEQLKKAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate 5-dehydrogenase
publication title The crystal structure of shikimate dehydrogenase (AroE) reveals a unique NADPH binding mode
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
total genus 98
structure length 267
sequence length 272
chains with identical sequence B
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1p74A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1p74A01
1ENYA 2UVDA 4I5GA 2FP4A 4CJXA 3IS3A 4NR0A 1A72A 2DVMA 2GERA 5HA5A 2GN6A 1BXKA 5CEEA 3DC2A 3V1UA 2VZ0A 5G4KA 2DBZA 2AEMA 2Y1CA 1HE5A 3PIIA 3GVXA 1M67A 3A28A 3JD2A 2RBEA 2CF6A 4D44A 2GNAA 2FZWA 4II2A 2I9PA 4Q39A 9LDTA 5FF9A 2PZMA 1IYZA 2P5UA 1LTHR 2NU9A 2LDXA 2W2LD 3I9LA 3UGKA 3W4JA 1B3RA 3E5MA 4WECA 5JYEA 4CLOA 3ZW9A 3D5QA 5JY6A 2VYVD 2O4UX 5TJHA 3EVTA 1JKFA 1LDMA 4CUJA 2AMFA 2V65A 3FWZA 1E6EA 5ITWA 4F46A 1I3KA 3EY4A 3HZZA 5U4QA 2A4KA 4XYMA 1MLDA 3ADOA 4RV9A 1GL3A 4CM6A 3OBBA 1ZXBA 4YBZA 5IZ4A 5LCXA 1WWKA 2O3QA 1FDWA 5CPFA 3GH3A 4WOKA 5DDIP 1HF3A 3K9QO 4LSWA 4HP8A 2EJVA 1JW9B 2O2YA 1QP8A 2POQX 3OJFA 4NZ9A 3WWYA 5BSEA 3DOOA 2GDZA 1ZJYA 3G49A 3PJDA 3UN1A 2VHXA 3IKTA 1YQDA 4CL3A 5KIAA 2FSVA 2Y68A 4BGEA 3QY9A 3S8MA 2E82A 3V1TC 3K6JA 4RF2A 4J4TA 3TZHA 4Y6SA 3SLKA 1E7QA 2Y0CA 4GAEA 3MZ0A 3SX2A 3KB6A 3P2OA 2SCUA 3W8FA 3D4OA 2C2XA 3OEWA 4BO9A 5A9RA 3IOYA 2EV9A 3SJ7A 1M75A 4FFNA 3ETGA 1ZJZA 2Q99A 4RVHA 1SOWA 1BMDA 4I5EA 3TZQA 1KY4A 3PXXA 4BMSA 1IOLA 2B4TO 2QHXA 2VTEA 1RYEA 3JQGA 5CEJA 2NVWA 3JCZA 3O8QA 5JO0A 2QW8A 3P2YA 1A4UA 1K89A 4B7XA 3DZHA 1O95A 1T26A 3NKLA 5AYVA 2Y1DA 1H94A 4IM7A 2C20A 3MJCA 4P4NA 4D45A 4I9HA 3IC5A 3IIEA 4QFDA 1EZ4A 4IIUA 3HDQA 4UUMA 2H6EA 4CMKA 4U6SA 3LK7A 3IUSA 2UAGA 4H7PA 1Q0HA 2VT2A 1ZO8A 3AM3A 1EBUA 3F9IA 3G3EA 1W73A 2HMUA 3OA0A 1MP0A 4XYGA 1U8XX 3ITKA 3I9JA 1SPXA 5BNTA 1VPDA 2PH3A 4L4SA 1DFHA 3H3FA 4HY3A 2G0TA 1Y1PA 2QX7A 4RPJA 3VKVA 4CMHA 1NNUA 4GGPA 4D41A 1DHTA 4WCFB 3Q2IA 1MX3A 5THQA 2J3JA 3K31A 1ISIA 1NYTA 1XU7A 3QJ5A 5A3JA 2AEFA 1CQJA 3E03A 2X58A 4DYDA 1HKUA 3SXPA 2IZ0A 3WGOA 5GZ6A 4E3ZA 3RROA 2B4QA 3VOSA 1M76A 3ZWMA 3L4BA 1GD1O 4FOOA 2GGSA 4L4RA 3SJUA 3KYCA 4KMSA 3RWBA 5JCJA 1PEDA 4GL4A 4J90A 2Y1GA 2CFCA 2FN7A 4AJ4A 2RHRA 4B3JA 2R6JA 4JBHA 5H81A 3RU9A 1T4BA 5A9SA 2ZTLA 2O23A 3WOHA 1T1RA 3L4BC 3Q1LA 3JYOA 4AJIA 7ADHA 2EIHA 2CNBA 3HFSA 5L40A 1GYRA 3GGOA 1XLTA 1DO8A 3IJRA 5CDYA 4K6CA 3TWOA 4HBGA 4E4YA 5A02A 2WD8A 1EVYA 5T6BA 3NUGA 2VRCA 4TRMA 4GX0A 3ZWNA 3OA2A 1X15A 2OUIA 2IDZA 4WEOA 5JCXA 5F1KA 1XSEA 4JJGA 3ENKA 1YBMA 3ONEA 2NUAA 3ZU4A 1D8AA 2NVUA 5L4LA 3EK2A 3CZMA 5HM8A 1UDAA 1JKJA 2DPHA 4J1SA 4YR9A 1PWZA 2E49A 3VZQA 4AJHA 3GOHA 1EQ2A 3JQ8A 2DQ4A 3ENNA 2W2KA 4PLTA 1VL8A 2HRZA 4JROA 1O94A 3M6IA 4ZVVA 3WWZA 1NP3A 4PG7A 1WDKA 3TDKA 1CF2O 2PR2A 1DHRA 1LNQA 4OOFA 2GUGA 1WAMA 3RC2A 3T7CA 4BB5A 2NACA 2P4HX 1NQ5A 1ZXLA 1XU9A 1WP4A 4DXHA 4IDCA 5KJFA 2FMUA 5FWNA 4J7UA 2B5VA 1P1RA 4YCAA 3P7MA 5BQFA 3PYXA 4S3MA 4WNCA 3NDRA 1PGJA 4RPHA 5IG2A 3UF0A 2B36A 1DLJA 5DOZA 1BVRA 3GDGA 2IRWA 4GLOA 3KRTA 2H5LA 4RF4A 5CDSA 4UUOA 3OJ0A 4GKBA 4DMMA 3EZLA 3MJSA 4YWJA 4KDFA 1YQXA 3AU9A 4L74A 4EZBA 1NHWA 1EK6A 2ZYAA 1ZW1A 1EBFA 2Q49A 3DBLB 1QG6A 3GAFA 4NBRA 4XJSA 4DUPA 4BHTA 2OL4A 3PIDA 1VI2A 1JWBB 4C7KA 2AQKA 4XJTA 5A04A 4B3IA 3GRPA 3BXXA 4B4UA 3PTZA 3AK4A 4R68A 4ROSA 4ZRNA 5ENDA 1DDOA 4JLWA 2X9VA 3P19A 3B6ZA 1LXCA 5HBRA 3E82A 4MVJP 3ZNNA 3L9WA 3VPHA 3Q9UA 5MGBA 3ASUA 4JBGA 1PL6A 1R0KA 4MVJM 5BSFA 4B7UA 4NFHA 1HYEA 3KUXA 3L4SO 1Y8RA 2HMSA 3ZWVA 3ON5A 1DFIA 2AXQA 4BV9A 5KVQA 4J0EA 4B4WA 2OP0A 5ICSA 4CQLA 1PJQA 1R6DA 1MXFA 2E6UX 1ZK3A 2JJYA 1CIVA 4NFSA 3CSDA 1B7GO 1KBZA 3PYMA 4D42A 4FFRA 4F6CA 4JIGA 1C0PA 2ZB8A 4PVCA 1T2FA 7MDHA 1EUZA 2W8ZA 4Y8VA 4IS2A 4EJ0A 1U3WA 3RBXA 4RZHA 2OHXA 5TT0A 1JA9A 3BMNA 1CERA 3GMSA 3KBOA 3R0IA 1X14A 3NRCA 3UAGA 4ZN6A 5F3RA 1Y7TA 2OORA 3OFSA 3FNGA 2QIOA 4Z9YA 2Y0EA 3ZHXA 5EERA 2FWMX 2VUTA 5FI5A 4EBFA 3C1TA 1KC1A 1ZEMA 1E5LA 1B8PA 1FDSA 1KYQA 1KEWA 4WOJA 1YKFA 1HYHA 1YDWA 2QZZA 1HDOA 1HETA 5AQ1A 1V3TA 3BZUA 3UHAA 3HJAA 4XRGA 1I3LA 2GYYA 3MCVA 2XF8A 4JJIA 3DAFA 1BXZA 1QR6A 4Y6PA 3UUWA 1I01A 1GPDG 5TT1A 4E5MA 3G1TA 5GY7A 3ROPA 4BO7A 2PK3A 1CWUA 4ZQFA 4J9UE 4KUGA 1NQAO 8LDHA 4NBTA 9LDBA 1F17A 5T8KA 2B83A 1C1DA 3INGA 1E92A 4AICA 1YL6A 3MTGA 4YB8A 5BNFA 1R4MA 5G0SA 1IHXA 3WTBA 1KIFA 4XWYA 3A9WA 3B1JA 1E3WA 3HADA 3VDQA 1UAYA 1V6AA 2J3IA 2EW8A 3ANLA 4HFMA 4XEHA 5T8KC 1GQQA 2DT5A 4UREA 4IDFA 4ESOA 1YRLA 4IMPA 3CE6A 1I5RA 3H9UA 3MJ4A 1HWYA 3WGIA 4D3SA 5DBIA 2HK8A 4ZJUA 2EKLA 1SO8A 1A9YA 3ZV3A 4MP3A 2Y1EA 3KYDA 3GC6A 4L73A 2VUSA 2FPPA 1VL6A 3QA9A 3EHEA 2W98A 1I3MA 4OXYA 1LC3A 1NAIA 2DBVO 2VUUA 1RM3A 3TOXA 5T57A 5K6AA 1HLPA 1VJTA 2CMDA 1EEHA 2VNSA 6LDHA 3CZRA 3RUEA 4NU6A 4U6QA 2DTXA 1C14A 3D3WB 3ZH2A 4NK4A 1ISMA 1Q0LA 4CM8A 2RIRA 3AWDA 5IDWA 1GAEO 3TZCA 4PG6A 4CQMD 1QLJA 1MA0A 5MDHA 2ZJ0A 5K6AC 5DZSA 2PZKA 5ILGA 4MKXA 5GMOA 1B2LA 3IDSA 4CM5A 1V3UA 1XYGA 1FDUA 2CUKA 3KM0A 1MFPA 1HDXA 4R3WA 3ZCXA 3KTDA 4IY1A 3D4PA 3KXDA 3VPXA 3PZRA 2YJZA 2QRJA 3CH6A 5BT9A 3U49A 2J3KA 3FBTA 2JAPA 1P33A 3L9XA 3JQAB 1GV0A 3C7AA 5I7EA 4E2XA 3RD5A 3STHA 3GDOA 3FRJA 4BNFA 1DAOA 3I9KA 4ND3A 1P1HA 3GMDA 3GVHA 2D8AA 2HK9A 1LQTA 2GLXA 4FR5A 4J7XA 3RCBA 2HAEA 4QECA 2GASA 2I66A 1ZMTA 1LRKA 4XGIA 2EERA 1K6JA 2J8ZA 4ZD6A 2WYWA 2DUWA 3HNPA 4K9DA 2FR1A 1V0JA 5L3ZA 5EPOA 2VYNA 3WBBA 3ORFA 1GZ4A 4CLXA 1E3EA 1XQ6A 1JAYA 4UAGA 2JD1A 4B8WA 5AVOA 5KJ1A 3MJVA 3LC1O 1HDZA 3ADPA 4J16A 3KSDO 4RVSA 4BNGA 3WJAA 3FTPA 3ZWYA 1QYVA 1BVUA 1AXGA 3GHYA 3KOUA 3LT2A 4LMPA 4EUHA 3KEOA 2W90A 1NWHA 3AM4A 3S2IA 4K26A 4BUCA 1K6XA 2ZQYA 2GZ3A 4Q3DA 3VTFA 4F3YA 2CD9A 3VPGA 5TGDA 1J6UA 3I4CA 3IAHA 4R16A 2ZKLA 4R9SA 4ZA2A 4E32A 4JGBA 3L07A 3JQAA 1C0IA 4DL9A 2DC1A 5G4LA 2EW2A 2DM6A 2H1SA 4YJDA 4E21A 3D5TA 1E77A 4BNKA 3HE3A 1LI4A 4CM9D 2UDPA 3PHJA 3N74A 4FFMA 4RGBA 3INRA 1N8KA 1YH3A 3JYQA 3RFVA 3TSCA 4J1TA 2P9CA 3DZFA 4PLZA 3DFZA 5I7FA 3FBGA 4EJMA 3RI3A 3WGHA 1Y8QA 3BAZA 4UVGA 2CDCA 1QXSA 4KTVE 4CLRB 1YB5A 1DC3A 1AN9A 1ZK0A 3AOGA 1UDCA 3ZHBA 3B1FA 4NBUA 3IJPA 1R4NB 4XQCA 2WD7B 1K0UA 1NPYA 4QTZA 4YRDA 3FHLA 1Z7EA 3PI7A 4CQMB 2B4RO 1GCOA 3AFMA 3D1LA 2CDAA 3DFUA 3PK0A 4FD3A 4WCDA 3W6UA 3BIOA 3ZU3A 1VSUA 5F21A 4IJKA 5B4TA 4YJHB 4M89A 2X5KO 5EINA 3O9ZA 3JD1A 3GQVA 3I9OA 3ZNOA 3KSUA 2WE7A 4RLSA 4BVAA 1P44A 4GVXA 2YV1A 1U28A 2Y1FA 2UYYA 2VTDA 1HYGA 3F5QA 3DOJA 1BXGA 4AJ1A 4UEKA 4J43A 4E5PA 5JW6A 4GMFA 5HS6A 3PDJA 2ZTVA 2HK7A 3H65A 8ADHA 1U4OA 3GVCA 1PTJA 3I6QA 4WJZA 4CLRA 2H63A 1ADCA 2PD6A 5C7LO 1YJQA 4H16A 1T2EA 1H6AA 2IXAA 1MFZA 2PGLA 3OSUA 3TL3A 1D1TA 1WNTA 5TRTA 3H4VA 1M6WA 3JYNA 4JJFA 3WQQA 3G17A 3RUHA 1FJHA 4YJHA 2CSUA 3S2FA 2NTVA 1U5CA 1J4AA 1X7GA 2B37A 2C29D 3L6OO 4LMRA 4Q3CA 1A4IA 1WXDA 3E1KA 4CV0A 4B4OA 1Y5MA 1E3LA 3Q2KA 4RQTA 5JAQA 2C7VA 3RJ9A 3AM5A 3WS7A 4CMCA 4AJNA 3EGOA 5L4NA 4R3NA 1KETA 1DRUA 3DAPA 3TQHA 1I2ZA 4LK3A 4OL9A 1Q2XA 3OJLA 4W99A 3WXBA 3BMCA 2YDYA 2D5CA 3N58A 4PVDA 3QVOA 4TQGA 3NEPX 4J49A 3PFFA 4J9VA 1GEEA 4FDAA 3VPFA 4D0SA 3T7EA 2JFHA 2YW9A 3WIEA 4YTEA 2D1YA 2W4QA 4I5FA 2EXXA 1DIGA 4HNGA 4NG5A 2Q2WA 3UKOA 4E2WA 2D5AA 3S2EA 3C8MA 1O8CA 5TF4A 2D4AA 3JYLA 2X7HA 1DSSG 1MGOA 2QRLA 4L9RA 3WGZA 4HFRA 4OSPA 1TVEA 4WLNA 1UXJA 4C7JA 1E7SA 2CF5A 2X0RA 5AXAA 1OI7A 5HRUA 5KJ6A 3V2HA 5IAAA 4IQ8A 5CAEA 3DXFA 1LA2A 1P31A 3RFTA 1D3AA 4LVUA 1H6BA 3C1AA 4YA6A 2GO1A 1YO6A 1Y9AA 2X5OA 4RVFA 4WKGA 3LVFO 1I2CA 4EEZA 2EHDA 1I36A 4YXFA 4O63O 2GZ1A 4FW8A 1UH5A 5A03A 5T64A 3GGGA 1IY8A 3VTZA 1KVSA 4J1QA 1LDBA 4DPLA 2Q50A 4OQZA 2QQ5A 2VWHA 3QIVA 3H9QA 5I8ZA 3WGTA 6ADHA 2HJSA 3NTOA 1I33A 1ADBA 4JK3A 4YJGB 3W6ZA 3ZGYA 3V2GA 1O0SA 1U4SA 1KEUA 1B26A 4L8VA 3TZKA 4UVDA 2Z95A 5AXBA 3BMOB 2VRCD 4OMUA 4CV3A 4YJFA 4KP7A 4XD2A 3JQ6A 3PFWO 4OM8A 1DOHA 2E48A 3JYPA 5EQDA 4A5OA 4P8RA 1AXEA 2RHCA 4OQYA 4MVJI 1GEGA 4W7IA 4ILKA 3WICA 1AHIA 4R1UA 1LSUA 2NWQA 4GSLA 4BMNA 4MVJH 3DTYA 1LRJA 1M6HA 5TIIA 4M1QA 1UAGA 2A35A 2O48X 2Q2VA 3B20A 3EDMA 1NFFA 4MOWA 3QVTA 5COQA 1W0CA 1RM5A 3E5RA 2O3SA 1GDHA 3DONA 2V6BA 3JTMA 3O26A 4BO8A 3O03A 5IF3A 4KQWA 3VZPA 3OJOA 3HUDA 4LSMA 4IPTA 1IULA 3VH4A 3CMCO 1Q1NA 3OP4A 4MVJG 1Y9EA 4R5HA 4G81A 3RVDA 4KDEA 2DTEA 4B4VA 2Z5LA 4JNKA 4N5NA 4Z6KA 3BHJA 4WLFA 4FC6A 1XG5A 3WFIA 4NJMB 3GLQA 4JQCA 4RL6A 1PU2A 5THKA 4E2ZA 4KTTE 1Y6JA 3ZNPA 1KVRA 4CLDA 2P9GA 2ZYGA 3A4VA 3PVZA 1Z6ZA 4IZHA 2BGKA 1GYPA 3ANNA 1ENZA 1TT7A 3E6AA 1DLIA 5F1OA 5I9NA 1G6KA 4ND5A 2VNAA 3AUSA 4KQXA 3I9NA 3ABIA 3DBRB 4R01A 2OZPA 5JAMA 2P9EA 3BTVA 4IXTA 4QXMA 1ZFNA 5G0UA 3DQPA 2RCYA 1T2DA 3PLRA 4PG4A 2QRKA 3PQFA 4A73A 3DZIA 2UUPA 4E30A 4AVYA 3DMTA 4QO7A 4YRBA 1KS9A 1P1IA 1YXMA 1MG5A 5DBGA 3ICPA 1E0DA 3M1LA 1L1FA 2I76A 2OGUA 3ETEA 4NMHA 3IMFA 3U4IA 3GA0A 4IXWA 1PR3A 1GZ6A 1XEAA 2JFGA 4NJMA 3UCFA 3DMTC 3VC7A 1G0OA 4LCEA 1W8DA 4DQUA 4IJVA 1E5QA 3ZV6A 4BMVA 4OXKA 4YACA 1GUYA 3PP8A 4PCVA 3H5RA 3S1LA 3E48A 1SAYA 2HSDA 2BKAA 3V1YA 4M86A 1KVUA 1LSSA 4DGSA 3E9NA 4K28A 2AA3A 2J6IA 2AE1A 1P45A 1KERA 2EJWA 4AJ2A 2YHIB 2PLAA 5JAZA 1DJQA 4MVJD 5JPIA 4XQ9A 2CVQA 4GX2A 3SC4A 4NHEA 2PFGA 4XYLA 3EC7A 2A92A 1U7TA 1EVIA 4ITUA 2Y0DA 5FFFA 4BOYA 3DZKA 3GR6A 3ZU2A 4WCFA 4J91A 2Q4BA 2WTBA 5KJEA 2WJPA 1Q7BA 1TEHA 3ZWWA 1YWGO 1KEPA 5KVVA 3RC7A 3ONDA 3I52A 1E1LA 1DJNA 4XQEA 4PLFA 3DZBA 1YB4A 4N18A 2QYSA 3DHNA 4XRRA 1HSZA 1X0XA 2VYVA 2J5KA 4RVGA 4WCFC 3OIGA 1H93A 5F1PA 4DLBA 5KTKA 2Y99A 3FWNA 5ES3A 4PFJA 1CRWG 3ASVA 3ZU5A 3G0OA 4BNJA 3GPIA 3RFXA 3U5TA 1IZ9A 1H2HA 3NJ4A 5G0VA 1OC4A 3BTSA 4MKZA 3K2EA 3FPLA 1NR7A 1OC2A 4FOSA 3FNFA 4EDFA 5IFLA 2E4AA 1Z73A 4C4OA 3PWZA 5CFZA 1T24A 1X1TA 1P3DA 4P38A 4RLHA 1EFLA 3QVXA 1PX0A 3K8ZA 2VCYA 4MJLA 5CDGA 2DPGA 4OYRA 3W1VA 3DR3A 1J0XO 1GQ2A 4L75A 3BHMA 4BO6A 2DUUA 4FC7A 1LSOA 1NBOA 2HCTA 1ZSVA 5EQFA 5L7TA 2EGGA 1E7RA 3TN7A 5EJ2A 2CVOA 4FCCA 5IDYA 1FXSA 4WPGA 1A5ZA 3FI9A 3I5MA 1EE2A 1HE3A 3M1AA 3PGXA 3AUTA 2HO5A 2Q46A 1KVTA 2YFQA 1W6UA 4IIVA 2JCYA 2PWZA 3ETDA 3PQDA 2Q1WA 5C37A 5TQVA 2GN4A 4YAJA 1QRRA 1LQUA 2EWMA 3U3XA 1R15A 2VOJA 2XOXA 3GEDA 3JQDA 5FI3A 4Z3DA 4W6ZA 1WPQA 1JAXA 2X86A 3DB2A 2H9IA 4BKUA 1YOVB 4EGFA 2G5CA 5IXYA 3WYCA 4YAIA 4M54A 1ZCJA 1BDMA 1UZNA 3QWIA 4K6FA 3JQBA 1RPNA 2NADA 2Q45A 1R12A 2J3HA 4J3FA 3W4IA 1U5AA 4TKLA 1CJCA 3CEAA 4A27A 4ALIA 2YYYA 3ZW8A 1IL0A 3NDIA 3Q6IA 3RC9A 3TL2A 3GZ4A 4FN4A 1XQ1A 3ZWAA 1UP6A 3D0OA 2JD0A 3FD8A 4JXKA 4LRSB 4QFCA 3I23A 4XQGA 1SMKA 3JQBC 5L53A 4GH5A 5JYDA 1EUCA 1FMCA 1NAHA 3V2UA 4HNHA 1H6DA 4IDDA 3AI3A 1LLUA 3M2PA 3L0DA 3JQ9A 3MTJA 4RO0A 4ZICA 4URFA 1E3IA 3DBLA 5A3VA 2B0JA 4XDZA 1K6IA 1K5HA 1VE9A 3GEGA 4Y9DA 3U9LA 1ULUA 1GZ3A 1YOVA 4D3FA 1U2GA 5IN4A 4GQAA 2ZQZA 5IDXA 3JQ9C 3I4FA 3AI1A 3TFQA 3F4BA 1KEVA 1SZJG 4QUKA 3RKRA 3E8XA 4BKRA 3TOZA 1VRWA 4RF3A 4ZU3A 1WZEA 2GR9A 3VPSA 4BGIA 1SB8A 2WYUA 2VHVA 3NX4A 4Z0PA 2GD1O 1ADGA 3GHHA 1X7DA 4XIJA 4LCJA 2G1UA 2X5JO 4YPOA 2C5AA 3WDSA 1NVMB 5TSDA 1TI7A 5BSGA 4MINA 1I8TA 3CUKA 4RCVA 3VH2A 1LJ8A 1ULSA 3E18A 4NNJA 5A5FA 3PGJA 4YQYA 3TFOA 5TS3A 3AY7A 5T5QA 4EEXA 3N7UA 1WDMA 4R69A 4W82A 3VHRA 1ZIDA 5HTOA 3HG7A 4Q3BA 3QSGA 5T67A 1UZLA 3JQ7B 1F8GA 4BNWA 5B4UA 3RUFA 4U7WA 3H7AA 4RPGA 3QWAA 4H3VA 4LGVA 1PL8A 1EFKA 1UZMA 4FIZA 2D59A 3TJRA 1P77A 3JQFA 3QWBA 3I3OA 1ISHA 3HFGA 4O6VA 3ROQA 4R51A 4ZQHA 1C1XB 2I65A 3UW3A 3NGLA 2BELA 5TJ9A 2ZIZA 2AE2A 1GTMA 4DRYA 1GCUA 1YL7A 1KVQA 4MIOA 1P1KA 2F00A 1MC5A 3LC2O 3WMXA 3WSWA 2YZ7A 4MO2A 3JQFC 4YAGA 5JE8A 3PWKA 4Z9FA 3R3SA 4IINA 3H6KA 4IQ0A 5KKAA 4BNZA 3GY0A 3ZWBA 4OHUA 1K2WA 1SOVA 2DU8A 1FDTA 2C07A 2FZEA 1BGVA 3DTTA 3QWFA 1G1AA 1MV8A 1ZVMA 3RSHA 1RWBA 2Q1SA 4XR9A 1KC3A 3RIHA 1HXHA 4GGOA 1PJLA 1TT5B 3PYLA 1WLYA 3UFXA 1ENPA 4CM7A 3CTMA 4MPDA 1AE1A 1JQBA 4KZPA 1UXHA 3C1OA 1IZ0A 3FSRA 3PDUA 4WGGA 4FGSA 5DULA 5JC8A 2I99A 4BS9A 1N2SA 5FEUA 1HDCA 3OH8A 1ZUD1 1MB4A 1ZK4A 1LC0A 3F3SA 3JSAA 2BFAA 1YL5A 1OMOA 3RBZA 4PLWA 1ZK1A 5CPBA 5CG1A 1QYDA 3S2GA 5EN4A 4P4LA 2C0CA 4BO4A 2WM3A 2YQ4A 1PS8A 2BMAA 3U4CA 5JMWA 4W9NA 3LZ6A 3VVCA 3R6DA 4PZEA 1DC4A 4PLGA 2WMDA 4RORA 4DBZA 4PLHA 4DWVA 1GU7A 1MXHA 2DFDA 3OQBA 4N5MA 1YJ8A 1V35A 3K96A 5LC1A 2DTDA 2NLOA 2PD3A 2CVZA 3D3WA 1DIHA 4ZHSA 1PJSA 1B0AA 1R16A 4WASA 4IGEA 3ZWCA 2C82A 3DO5A 3PJGA 4W9NC 4BGVA 4CMIB 3WBFA 1F0YA 2I5PO 3DZGA 5B4VA 1E1KA 5L51A 2HJRA 4DBVO 2O3JA 2EGHA 2NQTA 4TROA 5B12A 4XX0A 4EI2A 1TXGA 1B16A 4BKOA 3FR8A 4JN6B 4MIYA 3I1JA 1P9LA 1VSVA 1UJMA 4S1VA 3DEYX 1CQIA 4OOEA 2DAPA 1WZIA 2D3TA 1U2DA 2RH4A 3U62A 5HS4A 4XDYA 2X0NA 2EEZA 4M49A 2BLLA 4AJLA 3BMQB 2PGDA 3GF4A 1N9GB 3LT0A 4ZGWA 1W4ZA 3OJEA 5EESA 4Q3NA 2PNFA 4K1LA 4IDGA 4Q9NA 4MVJE 1NX6A 3SLGA 4JP2A 2BF7A 3LC7O 1NQTA 1JWAB 2NQ8A 4HKTA 1GR0A 3E9MA 2ZB7A 3W8EA 4OAQA 1PZEA 1PGNA 4CUZA 2CZCA 4GX1A 2HMWA 3CXRA 1O6ZA 5JC1A 1OBFO 3RUAA 5BSHA 1B14A 2BGMA 1X1EA 3RUCA 1DRVA 1QYCA 4CLHA 3S55A 1XA0A 5DBFA 3WIDA 1XR3A 3AY6A 3Q9NA 2PZJA 2F1KA 3MJEA 5I8WA 3ANMA 1DAPA 2IE0A 2CY0A 3C85A 3IL2A 2X9GA 2Z1MA 4DC0A 1IB6A 1WVGA 1YBAA 2I6TA 2PGJA 3M2TA 4I1IA 2ZCVA 3OIDA 4GI2A 4Y98A 3NJ8A 3ICCA 5JDIA 3OETA 2B69A 2AG8A 1NXQA 1H2BA 3COSA 1ORRA 2AG5A 2B5WA 2NSDA 2YY7A 4O1MA 3V8BA 4BO0A 5L9AA 3WYEA 1EDZA 4M55A 4FFOA 3ULKA 2VQ3A 2X0JA 4BL5A 2IZZA 4II3A 2PZLA 1RKXA 4ZRMA 1FF9A 2OFPA 1QYXA 2EP5A 4Y67A 1NTOA 5JDIC 3B70A 4INAA 1NFRA 5COAA 1HDYA 2PH5A 4R1NA 1A7AA 2HMTA 3GNSA 5EMHA 4HUJA 3AOEA 4Q3EA 4R9RA 3WGGA 3VVBA 5BNIA 2EF1A 2Y93A 3MEQA 2WWRA 1JN0A 4JBIA 1DC5A 1F06A 1NM5A 4BNIA 4ALNA 2AQIA 1R4NA 3BA1A 2WD7A 4XA8A 2C2YA 3AOEC 1RJWA 1QMGA 5AXDA 5A5EA 3WGQA 1Z74A 4CQMA 3U0BA 3K5PA 4NFYA 3PEFA 4TRRA 5CHEA 2E37A 2YDXA 5IXSA 3UICA 5EL0A 3GZNB 1T1SA 2VT3A 1SBYA 3L77A 4PIVA 2VN8A 2FHSA 1VC2A 3DBHB 4FJ2A 3RU7A 1GPJA 3ZWPA 1SNYA 4O59O 1OAAA 1VJ0A 3A1NA 3FR7A 3C7DB 5JFOA 2IEDA 2X6TA 1F12A 3U09A 4GWKA 1N92A 1Y81A 3PLNA 5H82A 1HLDA 4CMAA 4NPCA 2HRBA 4BNLA 4XR4A 4W7HA 1HE4A 3AI2A 4NQZA 4F6LA 1SCUA 3LDHA 2OOSA 4KOAA 2HU2A 3LU1A 4BGUA 5ILOA 4BIIA 5K0ZA 3GN1A 1LLDA 5JO9A 3WLFA 2HQ1A 1RYDA 1NQOA 2TMDA 4IUYA 4ZQBA 3NTQA 4PLVA 2JCVA 1R0SA 1PJTA 4CM4B 3LF2A 3UXYA 2RH8A 3SVTA 4HFNA 2X8LA 4EYEA 3HB5X 1YDEA 1PQPA 4ONEA 2GRAA 1ONPA 2JAHA 5L4SA 4KUEA 3KLPX 3Q0EA 5A4DA 1CEQA 1I3NA 3TF5A 1O9BA 4EW6A 4PLYA 1HSOA 3P5SA 4CLOB 3RASA 3ZDFA 3CINA 5GZ1A 1U3UA 3QWHA 4GLLA 3OIFA 2G17A 2PY6A 1PZFA 1DIRA 4Q3AA 1H9AA 5JCJD 3ONFA 3NDJA 4OJNA 1XWFA 4GBJA 3MJTA 4J4HA 4CM9A 3U4DA 2Y67A 5TNXA 4JP3A 1LX6A 1UP4A 1BTOA 1BDBA 2VHYA 1I24A 2VHZA 4EJ6A 2DFVA 3NT5A 1XKQA 4R5MA 5LDHA 2NV6A 3GG9A 4CM4A 4D7AA 5ITVA 3H5NA 1PZHA 4CR8A 3NAQA 5JBIA 3A06A 3PHLA 1PR9A 1M66A 1DC6A 2EKPA 2QYTA 3PWSA 3W4KA 4BO2A 3GT0A 4WEQA 3C7CB 5AOVA 2EG9A 2JHFA 2O3RA 2YV2A 5C3MA 4X54A 3H9JA 3NYWA 3EAGA 5C7IO 3HN7A 1ISGA 1EMDA 1VJ1A 3JQGB 3JQEA 5KVCA 2J5RA 1ZSNA 3O8QB 4DLLA 3DHEA 2OBYA 1ZKMA 4BO3A 3MWDB 1HRDA 2Q1UA 5ENVA 1VKOA 4E6PA 5DP1A 4XYEA 2O3TA 2EKQA 3B1KA 3SEFA 4B3HA 3FCOA 3MOGA 1N5DA 4DLAA 2PKQO 2GPTA 4Z0TA 3PZBA 2JL1A 4FSHA 3WB9A 4PG5A 4AJJA 1YVEI 3CMMA 4YJGA 4DC1A 3NGXA 1R66A 3GDFA 3CIFA 4D3DA 3WSVA 4J2OA 3WTCA 3AUUA 1SC6A 1O89A 5JNLA 3BMOA 1I10A 2VOEA 1ENOA 5TC4A 2VZ8A 1SEVA 2HMVA 3T4EA 5JS6A 2Y66A 4BV8A 3QHAA 1P74A 3QP9A 3GVIA 3ZN2A 1Y5RA 2AEJA 2D0IA 5JY1A 2YFHA 2NNLD 2O3UA 4NH4A 3DZJA 4CL8A 2PTGA 1NFQA 1ZNQO 2IXBA 3I6IA 2O7QA 4J6FA 4B79A 1FK8A 3O4RA 1DPGA 2GN8A 5CDTA 1LDGA 1GY8A 1DFGA 3H9EO 3KYCB 1UDBA 4B7CA 1PJ3A 4KWHA 4TSKA 4WK6A 2G76A 1NASA 3DBVO 1U3VA 5JMPA 2VZ9A 1E6UA 4AG3A 5A05A 4U0JA 4NK5A 3BYZA 1MC4A 5A9SB 4DVJA 3G1UA 2NM0A 2WSBA 1DEHA 4PZCA 4BNMA 2XAAA 2JD2A 4GKVA 3HDYA 4XZ3A 1QV7A 2VHWA 2WE8A 3NV9A 3OHSX 1PWXA 4PZDA 4YDRA 5KKCA 3H3JA 3FNHA 3GVPA 3PRJA 4LISA 1E7WA 1CYDA 1N1GA 3WYBA 4DPMA 1KY5A 3QE3A 4TVBA 4I9NA 2P5YA 3DBRA 3FN4A 5A06A 1ZZEA 3TRIA 5C5IA 1NPDA 1DXYA 1RM4A 3QVWA 3WQRA 3GFGA 1TB4A 1YS4A 4CMEA 4N54A 1PJBA 3DWFA 2NVUB 3K73O 4TKMA 2C59A 4GMGA 5L7YA 1ZMOA 3DAGA 1QKIA 2IZ1A 1NPTO 4EUFA 3F46A 4UVEA 3JQ8B 4CM1A 4CR7A 2W2KB 1HTBA 4RVUA 1A9ZA 2ZB3A 4IDEA 4NBWA 3K92A 2JCXA 3H2SA 4NI5A 1A71A 5A1TA 5F5LA 1LDEA 5L45A 3PHHA 4L4XA 4YYZA 4E2YA 4CMEC 1LSJA 3BTOA 5KNLA 1JTVA 2W2LA 4QEDA 1CETA 3KVOA 4TZKA 4PRLA 3BHIA 2NTNA 4ND1A 4EITA 5KWEA 2NU6A 3HSKA 5HWSA 4UULA 4XB2A 4IMRA 4MP6A 1EDOA 2ZTUA 4PGFA 4IJUA 1C0KA 1PGOA 3DL2A 3PPIA 3WR5A 4CMGA 2Q3EA 2AQHA 3H9GA 4YRAA 4Z9XA 4MVJF 4ZQGA 4DIBA 2UUOA 2UV8A 4RPLA 1AUPA 2LDBA 4D0RA 2BFMA 1D1SA 4WUVA 4FGWA 2OXIA 4RVDA 2GCGA 2P2SA 2YHIA 3WG9A 1P0CA 2EP7A 4JCOA 4AJOA 3JV7A 3Q3CA 4A7PA 2I67A 4MDHA 1YBVA 4J1NA 4CUKA 1E7YA 4BNUA 1P1JA 4FB5A 4D79A 1I2BA 1HT0A 1HEUA 4YAEA 4RDIA 1SB9A 4M8SA 3ZV5A 1ONNA 4BB6A 2V7PA 1J5PA 1H0KA 4XGNA 4ALKA 3KEQA 4TZTA 5AXCA 1LU9A 4LVCA 4BNXA 1DB3A 3TNLA 2JHGA 2G82A 3CPSA 1O5IA 5G2OA 3IP3A 4J2HA 2FOIA 3VDRA 4I9UA 4DMLA 1Z45A 4FJ1A 3F5SA 1ZH8A 3PQEA 3FNEA 4AJEA 1Y8RB 1VM6A 4DTIA 1UXIA 1ADFA 3EW7A 3LQFA 3GUCA 4H15A 3TZ6A 1WDLA 4RQUA 3ZHZA 2YUTA 1PQWA 5I9MA 4A2CA 4CQLB 4ND4A 4RDHA 4PLPA 3ZWOA 4I8XA 2YV3A 4QX6A 1G0NA 2GZ2A 5DF1A 4UVHA 3UCXA 3WGYA 2JKVA 5DOVA 3GN2A 3F1LA 1H6CA 2WEKA 3OMLA 1LLQA 3BMNB 4W4TA 4D43A 3LT1A 3C24A 3WLEA 1YGYA 2HDHA 1OFGA 4OO3A 1ML3A 1FDVA 4UVIA 4QO8A 4CODB 1L7DA 1TA4A 4A10A 1B15A 3ZHYA 1EVJA 3JQCA 2CDBA 3GFBA 1NHGA 4DYVA 5GZ3A 3LLVA 1OOEA 4G65A 1PQUA 1Q7GA 1K3TA 1XHLA 3CKYA 4I08A 4ALJA 3ITDA 3IKVA 4AJPA 5ICMA 4O0LA 4UUPA 3G79A 1B8VA 4ALLA 4Z3KA 1CDOA 2PV7A 4A26A 2X0IA 2Y05A 2FSSA 2BH9A 3HN2A 1X13A 1ZEJA 4GX5A 2VYND 2DBQA 1NWCA 1UXGA 5U1PA 4FS3A 3D64A 3D4NA 1XELA 1ZBQA 3JD4A 3QRWA 3PJEA 3NTRA 1WMAA 4IJWA 4KUHA 2C5EA 1GADO 3ZI0A 4E5NA 3UOGA 2NVBA 3VAZA 5I7SA 1IHYA 2ZJ1A 3AY3A 4WNIA 1AGNA 2Y1OA 1GQYA 3OM9A 4BKPA 4E33A 4QSMA 1PSDA 3MWEB 3HQ4O 2TMGA 1C1DB 1ID1A 2ILTA 1UXKA 4KWIA 4MVJA 3AFNA 3OF2A 4BNNA 4N7RA 4BO5A 1JKIA 1R4MB 4E13A 1PJ4A 3EMKA 5A9TA 1V3VA 2P4QA 5IZCA 3JQAD 1GFSA 1ISJA 2AQ8A 1E3WB 3I83A 4YT8A 2C54A 3A14A 3QQPA 1QSGA 3T4XA 2A94A 4J4BA 5LDGA 4OKIA 4TMFA 5DN9A 1I32A 3GUYA 3F6YA 3L6DA 1P0FA 1LUAA 2RAFA 1T2AA 1WW8A 4PG8A 5JXWA 3GAZA 3PJFA 1RM0A 2XPCA 1XGKA 4BNYA 5IZCC 2ZCUA 4XIYA 3Q11A 5TX7A 4BNHA 1B8UA 1Q0QA 1UUFA 3KYDB 4M87A 3O38A 1IPFA 3D7LA 3ZV4A 4R1TA 3GNTA 2A9FA 2NU7A 1E1NA 4DA9A 3FTNA 3AJRA 3W8DA 1H5QA 3FF4A 5B1YA 4ND2A 1KOLA 2DLDA 2BFOA 4R1SA 2GN9A 3KSZO 4UEJA 1R37A 4CM8B 3OQ1A 4NJOA 4HX5A 1IUKA 1BRMA 1M2WA 2ZATA 1NR1A 4G5HA 4XB1A 4XCVA 3RBVA 5JAIA 4CMBA 1TLTA 5G0WA 4D46A 1EQUA 3KV3O 5J23A 4DQVA 4BO1A 3ST7A 4IZIA 1PGPA 1T2CA 5CDUA 1XIVA 3UH1A 2V6MA 3JQ7A 2B35A 2NU8A 5TLSA 4IDBA 1MG0A 1V9LA 3QV1A 2XXBA 3IUPA 4G2NA 3X2EA 3X2FA 4BNVA 4L0QA 1PS9A 2Z1NA 5I9LA 1P1FA 2GF2A 1UP7A 1HZJA 1N1EA 4NIMA 3RAJA 3KLMX 2GSDA 4E5YA 3QLJA 1B3BA 1LRLA 4YEDA 1C1XA 3AUAA 4O5OA 4YT5A 5DCWA 4BQPA 2QG4A 2X1HA 3KO8A 3WMWA 4YT2A 1BW9B 1EK5A 3F47A 5DT9A 2OBNA 3GK3A 1H9BA 4U8GA 3FPCA 4GVLA 1J49A 4YQZA 2J5QA 4DPKA 4E0BA 3WQSB 3RQSA 2VWPA 4EUEA 3INTA 1DIBA 3ZNQA 1PJ2A 2FR8A 2BGLA 3OQ6A 4TRJA 5ER6A 3RUDA 2ZYDA 3OECA 3NT4A 3L6EA 1E3JA 2R00A 2O4CA 4OKNA 4B8ZA 2I3GA 2IODA 3HB4X 3VH1A 1D4FA 1TT5A 4F45A 3GGPA 4NBVA 1BSVA 1NVGA 4CV2A 1C3VA 2ZK7A 1HZZA 1GYQA 1XDWA 2IYOA 3OICA 1HL3A 4GSKA 4CV1A 4AJKA 5CG2A 5L95A 4J0FA 2R00C 2WYVA 4RJTA 1PL7A 1HDGO 1YONA 3V5NA 1WMBA 5I7VA 4HFJA 2AW5A 2FPGA 1HDRA 5KOIA 1U1IA 3GPDG 1DBVO 1ZK2A 1BW9A 5H83A 5DP2A 4OXNA 4CMJA 4PLCA 3EYWA 4MKRA 4BNTA 1U8FO 4FPXA 3KHUA 1BHSA 4XKJA 2X4GA 5DCYA 3OEYA 1NVTA 1Y8QB 3LF1A 1JDJA 3EVNA 3JD0A 4IS3A 5IJZA 1LDNA 2BFPA 4IGFA 2FRDA 1SEPA 4WLEA 4HADA 1F14A 2AHRA 3UCEA 1GUZA 4XYBA 3NT2A 4UEOA 3SBOA 3D3EA 4DIOA 1QORA 1S7CA 4Z0HO 5DCUA 1EE9A 1DIAA 1E7MA 4NU5A 5U9CA 3DDNA 3I9MA 1C0LA 1I0ZA 2I3AA 2FR0A 3C3XA 4ZQEA 4CMIA 4OGWA 4BKQA 3RC1A 2O7SA 4WLVA 3RJ5A 2IYPA 4PRKA 4TWRA 4YVFA 3MOIA 3K2BA 1GUFA 3ZZNA 3QW2A 4JX8A 2X23A 4R4JA 4FFPA 1VLLA 3K30A 3QVSA 1QLHA 1Z82A 2DKNA 4XGKA 1BXGB 3KETA 1EVZA 1R0LA 3AU8A 1YE3A 1A27A 3H8VA 2BD0A 1JLLA 2Q1TA 5DNAA 4HV4A 1PZGA 1PJCA 2HUNA 3U4HA 1VL0A 3LYLA 5KJCA 3BMQA 2IEBA 4A0SA 1BG6A 5IDQA 1N9GA 2HLPA 2PA3A 1ONOA 1MUUA 1X7HA 1LDYA 1Z7BA 2DBRA 5G0TA 2O2SA 4J7CA 1U7HA 1E3SA 3GRKA 4ID9A 2P91A 2NTJA 5KVSA 4BQRA 4RZIA 5BR7A 2BI8A 3HWRA 5CP8A 4CR6A 2VWQA 2OO5A 3GG2A 3VZRA 4R54A 5ER9A 4P4GA 1U3TA 4R41A 1ISFA 4CM3A 3AW9A 3EUWA 5FYDA 4UUNA 2R2GA 2OP1A 2D2IA 4OSOA 3IQDB 3EZYA 3LT4A 2BRUA 2ET6A 4TVOA 3TPCA 4LN1A 4FQ8A 4L76A 3RUIA 1D7OA 4HXYA 2QZ9A 4IDAA 1AHHA 1Z75A 3KYBA 4MIEA 1OZAA 3RKUA 4AFNA 4YAKA 1I30A 2O50A 4E5KA 5C7OO 1Q7CA 5JLAA 3PHGA 2WDZA 1N7HA 4GPD1 1ZSYA 1T4DA 4N5LA 1LEHA 1PS0A 4PN3A 5KCZA 3E9QA 5K9ZA 4RF5A 3BMCB 5ADHA 2VWGA 1DRWA 4WLOA 4CLEA 4AL4A 1VKNA 4LW8A 4HWKA 4U5QA 3VZSA 2VRBA 2HKIA 4FFLA 4QQRA 3ROKA 1LLCA 4Y6RA 2ZTMA 3HDJA 2YHUA 2BHLA 1A7KA 3IP1A 3WFJA 1YQGA 1IE3A 3DHYA 3WNQA 1PIWA 5L7WA 2BI7A 1ARZA 3F4LA 1LBEA 1X0VA 1F8FA 3GNQA 4P22A 1V8BA 1U9JA 2C7GA 3LLSA 4GWGA 1E1MA 2P68A 4NDNE 3GEMA 4U0KA 3ZWXA 4ALMA 5JSFA 3WNVA 3PHIA 2PKRA 2JFFA 3UVEA 3H5AA 4E12A 4LRTB 2V6FA 3LSYA 1PGQA 1QYWA 1XCBA 4RPKA 5F5NA 2YQ5A 1QV6A 3F1KA 4OH1A 4IQGA 4I5DA 3BTUA 5G4KB 1UR5A 4WLUA 1JVBA 1YB1A 1JU9A 4MP8A 2Q2QA 4FBGA 1S6YA 2OMEA 5B37A 4YT4A 2X9NA 4QT0A 5EIOA 3GZNA 2PD4A 4A03A 2XXJA 1IPEA 1N7GA 3WX0A 1EUDA 5COBA 4OIMA 1BWSA 3DBHA 5JDCA 4TRNA 3SC6A 4E31A 1JVSA 3WJ7A 2PKQP 4IBOA 3HHPA 3JD3A 2V6GA 3ROMA 3VH3A 4DIFA 3KZVA 4DQXA 3R1IA 2FY8A 3VKUA 2ZB4A 2X22A 1GV1A 2Q4EA 3DMYA 4FJ0A 4WE3A 4CPDA 1L7EA 4DREA 1HE2A 3H2ZA 1T25A 3R3JA 5JDCC 2FPIA 3HDHA 5IN5A 4YJFB 5CEFA 3DOCA 1E6WA
chains in the Genus database with same CATH superfamily
1CR1A 2HY7A 1WCV1 1PEAA 4RWZA 5BW6B 5C35A 2FP4A 1X1CA 2P30A 4UFPA 1MEEA 2J6BA 4O4LF 2GN6A 3PI6A 4H7HA 4TTIA 3A1EA 3DC2A 5HA5A 1RI2A 3LUFA 3V8EA 1DCMA 2ZSAA 3R7DA 5K8LA 2VZ0A 2XUGA 3UXEA 1KP3A 1C9MA 3D1VA 3GVXA 5JVDF 3JD2A 4ZK6A 3T9EA 2QVBA 1RYMA 4LFCB 4DV1B 5KZMB 3K9HA 2OHOA 1QQAA 3GEPA 1RTTA 2C3UA 2P5UA 1LTHR 2PFSA 3W4JA 3AF5A 2ISCA 3B6KA 3R6LA 4KQMA 4CLOA 1EI9A 1U02A 3C6YA 1WXGA 1V7CA 3AHGA 5JY6A 3SZOA 1UBMS 4PC6A 5TJHA 3EWSA 4C14A 2GXSA 3CKKA 1T3HA 3WP1B 1E6EA 1YJCA 2JFYA 3ZCUA 2ZZNA 1I3KA 4RJIA 4DMFA 1M8PA 4LRXA 1MLDA 5K0EA 1YRHA 2WJAA 2QA5A 2OB2A 4M83A 5IHPA 4YBZA 1SHUX 4X85A 5FBHA 5EJ4A 4XJXA 2WU4A 1M2EA 2NO1A 2PKWA 2QD5A 2JNWA 3GH3A 3QEMB 4PTZA 5DDIP 1NN0A 3V1MA 3KSBC 1JR6A 4AYXA 4HP8A 1VPVA 4CI0B 1J0CA 1JW9B 2O2YA 1P9WA 2POQX 3WWYA 2COUA 3QEKA 4F5EA 5IANA 2C97A 3DLAA 4N49A 4EGCB 3IKTA 4LJYA 2FWJA 1YQDA 2VK8A 5KIAA 5EIAA 3QY9A 1CX9B 1E69A 5AVQA 1ZGAA 4QUGA 5BMVF 3I6MA 3T7TA 5K0JA 3IBGA 3ZE1B 4WBSA 2G25A 4F7DA 4MA4A 3TZHA 2LZ0A 3SLKA 3FGZA 4COKA 4Y6LA 5HK8A 1LKZA 1CUXA 2C4HA 2Y0CA 3EIFA 3MZ0A 4HEA6 3U40A 3SX2A 3KB6A 3P2OA 1VKZA 3IBYA 1A8PA 1LV8A 3NS7A 3FB4A 4Z8XA 2PX2A 4AZSA 2FSVC 3R09A 1Q3KA 3IOYA 4AB1A 1ZKDA 5ADVA 4BAGA 2EV9A 4M1KA 3SJ7A 1DARA 3OCZA 4FFNA 3WP0A 5CXQA 1MJNA 3HKBA 1ZJZA 2Q99A 3NRJA 3S28A 1KYVA 1BMDA 3PUKA 5TMEA 1JBQA 3PVCA 3D54D 3GXOA 1QH1B 1O96B 2IXEA 1SIBE 2HHAA 2EFCB 1KZ6A 1UWVA 2HU5A 2KYRA 1ESZA 2QHXA 3EDOA 4LDPA 4OJQA 4EG6A 5A2GA 1Z2CA 5JBQA 3CFYA 3O8QA 3P2YA 4LZPA 3KVRA 4PCAA 2LPMA 1KJQA 2I0FA 3QEMA 5AD1A 1R0XA 3NKLA 1Z0DA 2VXOA 5AJVB 3MJCA 3V2IA 4KREA 2HSWA 2CLCX 3DBOB 3F90A 4EF4A 4QFDA 4IIUA 2BEWB 4BLOA 3HDQA 2JDID 3KKNA 5AJHA 3NWEA 1DZIA 3BCRA 4CMKA 5JZOA 4ZCPA 3ZTYA 2ZIUB 3T54A 1SXQA 3BXPA 3JZAA 1FYWA 2FN9A 3WB0A 3N2YA 4S05A 1YAJA 1GO2A 4ZYTA 3DM5A 2QN9A 2HCRA 3F9IA 4G0YA 4RXMA 1W73A 1MO5A 2A5FA 2ONKA 2V9CA 4C03A 1M0WA 1I3CA 1MP0A 3EG9A 4PBRA 4XYGA 4EWLA 4S12A 5LL6P 2GT1A 3UBMA 2ATCA 2G8LA 2PWYA 4HO1X 2JCSA 3CIOA 1F5NA 3JARB 2PDAA 3ICVA 3I3SR 1J8DA 3M9LA 1GAJA 1DFHA 3OCVA 3LWBA 4RTRA 2RH9B 3K70C 4U7PB 4JGGA 1LCIA 1VCMA 2G0TA 4K1XA 1HOTA 4XCXA 3SHOA 1NNUA 4GGPA 2VSQA 4QXAA 2DWOA 3IT3A 3VOTA 3C6XA 4C0JA 1BROA 3KELA 5FAKA 1LB1B 4TWBA 4ZOCA 1L0BA 1T5BA 4QAQA 3V1LA 4JR1A 4ZOEA 1CKEA 4WDQA 4BMZA 4O4LA 2OCAA 2JA2A 3E03A 4K46A 4KE7A 5BMVB 4LF7B 2IZ0A 4X64B 3HDVA 4OM7A 1WZNA 2BDUA 2OB1A 3WGOA 1P72A 2OT3B 3F9CA 3K0EA 3P45A 5JVDA 4GDFA 1S8FA 3VNRA 3ZWMA 2AD5A 2FSPA 4FOOA 3A0RB 4CCYA 4L4RA 3DVRX 3DCNA 5JCJA 3RWBA 1PEDA 3VO8A 4W7SA 5IRCD 2C4UA 1W49A 3AJDA 4JA0A 4RW0A 2K87A 2WR8A 3TQOA 1NC3A 2FN7A 1A2KC 1ITZA 1M2KA 1MR3F 1OTHA 1PRYA 2GBLA 2WM2A 3F6PA 3FDIA 5LWHA 4AIIA 2JIBA 3N6XA 3GJZA 2H7CA 1ZAKA 3C1UA 4HDNA 5LLSA 2B1QA 4LCBA 4BVHA 2Q3FA 4XAQA 4JSTA 4RWEA 2ZT7A 3MTEA 4ZQCB 2WICA 3SM9A 1P29A 5TF0A 1YULA 2FKNA 1NNLA 2JJ2A 3GNLA 4F6RB 3KKEA 4DV7B 5L40A 5AW0A 3C16C 3AR4A 2O5CA 3MAJA 3USZA 4EFDA 4LWZA 1EBBA 4EATA 2OFFA 1A88A 4I5IA 1SXGA 1UFKA 1Y1QA 2ZJ3A 2XUKA 3KHSA 4BP3A 1I80A 3CPEA 4HBGA 3ZCVA 4E4YA 1YFLA 2NVOA 4P33A 2WD8A 1SIWA 4EY6A 1H42A 2C78A 5T6BA 3KVNA 1R9GA 3B1VA 4TRMA 4GX0A 1F4LA 4DDHA 3VISA 2LTAA 2OUIA 1GHTA 4KYUA 1JJAA 4NBKA 2G88A 5SY4A 5F1KA 3FHJA 1XSEA 5BMVA 1EP9A 1YBMA 2NUAA 5F2EA 3ZU4A 2OQ2A 4CKCA 1D8AA 3RS5A 2YN2A 1G64A 3BH7A 3EK2A 1Z5NA 3D7KA 2J09A 2Y9PB 3JPWA 1JGTA 1H1LB 4G2TA 4I66A 3ZQUA 1CSEE 3VNVA 3R3YA 3I2IA 4AJHA 2VBFA 3WLHA 5KEIA 3GOHA 1Z4PX 4KBYA 1JR3D 3AEZA 2BF4A 1VL8A 2ZT6A 2CLSA 2HRZA 4JROA 3FTQA 4RK7A 2VVTA 4ZVVA 3RF6A 1YZLA 3A4TA 3VQTA 3ZHTA 1BVYF 1XAGA 1UC8A 1UKCA 4IVNA 4QULA 3PE4A 1NV8A 2AWNA 4Y2JA 1OAOA 3T7CA 1EFRD 5LM3A 1K9VF 5K7SA 2VJCA 1M1YA 4UU0A 1NXPA 3AKEA 3OE5A 1YCDA 3F8SA 1RXVA 2QPLA 1E9CA 3EF1A 3VVLA 4BJHB 1ULTA 1O94C 2GPWA 2QEQA 1AX9A 2NXNA 4ZO8A 1P1RA 2C0QA 9ATCA 1WCIA 3OX3A 1JEYB 3P7MA 2BFCA 3PYXA 3PCXA 4LKRA 2I6XA 4NC9A 4EP1A 1PW7A 4ZCRA 2IUFA 1PGJA 1JT9A 3OFJA 1P5ZB 1FUIA 1C9NA 2FGJA 2V03A 3EOAI 1ABBA 1B23P 2XZTA 3H1FA 5DOZA 3GDGA 4GLOA 4BYGA 3SJBA 2CEAA 5F9HA 3MF4A 2H5LA 1OFUX 2IYAA 2HBZA 4RF4A 5GOZA 1L3IA 5CDSA 1U5BA 5TR9A 3SDZA 1E99A 4DMMA 2FWBA 3RVJA 4KDFA 1A5AB 2F3UA 3PNPA 4DR3B 4PPQA 3CEPB 3DTVD 3P9IA 4M8IA 5JAUA 4EAAA 1T5SA 1FYVA 5HZGA 1EBFA 2R1TA 4IIBA 4M9CA 3ZCTA 2W71A 4XSHA 1CUYA 1NJ5A 5IKEA 1VI2A 4C7KA 4CDRA 3N6VA 1NN1A 5G40A 1SUFA 3FM9A 4R68A 5EIBD 4ZRNA 1OIVA 4ROSA 1DQSA 1E2MA 3OCCA 3P19A 3VDMA 3QX8A 3EB9A 1RYFA 4MVJP 3CBQA 1EM8A 4BECA 1EESA 2GLTA 3L9WA 4H3SA 5ALXA 4DJAA 1JU4A 2F64A 2E6KA 3TZBA 4BLQA 2ZUUA 1R0KA 2BBTA 5BSFA 3PFNA 2GWRA 4HB4A 4KIJA 4R1QA 3DO6A 1DCKA 3UJDA 3COZA 3ZWVA 4RCZA 4YASA 4Z3OA 4M36A 3COPA 1ZU5A 2G6TA 4GW3A 4MI3A 2QYHA 4HR7A 5JFTA 1UM8A 3DKPA 1JECA 4FHFA 3ZZTA 4G4SP 4M9ZA 4NFSA 2BFDB 4M0LA 1RWVA 5DV9A 1G9XA 1Z26A 1EFUA 2ATVA 5DB4A 4C20A 3OU6A 4Q1FA 2OWEA 4FFRA 4KLRA 2INGX 4BC0A 3T3OA 2B6NA 2REQA 3HWWA 4LE2A 3UH0A 1EUZA 2P1ZA 2AX3A 2W8ZA 4L9WA 1IHPA 4GE0A 4IS2A 1SELA 5DN6D 1NP6A 3K53A 1JA9A 1X1SA 3BMNA 1CERA 1MENA 2Q29A 4CKZA 3R0IA 2FEXA 2I2WA 4GZ6A 1NDHA 4ZYZA 2GAJA 1FYDA 2BJWA 4N39A 1JDTA 1Y7TA 4Y6OA 1XTVA 3OFSA 1LQ2A 4LS3A 2O6LA 5CCXA 5JHGB 5DWQA 4QU5A 4LSGA 4AF7A 3DKIA 1G5FA 1YTLA 3AFGA 1TYZA 2BFBA 3ELDA 3F5FA 2FEPA 2LIPA 2W6MA 3WVNA 4DNFA 3C1TA 1ECBA 1PTKA 3IDZA 5AJZA 1RACA 2IS6A 2OA0A 2ONYA 1NUAA 1FP4B 5DW0A 5ADUS 4HN9A 1YKFA 1AKTA 2XCUA 1SCAA 3UK6A 5KTNA 1AS3A 1HETA 2YVAA 3CW9A 4O29A 4BPRA 2JBHA 1C0EA 4TVSA 2BHTA 1C1HA 1QFYA 3CKMA 1V26A 4YC7A 3BCSA 3UUWA 4BRZA 3LY7A 4TX1A 1CU1A 1RWOA 3MINB 3G1TA 3UGQA 2JFNA 5HM6A 3K9LA 1CPYA 3X3HA 1WBDA 3EA5A 4NEQA 5J2TB 1CWUA 1XMPA 2PRKA 1NQAO 4G85A 3MWEA 9LDBA 3ZUGA 2ZW9A 3INGA 4AICA 2XF2A 2ICAA 3L3BA 3RFUA 3MTGA 3O2NA 1R4MA 1CG6A 1IHXA 5G0SA 3FCEA 4W9RA 3U4QB 2QQGA 4AZ3A 3F71A 4KFCA 3VDQA 1I0LA 3ZK7A 4A8TA 4MDFA 2EW8A 1ZD1A 2WPNA 5T8KC 4UREA 2Y71A 4KR9A 4G4JA 1E8DA 2Q28A 4GM1A 3GB9A 1WEHA 2DUMA 3ZZ1A 1TMOA 4D3SA 1AB5A 5D1HA 2A30A 1EP1B 4PQEA 4JOQA 1JEEA 3VAYA 2LBPA 3AEUA 1UPTA 5IPFA 4U2BA 1OXBB 2CXPA 1KK1A 2CXXA 2JLSA 3KYDA 1NVFA 2PL1A 3QA9A 5MFPA 1ZRNA 2AOTB 5L3SB 3N5CA 2ZCJA 2M2IA 1IK6A 1I3MA 1KMIY 2W98A 3M3HA 3JVUA 1PNRA 3K6KA 3TOXA 3GLFA 1EAMA 4YRIA 1WVIA 2V5VA 4I3HA 2ORIA 4H6XA 2FAXA 4DCGA 2IH5A 4NU6A 4QTXA 1DAMA 2DTXA 2OV1A 5CM8B 1L5WA 5JXJA 2YJNA 5K05A 2P5SA 3L6UA 2ZRBA 5EJAA 1OF1A 4W8HA 2FZGA 2V7WA 3KQMA 4BVFA 1Z4MA 4PG6A 1QLJA 4OV6B 2J9GA 3JZMA 4EG3A 5CFRA 1MPTA 1XLUA 1Z37A 4G1VA 4H7FA 4EB0A 5K6AC 3QI2A 1VCHA 3OT1A 4FE7A 1VJCA 3BJIC 4Q4HB 2G9QA 2GO7A 3IAEA 1V3UA 2A0YA 4FHZA 3C5EA 3M4YA 1GUDA 1YA8A 1FDUA 2CUKA 4G0QA 1VLVA 3KM0A 3KQQA 4HWPA 4NOLA 1HDXA 4XX0B 3NETA 1SVWA 3M1YA 5E1BA 3KTDA 1RLMA 1IN8A 2Z2ZA 1RBZA 3VPXA 3ZBQA 5IKXA 1E58A 3BF8A 2D1FA 3PZRA 3TR6A 5JFGA 3JALB 1OBHA 4WXEA 5BT9A 1TQ8A 2VPWA 1E3MA 1IOWA 1P2UA 2JAPA 2JG3A 5JZ9A 3C7AA 3OKFA 4C5AA 3BHNA 4OHFA 1BEZA 2FMFA 4E2XA 3STHA 5K01A 3FRJA 3LCRA 3RYFA 4ND3A 2FF7A 2XT9A 3V4FA 1UMBB 2DBYA 4MYRA 4OBBA 1LQTA 2GLXA 4FR5A 2G36A 4CTKA 1OPRA 2BCGY 4QECA 4IQFA 2VP9A 3DDZX 4P82A 4Y2XA 5F33A 2EERA 3CEHA 3EUFA 2VIIA 3M6AA 5E7QA 1XMQB 1M5TA 4UEWA 5L3ZA 1K27A 2VYNA 3WBBA 2PYZA 1N0WA 1HT2E 3I2FA 4HGOA 4MLPA 4D6PA 1JFTA 2H8KA 2ODWA 4CNQA 4UAGA 5BN4A 2JD1A 3THXB 3HCEA 4EG8A 3ADPA 1EE1A 1U2QA 2CZQA 2JJ1A 2FSGA 4RVSA 3H5TA 3WJAA 3ZWYA 2W42A 2QNRA 2OG1A 3LT2A 1GLGA 2EVWX 5LQAA 5DEOA 1WXXA 2WRZA 3AM4A 2HT6A 3HI4A 3S2IA 4TL8A 5THXA 1UBCA 2GZ3A 1L7BA 4JODA 2Y0BA 2CD9A 2XUJA 1J6UA 5TGDA 1B0ZA 1BS1A 2YWBA 3I4CA 4KR6A 4R16A 4TXNA 2VJBA 5JJLA 3STTA 4U63A 4LPSA 5ETJA 4JGBA 3ZI4A 3C97A 1C0IA 1AK9A 2EFYA 5G4LA 3TLJA 1U1EA 3RRJA 1XCGB 1AGRA 3IP6A 3RTAA 3D5TA 3OFKA 4IFIA 3K5HA 3PUVA 5HXAA 3ZGXA 4KK4A 1NN3A 4FFMA 2C3MA 4UXJA 1N8KA 2J7PD 3EZXA 4MWTA 1A98A 5BSVA 1PD1A 2P9CA 4PLZA 1D6NA 2C98A 2VDPB 4IH4A 2BGWA 1RZRD 1Y8QA 3QUCA 3SR4A 4UHBA 3AW8A 2CDCA 1P2FA 1N8SA 1G2OA 2W2PA 4BVJA 3P26A 4JBXA 1T2UA 4ON9A 5AK5A 1S8NA 2DWQA 1VLQA 4YONB 4F4FA 4EJ2A 4N01A 2Z5VA 1RVV1 2WK1A 1WA5A 2TECE 1UDCA 5CX4A 3AHIA 4M1OA 5JNUA 3ZHBA 1TEXA 2KLHA 3ZVKA 2PSEA 4NBUA 3TTTA 5HKKD 2BMWA 1R4NB 3HLKA 3N2KA 1ZONA 1K0UA 1KOJA 2YRWA 3D0RA 3EVCA 4YRDA 4U9IS 4DR6B 1RADA 1FQJA 2EKDA 5CLQA 2BKXA 3LNTA 4NMLA 2QTMA 3WKAA 4CQMB 4WCDA 1QR2A 4S1NA 3ZVLA 2Q21A 4G4IA 5FFMA 3D0QA 4MRMA 4OQXA 5AKJA 3ZU3A 2JANA 5AM2A 2D2XA 2OQIA 3GLKA 1L7MA 1HO3A 2X5KO 1U7UA 2OESA 3O9ZA 4MS4A 4QLAA 2VNJA 3GQVA 5EINA 1KJNA 2DFLA 3KSUA 5CA0A 1WUJS 3ZX5A 2WE7A 4RLSA 3CZ4A 3AFHA 4BVAA 4GVXA 2G5TA 2PMBA 3PXDA 2R7AA 4AJ1A 4BQFA 3EXG2 1L4GA 3O8OB 2HO4A 3E70C 3L5KA 3OBIA 4J43A 4ZVKA 5KTSA 1GAQA 4X7RA 4BY9E 1SA0B 1P7VA 3S1AB 2YWRA 4JU8A 1S2MA 1AMUA 5H4HA 8ADHA 1ZR4A 2AT1A 4OU5A 5ALSA 4F97A 5M7EA 3LK6A 5HSGA 3STXA 4YQEA 5C7LO 1YJQA 4IUCS 1RJGA 4IX1A 5HYVA 4RKEA 2IXAA 3IIJA 1UJ2A 3EXIB 4NYIR 1IQRA 1PK8A 3S40A 2W6ZA 1N6HA 2JH3A 1D1TA 1XOIA 3EXHA 2QM3A 5BWMA 3E3MA 5ARCA 4FKZA 2IUUA 3A1UA 2RI1A 3T1YB 4JI3B 4N41A 4JJFA 3G17A 4QTTB 1XE3A 3RUHA 4TXMA 1P75A 1C4XA 2NTVA 1XL0A 4ISBA 2B37A 4EUKA 1LI7A 1JEAA 1GNTA 4HMQA 4M60A 5FI1B 1CR4A 1Z7WA 1L9KA 5DGXA 4DWJA 2IYXA 1QVZA 1E3LA 3OLZA 4L8FA 5JAQA 3TFWA 1H1DA 3AM5A 3WS7A 1S1CA 4AJNA 5L4NA 4R3NA 2O2CA 5C80A 1DRUA 3F4KA 1D07A 4I3GA 3NBZC 3TQHA 2WD9A 4PPGA 1GNVA 4BFSA 4BMXA 4LK3A 2GJSA 5BXQC 2CNNA 1FQWA 1WS6A 3D6VA 3QBVA 1CUDA 4W99A 3BMCA 4MYCA 4HMOA 2C61A 1VTKA 3M6XA 2I33A 2ZU6A 3SXUB 4PVDA 5BVGB 2X8JA 4WESB 1S2GA 1KTVA 5DYNA 1N4DA 4GICA 3DUFA 4EAQA 3NEPX 2R7NA 3IXQA 3C39A 2REXB 3OCYA 4J9VA 3OQOA 2PRSA 1GEEA 5CNIA 3OG9A 2OKGA 5DFAA 2YW9A 5DXFA 3TEFA 2O2EA 5EUBA 2W4QA 5IT5A 4I5FA 1KZGB 5B6IA 3MMNA 2AJLI 2EXXA 4PZ9A 1Y1TA 3O84A 4NRDA 2A7XA 4NG5A 2Q2WA 3LA6A 1UPCA 2D5AA 3FLEA 3T9FA 2B8NA 2GUWA 2Z5FA 3C8MA 5ECDA 5SZIA 5TF4A 3JYLA 2X7HA 1DSSG 1MGOA 2ZEJA 4L9RA 4WK2B 4OSPA 1TVEA 1E7SA 3KUCA 3HP4A 5AXAA 5LB4A 4WRRA 4C4PA 5AFSA 2ODEA 2ZWOA 4G41A 1COWD 5KJ6A 2A9JA 4ECAA 5JASA 3DXFA 1F9AA 1SG0A 3PNMA 3I12A 3TRJA 1PNOA 3RFTA 3ABOB 2ZU0C 3KKZA 4ZJZA 3GFTA 5JJ5A 3JWHA 3W05A 4X84A 1B6SA 4EA6A 1HK7A 1XDGA 4HG2A 5GQSA 4DIMA 5I8PA 1LZLA 2I7CA 3C3CA 2G5GX 4HN2A 4YNBA 4XDGA 1I2CA 3EGCA 5AHXA 5AVVA 5KMGB 5HGJA 3HFJA 4RD6A 2VHEA 4G36A 2GZ1A 3K16A 5EEGA 4FW8A 1UH5A 4XM1A 1U80A 3DJFA 4BCBA 1Y4SA 1R0CA 2JEYA 5T64A 1XCMA 1FFXA 1TIPA 1IY8A 2QQ0A 3GGGA 4F91B 5KTPA 1KVSA 1X87A 4ZCSA 1SXJA 4O3MA 1BJRE 2Q50A 2WT4A 2QQ5A 2VPPA 5BOSB 2N47A 3QIVA 5I8ZA 3WBJA 4D4LA 4MMZB 5L6LB 1VXRA 2QX9A 3NTOA 1ADBA 2HJGA 2G4LA 3DC7A 4JK3A 4MUFA 3V2GA 1U4SA 1KEUA 4BV3A 2WVAA 3VJLA 1YIDA 4XM0A 4L8VA 4CKXA 3IQEA 3MCUA 4PQYA 1J5XA 2G09A 1UIRA 2P2DA 3NVKI 4OMUA 2GVZC 2BGNA 1OILA 2JLQA 2O9JA 4R2KA 4CV3A 3M4JA 2OEPA 2YIMA 4ZQIA 3SSNA 1XHEA 1QUFA 4XD2A 3P9RA 3VXKA 2IU3A 2V7TA 2WOJA 1IWOA 5JTTA 1P8AA 3DWGA 3EXAA 3NBAA 2OAGA 3OPQA 1AXEA 1EA5A 1YZKA 3PHBE 2XI4A 4MVJI 4O4HF 1VBFA 2OZLB 3DEHA 3N5KA 4ILKA 1AHIA 1IN6A 3K8OE 3LBHA 4R1UA 1LSUA 2O5RA 5HE8A 5IUJC 3MGBA 1DG3A 1QHYA 1M6HA 1EDDA 4TQAA 4CIBA 4B9AA 4M1QA 4EPRA 2PYIA 3T99A 3ZJ5A 1NFFA 4MOWA 1R10A 3QVTA 3UMVA 1VMIA 1VPLA 5COQA 2BGIA 3MJDA 3OWXA 3M33A 1V8ZA 2K5UA 4Y30A 2V6BA 3I09A 3JTMA 5LP1A 2E1PA 5DNCA 2QTVB 3O03A 5EJFA 2R8XA 2BFFA 3UA4A 3LXXA 4X1KB 3KFVA 1JSZA 1FFSA 1Q17A 2OOKA 1QO9A 3OJOA 1D04A 1SQSA 4PBSA 3CMCO 4N3BA 4LYYA 4F12A 1LWNA 3HTXA 1IUNA 3OP4A 1E1QA 4LC0A 1K8ZB 2JGRA 4FYXA 4YPFA 2AOWA 1S02A 4MV4A 4M8LA 4PF1A 2IZ6A 2XH8A 2DTEA 1X9GA 2Z5LA 4JNKA 2K4MA 5FR1A 3QXSA 2IL1A 4CIVA 4FC6A 1OXVA 1EH5A 1LNZA 4O2AB 1NY5A 2X14A 3PS9A 2NO0A 1NATA 2A88A 2Z30A 3KR1A 4IHQA 1H9CA 4EX7A 1K5DA 1N32B 1WHSB 5JJCA 4ZFNA 2A0KA 3BEDA 2HSGA 1MO3A 3B89A 2Q5JA 2XITA 2ZYGA 1ODIA 4LJLA 3PFGA 4N1AA 3A4VA 2FEWB 1CZOA 1N2IA 4PWZA 1BEEA 2BGKA 1VLJA 4FNGA 5I9NA 5M5BA 1G6KA 1B1AA 1PT8A 3A36A 4ZYVA 1QTNA 4HEJA 4RJKA 4FGZA 5M3BA 5JANA 3FMOB 1C8VB 2QXYA 3DBRB 3RVKA 1FVXA 2OZPA 2OC9A 2GEVA 3B9QA 3UYLA 3T7DA 2JW5A 4YIKA 1OWOA 3LPCA 2GKSA 1M6YA 3A04A 1NUTA 4GMDA 3NM6B 4DM3A 2WUGA 3EIOA 3PLRA 4CIXA 3DZIA 2UUPA 4MQLA 3SICE 1G2QA 1TM7E 2CC2A 4E30A 4IFTA 1E9BA 5C9ZA 2WWIA 4JR0A 3WIVA 1Q1BA 721PA 4X1KA 2ZRHA 4ENPA 5DBGA 4QJ3A 3QIAA 5EP4A 2XXAA 3LS2A 1N9KA 3GJQA 4DEVA 2I76A 2GTIA 3DJYA 5JNSA 4I99A 4G0PA 4NMHA 3C8UA 4A8PA 5E1MA 2PS0A 4HAUA 2YYZA 5KREA 5FNVF 1X2EA 2JFGA 4M9QA 5AHRA 1G0OA 3W0LB 4LCEA 4BFWA 2WWWA 1QIEA 1RI3A 4EJSB 1WHSA 5BSUA 1YKSA 1E5QA 4Y7CA 3ZV6A 1GUYA 3F3MA 2R4TA 2FZKA 4PCVA 1GKLA 3H5RA 3RJTA 3V80A 1L6IA 4S1WA 4TN5A 3JATA 2PMFA 1PX2A 3RGGA 2OK8A 1M73E 4V38A 4Q1DA 2HSDA 1NU6A 2BKAA 1KYIA 1JU3A 3O21A 4M86A 5FH9A 2B2XA 5CITA 4HQ0A 4I1SA 1OYWA 4QYMA 3E9NA 4IGAA 1DV2A 2F59A 4R83A 5JSQA 1KERA 2EJWA 2MSNA 2WHXA 3FZEA 5BV2P 4DV6B 1PFUA 2BHNA 3BXFA 5JSUA 4MVJD 4LDQA 2QUAA 1YS1X 3LUGA 1A8QA 1KO5A 4XQ9A 3RSGA 1G42A 2PFGA 4XYLA 1E2NA 1U7TA 1EVIA 3CNBA 4BOYA 4DRXB 1RC1A 3O1IC 3D4BA 1K4YA 3L43A 3PKIA 4WCFA 3QKRB 4YYEA 4IX9A 3T5GA 4G8BA 3DOIA 4J91A 3QVGB 5BQPA 2ZTHA 2WTBA 5KJEA 2B8TA 3ER6A 1CZRA 3EQ2A 4O4HA 4RDCA 4V0SA 4X90A 1JIUA 1XK6A 1YWGO 2NOAA 2ZBFA 3QNMA 3RC7A 4A0GA 3LY8A 4V0ME 4JITA 3I52A 4GOOD 2XZDA 3IAXA 3ONVA 2V0GA 2BM1A 3GLHB 3DHNA 3SPXA 1G4AE 1HSZA 1X0XA 2VXCA 3O1JC 1X1DA 4RVGA 1YB2A 3OIGA 3ZLTA 1TO2E 1XVAA 2Y99A 4FLEA 4FZVA 1UKZA 4PINA 3UQZA 4QKQA 4C2BA 3G0OA 1U3DA 4C76A 5LOVB 2HDNB 4L7VA 1Z5OA 1H2HA 2HTEA 2JIRA 3DMHA 1BYIA 4FU0A 3B6JA 4AF6A 2VPQA 2X5NA 2IHNA 1JJVA 1Z5UA 3BTSA 3IVXA 4MKZA 2PUFA 1QO0D 1FE8A 1IXRC 1NR7A 1UMCA 4RKWA 3M81A 3R0XA 5FEMA 1GKKA 3UWMA 4E51A 1JFSA 1MV5A 4M1YA 4OXXA 4IW3B 1ST2A 2JEOA 5E6UA 1XVUA 5KX5B 1X1TA 1P3DA 3KT3A 3PDWA 4RLHA 4WVLA 4V1CA 4MJ3A 2H1RA 2GEBA 5FBQB 2YL2A 3CR8A 3K8ZA 1OREA 2VCYA 4MJLA 1LK0A 5A0FA 2DPGA 3VR6A 3CH4B 4L75A 4BO6A 3BHMA 1B73A 1PWHA 1UJCA 2DUUA 4FC7A 4L6CA 2OCXA 1J00A 2ZE5A 3MBKA 3OTQA 4B9EA 4MV1A 2CVOA 4D4GA 2E87A 1FXSA 4UM9D 1EE2A 2Q6IA 1QHNA 2H4FA 1K7EB 3AUTA 2Q46A 4UTOA 1KVTA 4BJ3A 4E70A 3UO8B 2YFQA 4EGSA 2I7TA 4ZKDA 2J3EA 3JAMA 1XPRA 3ZDBA 4KYIB 1DUVG 2JCYA 3ETDA 3PQDA 2Q1WA 4KKVA 2R84A 3UB2A 5NULA 4YAJA 3UWKA 1Y3HA 3MFQA 3QJYA 3GYBA 3DQQA 3KS9A 1DBQA 4GO1A 1HQDA 4YRQA 3V4SA 2XOXA 2OZEA 4MUHA 1RRFA 5FUXA 4REQB 1P2VA 1JAXA 2X86A 3DB2A 2H9IA 2WIAA 5ESDA 5KOJA 2F43B 4M0KA 5IVKA 2A14A 5ICEA 2CD7A 3N1UA 3R44A 2HEGA 4CEIB 3UMBA 4YCSA 4M54A 4P7KA 1MX1A 2A8YA 4URYR 3T95A 4WBXC 4X1YA 3VPAA 3QWIA 5T4FA 4K6FA 4Z4CA 3BC1A 4DJJA 1X8JA 1YR1A 3TSAA 2Q45A 5FNVA 2C9YA 2J3HA 4P3XA 4TKLA 4NVRA 3H16A 4D8UA 1NW9B 3WMEA 1MABB 1XN4A 1FLVA 2HHLA 5C8ZA 3CLTD 4TYMA 3RC9A 3FMIA 1YA6A 3LQKA 1L7PA 1XQ1A 3SBXA 3T38A 4IXMA 3ZE7A 2NO5A 1IG0A 3QPBA 2PBFA 4HH3C 3D0OA 1T9CA 1MU0A 2CT8A 3LPDA 1H4SA 1DG9A 3G5TA 3I23A 5HIMA 5B7QA 4Z7QB 4GH5A 4QOHA 3O31A 1L5MA 3O8DA 4L16A 1AD2A 3ZJ4A 4DA8A 5K0BA 2QMQA 4HNHA 3F78A 2AVNA 3AI3A 3L7IA 1ND6A 1XK7A 3G6KA 4ZCMA 3K8QA 3R0VA 2HN9A 4RO0A 4ZICA 1E79D 5K0GA 1WCYA 1OH5A 2OV8A 4JOBA 4RANA 5JADA 3R76A 2JGLA 1Z8DA 1UKAA 2J67A 2WF6A 4IVQA 1T6ZA 4CDMA 2HCFA 1NUQA 1K6IA 1T9HA 2ASEA 3HV0A 4XDZA 4Y9DA 4FUTA 3KHTA 1HA3A 2EW1A 3QBTA 5IN4A 2BW0A 2GK4A 1J97A 4F92B 3VGPA 3FJ1A 2AZTA 3OKCA 4ZVUA 1G4UR 2I54A 2WTMA 5HF6A 3AJ9A 3RKRA 3TFQA 4AG5A 4ENWA 5LU9A 3MELA 1L8QA 4L2IA 2DWPA 3LUCA 3IV9A 5BV0A 2QUZA 1WZEA 2FWNA 2VDOB 3VPSA 3WYFA 3UUGA 2F6RA 2WYUA 3Q6MA 2VHVA 4EUNA 4F21A 3R20A 4HLDA 4ETNA 4M3NA 1OWPA 1YZUA 1E2DA 3E22B 1NDUA 2PKCA 4A6DA 1ADGA 1UMDB 2J4FA 5ADWA 4GKJB 4WXHA 2J0EA 1X7DA 2XUOA 4U3JA 4LCJA 2J0UA 2APJA 2G1UA 4LA4A 3KIPA 5CB0A 3IIMA 4YWHA 1IDN1 1QHEA 2C5AA 4OTZA 2DOKA 4BCDA 1Y7LA 1TI7A 4MINA 2QAJA 4I8IA 2N9UA 2PT7A 5CYFA 5JR3A 1ULSA 1GXSB 4NNJA 4B4KA 2GKGA 5B5SA 3ZXSA 3AVOA 1BZYA 5IWAB 4NESA 3VR5D 5FBVB 1WDMA 4W82A 2CJFA 5ULLA 5JPCA 4Q3BA 2XMZA 5FWDA 4DIKA 1VG0B 4JNCA 1L8AA 2WFAA 2ID4A 1RZVA 2XEXA 3ZW7A 1U7OA 3FVWA 3RUFA 4KFUA 2W43A 2IZOA 3RYHB 3PU6A 4B3GA 3IXMA 5IMBA 3JWPA 1II8A 2RHBA 2RK4A 1KRHA 1EFKA 2Q1XA 2CHVA 4YRKA 4DMKA 2NMVA 2D59A 3KUUA 4KWEA 2HF2A 3JQFA 4MJXA 3QWBA 2V5UA 2OYRA 3RS8A 4GZ5A 4H31A 4HMPA 4ZQHA 3W9SA 1DC8A 1KKMA 1E8MA 3FPFA 2I65A 2FFRA 2XMGA 3DTVB 2XQJA 3AM1A 3Q15C 4ARAA 5EIEA 2DZDA 1KVQA 3A2LA 3TR0A 4MIOA 2WWGA 2R8OA 3B3AA 3WLNA 5BT8A 1MC5A 5CNMA 3WMXA 3VBCA 4YV1A 1NUHA 2YZ7A 4MO2A 4R71A 2B94A 4I81A 2HNAA 5JE8A 4DLZA 1DC7A 1P81A 4Z9FA 1EFRA 1H23A 1PDVA 3QM1A 4IINA 2AN3A 4KNVA 3O6VA 4X63A 3P5BA 1N2CA 5K3FB 1YQUA 2D06A 5IP5A 3GY0A 3B3QA 3MUNA 1ULZA 4CKEA 2EARA 4OHUA 5KQLA 3CW2A 1F38A 1EZZA 3TGPA 2NN3C 2D1QA 2FZEA 3BGOS 4FEAA 3DTTA 4QHYA 3ZU6A 4PZLA 4E7PA 4EO7A 4OHXA 1RWBA 3N7AA 2GTPA 3AG5A 3T94A 4U7GA 2A9KA 4CL0A 1STOA 1HXHA 1XMVA 3VNSA 3HJFA 3GLHE 2CDRA 1KJIA 3MXOA 4LZLA 5ALVA 1KFJB 5HG0A 2WLTA 4CM7A 1GNQA 1TU3A 3CTMA 1SQ5A 4MPDA 4N3GA 2WTUA 2V4UA 3FSRA 4M0EA 3RVNA 1L8XA 4UDYX 4KZKA 4H1TA 4QFBA 1W88A 1WSAA 2WHPA 2YZ2A 3BB1A 2J6CA 1T4CB 4KAJA 4MPTA 2X19A 3DTVA 3ZHSA 1PSWA 1HDCA 5BV7A 2EFDB 2ANCA 2QTGA 3PCRB 5HIAA 2Q5HA 4QGHA 5IS2A 5E9AA 2FJPA 1YL5A 2IDMA 2B2CA 3L7AA 1ELOA 3OF5A 3MA0A 1TKCA 1BMFD 3ND5A 4YCMA 1Y1LA 4BQNA 1QYDA 2OHJA 1QZZA 3S2GA 1ZC4A 4M0MA 4IFEA 2N75A 2WM3A 1R18A 2YQ4A 1T1IA 1A1SA 4EELA 5JMWA 3TLZA 3WLQA 1ZH6A 1DC4A 4RORA 2WMDA 1MXHA 3AUXA 3DMFA 3AUKA 4FONA 1THMA 4PPNA 4RZQA 121PA 4OF4A 2QZPA 3CF0A 2BTQA 1FNMA 1V35A 1O5OA 1IFXA 1ZJ4A 2FSUA 2NLOA 3D3JA 5KWIA 4UXHA 3UMRA 1DIHA 2QE6A 5D84A 3R3UA 1PJSA 1B0AA 4QJ5A 5CVCA 4IGEA 3CB4A 4Q7EA 3S7TA 5LKAA 4MXDA 4GR9A 1HEIA 4Y7DA 3TLGA 1E1KA 1D2EA 4GUDA 3QKTA 3TOSA 3I2KA 3QHQA 5T4EA 5KPDA 2EGHA 3OM1A 4X93A 1JDPA 1P9NA 1T4CA 1TDJA 3BXEA 4MR8A 1ZMBA 4G1CA 4MV0A 3ILVA 2QRVA 3ND9A 1JDNA 2FQ1A 5DGTA 3RSZA 4HAVA 5CGQB 5B57C 5JPDA 1RJEA 1TXGA 1FTGA 2IXFA 1J1ZA 2JF0A 1PWYE 4O1IA 2Q3DA 1VSQA 1JBEA 3FR8A 4OFXA 5DNVA 1GCIA 4IJ5A 2JBAA 4ADSG 5C51B 4YRRA 1CJKC 5CMLA 1M34B 1CQIA 3I0MA 3DDWA 2DR0A 4OOEA 3TCXB 2QRPA 5HS4A 3KOZA 3ZXXA 4UD2A 2X0NA 4M49A 2BLLA 4NS4A 1T0BA 4ZGWA 4GQIA 3MB8A 2BV3A 2KSQA 1W4ZA 5HE9A 3QVUA 1RXWA 3L8GA 3S1SA 3AP1A 2O2DA 2PNFA 3VUEA 1TX4B 2VH1A 2VF7A 1KIAA 4K1LA 1ZOSA 2BF7A 1ZD9A 3LC7O 3N8IA 4R7TA 3H75A 1ZN8A 1XA3A 2G28A 3E9MA 3OLXA 4AMYA 4F0JA 3C0KA 5CGZA 4GS5A 1PZEA 4I9FA 4OAQA 3S44A 3H04A 1VBNA 4IG4A 4LXTA 3CXRA 4JLAA 3QF4B 4Q9LA 2QGNA 3IESA 5EOVA 4BMCA 1OBFO 2OXRA 2WYIA 3LZDA 3TTUA 2H48A 3G8AA 4UUQA 5IH3A 3C3DA 5DGIA 1QYCA 3ZDCA 3CY6A 2HDWA 2H00A 1XA0A 3HL0A 3M4ZA 1FYEA 2ZROA 5BQOA 2MR5A 2ZIWB 3AZPA 3PBKA 1Q0ZA 1Y3FE 3UENA 2ATEA 1DMRA 2RGCA 2NZUG 5AKXA 5HJ2A 1DAPA 3WKEA 4PYLA 5KC8A 2CY0A 4NTZA 1IXZA 2I6FA 3IAAA 4AT1A 3IL2A 1JR3E 1C41A 1BJTA 1IVNA 1TK2A 1WVGA 4I1IA 2H1HA 1ZUHA 3ITNA 4Y98A 3NJ8A 3ICCA 1THTA 4RHFA 1SCJA 3GPCA 1CUCA 2AG8A 3UJPA 2NUPB 4G0NA 5LP6F 3COSA 3OQIA 2AG5A 3S29A 2YY7A 4LF8B 3C3EA 4DUGD 3ULKA 2VQ3A 1CUFA 1X42A 2MJLA 2Z3WA 1K1EA 2PUJA 4FGJA 1W1UA 4ZRMA 1RWWA 1J8MF 1MIHA 5LFAA 2EP5A 2F1HA 1G5QA 1ZP6A 2H2AA 1F8XA 1H1TA 3HU5A 3NBUA 5K0TA 1A7AA 3W77A 4DA0A 1HTWA 3QF4A 2SKEA 5SYMA 2ID7A 4NYMR 5ENZA 4F3KA 2F7SA 1Z25A 4R9RA 5DTRA 5CA1F 2GAOA 4DHWA 3QUQA 4LTMA 4P34A 4CKWA 1NM5A 2M98A 1HLFA 3E3NA 1RAGA 4QC2A 1BCSA 3LFTA 1MQSA 3YASA 4ITRC 3KJEA 1W96A 4D98A 4Y2YA 3L7JA 5JU6A 1CY0A 3RWMB 2XD4A 1ISSA 4KC0A 3ETCA 3U0BA 4C3VA 4TRRA 4TSFD 3OZCA 4AX4A 2JLYA 3LC0A 3A7EA 1KDOA 3N2ZB 1ZIOA 4HWGA 4Q9AA 1HQCA 2CW5A 1T1SA 1SBYA 4BBZA 4PIVA 2H31A 3QPUA 3BM5A 3UK1A 1A8IA 1GRVA 2YJTD 3QXCA 3DBHB 5J1TB 3RU7A 1GPJA 4AWXA 1SNYA 4OYHA 3A1NA 2YXEA 3FR7A 1TUGA 3LY5A 1HV8A 1M8JA 1XU4A 1GG9A