1P77A

Crystal structure of shikimate dehydrogenase (aroe) from haemophilus influenzae
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
265
Chain Sequence
MDLYAVWGNPIAQSKSPLIQNKLAAQTHQTMEYIAKLGDLDAFEQQLLAFFEEGAKGCNITSPFKERAYQLADEYSQRAKLAEACNTLKKLDDGKLYADNTDGIGLVTDLQRLNWLRPNQHVLILGAGGATKGVLLPLLQAQQNIVLANRTFSKTKELAERFQPYGNIQAVSMDSIPLQTYDLVINATSASVDAEILKLGSAFYDMQYAKGTDTPFIALCKSLGLTNVSDGFGMLVAQAAHSFHLWRGVMPDFVSVYEQLKKAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of shikimate dehydrogenase (AroE) reveals a unique NADPH binding mode
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
molecule keywords Shikimate 5-dehydrogenase
total genus 98
structure length 265
sequence length 272
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1p77A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1p77A01
3B1JA 1JLLA 3ZZNA 4ZVVA 3CINA 1DIAA 1K2WA 3E9NA 2GUGA 1EVZA 2PR2A 3KETA 4RPKA 1EE9A 1JA9A 4GL4A 1MX3A 4BVAA 3R0IA 3JQ7A 4A27A 4R3NA 2FP4A 3WQQA 4ALNA 4JJIA 4YAKA 2R00A 1BXZA 3GG9A 5BSGA 5C37A 5JMWA 1PU2A 1U5CA 2DLDA 5C5IA 1MLDA 1X0VA 1DC5A 3DR3A 2AA3A 3D1LA 1NFFA 4S3MA 1VE9A 1N1EA 2X22A 3JQ9C 3FD8A 4M55A 5B1YA 1XGKA 5A02A 5T6BA 1D7OA 1Y9AA 1FDVA 2DPGA 4KP7A 3TFOA 1ZW1A 1ZJYA 1DLIA 4J4TA 5KKAA 3NYWA 2HUNA 4KZPA 1DFHA 1DC6A 4PRKA 1JKIA 1ADGA 1WP4A 3G1UA 1AN9A 2PA3A 4EDFA 5JDIC 3I9JA 2ZQZA 4ZN6A 3GFGA 1BHSA 4BO3A 4J7CA 4LN1A 2AHRA 3L6EA 1SNYA 2QYTA 3BMCB 3V2GA 3GNTA 2B4QA 1BXKA 4W7HA 3PHHA 3CEAA 2Y0EA 3AOGA 1DC3A 3HE3A 3ZNPA 1XKQA 3LC1O 1M6WA 2DU8A 5JMPA 2D5CA 4R5MA 1LXCA 2X0JA 2I3GA 1AHHA 3GK3A 1Q7CA 2YV2A 3TWOA 3OA0A 2FPPA 2BFMA 3DOJA 1XHLA 3ZH2A 2EGHA 5BT9A 3Q9UA 2W98A 3LDHA 3NKLA 1YB1A 2PK3A 1P1RA 3O4RA 2GO1A 3ITKA 4KUEA 5TT1A 3GR6A 3UVEA 2JHFA 1UXHA 1GYRA 3RQSA 3X2EA 2C0CA 5C3MA 3ZWYA 4R1NA 3ROMA 2FR8A 3KB6A 4NFHA 4AJIA 4J3FA 1GUFA 4D45A 5JO9A 1I3NA 2BF7A 5THKA 1ZJZA 3INTA 3JQFC 1HDRA 1T2AA 5IZCC 4O6VA 4UVIA 5IAAA 3VH4A 1AUPA 3ANLA 3KYDA 3HFGA 2B36A 2DFVA 4R3WA 3LF1A 5TJHA 1ISMA 1QMGA 3EHEA 4R1UA 3CZMA 2I9PA 3HADA 3JD0A 1DAOA 3JD4A 3NTRA 3N7UA 3ONFA 4RPLA 5KJEA 1NVGA 1T1SA 4M49A 3JQ6A 4GWGA 3WWZA 2FRDA 4BGIA 2P9GA 5BNFA 4P4LA 5A4DA 1EBFA 4YJHA 4CLRA 4IDCA 4DLLA 3TF5A 1GPJA 1Z73A 2VYVD 1HDGO 3K31A 2Y67A 1HSOA 1U7HA 2VYNA 3KV3O 4RPHA 2CSUA 3L6DA 4BNGA 5L53A 2O3SA 4N5NA 4FOOA 1K3TA 4XRGA 3KYCB 1KY5A 5DULA 1EUCA 2AQ8A 2J3JA 1LLUA 4DMLA 2RCYA 4QX6A 1LTHR 3L4BC 5JSFA 3SVTA 2DUUA 1N9GA 1PS0A 1GD1O 3Q1LA 4AVYA 3DONA 1W0CA 1IY8A 1R0KA 3CMMA 3RUFA 3UAGA 4CM7A 1GQQA 1DRWA 4H3VA 2B4TO 1JU9A 2D8AA 4R1TA 2PH5A 3DWFA 2HK8A 2D4AA 1ZVMA 4PGFA 3C1TA 1B0AA 2B69A 5TJ9A 4CM8B 1ISHA 3N58A 5EERA 3GVXA 4MVJM 4JIGA 3FI9A 1I36A 3KXDA 3NX4A 4OHUA 4W9NA 4Y98A 3SBOA 3VPHA 1RM0A 5I9MA 1IL0A 1GADO 2RBEA 3BMCA 5CDSA 5T64A 5EINA 1U3VA 4AJOA 2G1UA 1GPDG 3A9WA 4BMSA 1P3DA 5LDGA 3WXBA 1YS4A 2QHXA 4UUNA 1SEPA 1QORA 1E7QA 1JTVA 2YDYA 4QO7A 4AJKA 1SZJG 4NBTA 2E37A 4RVUA 5JCJD 1KEWA 4N54A 2V6BA 1HETA 4S1VA 1T2DA 1ZCJA 4ZRNA 1Y81A 1H2BA 1XWFA 3ETDA 1T2FA 5FF9A 3T7EA 2CUKA 2GNAA 3I52A 4I5DA 1B8VA 4JROA 1V3VA 1Q7BA 1ULSA 4MJLA 5ILGA 3FTPA 3VAZA 1O6ZA 3RUHA 2VNAA 5A04A 1BSVA 4DA9A 4JBGA 1LSJA 4D79A 1FDTA 5GMOA 4PN3A 2BHLA 4RORA 3L77A 1PGOA 5F3RA 1NVTA 2O23A 1KYQA 4U6SA 2C20A 2AEMA 1IHYA 1T2EA 1WXDA 3D64A 4NK5A 3VZSA 1MV8A 5EL0A 1EBUA 1NP3A 3GGPA 3PWKA 4IQ8A 4TQGA 1WNTA 4GH5A 2WE7A 1XQ1A 3U49A 3AWDA 2GR9A 3C7CB 1KC1A 2YY7A 3GQVA 2WTBA 4GX1A 4LISA 1YONA 4FOSA 4J2OA 1N7HA 1C0IA 3DBRB 4B8WA 3GHYA 5T5QA 1C0LA 2Q4EA 3PRJA 4QO8A 3ZV6A 4M86A 4YT5A 2HLPA 4CM1A 1R4NB 3UCFA 1WVGA 4IIUA 4B3IA 3GPIA 4RF3A 3WGGA 2X0NA 5DF1A 4XR4A 3MOIA 4MVJP 2IE0A 2E82A 1HEUA 2DTXA 3HJAA 3VH2A 5CDUA 8LDHA 5JS6A 3D3EA 4ND4A 1PGJA 1EDOA 3RU7A 4CM6A 4GMGA 1QKIA 3AUSA 1L1FA 3OIGA 3QVWA 1GDHA 5FEUA 3C7AA 5T8KA 4BNFA 1DDOA 1PL6A 1E6WA 2GN4A 3MEQA 4CLOB 5JW6A 5HWSA 4BO8A 3TPCA 5TT0A 3GA0A 4O59O 1HLPA 2CVZA 4D41A 3VPSA 4I5FA 1IE3A 2VWGA 4I9UA 1JW9B 3Q9NA 3ZV3A 2GF2A 1NQ5A 1WDMA 2EWMA 2TMGA 2VYVA 3CTMA 3P2YA 3PYXA 5JC1A 3IUPA 5G0VA 1EDZA 1GR0A 1U3TA 3IDSA 4LRTB 4PG7A 5MDHA 2C82A 2IRWA 1Z7BA 5B4VA 4U6QA 4WECA 4CM3A 4QQRA 7MDHA 4YA6A 1ZZEA 4HKTA 3QHAA 4ALIA 4XB2A 4L4SA 3C24A 3A1NA 2OHXA 4PFJA 1GUYA 2XPCA 1KOLA 4ND5A 1Z74A 3K2EA 4OXNA 1N9GB 3DZBA 3NDIA 4RVSA 4WCFC 4ZU3A 2WWRA 1KIFA 1P1JA 1MFZA 1IUKA 1NNUA 4Q3DA 4UUPA 4FCCA 1QRRA 4XQGA 1I3KA 4CLHA 2FR0A 4J91A 1HE4A 2OZPA 1U3WA 3PLNA 4TSKA 2I67A 4MIYA 1E77A 1P45A 1D1SA 1ISJA 3OMLA 4M89A 4BO0A 3SX2A 1H2HA 4BNZA 1YO6A 4BMNA 3D7LA 2B83A 3VH3A 4U5QA 3PLRA 4TRJA 1M6HA 3E1KA 3DTTA 4OXKA 4P8RA 3E9MA 1BVUA 2NTJA 5JNLA 4Q3NA 4EEZA 1GUZA 3K8ZA 1C1XA 1DIBA 1T2CA 1YJ8A 4R54A 4BGEA 3RBXA 1ISIA 1E6EA 5IZ4A 4TKMA 1BW9A 1SCUA 1EQ2A 1ZMOA 3DAPA 1WDKA 4I08A 4BO7A 5L9AA 3NT2A 4XEHA 1A4UA 1X0XA 3WGIA 2Z1MA 3PJDA 4W99A 4R68A 3B70A 4KDFA 1AXGA 3RKUA 5A06A 5L7TA 5AVOA 1WZEA 2VZ9A 1ZXLA 2J5QA 4G65A 5JC8A 3FTNA 3BMNA 3M2PA 4U0JA 1DAPA 5JDIA 3O38A 2VHVA 1Y5MA 5IN4A 4DLBA 1IPFA 1ZO8A 4ZQEA 1BWSA 3WIDA 4IDGA 3ZWBA 2YHIB 4E4YA 1PR3A 1P1FA 1VJ1A 1V6AA 1WAMA 3KSZO 5KJ1A 3UUWA 1R4MA 1O89A 5A9SB 3SJUA 1ZSVA 1LRLA 1N1GA 4R01A 1E7SA 5DP1A 3BHJA 3PP8A 3QWHA 1O9BA 5KKCA 1BGVA 3H9EO 1MC4A 1YRLA 5COBA 3TZ6A 4BO9A 4HV4A 1PGNA 2DQ4A 3R3SA 2C54A 3PK0A 4ROSA 4TRNA 1O95A 4BNKA 1ZBQA 4XGNA 4CR6A 4PG8A 4RQTA 3UH1A 1EFKA 2VT3A 3ETEA 4JK3A 3P7MA 4J16A 1HKUA 4CMBA 3E03A 5G2OA 2EKPA 1WLYA 4GSKA 4WOKA 5B4TA 2VWQA 4Z9YA 1KVRA 3IOYA 4CMCA 1G1AA 2ZQYA 3QWIA 2HDHA 4P4NA 1UDBA 1BDMA 2X0RA 3ZU3A 4NBVA 3VHRA 1K6JA 4R9SA 2ZB8A 2PTGA 3ZWMA 2RH8A 4JP3A 4FS3A 1T4DA 4ZD6A 1I5RA 4E5PA 2IODA 2C59A 4XQCA 4GPD1 3NDJA 4XB1A 4BNTA 2G76A 1XCBA 3P19A 4DQXA 3G1TA 1CRWG 3NUGA 5HTOA 3FNFA 4UVDA 1T4BA 5ITWA 5L7WA 4QT0A 1LA2A 2BH9A 2DUWA 4LRSB 5G4LA 4MVJE 4FFRA 3ZU5A 1FDSA 4KOAA 5JCXA 4OL9A 3FPLA 1OMOA 1CWUA 5AXBA 4D0RA 1D4FA 1YBVA 4NK4A 3CZRA 3OIDA 2FZEA 4DPLA 4GI2A 4WLUA 1VSVA 2EF1A 4AJLA 3KYDB 1Q2XA 1HYHA 4XA8A 2NU9A 3I5MA 1OC4A 5EMHA 2EP7A 5HM8A 4A26A 3STHA 1D1TA 2Y1FA 4TKLA 3GDGA 5I7SA 2OGUA 4R51A 5F1KA 3AOEC 3UFXA 1UZLA 4XJSA 5G4KA 3QWBA 4GQAA 4PG6A 2PY6A 4PLPA 5EJ2A 3WX0A 4ITUA 4Q3CA 1Y8RB 4RVGA 2X5JO 5DOVA 5J23A 3E18A 1H0KA 3OIFA 4XZ3A 1IPEA 1ARZA 2IXBA 3IC5A 1ZK1A 3N74A 1IULA 4N18A 5ICSA 3IKVA 3FNHA 5KTKA 3DMTC 5JE8A 3MWEB 1Y8QB 2VUTA 5KJ6A 1JVSA 2QZZA 5JY6A 1JWBB 2WSBA 1F0YA 4BGUA 3I9NA 4GAEA 5CHEA 1MUUA 4BNLA 3TZKA 2CY0A 1ENOA 1X15A 2X8LA 4BO5A 2EGGA 3E6AA 3BAZA 3OJEA 1A7AA 1DBVO 1MXFA 2TMDA 1GZ6A 3RI3A 5DN9A 4HWKA 5CDYA 5ES3A 5IJZA 4CLEA 4CQLA 3VTFA 4GLOA 2NU8A 2O3QA 2O3RA 4E12A 2PZMA 1GZ3A 3WYCA 2RHCA 4LGVA 4YCAA 2PZJA 4YJGA 5A03A 2H5LA 2HMUA 1MP0A 2GZ2A 3IQDB 3TOXA 4KUGA 1L7DA 2XXJA 1JN0A 4L8VA 1MB4A 1F17A 4G2NA 4DIFA 1O8CA 4CM5A 5BNTA 1PJ3A 4DYVA 4UUMA 1A9YA 3QWFA 4N7RA 5G4KB 1NR1A 3HQ4O 5DDIP 5JYEA 3HDQA 4Q3BA 2CVOA 3ROKA 4CM9A 4DQVA 1NASA 1U2GA 4MKXA 4LCEA 3PDUA 2A9FA 1DXYA 1BG6A 4RPGA 2H63A 1PJ2A 1PJLA 2EW8A 4HNHA 3TSCA 4BB6A 1DFIA 3VVBA 3I23A 1X1EA 3K96A 2GN9A 3VVCA 4DMMA 5GZ1A 1PJCA 2Q2VA 4GKBA 3WIEA 5T57A 4ZQBA 3RFXA 4WOJA 2DBZA 3H4VA 2AQIA 3HDHA 3K5PA 1OAAA 3PQFA 1ZK2A 3U4DA 4CMKA 4EJMA 1LC3A 2WYUA 4Q3AA 4CJXA 1P77A 5AXDA 1I01A 2C5AA 2Q4BA 1TVEA 3BMOB 2Y05A 1MFPA 3DB2A 2O3TA 3W4KA 4D0SA 5KVCA 3GEGA 2W2KA 5F5LA 3WLEA 1WWKA 2FZWA 1EK5A 2YV1A 3Q2KA 3ZU4A 5JAZA 3NTQA 4J49A 5TGDA 2RIRA 3F6YA 1W8DA 4KMSA 1EEHA 2HMVA 3GF4A 4GLLA 2AE2A 1U8XX 1CQJA 4BNIA 2Y0DA 2BGMA 3FF4A 2FN7A 3JQGA 4XCVA 2QRLA 4WCDA 1JWAB 4ONEA 1KVTA 4BO6A 4NU5A 2NWQA 1VSUA 1PQWA 1LNQA 2GZ3A 4ZQHA 3BMQA 2YJZA 1RM5A 3O9ZA 5H82A 5U9CA 2ZB3A 3W8EA 3ZWOA 5MGBA 2WJPA 4TZKA 4CUZA 3O03A 2BI7A 2EEZA 2DVMA 4LCJA 1M2WA 2YYYA 3WLFA 3GEDA 3MJTA 5A9RA 4BQPA 3RBVA 2HKIA 3BMQB 5A05A 4PCVA 1A4IA 1W6UA 3JSAA 4H7PA 4YWJA 1VL6A 4RQUA 5JAMA 1Y5RA 2FPGA 2V6MA 4Z3DA 2DKNA 1OFGA 1GYQA 2ZTMA 2EW2A 1ZSNA 2ZTVA 1NM5A 3P5SA 1A5ZA 3L4BA 5A5FA 3RC1A 5IDXA 4BNHA 3AK4A 1EFLA 1H6CA 3H2SA 5B37A 1X1TA 3PIIA 5G0SA 4BKRA 4XYBA 3RJ5A 1UXGA 3H5AA 1HZJA 4W9NC 1WPQA 3INGA 5DCUA 1Q1NA 4PRLA 1PWZA 2YDXA 3C85A 5F5NA 2O2SA 4E2ZA 1DFGA 1I10A 2CF5A 2WMDA 4J2HA 4NU6A 1V3UA 4BNYA 3HN7A 3KZVA 1KVQA 1Z82A 2C2YA 4MVJH 4IJKA 1WW8A 5G0UA 3RC7A 3GVHA 3LT2A 4OKNA 1U28A 4Y9DA 2C2XA 2CD9A 4AJ1A 3WOHA 3HUDA 1RJWA 2I5PO 3LSYA 2DBVO 4L4RA 4XGIA 5JXWA 2C7VA 1X7DA 2NU7A 1R37A 1W73A 3KEQA 2PGDA 1UP6A 1NWHA 4IZHA 3BYZA 3PJEA 4MVJF 4F3YA 2JHGA 4WLFA 1EUZA 4RZHA 5IG2A 2F00A 4UEOA 3H9GA 3W8FA 3WJ7A 2IXAA 1P1IA 2CDBA 4HFJA 4B4UA 3G17A 4A5OA 5C7IO 1LSOA 3V2HA 1FF9A 4EBFA 2GLXA 4R9RA 4BNWA 3OJOA 3PGXA 3WGZA 1OC2A 2HRZA 3BZUA 3QA9A 4PLCA 4DC0A 1HZZA 1EK6A 2NV6A 4CQMD 2B4RO 1YXMA 4CV0A 4C4OA 3O26A 2CNBA 1U5AA 3FBGA 3T4XA 2BFPA 2ZK7A 2IYPA 3DBHA 4JJFA 1GL3A 4Q39A 3AJRA 4TWRA 4U7WA 4MPDA 4XIJA 5TSDA 1C0KA 4MIEA 4OJNA 2EV9A 3U62A 3IL2A 2UYYA 4IQ0A 5F21A 3W6ZA 4EZBA 1ZKMA 3LC7O 4HFRA 1Q0QA 3IUSA 3L4SO 4K6CA 3JTMA 4U0KA 4C7JA 2ZB7A 3OICA 2X5OA 3C8MA 5KIAA 4E2XA 4WEQA 1PJ4A 4IPTA 4IXWA 1E7YA 3R3JA 3EC7A 3U4HA 4EITA 3TN7A 4URFA 2ZCUA 4E5YA 1NBOA 4K1LA 2YHIA 4E5NA 4MVJA 1QG6A 2BKAA 5ADHA 3ICCA 2QYSA 4JBHA 4FJ0A 4LVCA 4D3SA 2O4UX 5IDWA 1HE5A 4BQRA 5TF4A 3TJRA 2JL1A 4K6FA 4FSHA 1ISGA 1RPNA 3BTVA 2RAFA 4FQ8A 1AXEA 1ONPA 4BNXA 3RIHA 3DHEA 3SEFA 2NVUA 3GLQA 1R16A 2AG8A 2IEBA 3LT4A 2PKQO 4BKUA 2BMAA 2FPIA 3KSDO 4CMGA 5DCYA 1R0LA 4PLGA 4L9RA 4FBGA 1T25A 4O0LA 2P2SA 3CIFA 5ILOA 3ASVA 1KBZA 1LQTA 3PI7A 2X9VA 1VPDA 1HDZA 2UUPA 2W2LA 1P33A 3OF2A 3OQ1A 4FFPA 4ZRMA 4TROA 2AEJA 4K9DA 3MJCA 4XQEA 3I9KA 3AM5A 2HSDA 1PQUA 1TA4A 1KVUA 1ZNQO 5BSHA 5HRUA 2WD7B 3ASUA 4U8GA 5GZ3A 2FWMX 4WLNA 4DYDA 4C7KA 3IKTA 4DBVO 2Q45A 3AUUA 1VL0A 4B3HA 3GGGA 3EAGA 4B4OA 4OKIA 2FMUA 4TRMA 1NHGA 5BNIA 1F8FA 1FDUA 3MCVA 1WDLA 4NJMB 3ST7A 2AXQA 4NR0A 4JNKA 2EJVA 5EIOA 5I7FA 3K92A 4YR9A 4DC1A 4XWYA 4RV9A 1PZHA 3QIVA 4BV8A 5B12A 2EP5A 3DTYA 3DL2A 3QSGA 4FFOA 1QV6A 1U3UA 1X7GA 4YDRA 1Y1PA 2CMDA 3PZBA 4JCOA 2J6IA 4YQYA 4CLOA 3S1LA 1JKJA 2J5KA 4HADA 4BO4A 4UVEA 2I65A 3ADPA 4II2A 2RH4A 1WZIA 2FHSA 3D4PA 1U8FO 5CPFA 1ZSYA 3QVOA 3TL2A 3GNQA 2J3KA 3OETA 1LLQA 2O48X 3I83A 5KOIA 1I3MA 2PD3A 2WM3A 3M1AA 2J3IA 4B4WA 3CMCO 3ZWWA 3W6UA 2PZKA 4PVDA 4E21A 1ZUD1 3HB4X 4IINA 3WQRA 2WYVA 4W6ZA 3JQBA 3GMDA 1LSSA 3ROQA 2X0IA 3ZHBA 4MP6A 3G0OA 1B2LA 2DPHA 1TB4A 1HDYA 3V1YA 4IM7A 5CPBA 1H6BA 3KO8A 4PLYA 4RVFA 2YQ5A 1DOHA 2WDZA 4K26A 4BB5A 1CEQA 1NQTA 1R4NA 2X5KO 4NBWA 1ADBA 3KYCA 1B15A 4J0EA 5ICMA 1FK8A 1YBAA 2I76A 4Y6PA 1E0DA 2IYOA 2R6JA 3V8BA 1U1IA 2OUIA 3JQAA 4NBUA 5COAA 4EW6A 3WB9A 5A3JA 2EIHA 4EJ0A 1H6AA 3LK7A 3LLSA 2GPTA 1ENYA 4E30A 1VM6A 4FDAA 4KTVE 5CAEA 3DZIA 4UAGA 3EMKA 5FYDA 5CG1A 4J9UE 2QW8A 1DPGA 4WEOA 3WS7A 3AI1A 2BI8A 3F5QA 3JCZA 1U9JA 4J1QA 1K89A 1RM3A 2JJYA 3ONEA 1E1NA 1PX0A 4PZEA 3VH1A 4A73A 5LDHA 4CODB 2ZB4A 3GVPA 4NNJA 2EKLA 1TT7A 3A28A 1C14A 1QYXA 1NWCA 4OIMA 3RC9A 4BNVA 3E82A 5THQA 1E3LA 4L75A 3IJPA 3RAJA 1SB9A 3DZGA 5CDGA 4XYEA 2Y1EA 2B5WA 4W82A 1YH3A 1Z45A 1ADCA 1I8TA 4ND1A 3D4OA 3FCOA 4J1NA 4YAEA 5BSEA 5COQA 3VZQA 4EUEA 2ZYDA 1A7KA 3WWYA 1MC5A 1SB8A 1GV0A 4BKOA 1R15A 3W8DA 3V2UA 3F5SA 3DHNA 3K6JA 1YDEA 1E5LA 2P9EA 2GD1O 3AM4A 4PLTA 3UCXA 1LJ8A 4BS9A 2UVDA 4BKPA 3BMOA 3MOGA 1YL7A 4YRBA 2C07A 4I9HA 3RSHA 5I7VA 1L7EA 5HS6A 4GKVA 4FW8A 3CSDA 5C7LO 3O8QA 3E48A 4FGWA 5CFZA 3DHYA 2IDZA 3L9WA 3DMYA 1EMDA 4CMAA 4M87A 1LDBA 4Z0HO 4GMFA 3WMWA 4XRRA 1XA0A 5KVSA 4YJGB 2WD7A 3Q6IA 3H2ZA 5JDCC 4DL9A 3QVTA 4M54A 1VJTA 1XDWA 4PIVA 1J4AA 3UOGA 1Z75A 5FWNA 1GZ4A 3PQDA 4YB8A 3M2TA 5TIIA 4MKZA 4GGOA 4IGEA 4DBZA 1BXGB 1UP4A 4E32A 3WJAA 3PJFA 1UXJA 3D4NA 4PG5A 3BA1A 5TNXA 1VRWA 2W2LD 2OO5A 3SC6A 1IB6A 1OBFO 1UR5A 4L73A 5TX7A 5HBRA 3INRA 3T7CA 1VC2A 1NXQA 3TNLA 3PXXA 1HDOA 4KQWA 4QSMA 4QXMA 3UN1A 3D5TA 2AW5A 3IS3A 1EVIA 4EYEA 3DAFA 2XF8A 7ADHA 4Z9XA 5DNAA 2Q3EA 4YACA 1M76A 4I5EA 4EEXA 1NPDA 2UAGA 3AU9A 2LDBA 2V7PA 3F4BA 3GZ4A 1ZMTA 3FHLA 2Y1CA 3I3OA 1MG0A 4L74A 4IXTA 1KVSA 2EHDA 4J9VA 3AU8A 1CYDA 4JP2A 2OXIA 4RPJA 4ALKA 4I1IA 3AFNA 2E6UX 2Q2WA 4YJFB 4UREA 3OJLA 5EN4A 1C0PA 4M1QA 2A4KA 3LT0A 4CMEA 4GX0A 4HNGA 2E49A 4YAJA 5CDTA 1S6YA 1R12A 3K73O 2BGLA 3HB5X 3H9JA 5F1OA 4OO3A 4QECA 3NRCA 3OQBA 1TT5A 2OL4A 2YW9A 3NEPX 2CDAA 4FFMA 4ZQFA 1K6XA 3DZKA 1M66A 1DRVA 4MP3A 3U5TA 4RJTA 2GGSA 4DPKA 1NHWA 4GSLA 2NQ8A 4NZ9A 5L51A 2ZATA 3RUCA 3TZHA 5JDCA 4RF4A 2VHYA 1B14A 3VTZA 1Q0HA 3ABIA 1QXSA 4CMIB 3L0DA 2I66A 1ONNA 5IN5A 1U4OA 1H93A 4CR7A 4INAA 5JPIA 3UF0A 2Y99A 3DBRA 4J1SA 2YHUA 2OORA 2W4QA 5IDYA 3TFQA 3H9UA 4QTZA 1PS9A 3DFZA 2D0IA 5FFFA 1C1DA 3EW7A 3GN2A 4EUHA 1HWYA 5KWEA 3RD5A 4WNIA 3IP3A 4AJPA 3EZLA 2VRCD 3JQGB 2ZIZA 4AJHA 3H65A 4PZCA 2Q1TA 5CEEA 4OYRA 3NGLA 2R00C 2JCVA 2NQTA 4B8ZA 3KVOA 4KQXA 5DT9A 4YTEA 3WYBA 3E5RA 5TC4A 4BNMA 3GOHA 5L95A 1TLTA 3C1OA 4IY1A 3JQAD 3QLJA 4IGFA 1MG5A 4I9NA 1U7TA 1BTOA 2B37A 1UXKA 1T26A 1PJQA 2JD1A 3BXXA 1FMCA 3F1LA 2FSSA 5I8WA 4H15A 4NQZA 2OBYA 4WUVA 2P91A 2ZTLA 3V1TC 1GV1A 2V65A 3C7DB 5H83A 1VJ0A 4RDIA 2YFQA 3GDFA 3OA2A 1YB4A 2P9CA 1XSEA 1SBYA 3U9LA 4J0FA 1P9LA 1GYPA 4MO2A 2FY8A 3BIOA 1HYEA 2CDCA 1MGOA 2EJWA 2HMWA 3M6IA 1B26A 1IHXA 1PGPA 2X7HA 1I33A 4J7UA 2O3JA 1DIRA 4Q3EA 2PFGA 4G81A 2Q2QA 3DQPA 3LC2O 2GSDA 3SC4A 1M67A 1XQ6A 1QR6A 3GN1A 3OSUA 3FPCA 2CF6A 4PLFA 2VYND 4YBZA 4YEDA 2W2KB 5HS4A 1QYVA 5A9TA 1P74A 5JAIA 2H9IA 2HRBA 2HU2A 3IJRA 4NH4A 3QJ5A 1GFSA 3A06A 4TMFA 2IZ1A 5EPOA 3WGHA 1O5IA 3RKRA 3JYPA 3K2BA 4JX8A 3JQFA 1QV7A 4YQZA 8ADHA 1LX6A 3HSKA 3JQEA 3MTGA 4AG3A 3KTDA 2I3AA 2VWHA 3PYMA 2D3TA 1F8GA 5T67A 2VZ8A 3MTJA 3LVFO 2HCTA 3OJ0A 3S2EA 3RVDA 3ZNOA 3ZWAA 3U0BA 3MWDB 3H3FA 1VL8A 5TRTA 3PQEA 2ZKLA 4UEJA 4OMUA 1T1RA 4CMHA 3EGOA 2C5EA 4GVXA 3PHIA 1HYGA 1CIVA 4IMPA 4GGPA 3B1FA 1IZ9A 1ZK3A 3D0OA 3ZDFA 3RWBA 2GZ1A 3DZFA 2BD0A 4MVJG 4QFCA 2A94A 4LW8A 4DIOA 3ON5A 1QYCA 3KLPX 5K9ZA 1N5DA 3WGOA 1EZ4A 2HK9A 1UH5A 3VPGA 3WSVA 1ZEJA 2G0TA 1PZFA 5FI3A 4IDBA 4DPMA 3ITDA 1PS8A 2QRJA 4ID9A 3DZHA 1N7GA 5JCJA 1RYDA 2RHRA 4PLHA 5EQDA 5B4UA 4Z9FA 2EERA 4OSOA 1G0NA 1V3TA 2Q46A 1P44A 3EYWA 4NIMA 4E2WA 1BXGA 2JCYA 3B1KA 2PH3A 3HDJA 2Y68A 4IDFA 3MZ0A 4PVCA 4OXYA 5G0WA 5JAQA 2A35A 4YPOA 4BNNA 3ANNA 1E92A 2J3HA 3WFJA 1E1LA 1P0CA 1VLLA 2VZ0A 3A14A 1NVMB 4UUOA 1NFRA 4AJ2A 4FN4A 1QYWA 3WSWA 5AOVA 1PJSA 4MKRA 4UVGA 1V9LA 3NT4A 3ENNA 3F1KA 5AXCA 2DTDA 3GEMA 4Z6KA 3BHMA 3QVSA 1P0FA 5ER6A 3GRKA 4E13A 1ML3A 2BELA 1Y8QA 3HFSA 3PHJA 5GY7A 3PIDA 1EE2A 2GRAA 1PWXA 1LC0A 3U3XA 1DHTA 4DUPA 1R66A 4HXYA 3OEWA 4D44A 4LMRA 2BGKA 4PLVA 4R5HA 5L4SA 3AY7A 3I9OA 3WDSA 1LLDA 3VKUA 5IXSA 4M8SA 2OMEA 3WYEA 1JKFA 1HF3A 1U2DA 4ZHSA 1DIGA 2X9GA 3HWRA 4E0BA 4CV2A 5BR7A 1CQIA 1C3VA 3H7AA 5U4QA 3PJGA 1Z7EA 3D5QA 4IDDA 1E3IA 4IBOA 4B4VA 4BNUA 1NFQA 3D3WA 3WGYA 3WBBA 4FJ1A 3KRTA 3VDQA 2J8ZA 1I32A 4BO1A 1SOVA 2O7SA 4F6CA 3ZV4A 3GZNB 2B5VA 3RFVA 1LBEA 2Y1GA 3EK2A 1HSZA 3RC2A 2GN6A 2VUUA 1I2BA 1XU9A 4L4XA 4WLEA 1I30A 3AI3A 3IIEA 3ZHXA 3OHSX 4XYLA 1O94A 4OQZA 4ZQGA 4E6PA 4B7CA 1O0SA 3AM3A 4Z3KA 4PLWA 3WGTA 4GBJA 3K9QO 1PGQA 1E6UA 3ZNNA 4XDYA 3LU1A 3OFSA 4TZTA 5KCZA 4XX0A 5A5EA 4NHEA 1CERA 1N2SA 2Z95A 3PGJA 4WLVA 3WFIA 1ZH8A 1I3LA 3B20A 3ZWCA 1D8AA 3TQHA 2VUSA 1HT0A 5EESA 4J4BA 1B16A 1HXHA 1E3JA 1R4MB 3GNSA 3PFFA 3RUIA 3BTOA 2PNFA 2DAPA 3ULKA 4CM4A 1NR7A 2P5YA 3RFTA 5KJFA 1DJNA 4FD3A 4OH1A 4E5KA 5A3VA 1Y8RA 2NNLD 4WASA 1QYDA 2P4HX 3OJFA 2WEKA 5IFLA 4RVDA 3JV7A 3KM0A 3CH6A 3GH3A 2Y1OA 1DLJA 1R0SA 3DXFA 3NT5A 9LDBA 3DO5A 1E7WA 1GY8A 3RUEA 2GASA 3KYBA 4XIYA 5L7YA 4J4HA 1PJBA 2GCGA 3JQBC 4LSWA 3ZWVA 2Q1SA 1LRJA 1XYGA 2Z1NA 2VN8A 2XAAA 4W4TA 4UVHA 5AXAA 3TOZA 1OI7A 1NPTO 2NTVA 1A72A 2QZ9A 3CUKA 1Y7TA 4PG4A 5I8ZA 2UUOA 5DCWA 4AJJA 1D3AA 4Y6SA 1PEDA 5A1TA 2HJSA 3PVZA 3QRWA 2A92A 3GG2A 4A7PA 5C7OO 4P38A 3AUAA 2G5CA 4NBRA 1ID1A 3ONDA 3JYNA 3IP1A 4R41A 4B7XA 4YT2A 1K0UA 3SJ7A 3EY4A 1HE2A 2BRUA 1Y9EA 2PD4A 4A0SA 2ET6A 1E3WB 1H5QA 1I0ZA 1ZEMA 1YDWA 3PZRA 2H6EA 2YUTA 1QLHA 4BHTA 2XXBA 5CP8A 5L4NA 3R6DA 2HO5A 3JYOA 3GGOA 3JQDA 2DBQA 2FR1A 4JGBA 1H9AA 2Y0CA 1SMKA 3PTZA 3ENKA 4HFNA 3S2GA 3FNGA 2X1HA 3U4IA 3WNQA 4F46A 1B8UA 1C1DB 1PSDA 3GT0A 3H9QA 3WNVA 2G82A 3W4JA 1B8PA 3FSRA 3VDRA 6ADHA 1HDCA 4HP8A 1I2ZA 3VPFA 5CEJA 3G49A 4XJTA 1BRMA 3PDJA 4R4JA 3Q2IA 4O1MA 5DBFA 5I7EA 4XGKA 4A10A 2PD6A 4XD2A 3KEOA 1ADFA 4DREA 4ZJUA 4R16A 4KWIA 1NQAO 5HA5A 3ZV5A 3KUXA 5T8KC 4CR8A 3WBFA 1X13A 4AFNA 3ORFA 3W1VA 4BUCA 4BIIA 1SPXA 3R1IA 3HDYA 1EUDA 1SO8A 1YKFA 4FC7A 3H3JA 2DFDA 2HMTA 3S2FA 3DAGA 5ENVA 2VHXA 3COSA 3LQFA 3UXYA 1K5HA 4IJUA 2AQHA 4AL4A 3OECA 3S55A 4BL5A 2PZLA 5CEFA 4HX5A 3F3SA 4BMVA 3PWSA 2OP0A 1DSSG 3OBBA 3OH8A 4E3ZA 1NX6A 5KJCA 4RO0A 1GCUA 4Y8VA 2FSVA 4L76A 2G17A 2VRCA 2CFCA 3HHPA 5FI5A 3KSUA 2UDPA 1QP8A 3FN4A 3T4EA 4FIZA 2DM6A 2POQX 3C3XA 2ZTUA 3GY0A 4WKGA 1YQXA 2O3UA 4GX2A 1GCOA 1QLJA 2Q99A 4IDAA 3GRPA 1KEVA 2NTNA 1XIVA 4G5HA 2R2GA 4WJZA 4H16A 4DQUA 2P4QA 4RLHA 1BMDA 1G0OA 3CPSA 1E7RA 1XLTA 4OM8A 3UKOA 1OZAA 2ILTA 5L40A 1I24A 3JD3A 1LLCA 2JAPA 1XEAA 9LDTA 1NTOA 2WYWA 1DC4A 3GAZA 4IS3A 4UEKA 4N5LA 1AHIA 2IZZA 1KS9A 2VNSA 3SLGA 5K0ZA 1JAYA 4CUKA 4F45A 3FBTA 3GFBA 3VOSA 4NJMA 3UHAA 2DT5A 3JQ9A 2ZYGA 2W90A 1YOVB 3QW2A 1AE1A 1TXGA 4RDHA 2X9NA 3B6ZA 4ALLA 4CPDA 4E33A 3UW3A 5K6AC 3UCEA 4WLOA 1VI2A 3NV9A 3VKVA 3X2FA 1YWGO 3LYLA 2OFPA 3I1JA 1XR3A 2O50A 2VOJA 2B0JA 5H81A 2E4AA 4AICA 2OP1A 4FFNA 4BNJA 2VT2A 2O4CA 4DXHA 3PEFA 1B3BA 4KDEA 3MJSA 1V35A 3DC2A 4MINA 2Y1DA 5KVVA 1X14A 5IDQA 4L0QA 4BOYA 3VC7A 4J6FA 1CJCA 3DEYX 3VZRA 1PTJA 1E3SA 3L6OO 3ZI0A 2O7QA 3GAFA 2VCYA 3FR8A 2AQKA 2QQ5A 2EXXA 5KVQA 1E5QA 3RUAA 4DIBA 4YRAA 3MJ4A 4CV3A 3NTOA 1V0JA 3ZNQA 1YL6A 4P22A 3RCBA 2SCUA 1FJHA 1DHRA 2WE8A 4MOWA 1DIHA 3EUWA 1PR9A 1UDCA 4YYZA 1NPYA 4FPXA 4HBGA 1WMBA 4YXFA 2NUAA 1DB3A 3LF2A 2AG5A 2LDXA 3DBVO 1LEHA 4FR5A 4MVJD 2W8ZA 2QIOA 3KBOA 3TZQA 2ZJ0A 2Y66A 2Q1UA 5CG2A 1P1KA 1HTBA 5U1PA 4D3DA 1YJQA 3U09A 1UUFA 5KNLA 3W4IA 2X4GA 1XU7A 1ZIDA 3AFMA 1GQ2A 2D5AA 3Q0EA 4KUHA 2CZCA 4Y6RA 3RU9A 3ETGA 2PKRA 5I9NA 4JLWA 6LDHA 1UP7A 1TEHA 3BMNB 4TVOA 2NLOA 4A03A 2NADA 2DBRA 3NJ4A 3F4LA 1KC3A 3ZW9A 1DJQA 3H5NA 1N8KA 2QRKA 1B3RA 2BFOA 5L4LA 5G0TA 1IOLA 4YAIA 3FRJA 4MP8A 4HUJA 4YRDA 4R1SA 1GEEA 2D1YA 4JBIA 2NACA 4ILKA 5DBGA 2VTEA 3RUDA 5BSFA 4ESOA 2JFFA 2EKQA 5TS3A 1K6IA 4N5MA 4II3A 1MA0A 5JBIA 1J6UA 1IYZA 4MIOA 1ONOA 1YVEI 1PL7A 4LVUA 2Q50A 4E5MA 1Q0LA 4IQGA 3KHUA 2HJRA 2NVBA 3PHGA 1WMAA 1LDGA 2GYYA 3VPXA 3DBLB 3AY3A 1ENZA 3F47A 2EG9A 2V6GA 3WTCA 3DBHB 4DWVA 2AMFA 1FXSA 3ZU2A 4EUFA 1RKXA 3JYLA 2P5UA 3LT1A 4X54A 2NSDA 2VRBA 1LI4A 1YQGA 3L9XA 4IS2A 4AJEA 4NMHA 3MJVA 3FWNA 5DP2A 3C1AA 4PLZA 2OBNA 1JDJA 3JD2A 3CE6A 2O2YA 3OEYA 3I6QA 1DRUA 1PQPA 4E2YA 1W4ZA 4NDNE 1LDNA 2PLAA 5ER9A 1YBMA 1S7CA 1HRDA 3H5RA 3ROPA 3S2IA 4NG5A 2WD8A 2X86A 2ZYAA 2V6FA 4RF2A 1P1HA 4CMEC 2B35A 3H8VA 4WGGA 1E7MA 3DZJA 2PKQP 2DC1A 4OQYA 4B79A 1GEGA 2NM0A 4CQMA 5BQFA 4QEDA 1JAXA 2HK7A 2YV3A 3PYLA 1GQYA 3Q3CA 1PZEA 1CF2O 3KLMX 3L07A 3TRIA 3V5NA 4B7UA 1NQOA 1UAGA 2NU6A 1DO8A 1LDEA 4WNCA 2IZ0A 3CXRA 1BW9B 4I5GA 4J1TA 3E8XA 3IAHA 1KY4A 1NAIA 3NAQA 1LRKA 1IZ0A 5A9SA 4I8XA 3ADOA 3PWZA 1A9ZA 5L3ZA 4CL8A 1SAYA 2VOEA 1GAEO 3TZCA 1F06A 5AYVA 1ZFNA 4CMIA 1KEPA 1MXHA 1FDWA 4RGBA 4ALJA 1HLDA 1X7HA 3GMSA 2JD0A 4NI5A 2C7GA 1LU9A 4UULA 3SLKA 3QY9A 1YL5A 4BKQA 3FNEA 1BVRA 3HG7A 2IEDA 3JYQA 4MVJI 1QSGA 2YFHA 1ZK0A 4KTTE 3QV1A 4GVLA 1SOWA 2CVQA 4B3JA 4ND2A 1TT5B 4K28A 2JFGA 3BHIA 2OOSA 1TI7A 3V1UA 1LUAA 3DFUA 1G6KA 4JQCA 3Q11A 4R69A 3S8MA 2VTDA 3D3WB 3RBZA 5L45A 1A27A 3KOUA 1EQUA 3ZHZA 1E1KA 1F14A 1UAYA 3I9MA 4DVJA 3F46A 4NFSA 4IIVA 1V8BA 1I2CA 4CL3A 1J5PA 4OSPA 4E31A 1F12A 1UZMA 3WR5A 1YGYA 5GZ6A 2QX7A 3I9LA 3PHLA 4FC6A 4BO2A 2YQ4A 4EI2A 2UV8A 1ULUA 4JN6B 2X23A 3F9IA 4LMPA 3ZWXA 4YAGA 4CMJA 4XYMA 4JJGA 3ICPA 2X6TA 1Y6JA 4ZGWA 1RWBA 1UXIA 3IMFA 3DOCA 3RROA 4A2CA 3HN2A 5DZSA 3WTBA 1U4SA 4O63O 3ZWPA 4AJNA 4ND3A 4CUJA 4TRRA 5IF3A 4DGSA 1ISFA 4ZICA 1HDXA 4AJ4A 5TQVA 2JD2A 1Q7GA 5AQ1A 1HE3A 2PV7A 1C1XB 4RLSA 4Z0TA 2VHZA 1PZGA 4WK6A 4ALMA 1YB5A 4JXKA 3AY6A 1Z6ZA 4CQLB 2JKVA 2I6TA 2XOXA 3CKYA 3DDNA 2JCXA 1YE3A 2PGJA 1JQBA 4DRYA 1CETA 3SXPA 3RASA 4D42A 2X58A 3JQ8B 3ZCXA 1KERA 3OQ6A 4EJ6A 1E3EA 1ZK4A 2F1KA 2BFAA 3HZZA 1UDAA 4RCVA 2DTEA 3H6KA 2VWPA 4Q9NA 5EQFA 3O8QB 4WCFA 4CM8A 2D59A 3GC6A 3JQ8A 2HQ1A 3BTUA 4OOFA 1PJTA 1VKOA 4RF5A 1LDYA 3EDMA 3GDOA 3GUCA 4J7XA 3ZWNA 3NDRA 2AEFA 3ANMA 4XYGA 5JFOA 1EVJA 2I99A 4OGWA 4MDHA 1YQDA 3LZ6A 1AGNA 3OM9A 2FOIA 4FFLA 2E48A 5I9LA 4ZA2A 1E3WA 2ZJ1A 1H6DA 1VKNA 2Q49A 3WG9A 1RYEA 4J43A 3LLVA 3FWZA 3A4VA 3U4CA 5JO0A 3UGKA 1SEVA 3E5MA 3P2OA 1PL8A 5TLSA 3M1LA 4TVBA 3GVCA 2PGLA 1ZXBA 2Q1WA 3EVTA 1E1MA 4WPGA 1HL3A 5ITVA 3ZW8A 5DBIA 4FGSA 2NVWA 1EVYA 4LSMA 4YT8A 4YJHB 4CLRB 5IXYA 4IJWA 4FJ2A 4CQMB 2YZ7A 2JFHA 4NFYA 3GVIA 5F1PA 2Z5LA 4OAQA 4QUKA 1CDOA 3K30A 1T24A 4NJOA 3ZHYA 1DEHA 4RZIA 2GDZA 2PWZA 4WCFB 2Y93A 2JAHA 4YVFA 4XDZA 3ZGYA 3MJEA 2AE1A 4HY3A 2GN8A 2VHWA 3AOEA 4J90A 3GUYA 4YJFA 1LDMA 5ENDA 1R6DA 1GTMA 2BLLA 1KETA 3QQPA 4GX5A 1OOEA 4Z0PA 2H1SA 3TDKA 3E9QA 3UICA 4DTIA 3QWAA 3BTSA 4IMRA 4EGFA 3GPDG 4OOEA 4CLXA 1J0XO 1LQUA 1PIWA 5JYDA 4FB5A 1GU7A 3VZPA 4D7AA 2HMSA 4LK3A 4O5OA 3ZN2A 1N92A 1RM4A 4D43A 1NAHA 1KEUA 3G79A 1XELA 1UZNA 3I4CA 3QE3A 1M75A 4IDEA 3AI2A 3NGXA 1ORRA 4KWHA 1J49A 1H94A 4BGVA 1H9BA 4CLDA 3RJ9A 3EZYA 5LCXA 3I4FA 4PZDA 1NYTA 3FR7A 2VQ3A 3AUTA 4XQ9A 5IZCA 4RVHA 3AW9A 3PFWO 1A71A 4IUYA 4NPCA 3PPIA 5DOZA 4CM9D 3JQ7B 3WQSB 3JQAB 4W7IA 2C29D 4IJVA 3WICA 2NVUB 3GHHA 3G3EA 3TL3A 3OP4A 4IZIA 1ENPA 4F6LA 3NJ8A 3EVNA 3DOOA 1BDBA 3GZNA 2QG4A 2ZCVA 4WE3A 4YJDA 3QVXA 4CM4B 4D3FA 4Y67A 5K6AA 4RL6A 3JQCA 2D2IA 1JVBA 1YOVA 1B7GO 4HFMA 4DLAA 3WMXA 5JY1A 1UJMA 4GWKA 4QFDA 4XKJA 3I6IA 4BV9A 3QP9A 4XR9A 3WGQA 1SC6A 3DBLA 4CV1A 4D46A 1XG5A 5LC1A 1P31A 4P4GA 4YT4A 2HAEA 1LSUA 2GERA 2J5RA 3DMTA 2P68A 3JD1A 3HNPA 5JLAA
chains in the Genus database with same CATH superfamily
5ITSA 4UDNA 1JEOA 2BTOA 4G67A 3BJIC 3IGFA 3DXXA 3LPDA 3OPQA 4JI2B 2IYQA 4KQ6A 5K4HA 2QGZA 1EVZA 4MLCA 5J4HA 3KETA 4ENUA 4RPKA 1JA9A 1UF9A 3U7IA 1NI4A 1TDJA 1J0BA 3THOA 3S81A 1YA8A 4IIJA 2YXLA 2PM8A 2QL5A 3NWEA 4KYIB 3WQQA 2PWBA 2WSYB 1AS2A 3VJLA 4JJIA 3S68A 2QRZA 5EP4A 4RMNA 5BSGA 5E2IA 3I5YA 3AL0C 4JL5A 1PU2A 1EIWA 1U5CA 2DLDA 3H2KA 3WLOA 2IYXA 1DMRA 1UBSB 4QBGB 1DC5A 2EEPA 2YWCA 1J33A 2BL4A 2A5GA 2AA3A 2WUDA 1NFFA 4S3MA 3R7SA 4D8XA 5I7OA 4ESVA 1ZIYA 4CQJA 5B1YA 3Q3HA 4JT8A 1HYBA 1W44A 3ECCA 5B1HA 1ULBA 4JBLA 1SELA 4BX0A 4KP7A 1YCHA 3TFOA 1ZJYA 2P7HA 2HZ7A 2OVFA 2LKDA 4G1FA 3O2SB 3IA2A 1DFHA 4C5BA 1G3RA 3U6KA 4PRKA 5B3LA 1CKEA 2PVSA 1XDSA 1VSBA 3M7IA 1N3YA 3Q6MA 3CNBA 5DM1A 1U8YA 3CUUA 2PA3A 1EFAA 4DM7A 2EU8A 1FU7A 2ZQZA 4ZN6A 5AW2A 3GFGA 1BHSA 3R3WA 4OQMA 1W0KD 2R6GA 4BO3A 5EJ5A 3BQ9A 1WQ1R 5LYYA 3QYAA 4Z3OA 1NJ8A 1SNYA 3GNTA 2P2ZA 3ITNA 5E1BA 1WXHA 1BXKA 1E69A 1O7JA 2VDVE 3G2LA 4QIHA 4RX1A 5FO0A 1RWWA 4WKBA 1TC1A 2Y0EA 1B76A 1DC3A 1ZA2A 3HA7A 4F4HA 2YJ6A 3I0ZA 1PT8A 3LP5A 3QEMB 4K9SA 1MABB 3LC1O 2QP4A 3DMDA 2ERCA 3BK1A 1G19A 2CNWD 3SSNA 3KWMA 4X8OA 2D74A 3Q87B 3SM9A 2X0JA 4CN8A 1C4WA 5E0KB 2J3MA 4MGHA 5DSTA 3V7WA 4BZWA 5I4CA 1SC3A 2YV2A 4KQMA 2VDRB 2FP4B 3IOEA 5HCIA 5JH7A 1XD8A 1E2UA 3HYTA 4GSYA 3U4MA 3S2YA 3C2QA 2EGHA 1QTQA 1HEIA 3NKLA 2DEUA 1RAHA 1YB1A 2C8LA 4O4IA 1RCUA 2GLUA 4TVKA 4ACAA 3U60B 5I7UA 2BZ0A 4G5SA 3N6RA 4ZT6A 1QO0A 4F5DA 4A6DA 4CIWA 1ICEA 1UXHA 3A6EA 3ZIUA 1WMDA 3RRYA 2AKYA 4M6WB 2V97A 2N75A 4XTCS 5DTMA 4YCNA 2D5LA 2CLEB 3UHJA 3ZWYA 3ENWA 2V0GA 5DNYB 3EUFA 4BAZA 1UFVA 2I4TA 3KB6A 2H92A 4FEGA 1DO2A 1GUFA 3NHPA 5JO9A 2UZIR 3DEIA 4N3NA 1IJEA 1E2GA 5BQPA 3WHLA 2YWBA 4ZHQF 5EP3A 1TFUA 4BX9A 4W1RA 2JIZA 3OQMA 1GTSA 2FQ1A 3RTEA 2RHJA 3T3PB 1IAVA 3ANLA 3CHYA 4R3WA 2DFVA 4TTSA 5EUQB 1XBTA 5CVVA 4AKIA 1XZKA 3W79A 1AZLA 5EGSA 3X3HA 1JEAA 3EQ7A 1JG2A 1QMGA 1GN9A 3EHEA 1NIJA 4TTAA 3CZMA 1A9QA 1DU4A 2I9PA 1V8ZA 3EEFA 3GJRA 4FK8A 4QXQA 5KJEA 3UMCA 1YA4A 1T1SA 4M49A 4B80A 2G7MC 1KH2A 1Z5WA 2IEYA 3WWZA 3ZY2A 2XV1A 4BGIA 5BNFA 4JJ4A 1ORTA 2JKYA 2YV5A 3CX4A 5EWMA 5K8CA 1E64A 1F4LA 5A4DA 3WO1A 2GN2A 1SU4A 5BRNA 1GPJA 2VYVD 2V4UA 4O2BF 3QU7A 2Y67A 2DXIA 3SFVA 3RG8A 3QE9Y 2IHJA 3F8SA 1AO0A 2JFVA 2HXGA 2VYNA 4R8LA 4IOJA 5DI3A 5L53A 3R3ZA 1VSQA 2VJCA 1SUWA 2DFKB 1ZIOA 1K3TA 4MUYA 5CW1A 5DULA 1K4MA 4AZ0B 3W5IA 4DMLA 1XMXA 2G7ZA 4DV7B 2ZIUB 2ZIXB 3L4BC 4HSGA 4WD3A 1U7ZA 4LUCA 1ODSA 2G1AA 4KIGA 1TZJA 2F90A 2FK8A 2OYCA 1IAQA 4H35A 5B53A 4IDNA 1IXZA 2QZ4A 4F5WA 3AVWA 3BJZA 1WULS 3MXOA 4DTCA 3CMMA 3F0TA 5K8TA 1NP7A 3B12A 4OGKA 1DRWA 3QJYA 2B4TO 2YVQA 2Z2JA 3VU0A 5JZBA 2D8AA 3AEKA 3MERA 3D2LA 1U04A 3C98A 1AHPA 3B3GA 1Q3TA 1C7QA 4AO7A 2WJWA 3OZSA 3P2KA 4C9BA 1G20A 1Z5GA 1ISHA 2BM9A 3HL4A 4UMFA 4Q15A 1FVFA 5F1YA 1G7SA 3T5DA 5ITZB 2KI5A 4MVJM 1U7DA 4RE6A 3OEEA 3I8XA 1IATA 3SJCA 5IC6A 4Y7CA 3BZWA 4LOAA 1GPKA 2DHCA 4LWOA 2YHSA 4D99A 2JKZA 1GADO 5DCLA 2BKVA 1YUMA 2O19A 3N2GB 2BC9A 2FZGA 4DRXB 5T64A 4AUKA 3FPJA 3H04A 4AX4A 3B1YA 3T9BA 3K72B 2YH2A 3DDSA 1IZZA 1GPDG 1TUIA 3QOYA 5DASA 5KTTA 1GZVA 1YD7A 2E5FA 1SUAA 1WIWA 4B09A 5IJ0A 3C3CA 1T2UA 4LX8A 5B30A 4YRSA 2CLCX 2QHXA 4UUNA 3KUDA 3TNFA 5ALVA 2JIPA 2IP4A 5KS2A 4L78A 1SEPA 4LQ4A 3D4IA 4LBVA 4ERXA 1AV6A 1CD5A 1RLMA 2QZSA 1QX3A 2E37A 1EZZA 1A82A 1Q12A 1SHJA 2P1RA 2Y76A 3IEUA 1XKTA 1HETA 3IIJA 1ZCJA 3O0DA 2FMFA 1A8HA 3GLRA 1H2BA 4MKFA 1XWFA 4ZRNA 5SV2A 3ZE6A 3NWOA 5CT6A 3BIJA 4AXBA 3GRAA 2CUKA 1NUHA 2W2VA 1QWOA 2NYVA 4HGQA 3GAMA 3I52A 4KGXA 1W59A 1B8VA 4JLJA 2V7BA 1V3VA 2YHAA 1XTJA 5IH7A 1ULSA 2B1QA 1SVUA 4E4TA 2G6BA 1BD3A 3O9MA 3N8DA 4MJLA 5ILGA 5K3CA 2D3WA 1KBQA 4IHAA 1XT6A 3LHSA 2OCGA 4O08A 2QMOA 3LQRA 3ZDBA 4JBGA 4L8WB 4EX7A 2GCIA 2JATA 3KXLA 2QXTA 3O75A 4F1KA 1G4HA 4MV8A 5FTMA 5FWYB 4ZZ2A 2BHLA 4EWLA 4IQ4A 1Y3BE 1VLMA 2OZVA 2O23A 1KYQA 1FSZA 2AEMA 2WIGA 1ZNYA 1UEIA 1WXDA 4R0NA 1WZ2A 4LXYA 3VZSA 4U63A 3T5AA 4PHCA 1C9MA 1EBUA 4GL2A 4TQGA 1Y4UA 1ZLYA 4D6PA 5KEIA 2YWHA 2Q4OA 1VHTA 3HU1A 3OTIA 4DOMA 1KC1A 2EJCA 1SCJA 3TIGA 1N32B 4QLAA 1C0IA 1SVSA 1KI2A 3N6VA 1A97A 5T5QA 1C0LA 5LR6A 3PRJA 1ND6A 4MAAA 2Y3IA 3BGDA 3QFSA 3ZV6A 3FNRA 4G85A 4YT5A 2RIPA 1RMYA 2IHUA 2N3ZA 3UGTA 3UCFA 4XASA 1CRQA 5G3YA 4RF3A 3ZLBA 1YAJA 4OXXA 2X0NA 2PN1A 4TLBA 2A6PA 5CYOA 2Z04A 4ZKDA 2GILA 4D9CA 2ZT5A 3PQ3A 2E82A 3FGZA 2DTXA 3ESDA 4XM0A 1YZGA 2IT1A 2JGKA 5JS6A 3FPAA 4F21A 2QNIA 3RU7A 1ZM9A 2HBZA 2P75A 3KB1A 4MO9A 1I7QB 1UBTS 1KXZA 2GK3A 3OIGA 5E1MA 5HK8A 4B7ZA 1YVUA 1BE1A 1NJFA 2HU5A 1KI3A 1XJCA 1FFBA 1GKUB 4IKOA 4K9MA 5D1NA 2LCQA 1OWLA 4EG8A 5AM1A 4U7HA 4YRJA 3TI9A 2GN4A 3H13A 5HWSA 4C4RA 4BO8A 1O77A 1JDTA 1IM5A 2W70A 1V3QE 2C5BA 1SXJE 5CA0A 4I5FA 1IE3A 3LCMA 4I9UA 2VJBA 3VPSA 4AU1A 5JTTA 2GF2A 1QF9A 3GJTA 3CTMA 3U37A 4BE9A 3I62A 1R0YA 4TWAA 1DAIA 5G0VA 3HI4A 2A4MA 3ZE7A 4QYIA 2VJDA 2ZSIA 4CHGA 1JLRA 3FMPB 3JWJA 1WW3A 3ZHTA 1QIMA 2GZHA 4UHKA 3D3KA 4WECA 4G1EB 1QPGA 4RLQA 4O3MA 1SK9A 4C4YA 1JRLA 4JCCA 5B1IA 3DR5A 3KELA 2FFJA 4ALIA 4MTLA 1EP1B 1KPHA 2XQKA 5K8LA 1NNSA 2ZIAA 4C4ZA 4PFJA 2XPCA 4D9IA 3RBAA 4ND5A 1XTRA 3X43A 4ID3A 3K2EA 2MWMA 2IYAA 3DZBA 4N7BA 3DV9A 5K0LA 3TLEA 4E11A 1RKUA 5DM4A 4WCFC 1YTLA 5JROA 5CB0A 1C4KA 1NG1A 4ZT2A 3B85A 3ZGOA 1IUKA 1NNUA 3M6XA 3AVTA 3UIEA 3P0FA 4F93B 4J91A 1A8UA 3WADA 2OZPA 3KVVA 1U3WA 1WOMA 4E03A 3AKZA 2I67A 5LU9A 2NZXA 1GFIA 1UPFA 4FX2A 5IP5A 1ZGAA 3LFUA 4M89A 3FY4A 2GXSA 4HS4A 3IDFA 1EB8A 2B83A 2YL2A 2ZYIA 3GJXC 1A50B 1TX4B 2YN4A 4FNGA 3GT4A 4TRJA 3WK5A 3E1KA 4XVCA 5SZKB 3DTTA 4P8RA 1Y3AA 5H3HA 1ZU5A 3E9MA 5CVJA 1YZUA 2NTJA 1T9HA 3RYHA 4I1RA 4Y1FA 1GUZA 2B2NA 1DIBA 1T2CA 4BGEA 1YJ8A 4XVUA 2WMOB 4Q16A 3RBXA 2XUKA 3AO0B 3ZJTA 4KX3A 1ISIA 2FW9A 5IZ4A 5T3UA 4TKMA 3HL0A 2GEBA 4QGBA 1EQ2A 1QH1A 2BFBB 2WKSA 3DAPA 4C4XA 4Q7KA 1IWPB 4CDMA 1OAOC 3BSYA 3G9UA 3W04A 4DN6A 3F6EX 2CNOA 4DZZA 1X0XA 1NP6A 1RXYA 3WGIA 5CX1A 2Q0QA 1GA1A 5E3IA 1ATIA 4UZSA 1L4FA 1PLJA 2HFKA 4S04A 3LA8A 4TMZA 1Z6TA 3RKUA 2G40A 5INTA 2P5SA 3VU1A 5L7TA 4A2WA 4LHWA 3OBIA 3C70A 3UT0A 3VVLA 2VZ9A 1U94A 3MSXA 2C2ZA 2J5QA 4G65A 5JBQA 4FEYA 3V7NA 2NNWB 2VK4A 3M2PA 1DCFA 1ZNXA 1QH8A 1DAPA 3TAHA 2VHVA 3E3OA 1IPFA 4ITVA 4ZQEA 1JLSA 3WIDA 4IDGA 3ZWBA 2CVHA 2YHIB 3TKYA 5DX8A 1ACLA 1OR8A 2GN0A 4NATA 1P1FA 1V6AA 1WAMA 3KSZO 3ZKWB 1E2KA 2A5LA 1LK7A 3ICVA 3UUWA 4DCMA 1R4MA 1O89A 4J07A 5KJ1A 5KYGA 5L3QB 4Q1VA 3R9WA 3SJUA 4V02A 1ZUNA 2NZVG 2EFJA 3FGPA 3HPRA 1KK1A 4IH4A 1OHHA 4MWOA 1NBMA 3BHJA 1BHQ1 1O9BA 1Z4JA 3PP8A 5FBHA 1BGVA 1MC4A 1L1RA 2CXOA 3MT0A 2IYNA 2PX3A 4TRNA 4A82A 4UTPA 2C7OA 4XGNA 3NC1C 4DR5B 2BISA 3EZ6A 2GAAA 4RQTA 4BNDB 1MHTA 1C5KA 4HXFB 2PSSA 1EFKA 1PJ8A 4KLZA 3P7MA 1GXSA 4J16A 3QH4A 1HKUA 3A0RB 3KQUA 1U2RA 5G2OA 1YHNA 1T6ZA 2EKPA 4QDTA 2GZAA 1Z4IA 3HKEB 2VXOA 3TEMA 4US2R 5ED4A 5E7JA 1GQRA 2VWQA 2R1UA 3ZZMA 3N8IA 3PGLA 4WZAA 4CMCA 5CFOA 2J3DA 2EP8A 5LQMA 3A9RA 1WUKS 4JQZA 4C3UA 1UDBA 4NYIR 4YX9A 2X0RA 1FFGA 3B5JA 4NBVA 1K6JA 1IWBB 5FUXA 5BSTA 2ZB8A 1YU9A 1ZIXA 2VP2A 2XA2A 4LI3X 1U4NA 1CIJA 2RH8A 4JY7A 3Q3VA 1U2DC 3I2FA 2IV2X 3BL5A 4BFYA 4OLFA 4QWWA 4MI6A 3HKCB 3GFRA 4KPEC 5F98A 1E6MA 3QGMA 4BNTA 1U0HC 4BPRA 1XWIA 2RHHA 2BFCA 3M9XA 1CRWG 3PL5A 3FNFA 3E0QA 2IIVA 1QU2A 3BXFA 3G0HA 1KI7A 1QK4A 3DJFA 4V3CA 4NV1A 5ITWA 5JQGB 2BH9A 1C9EA 2DUWA 2PMCA 3NPAA 5G4LA 4NZOA 5H4GA 3ZU5A 4AMBA 3SICE 4LWZA 1QNLA 2XGOA 1NLMA 1D4FA 5CU7A 2AH5A 2CXPA 5FL7D 3P2IA 3VJKA 1OWNA 3OIDA 4AAYA 5DIFA 1R27A 3C5WP 5IMBA 1NXVA 1U0GA 5NLLA 3SF8A 1CQXA 1OPRA 2ZJFA 2EP7A 1D7AA 2LIVA 4KBGA 5J2TB 2Y1FA 2FPOA 2ZRAA 3NJRA 2C5LA 2OGUA 4LNAA 4R51A 2UU9B 1IEVA 3BSFA 5IVPA 3FI0A 5CM8B 2Z3VA 1ND5A 4B73A 1CZRA 1Y1TA 3TSOA 1QK5A 4HD8A 2AYXA 3QELB 4PLPA 5LB4A 4RVGA 3TW0A 4EPYA 1SHZA 2QTAA 3IC5A 2QLTA 3Q41A 1KAGA 4N18A 4TLEA 3W3ZB 5KTKA 4INPA 1JHMA 3MWEB 4TGLA 1FS4A 2XA1A 4Q7JB 2O2JA 1JWBB 1N0WA 1L4YA 3BREA 5CHEA 1MUUA 2AF4C 5K2MA 4RKEA 2I7XA 2JZCA 1FBTA 2ZPUA 4UHFA 2X8LA 2DWPA 3QTBA 4BO5A 4QAJA 4DY6A 5MHTA 3ID6C 4E1BA 3E6AA 2PLWA 3OJEA 3PR2B 4MA0A 2J0SA 2CZQA 1KJZA 3HB1A 4HDSA 4K8OA 4IIBA 4Q4CA 4ZYLA 1WHTB 4RD0A 4DR1B 3R5FA 4G01B 1RRVA 4CQLA 3QITA 4GLOA 3RSOA 3UWPA 4BECA 2O3RA 2VYCA 3WYCA 2IXTA 4R7ZA 1ORHA 2PZJA 4W5JA 1X3SA 5A03A 4I6JA 5DMHA 3VHLB 4C2BA 5AHOA 3MCAA 2V8OA 5J63A 1L5NA 1BHJA 5A71A 3HKBA 4KR7A 5HUJA 4BLPA 3U7JA 2GZ2A 2VIIA 1SKMA 3L7YA 4DA6A 3TOXA 1XTUA 3T1QA 1FRQA 4OGFA 2XXJA 2H2FA 3FMOB 3MJHA 3FCYA 2WA2A 3LPAA 4RKQA 3RFCA 4L0CA 3ZDRA 1ECPA 1FX1A 1VPEA 2QI9C 1TIKA 5CX1B 3W2FA 4HG2A 2H9YA 1V4VA 2CCGA 4Z8XA 3RJMA 5J47A 4XD7A 1LQ2A 4DYVA 1A9YA 3D0KA 1Q3HA 5DDIP 1MA3A 3G13A 5JYEA 1Y7LA 3GA5A 4Q3BA 2CVOA 2ASEA 3AG5A 1E4OA 3C6BA 2RK3A 4CM9A 2W42A 3NHFA 4LCEA 3PDUA 4D2IA 1RTKA 3HHEA 3NEYA 4RGYA 1EFPA 4IIFA 3I9FA 1HZZC 3QF4B 3QHPA 4JI3B 2AF3C 2AC4A 2W6JA 2H16A 2E85A 1G8JA 5DKFA 2H63A 1U0JA 4BB6A 4DQKA 4BQNA 1U6KA 1G291 2YJ5A 2FPUA 4EVRA 4Z49A 4ATNA 1TCCA 2IY8A 5ICFA 2P6MA 3K96A 3VVCA 2BBOA 5GZ1A 1UEJA 1PTJC 2C3OA 2J9GA 2VO1A 3I6BA 2UXBB 4YRTA 1Z0IA 5FOUA 3KSRA 1E9CA 1L7AA 1PZXA 1PFQA 2GI4A 2HPVA 1FRZA 2Z30A 3P9ZA 2JLSA 1FS5A 1MAAA 2XDWA 1KDYA 3T0FA 4BRZA 2Z56A 3GLIB 2AQIA 1NNLA 3ND9A 1M74A 3OCJA 5TR9A 1KJJA 1OAAA 3GJ8A 3PQFA 3TCXB 3V1LA 4BEVA 3PUKA 1Z36A 4CMKA 1EJ0A 2ZT7A 2J07A 4EH1A 1F6DA 1BRTA 4FFVA 4GRDA 2RHGB 3ANXA 3N6XA 1E1RD 4BEBA 2OBMA 3QUSA 2C5AA 3DB2A 4NONA 4YP6A 5D85A 4GPAA 2H1FA 5GOTA 3W4KA 4OK3A 4D0SA 2NPFA 1QO9A 3GEGA 3JVUA 1GFZA 2PCLA 1WWKA 4HYYA 3EE6A 3H5IA 1M0TA 2FJ0A 3Q2KA 3ZU4A 5FBVB 5JAZA 1WBBA 2WMYA 4J49A 4JKIA 4HAZA 5TGDA 4IRUB 2ZIFA 3L04A 1EEHA 2ORWA 3GF4A 4YYEA 3H1BA 4D9MA 2HRRA 4JR0A 4UMDA 1Q0ZA 1SUEA 4BNIA 1CQJA 1SBHA 2AR0A 3E2PA 4GM0A 2WZQA 4O33A 3V4OA 4F9EA 5IFKA 4TTQA 1ECGA 5CBPB 1SIUA 1QIDA 1KVTA 3H84A 1VXRA 1LNQA 2GZ3A 3R5TA 2W9XA 1RM5A 2YJZA 1JLKA 3CUSA 3HACA 4DT1B 3OC6A 5AVRA 3GUUA 2ZB3A 1BYIA 3KD3A 1ZC4A 5C46F 1IWOA 1NW6A 2CFSA 2JRLA 2HO4A 2RHWA 2WJPA 3C5VA 3M9WA 3NLLA 3O03A 4MGYR 5FOXA 4EAAA 1M2WA 3L0CA 2YYYA 3LX4A 4OXIA 3GEDA 1T8YA 3MJTA 1Z4QA 1C2TA 3GCXA 4BB9A 5B7NA 3BMQB 5ESXA 1RHUA 1TGVA 2H9AA 3HS3A 621PA 1ZNWA 4EHDA 1JYSA 1RWNA 2OV2A 1CTQA 2ZS7A 1VZ2A 4ER6A 1CUWA 1W9MA 1W6UA 4CKEB 1E1CB 3QM1A 5DHFA 2IYWA 2V6MA 3C14C 1XAGA 5HR5A 2MSEB 3S4YA 3HXQA 4K3UA 5HFAA 1OFGA 2FQYA 4C0SA 3PEUA 4EW1A 2EW2A 1ZSNA 1UBNA 3P5SA 3T7SA 2IZ5A 1MO4A 2MYPA 4WFJA 3U31A 1HGXA 3G8CA 4KQGA 4YAFA 4I50A 4YP5A 2H2DA 2P41A 5E6UA 4BMYA 3CH7A 4XCQA 3KVYA 3RC1A 4B6GA 4BNHA 3AK4A 1PCXA 1N6KA 3DE6X 4GXRA 2HL6A 1EFLA 3ZGZA 3QELA 3PITA 4H18A 5KAPA 2YYSA 1Y6FA 1F2UB 3H2SA 2HADA 4WADA 3T38A 4F4UA 2XE7A 1X1TA 3IE2A 2YASA 4BLQA 4YRZA 5G0SA 4LI0A 2JB9A 1UXGA 4QYIB 3PE3A 5DCUA 2VPYA 1PWZA 2J31A 5KYUB 1K7FB 1M34B 3C0KA 1DFGA 2VK1A 1AOXA 3CGWA 1NRJB 4RXMA 4C7BA 1I10A 5JUWA 5I9TA 4WX2B 2E1PA 2WTEA 1QE5A 4NU6A 2ZIVB 5C4GB 5JS8A 1KVQA 2CHFA 3HJBA 5K3FB 1Z82A 3BBPA 3AR4A 2QSYA 4MVJH 4UZFA 5E2AA 4O2LA 3GVHA 4OKNA 2X1MA 2EKBA 1RJ9B 2L17A 3S3TA 3RS8A 2C9YA 1FSGA 3A9VA 3NDPA 2OTCA 2VJYA 1RJWA 1NXTA 3HUDA 4L4RA 3AV0B 4XGIA 2GM3A 5JXWA 1Y3DE 1D0IA 1K9SA 1W19A 2Z58A 4PZLA 1P0PA 3P0HA 5FP0A 1NWHA 1SWWA 2FUEA 2RI6A 4FWIB 3EQ8A 3CA8A 3PJEA 4MVJF 4QQFA 3LOQA 3RTAA 4O4HF 1K0FA 4D9KA 5I47A 2Z43A 4WLFA 1EUZA 2OAEA 4FDTA 4RZHA 1YZLA 3AFOA 4QASA 4AWXA 1MH1A 4UEOA 1S3IA 3PDIB 4DUGA 2E7ZA 5ALLA 1XLVA 1HTWA 3RG2A 3FE2A 1AMUA 3OMXA 4OYYA 3VX4A 2Q7XA 5KTYA 3G17A 4P1ZA 4ON9A 4PY2A 4E5UA 4RA6B 1UOQA 4BX2A 4I0WB 1U7OA 3SZOA 3V2HA 2FE1A 1USGA 1ZINA 2HWWA 4CFSA 2QJWA 3PGXA 1M33A 1OC2A 2A1UB 1SN7A 1W46A 3AHFA 4QTTB 4UPEA 2PKWA 2HRZA 3BZUA 2A57A 4GICA 4Q4JB 4PAQA 3Q7IA 1NJ2A 1YXMA 1OFVA 1TM1E 2IELA 1XK7A 3WJ2A 5KNCA 2BFPA 3LQKA 1BE0A 2ZK7A 2JLBA 4RELA 3JASB 4LF7B 1QQ6A 3KDPA 3M49A 4UAUA 3QU9A 4ZFNA 4DJDC 2FPRA 4KXLA 1A5SB 4TZ0A 2X0FA 2NUAB 1MJGM 2OCKA 5CJPA 3NIDB 4JX9A 3IL2A 5F21A 1FTYA 3TTXA 4DIDA 2X8JA 4MGIR 4EZBA 3DBOB 5JAHA 3MS7A 4K6CA 2WFZA 2JBAB 4N4AA 4ZIRB 5B2EA 1O97D 4WEQA 1JYEA 2BJVA 4EL5A 4EITA 4W5WA 3T06B 3TN7A 3NBQA 2ZCUA 3D7NA 1NBOA 1AS3A 2YHIA 1LBSA 1CRLA 4DRZA 4MWGA 1UBKS 5K1ZA 4RNCA 2H57A 5HBGA 3SMVA 4DEYA 3CW8X 3BF7A 4L3VA 5A7FA 4AY2A 1QGZA 1WV0A 4G5XA 1TVKA 3SC3A 3PPXA 2O4UX 5IDWA 1WO8A 4D98A 1Y1LA 1CY4A 4KU4A 1YR3A 1JFLA 4FQ8A 4BNXA 4M76B 1KJYA 1II8B 1SD2A 4RHXA 1D2RA 1G18A 1KL7A 1M2VB 4H7KA 2INGX 3RGGA 1WU7A 3LT4A 4YRMA 4X62B 1H0HA 3QNUA 3T5TA 5DCYA 4MV4A 4PLGA 1KSJA 4FBGA 3NHLA 3ZEAA 5HKOA 3ZHUA 4BP3A 1VFPA 4IDOA 1NBAA 2R68A 3SZUA 5HOEA 4H7IA 2W2LA 1P33A 1PG0A 3B2QA 4QRDA 4ZRMA 3DVQX 3ECSA 1UJCA 1KIMA 2GA8A 4K9DA 1AK2A 3WP0A 2PWPA 1F9AA 5FBZA 3OQVA 1ZGHA 3IV9A 4XQEA 3I9KA 1DAKA 4FDMA 3TFWA 2IYZA 4HQFA 1HQYE 3AM5A 3B13B 1L5MA 4BB0A 1C7RA 3Q6NA 3AZOA 5C4IA 7YASA 1TA4A 5BSHA 5HRUA 2EDCA 2VR1A 1YQQA 4JLPA 4WLNA 2R86A 3GP3A 3JVEA 4RJ2A 4LFAB 5THXA 4DKJA 2Q45A 2Z2IA 1VL0A 1O6GA 5F2OA 4B3HA 5CFQA 3CUYA 4P2BA 4GI5A 4MVXA 4D96A 5B7PA 4TRMA 1US8A 1ZJ4A 1FDUA 2JGLA 2HR1A 4NJMB 2ODWA 1TU4A 1ZRSA 1ZL0A 2AXQA 2FN4A 2X42A 4NR0A 4RKWA 4Y1RA 4BYMA 5EIOA 5LQNA 3K92A 5ARCA 2V7WA 3NHAA 4NP6A 5EXTA 4XWYA 4UTVA 4IW3B 4RM2A 2AFVA 1HV8A 1JSCA 4MLZA 1CQPA 3K7EA 2XW6A 4ZMRA 2H4ZA 1K63A 4X91A 2XY4A 4G5YA 3KAKA 4XPIA 1X7GA 5BURA 4YDRA 5KYWB 5LLTA 1Y1PA 4YC7A 4FCWA 3EH1A 3FZGA 4YQYA 3S6JA 4CLOA 1I7SB 4DR6B 1GG2A 1P7PA 4W9RA 4BO4A 4HEHA 3C41J 5FOQA 2FKAA 2PSHA 1F38A 2CSXA 1ZSYA 4HH1A 1II9A 4HL6A 4HXGA 1LLQA 3L8YA 3NHKA 4CIAA 5KSOA 3I83A 3HRKA 2VDUE 1ZRHA 3QU5A 5KYYA 3USCS 2WM3A 2C0PA 1GNSA 2JLCA 2ATCA 4FMCF 1DL5A 3EXG2 4AULA 4PVDA 4C0HA 1ZUD1 1GA4A 2LCFA 4IINA 2J4DA 3AFGA 2QPLA 3MUFA 2HC9A 3R2JA 1NDUA 2PQMA 4LXIA 1TYEB 2XAUA 3EH2A 4MJXA 3ROQA 4RIFA 4MP6A 3PD7A 3T99A 2UYHA 3VR6H 2FQQA 4ER5A 5BN3A 2ZYVX 1TB4A 5SY9A 1H2ZA 1P72A 4IM7A 1FP1D 4UEQA 1W0KA 1TVMA 3E8MA 4H0FA 4YCJA 5CPBA 2X0DA 3MN1A 1MOQA 4PLYA 3KUCA 2YQ5A 3HY4A 2XMDA 3ZEIA 5IM4F 1DOHA 1H2YA 2WDZA 3ZCQA 3QSYA 3PSHA 1CUJA 1NQTA 4HXEB 4NEQA 4X93A 1QKJA 2E4XA 2H0RA 5DHPA 3OZBA 2E21A 2JFPA 2VHUA 1R6XA 3MTEA 4X24A 1V48A 4DRXA 1E0DA 4DR2B 5D3ZA 3NETA 2PZ8A 1KQ3A 3JZAA 3G7SA 4CL0A 5ED0A 1E9FA 3AX6A 4HUQA 2GPTA 1ENYA 1J8FA 1VM6A 2XUOA 4JDUA 5IX8A 2TMKA 5K8UA 3OLQA 4YRCA 5EIFA 2DPXA 2AZDA 1RXWA 1VJRA 2BEVB 2BI8A 2GD0A 4KZKA 1DBQA 4G1VA 4KB5A 4ZI7F 1DQYA 4FFDA 4WXPA 3ONEA 1E1NA 1PX0A 2Y8EA 4NCXA 4KWTA 5LDHA 1E98A 3OCYA 4P3YA 2Q4TA 4CODB 3EA4A 3HCEA 2PMBA 3W9YA 2FX5A 5JSUA 2EKLA 2FSGA 1FTWA 3A28A 3R77A 5DGIA 3AETA 2R1TA 4BVBA 3DYBA 5HRCA 1E4YA 3ADKA 1U0EA 4L75A 4UXHA 5DW0A 4PSAA 4OJTA 4CL2A 3QEJA 3DZGA 5BVGA 3E2MA 3FVQA 5KNCD 3A11A 2O14A 4KO2S 1I8TA 3KUUA 4MGKR 4ND1A 4QQKA 2CVPA 3MMPA 4QQ8A 3K9FC 3H0EA 5HCNA 1A7KA 4J3NA 3HP1A 4MW6A 3WWYA 1Q7TA 5IVIA 3ZOZA 2YV4A 1MC5A 3L8DA 3B7PA 3Q7SA 3BBLA 4IYRA 5JARA 2VBGA 5HE9A 5HIAA 2I8CA 2W6CX 1WPRA 1R15A 5SYNA 3V2UA 3WLIA 3DHNA 5K3DA 4JJ6A 4LOIA 4F4FA 1E5LA 4PLTA 2ZJ7A 5GVRA 4LXGA 1F8XA 3S7ZA 4WA7A 4BS9A 1RQ7A 2VBCA 4I99A 3DMGA 4I4TF 5FWAA 2VF5X 2AUMA 3KHKA 1ZJ5A 4YRBA 5LQDA 2C07A 3PXEA 4I9HA 4D45A 1FFDA 2XUAA 1BU5A 4G0OA 2VP9A 3IAXA 1Q6ZA 4GKVA 4TMYA 2XMBA 5KMGB 5C7LO 4CUKA 1QIFA 4POOA 3G85A 1R9JA 1WCIA 3BK7A 1CUYA 3AEXA 2IFTA 4R2WA 5BWLA 9ABPA 4LDPA 4L15A 1EMDA 4WK4B 5REQA 4M87A 4C7OA 4Z0HO 4XRRA 2PJDA 3H4TA 3MSCA 2PXCA 4QU0A 1MPXA 5JDCC 1UPBA 2GKOA 5BV7A 2PSDA 2NXWA 4YROA 3KDAA 2JHAA 4EPTA 5K0JA 1J4AA 4YB8A 4HJRA 3JSXA 3QKUA 2J7PA 3UG7A 1YRHA 2TSYB 3W34A 4C7XA 3P0RA 4YMVA 1U2PA 2OG2A 1M73E 3PGA1 5IULC 3IAEA 4RCZA 2A5FA 3ZLTA 4XDGA 4YLGA 3P71T 1UXJA 3HO6A 3BA1A 5ICEA 4JLVA 1NW8A 3C3DA 1QRUA 1IB6A 3EPHA 3JQPA 4JQSA 1U0OC 1ETUA 4L73A 3ONVA 3SDSA 4I36A 3FIUA 1GU1A 1OBHA 3PXXA 4QBHA 4QSMA 4E46A 2QJRA 3IS3A 1FLDA 3L79A 4L5YA 3DAFA 4EYEA 4Z9XA 1UWLA 4IFTA 2AN4A 1I6MA 2Q3EA 1L3IA 2GEFA 3KJZA 3QKRA 5DN6D 3KLNA 4FVTA 4M7WA 4MWBA 4EEXA 3ZD9A 4ZEMA 1E9SA 3KV1A 1V5FA 3N2EA 4M1YA 4JLNA 3OQHA 3GZ4A 3F6SA 3MHPA 4REOA 1E6LA 1Q6YA 3CLKA 3BFVA 3FHLA 4GLFA 4UD2A 1MG0A 4JJ8A 4WL0A 3NHJA 1HY3A 1IBKB 4K1XA 1W8IA 3FYDA 4Q66C 4WKNA 2CXXA 3RM3A 4G5RA 2P6OA 4ALKA 4I1IA 3FYSA 3K0KA 3UJCA 4YJFB 2YZ2A 1SXJD 3HYLA 1K2VN 2C2BA 3EIQA 2QGFA 4MS1B 4ZP1A 5JVDB 5KYUA 2DSTA 5DNWA 1LK5A 4X61A 4CVNA 1C80A 1PNVA 3CBGA 2F8SA 3QBVA 4GPTA 2J7KA 4RVOA 2XBLA 1XTSA 2WUGA 1S6YA 1R12A 3L8EA 2PGOA 3CLRD 3RRXA 2XCOA 3HB5X 3BS4A 4ZGBA 4QECA 4A8HA 1PSZA 1H1TA 4MYCA 2VXYA 3X1KA 2ZAIA 3RABA 1EBBA 2OK7A 1JXQA 4MSUA 1DC8A 1OT3A 2Q8NA 2VVTA 3NEPX 4B3BA 2JJ2A 4BBPA 2WM8A 5EJIA 3RLIA 2FAXA 3VSBA 3DZKA 3GARA 1KDPA 1Q83A 3IT1A 3K20A 4MYDA 2FDCA 4AKEA 4Q7MB 3C3JA 2CHEA 4NZ9A 1JEQA 2NQ8A 3K3PA 4V0ME 2W48A 2ZATA 1W87A 4B35A 3IB6A 3T1TA 3ABIA 1QXSA 3NC0C 4Q24A 2Q7OE 3L0DA 2I66A 4CMIB 5BWBA 2IXEA 1I2DA 1TK3A 4U6NA 2GBGA 3MQFA 4INAA 4U7JA 1CUXA 1N5LA 2C9DA 4LMBA 4XPZA 1HG0A 1KIAA 4L02A 4P4UA 3UTCA 4UBOA 2E9SA 5U4XA 3NPMA 4QTZA 2FZLA 4A1FA 1O8BA 3I01M 4ARZB 1E9VA 3H3XA 2VS1A 3NHMA 4YMSA 4D8YA 1JQJC 1C1DA 1OFUX 4ZXFA 1SXJC 5AVYA 1HWYA 3B78A 5KWEA 2IC5A 1E2HA 1XZQA 3IP3A 1UT5A 4RBNA 4ZREA 3JAKB 1XZCA 3JQGB 4Q9DA 3MK31 2DKFA 4BE4A 5CEEA 2JI7A 2R00C 3FSGA 5MN6A 3KWLA 1DWQA 5P21A 3WYBA 2A58A 2EARA 2J6CA 1M2VA 3KG2A 4FFBB 4DLNA 5BSWA 1U28C 3F96A 2F9LA 4HB4A 1FRFS 2PUTA 4I9NA 5B3KA 3ER9A 5DJ5A 5DK4A 5BV1A 1ZICA 1G66A 4C6TA 3H19A 5I8WA 2FSSA 4AK9A 2YWJA 3C7KA 1MB2A 1UC4B 1YZNA 5IK2A 4AY3A 2OBYA 1MOPA 3STVA 3MB8A 1YS6A 2HDOA 2G9RA 5BW4A 4O25A 4UU7A 4L7QA 2Q3CA 3OA2A 4U00A 1XSEA 2B7BA 3HCFA 5EFZA 3TVTA 1KO4A 1P9LA 2NZYA 2FFAA 2QWXA 3R4VA 3BIOA 2AJCA 1MGOA 3MPUA 4KX5A 1D6NA 4LOLA 3EW9A 4R2KA 1U3DA 5JRZA 2QZJA 1MDBA 1EDBA 4KKVA 2G06A 3O93A 3OM0A 4H6VA 4BVKA 4G81A 3DDZX 3MGCA 1CJKC 4GYWA 5PNTA 3KPUA 1ONSA 1ODJA 3ZXUB 2HREA 2IHVA 1M67A 4DG5A 3V4VB 1TCVA 4Y1GA 3KJFA 1XAIA 1W5FA 1A7UA 3LDGA 4UZEA 2HLDD 5L3QA 5AR1A 5LKRA 3OEED 2YXDA 5LP6A 2JBWA 3EOBI 4C88A 1QFMA 2CHGA 4C0LA 2GK4A 4MWZA 5JAIA 3WL3A 1MJHA 4NH4A 3IJRA 5EPOA 3WGHA 4MKHA 4K0RA 2HM7A 3MUEA 3NBYC 2AN5A 4YQZA 1QV7A 3HSKA 5H9WA 2MSKA 2WHPA 3DMFA 3JQEA 2XHEA 4R0VA 2A0KA 2YN2A 4US0R 4HT3B 2D3TA 4DSOA 3TW8B 2AN9A 5T67A 5JFGA 1OLUA 4HWRA 4V38A 2YX1A 5EWMB 1JFSA 2WJIA 3OJ0A 3S2EA 5EGNA 5LA6B 4B6JA 3TTYA 1SVMA 1FFHA 1T8TA 1OTHA 1T9CA 4HB2A 3ZWAA 1HLFA 3H3FA 2PVPA 5IVDA 4IZ6A 5MGBA 1E2QA 1T0IA 3ICWA 4YFVA 3PQEA 2N1BA 5AM5A 2ZKLA 3VKGA 5J5CA 5IUJC 1T1RA 3KB2A 1SUDA 4XIIA 2FLKA 5AI9A 1Z6YA 1C9NA 1K3UB 3PHIA 1HYGA 4OHMA 4JB0A 4AQYB 1G21B 1OWOA 2P77A 3I6YA 5KX5A 1JB1A 3K1TA 5LZ7A 3T4UA 3WKCA 1IZ9A 4JFAA 4XOUA 1ZK3A 4X97A 5EJMA 3S29A 4ZYZA 1NOIA 3RWBA 4QFCA 4MVJG 4ZOLA 4C5CA 3ON5A 4UDXX 1QYCA 2V5UA 4N49A 4UCQA 3KLPX 2PS1A 1EZ4A 4ZYYA 3SOPA 4EG5A 1UH5A 3N28A 3GP8A 4FMPA 2PKEA 4ZYXA 1J1UA 2G0TA 3L7OA 1VPWA 5ECGC 4DPMA 3ITDA 1PL0A 2I71A 3FYUA 5FWXA 3VR4A 5C8YF 1BVYF 5JCJA 5IYZF 4CEJB 1AJEA 2QRQA 3L49A 2EBFX 2IL1A 1CQIB 2IUFA 3KQYA 1W5AA 5B4UA 2QAGA 1FLAA 1Y3CE 2N42A 3IODA 3LVRE 4OSOA 3RWMB 3WFZA 2VQ6A 4E2WA 4WDQA 4Z1MD 3DEKA 2PH3A 3CE9A 4FLEA 2Z83A 4IDFA 1IN6A 4BFZA 5G0WA 4OXYA 5JAQA 1DXOA 4MYSA 3KK0A 1GHTA 1VHJA 4Z2YA 3WFJA 4BMCA 4C6RA 5BXQC 1P0CA 4BZQA 1XRNA 2WP8J 1A96A 5LOVF 4MICA 2I6GA 3DE2X 4V0NA 4UUOA 1S5PA 5WRFA 4AJ2A 2O8BA 4TKVA 2R5NA 4HGZA 4OHBA 4WXYB 1W88A 4DSAA 2WJZB 4UVGA 3OAAA 3RYFA 1E1QD 1MF7A 3ENNA 1A8QA 3UT5B 5AXCA 1K92A 1S8OA 2YOFA 1XL0A 5K4AA 3DP9A 5ER6A 5IM5A 1ML3A 3ZS9A 2HCFA 4X1YB 2AWOA 4GC5A 1Y98A 4U9HS 3PIDA 1EE2A 2GRAA 1DHTA 4DUPA 1TKBA 1R66A 4HXYA 4OQNA 3VR3D