1P77A

Crystal structure of shikimate dehydrogenase (aroe) from haemophilus influenzae
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
265
Chain Sequence
b'MDLYAVWGNPIAQSKSPLIQNKLAAQTHQTMEYIAKLGDLDAFEQQLLAFFEEGAKGCNITSPFKERAYQLADEYSQRAKLAEACNTLKKLDDGKLYADNTDGIGLVTDLQRLNWLRPNQHVLILGAGGATKGVLLPLLQAQQNIVLANRTFSKTKELAERFQPYGNIQAVSMDSIPLQTYDLVINATSASVDAEILKLGSAFYDMQYAKGTDTPFIALCKSLGLTNVSDGFGMLVAQAAHSFHLWRGVMPDFVSVYEQLKKAML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of shikimate dehydrogenase (AroE) reveals a unique NADPH binding mode
pubmed doi rcsb
molecule keywords Shikimate 5-dehydrogenase
source organism Haemophilus influenzae
molecule tags Oxidoreductase
total genus 98
structure length 265
sequence length 272
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1p77A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1p77A01
3A1NA 3TJRA 1U1IA 5LDHA 1JVBA 4AG3A 3VAZA 5JLAA 1Q7GA 3HB4X 1X0VA 3AJRA 4ZRMA 4ZQEA 2ZQZA 4DIOA 4FFPA 4UVDA 4EYEA 4CUZA 1FDVA 2P2SA 2YQ5A 3HNPA 3Q0EA 3ZWPA 3GVCA 5B4UA 3ENNA 1C3VA 2NUAA 3MZ0A 5K9ZA 3FTPA 4CLRA 3DBRA 4CQLA 2BGMA 2B4QA 4FC6A 4A10A 2CUKA 2JAHA 2LDXA 3F5SA 4E3ZA 1GPJA 3TFQA 5JY1A 1SMKA 1GQYA 3UHAA 3MCVA 5K6AA 3GNQA 3ITKA 2HK9A 3JQAD 4DPMA 1MG5A 4HFNA 2X5JO 5C7LO 3RKRA 1QSGA 1JWAB 5EL0A 1I3LA 2YFQA 3ZWMA 4DPKA 1I0ZA 5MGBA 1L7DA 3DB2A 2YDXA 1A7KA 4MKXA 1MC4A 4BO2A 3EW7A 4XR4A 1K3TA 3BTVA 2CVOA 3SJ7A 1QYXA 3VZQA 4WJZA 5KOIA 1NXQA 5CFZA 3Q2IA 4BO5A 1J0XO 4K6FA 4D79A 1I33A 1YO6A 3CIFA 1N8KA 1SB8A 3G0OA 2WM3A 3WGYA 4E2ZA 4XQEA 5G0UA 1Q7CA 4BO4A 1F06A 4HX5A 4XRGA 3ORFA 4IJUA 4UUOA 2P68A 1T26A 4B4OA 1X1EA 5IZCA 4JP3A 3HDYA 1P31A 2VTDA 3ZHXA 1WW8A 2WMDA 5IG2A 4WOJA 1HZZA 3ZNPA 3A28A 5FFFA 1O5IA 4CMIA 2EERA 3INTA 3KM0A 4TWRA 3BMOB 3HADA 3C8MA 2Q1SA 3BXXA 1YL6A 3W4KA 5I9LA 1HWYA 1IL0A 4JJGA 3PIIA 2PV7A 3WBFA 3RUHA 3SC4A 5CDTA 1XIVA 1B8VA 1M2WA 3O8QB 4FFRA 4RQTA 1WPQA 3JQEA 3H5AA 1EK6A 3OIDA 4IDFA 4JCOA 4EBFA 1RM5A 2Q45A 3LT2A 5KVCA 2R6JA 1XR3A 3JQ6A 1ENYA 1RYEA 4IMRA 1B15A 3LF2A 2J3JA 4LISA 2E4AA 4RVUA 1I2BA 4ND4A 3MOIA 3M1LA 2OP1A 1GV0A 2HK7A 1EUCA 1MFPA 3VKVA 1BXGB 3O38A 3IUPA 1M6WA 3OQ1A 4IBOA 3TN7A 2O50A 1E1LA 1V3VA 1GY8A 1GU7A 2OMEA 2BFMA 2EIHA 1U8XX 3GPIA 4ND2A 3WTCA 3H5NA 5JO9A 3HDJA 3S8MA 1H2BA 1P33A 4NU6A 4KP7A 3D3WB 5I9NA 4PLYA 1PQUA 2HMSA 1YJQA 3K2EA 1E3WB 1ZFNA 2D8AA 2VRBA 2EGHA 3ZH2A 2BKAA 1M75A 5ICMA 3L4SO 3WIDA 3TZ6A 4LSMA 5T57A 1NPTO 4CM1A 1LNQA 4CMHA 1W4ZA 2HJRA 1KEPA 5DOZA 3AFNA 1SEVA 1C14A 3OH8A 1TEHA 1ZNQO 4KTVE 1Y9AA 4ID9A 9LDTA 1H9BA 3GRKA 2J5RA 4J2HA 1HTBA 1D7OA 1OBFO 1Y8RA 1PJBA 3KSZO 3GNSA 1GL3A 1O8CA 2WE8A 1RM4A 1E5QA 2AW5A 3E82A 4CUJA 1FJHA 2D3TA 4II2A 1JTVA 2E49A 1MG0A 2VHVA 4NBWA 1DBVO 2EWMA 1YL7A 3AI2A 1E77A 4BV8A 1DIAA 4R9RA 5G4KB 3QA9A 3W8EA 2PGJA 2GERA 3OA2A 3V8BA 2B36A 3VPXA 4OKIA 4QSMA 3TWOA 1UDCA 4I9UA 2DBZA 2Z1NA 3U4CA 4CQMD 4UVGA 4A27A 4EI2A 1TVEA 1K2WA 2QHXA 4BUCA 3JQ8B 3N74A 2OGUA 3OJOA 1LU9A 1LA2A 3W6ZA 1WWKA 4BNGA 4J1NA 2NVUB 1EFKA 2ZB8A 3C3XA 4O63O 3DBRB 2YV1A 2VNSA 3LK7A 1M66A 2UAGA 4JJFA 4PZEA 1DRWA 2NSDA 4Z9FA 1PR3A 3M6IA 3FWNA 4J7UA 3F1KA 1TT7A 4G5HA 4M86A 2Z1MA 4QT0A 4ALJA 3VPHA 1EBFA 4AJ1A 1FDSA 4A2CA 1BTOA 5IXSA 3GUYA 3JCZA 3CUKA 5A06A 4MVJM 2CD9A 2XPCA 1EBUA 1HF3A 4RCVA 2P91A 3KYCA 4PLCA 1HT0A 5BNIA 3F5QA 3K96A 2HO5A 4AJEA 4K28A 2W2LD 2FR1A 2EW2A 2HMWA 1E3SA 2ZCVA 3K5PA 4OAQA 4EUHA 1Z73A 2B35A 4DIBA 5JFOA 4MJLA 3ROKA 3RKUA 2GN9A 3KOUA 2VUTA 2EKPA 4GX5A 4CMGA 2HDHA 1C1DA 1ZK4A 3WSVA 4RVFA 2G76A 2UUOA 5L40A 1OC2A 4NFSA 3G49A 4MIEA 3PIDA 4JQCA 1EVZA 1SOVA 1B2LA 3L9WA 3PHHA 4CM9D 3BHMA 2PGDA 1UP7A 4RO0A 4ALMA 2O2SA 5HBRA 4J90A 1LLUA 2VT3A 1E7MA 4TZKA 4YT2A 1ZSYA 2WWRA 1PTJA 4Z0TA 2RCYA 4J3FA 1DFHA 1ONOA 3WG9A 1ULSA 2DBRA 3AOEA 4U0KA 5BNTA 4XZ3A 5F21A 3WMWA 2YV3A 4XR9A 4AJ4A 1JW9B 1VKNA 3LLSA 1DOHA 3TPCA 3DHYA 3LF1A 1HXHA 5T8KA 3GMDA 2BGKA 2FRDA 3TZKA 5JMPA 4BQPA 1BXKA 4IS3A 4F45A 5A9SA 4WOKA 5TJ9A 1FDUA 4L4RA 4P38A 4RVSA 3NEPX 2JCVA 3ON5A 1I5RA 5JW6A 4R4JA 1H6CA 4P4GA 1NFRA 3R1IA 4M54A 1EDZA 3KYDA 4NU5A 4CMCA 2EJVA 1G0OA 1X7DA 2O3UA 1GD1O 3QLJA 5AXCA 3ZV3A 2BLLA 2O3TA 1ZMTA 4FSHA 4PLHA 5JDIA 1Q0LA 4EZBA 4WCFB 4E5YA 1JN0A 4D46A 1GADO 3VC7A 5CPFA 3WYBA 1BVUA 3FSRA 3PJGA 4MIOA 2NU6A 1WDMA 1ZIDA 1BW9B 2X4GA 4L9RA 2AQHA 3AY6A 2GZ1A 1P74A 1Q2XA 5I7FA 1W8DA 3WDSA 5KJ1A 1UP4A 1E3EA 3RIHA 1EEHA 1MUUA 4LW8A 2PWZA 4KUGA 2J3KA 3D0OA 4I1IA 4IY1A 4FGWA 2ZCUA 5KCZA 3UFXA 4MVJP 4QX6A 2YUTA 7ADHA 3L0DA 4W6ZA 3UOGA 4GPD1 5IAAA 3NJ8A 3H6KA 2HRBA 4CM3A 2OO5A 3QRWA 4HNGA 2OXIA 4PN3A 3F6YA 3H3JA 3E9QA 5BT9A 3LC7O 2Y68A 3I4CA 3V2UA 4E33A 4J4BA 1FF9A 1TT5A 3FD8A 3QWHA 3ONDA 1VPDA 4J7CA 2G1UA 3OECA 1Y81A 1ZJYA 4P4LA 2Y67A 1WZIA 3ANNA 3ASUA 1PGNA 3IP3A 5L51A 1N9GB 1ZXBA 1VM6A 3GEGA 3M2TA 5BSHA 3U3XA 1SC6A 4AJIA 3QSGA 2DBVO 1DSSG 3D4NA 2VHWA 3A9WA 4PLGA 1ZBQA 4FCCA 5DNAA 1P1JA 1FXSA 3WOHA 1U28A 2VZ8A 3PP8A 3UW3A 4GI2A 1F8FA 3BMCA 2B69A 1IZ9A 3TRIA 1QKIA 1VKOA 5JSFA 3QVOA 2FY8A 5KVQA 1L1FA 3IIEA 3ZN2A 4C7JA 2OBNA 4YAEA 3JQ7A 4GKVA 3QIVA 1Y9EA 3GDGA 3I83A 5A3JA 4HNHA 5AOVA 1IHYA 2HUNA 4HFMA 4IDDA 3GOHA 2C5EA 3OIFA 5AYVA 1LUAA 4DMLA 1T4DA 2RH8A 2W8ZA 1PS8A 4KTTE 4B3JA 4KUEA 3SXPA 1V9LA 1C1DB 1KVUA 5EMHA 3W8FA 1ULUA 3DMTA 1Z82A 3QQPA 1YVEI 2DFVA 1UAGA 2WEKA 3JQ9C 4GGOA 2FSVA 1DDOA 4MKRA 2NADA 1OC4A 2EW8A 5CEJA 3KTDA 1LSUA 3ETDA 4RZHA 1EUZA 3S2EA 1DIGA 1EZ4A 1T1SA 3A4VA 4OIMA 4GX2A 1ZSVA 4BMNA 5C5IA 1VLLA 3K9QO 4O59O 4WGGA 1Z74A 4IM7A 2RH4A 3GG2A 1I01A 1ZW1A 3RFVA 3B70A 4JK3A 3ZU5A 3DC2A 4YDRA 5IN4A 1R0SA 2Y66A 3H9QA 4PG8A 1ISJA 2PKRA 2PTGA 4E30A 2UVDA 3E9NA 3AW9A 1WVGA 4DA9A 3I9JA 2JD2A 1BHSA 3D7LA 4E4YA 4NFYA 3ZV4A 3DOCA 4QFDA 4BMSA 1EQUA 3OM9A 3WIEA 1BMDA 4PLPA 1NASA 4E6PA 1PS0A 2R00A 3E6AA 4LCEA 1O95A 2Y1GA 3NX4A 1E6UA 1EE9A 1GV1A 5JO0A 3Q9NA 3RC9A 3DMTC 3LT4A 4IQ0A 4CR8A 2JFGA 3D1LA 2ZTVA 1PWZA 4RV9A 2UV8A 2ZIZA 3QWBA 3KEOA 4ZRNA 4Q39A 1B0AA 3PZRA 1P44A 2VTEA 4FJ1A 1X1TA 2AG5A 2VZ0A 5CDSA 3VZSA 3CSDA 1ENOA 3QJ5A 3FI9A 2RHCA 4J43A 4J2OA 4EJ6A 3IOYA 4GMGA 1XHLA 1CRWG 3K6JA 5KNLA 2ZK7A 1ML3A 6ADHA 1ZMOA 1KEVA 2QG4A 3FNGA 3LVFO 4BL5A 4NJOA 3FPLA 4JGBA 3JD1A 2BFPA 3ICPA 1E7SA 4PG6A 4YJFB 1K0UA 1E1MA 5GZ1A 2BHLA 4W99A 1HSOA 4E13A 1N1GA 4FBGA 2BH9A 4CM4B 3RU7A 4LCJA 2ZQYA 1LRJA 3VH3A 4B3IA 1TXGA 3DOJA 1KETA 3PEFA 3WICA 3GPDG 4RLHA 4BO0A 2VRCA 3BZUA 5DBGA 4C4OA 3HDQA 2O23A 1UDAA 1E3LA 3OJEA 4NZ9A 1E0DA 5DZSA 3UH1A 4M49A 3FWZA 2R00C 1XYGA 2ZJ0A 4NQZA 3ONEA 2OP0A 1HYHA 2BGLA 2NQTA 5AXAA 3WYEA 4A26A 4CM7A 2UYYA 1P1IA 5C3MA 1NQTA 3NGLA 3OQ6A 2HLPA 3ICCA 3CEAA 4HFRA 2OUIA 4N5LA 2PH5A 1I10A 4GAEA 3RCBA 4CLHA 1YQGA 1LDEA 2QX7A 2X9NA 3PQDA 4DQXA 2X23A 3GUCA 5F1PA 2VN8A 3A14A 3F47A 1XU7A 1QXSA 2E82A 3DMYA 1P3DA 4UREA 1WMBA 2GD1O 3UUWA 1HDCA 1IULA 4FPXA 1T2CA 1T2FA 4YTEA 3DR3A 1P1RA 1UXHA 3E03A 1O0SA 9LDBA 2YJZA 2BD0A 1E7YA 2QRLA 1PIWA 4EDFA 1EVYA 3BMOA 2Y0CA 1U8FO 3BMCB 5HTOA 1F14A 4YQZA 2DBQA 4YACA 2QRKA 5LCXA 3DZBA 1KEUA 1HEUA 3E48A 5A9TA 1BXZA 1HYGA 1WXDA 3DZFA 4W9NA 4Y6PA 3UCFA 5KTKA 3OICA 3W4IA 2NNLD 4J91A 1H2HA 4IDAA 1E1NA 1YQDA 2YHUA 4R41A 2LDBA 2AE2A 4P22A 4PRLA 3V1TC 1MP0A 2TMGA 3HFSA 3UKOA 3EC7A 4NJMB 4MPDA 1GPDG 3G17A 4RJTA 1GAEO 4XYLA 4W82A 4WUVA 3PWKA 2NLOA 3MJTA 2XAAA 1WP4A 4FGSA 5HS4A 2A94A 4GWKA 3UF0A 1DHRA 3EZYA 4LVUA 3ROQA 2V7PA 3VH1A 4XYEA 3UGKA 2O3QA 3D3WA 5A3VA 2FN7A 4CMKA 1NAHA 2OORA 4IGFA 1PL8A 1E3WA 1JU9A 3FR7A 1U7TA 4BGIA 1YBMA 2FR0A 3LQFA 4UULA 5C37A 3QWAA 5C7OO 4N5MA 1SO8A 1Z45A 4B8WA 1AGNA 3ZW9A 3ZHZA 4KDEA 3WQRA 4TRRA 4A73A 5BQFA 4L4SA 4Y6SA 2VQ3A 3GC6A 2D0IA 4RPGA 3DQPA 2D5CA 2JKVA 3F9IA 3JTMA 2W2KA 5TGDA 6LDHA 3PGXA 1DRVA 1UH5A 2Q4EA 4YJHB 1DB3A 3BIOA 1QV7A 5K0ZA 5FI3A 3CPSA 1NPDA 2FZWA 2NVWA 4FW8A 3L9XA 1JQBA 4A0SA 4CM8B 4YAJA 2Y1DA 3RBZA 1N1EA 4FJ2A 3G3EA 1NWCA 5G4KA 1JKIA 1PZFA 4J9UE 3K31A 5H81A 1DIRA 4R5MA 2I76A 3DZIA 2V6BA 1C0KA 1FDWA 3EVTA 3H2SA 4FOOA 4DVJA 4WNIA 5JY6A 4Q3BA 3JQ8A 3HB5X 5L7YA 2CY0A 2PZJA 3ZWAA 3FNHA 3ITDA 2RAFA 4JBHA 2A92A 2NVUA 4FFNA 4BIIA 3NYWA 4YRAA 1EE2A 4PG4A 1X7GA 2G82A 1ZEMA 2WYVA 3T7CA 3ZI0A 5F5LA 2SCUA 3GN1A 4GH5A 3ZNNA 4D7AA 4X54A 4WEOA 1UXGA 1UR5A 3N7UA 2NTJA 1DPGA 1VJTA 3WJAA 1NQOA 2QZ9A 4JX8A 3TL3A 4RF3A 3WGZA 5DN9A 5CPBA 1VJ0A 5JAZA 3HZZA 4LGVA 1GFSA 5GY7A 1H9AA 4DREA 5A5EA 2CZCA 3KV3O 3E8XA 3D5TA 4YT5A 3JQBA 1ZKMA 4PVDA 1LBEA 2O7QA 4N7RA 3CZRA 4J4HA 1QRRA 4NR0A 4B7XA 3IUSA 3DZGA 4RPKA 4ZICA 5HM8A 4GX1A 2PY6A 2GYYA 4CR6A 3DBHB 4DLBA 1ISHA 4CLDA 4I5EA 4MVJA 1E5LA 2ZB4A 3HG7A 3HJAA 2I3GA 4IXTA 4P8RA 5KJCA 4BKPA 1U3UA 1LDGA 3L6DA 3I5MA 5DP1A 4FR5A 3WBBA 3LZ6A 3G79A 4BVAA 1U7HA 1U3TA 4J4TA 5K6AC 2W4QA 3C1OA 2RBEA 3INGA 4TRJA 3TOZA 4NBVA 1WAMA 2ZTLA 3BHJA 5JYDA 2ZTUA 5HWSA 3DAPA 2Q50A 3P2YA 4CV0A 4ROSA 4BOYA 2AEJA 1C1XB 1IE3A 4FQ8A 2DFDA 4HXYA 2IXBA 2Y0DA 1O89A 4BMVA 3WGHA 3W8DA 1NHWA 1PSDA 3KSUA 4XGNA 4QEDA 2FHSA 3JQBC 4MOWA 1LRLA 1DLIA 3PDUA 1WDKA 4IDCA 3GFGA 3KLPX 3U4IA 3VVBA 1Z75A 2E37A 3JQDA 1V3UA 5GZ3A 4L4XA 2VWGA 4J1TA 1ONNA 3I4FA 1NBOA 5CP8A 4JJIA 1WMAA 3EY4A 3LC1O 4PLTA 5AVOA 3X2FA 5IZCC 3GHYA 3L6OO 4KZPA 3GRPA 2QYSA 4J16A 1JA9A 2H63A 3ZNQA 1SEPA 3DAFA 3JQFA 3E5RA 3L4BA 4XYGA 5JCXA 1PL7A 4AJPA 2G5CA 3RUDA 4WCFA 3F1LA 4DMMA 2QZZA 3HQ4O 1UXIA 1I8TA 4DTIA 1BW9A 1QMGA 1EVIA 1YQXA 3WTBA 5HS6A 2YDYA 1O9BA 3KSDO 3NTOA 5AXBA 4BNNA 3GFBA 4R1TA 4EEXA 2DTEA 2X0IA 8ADHA 3EMKA 1G1AA 2AQ8A 4KQWA 3VH4A 4IPTA 1GZ4A 1JLLA 4D42A 2JD0A 2OZPA 2W2KB 4UVHA 3RWBA 3V1UA 3NAQA 1S7CA 2F00A 4MIYA 2D4AA 1KVQA 1R0KA 1PJ2A 4HKTA 4WK6A 4XKJA 5JNLA 2HJSA 1YRLA 4W4TA 3FBGA 4HADA 1HSZA 4MKZA 5COQA 1ENZA 4WLNA 1LQUA 2AG8A 4XDZA 5CAEA 5F1OA 3OMLA 2ILTA 2ZB3A 3FRJA 2Z5LA 4EITA 1KERA 1HETA 3K30A 4AJKA 5L4NA 5TLSA 2QYTA 2FPGA 1E3IA 3EGOA 1K89A 4TSKA 3L4BC 3GLQA 3RC7A 3OP4A 1N9GA 4IMPA 4CLOB 3K92A 2XF8A 4YJGB 1X7HA 2VOEA 1NM5A 2PGLA 1KY4A 1X0XA 2VRCD 5ER9A 3H8VA 2H1SA 1PGOA 4KUHA 4L76A 1U5CA 5JPIA 4MDHA 4OH1A 1ZUD1 4WASA 4YAIA 2VUUA 1ENPA 4L8VA 3Q9UA 4IZIA 2WSBA 3GHHA 1PJ3A 3I9NA 3OIGA 3HFGA 4RVHA 5KJEA 1M76A 3GVHA 3QP9A 1FK8A 3GEDA 3BHIA 1RM3A 4AJ2A 1DAPA 2Q46A 1GUYA 3ASVA 1N5DA 1IOLA 2DTDA 1Q1NA 2J8ZA 2Y1OA 4ND5A 3RC2A 2QW8A 3T4XA 4BO7A 4AJOA 5JYEA 1A4IA 4D45A 4OQZA 4RORA 3R3SA 5B4TA 1NFFA 4J1QA 5I8WA 1E7WA 3JYLA 3C7DB 3PGJA 4KMSA 5MDHA 5IF3A 1VSVA 3S2FA 1HZJA 3JD4A 4JIGA 4BGEA 1OAAA 1E92A 3WNQA 1PU2A 3VOSA 2QQ5A 2EG9A 1PQWA 4XYBA 5CG2A 2AEFA 2DC1A 3ADPA 2CF6A 3AI3A 5G0VA 1ZJZA 4TVOA 2X5KO 3GNTA 1DC3A 3DZKA 1LDMA 4LRTB 2X8LA 4F46A 5A1TA 1Z7EA 3PHLA 4UUPA 4I5DA 5A03A 1KBZA 2OHXA 2YQ4A 2C2YA 5A05A 2NTVA 3UVEA 2C2XA 4CODB 3W6UA 4JBIA 5EPOA 5CDGA 5GMOA 3E18A 3NT4A 2H6EA 4I9NA 4BNFA 2WTBA 1DFIA 1BG6A 1OZAA 3GH3A 1S6YA 3QWIA 1YKFA 3DTYA 3H3FA 3GT0A 2C59A 2J3IA 1ZK1A 2OFPA 4BNHA 1NPYA 4YXFA 5I9MA 2AEMA 4LVCA 2X5OA 2C7VA 4ILKA 1PS9A 5FWNA 4UUMA 1U3WA 1DIBA 1RKXA 3I52A 1N7HA 4IZHA 3JYOA 5L9AA 1N7GA 4BNXA 3LC2O 5G0TA 2JAPA 1RWBA 3DHNA 2GASA 3WQSB 3GF4A 5ILOA 3WFIA 1EVJA 1Z6ZA 5KKAA 3KXDA 4E0BA 4M87A 4PG5A 3AWDA 4R51A 1RYDA 5ENDA 5ILGA 2AA3A 1I3NA 3PFWO 4OYRA 4XGIA 1YDEA 3C1TA 1J5PA 2NACA 3ZWWA 1GYRA 1P1FA 4BNMA 2I6TA 3EAGA 3S55A 3CINA 4ZJUA 4NNJA 5H82A 1ISIA 1BVRA 2IODA 4YJFA 3GGGA 4INAA 2GF2A 3QE3A 3F4LA 3AOEC 4AJJA 3VHRA 1NFQA 4CM4A 1PR9A 4XWYA 2NQ8A 3WX0A 1U4OA 2OBYA 1SB9A 5T8KC 3U4HA 4XD2A 4YT4A 3H65A 1T2AA 1EQ2A 3AUAA 1EMDA 2VYNA 2J3HA 4YT8A 2P5UA 1XKQA 1E7RA 2O2YA 2I5PO 3UCEA 1I36A 1PQPA 5JS6A 4NH4A 1I3MA 3F4BA 1YL5A 2EJWA 1QYWA 4Y67A 5L4LA 3DTTA 1UZMA 1FDTA 3NTRA 3GEMA 3O9ZA 4CL8A 3ZV5A 2B5WA 4FC7A 4JROA 2FR8A 3PWSA 3V5NA 5L7WA 3RUEA 3BMNA 4W7IA 3UCXA 3FNFA 3V2HA 5JDIC 4D43A 5KKCA 2DKNA 4P4NA 3C1AA 4ND1A 5KJ6A 4NBTA 3O26A 3OF2A 1HE2A 3VVCA 4OXNA 3WB9A 1E1KA 3LSYA 4YAGA 2V6GA 4E5MA 1LSOA 1LQTA 2BI8A 3VH2A 3INRA 1H5QA 2O3RA 1LLQA 4ZGWA 3DOOA 1Q7BA 3SJUA 5JXWA 3QVWA 1XG5A 5TT0A 1UP6A 1M67A 2FSSA 3P5SA 3PLRA 3E5MA 4BHTA 1Y5RA 2VWHA 3GAFA 3KBOA 4QO7A 2X58A 1B8PA 1YGYA 3BA1A 4MVJD 4WEQA 5EQFA 4H16A 2GGSA 2IZ1A 1NX6A 2D1YA 1YJ8A 1ONPA 1U5AA 2GUGA 3AI1A 4J7XA 4NJMA 3WJ7A 3IKTA 2PR2A 3WLFA 1NP3A 3RFXA 3KO8A 5DCUA 1MFZA 4OM8A 4CV2A 2DLDA 3PHIA 3RBVA 1PZGA 1GQQA 2VWQA 1N92A 4IJKA 3RSHA 3DAGA 2Q99A 2VUSA 2AE1A 3K8ZA 2HMTA 3RJ5A 4ZN6A 5G0WA 7MDHA 3BTOA 3BAZA 5DCWA 4ALLA 3S2IA 4E5NA 3ROMA 2WD7B 4FFLA 3EK2A 1AXGA 4OHUA 2JFFA 4TRMA 1AHHA 3QVTA 1B3BA 4EUFA 4YJDA 1MB4A 2POQX 1M6HA 3GK3A 4DGSA 3OJFA 2Q4BA 5CG1A 3CZMA 3DBVO 3ZHYA 3VTFA 4R3WA 5B12A 5IDQA 4R01A 3RD5A 4OGWA 1LRKA 1DLJA 3OEYA 4RPHA 4XIJA 4XJTA 1NQ5A 3EUWA 4QTZA 4AJLA 2JHGA 2Q2VA 3PLNA 4S3MA 4Y9DA 1A72A 4R1SA 4YJHA 4RF5A 1PJCA 1LC3A 4PFJA 2PD6A 4NIMA 2IZZA 4U5QA 4NK4A 4ZVVA 3MJSA 4RF2A 5BNFA 4CM8A 3FN4A 3GVPA 5G0SA 4WKGA 4XQ9A 4A5OA 1XELA 4GVLA 1DXYA 4XQCA 2GCGA 1R4NB 4HP8A 4M8SA 2JHFA 5DULA 3RUAA 2BFAA 1CF2O 2ZB7A 1D3AA 3TSCA 2V6MA 5JDCA 3M1AA 2GNAA 2O48X 1R6DA 1LX6A 1YDWA 2OL4A 2D59A 2P4HX 2GDZA 2PKQO 2Y1FA 3I9MA 3EZLA 3GAZA 3PQEA 4G65A 4WNCA 4XB2A 3VDRA 5IFLA 5DT9A 3SLKA 4PCVA 4TROA 4NHEA 4NFHA 5TQVA 2EF1A 4B8ZA 1IY8A 1V3TA 4Q3CA 1A9ZA 2FMUA 5IZ4A 2EV9A 4YRBA 1HDOA 4J9VA 3ADOA 2YHIB 2VCYA 4J0FA 4LN1A 2EKQA 3PPIA 3JQGB 4QO8A 1VSUA 3WWYA 4F6LA 1PJ4A 4WPGA 3TNLA 3GVXA 4MP8A 4AL4A 4CMJA 3AUUA 3FPCA 1ID1A 4GGPA 4HV4A 2J5QA 3TDKA 1AXEA 5ITVA 2GN6A 2JJYA 3B1KA 1T2EA 3HDHA 1XEAA 1P77A 4CMBA 1PJLA 2YZ7A 1KVTA 4ZQBA 1T2DA 3TF5A 4UEOA 1GYPA 3GN2A 1HYEA 4U6SA 1CEQA 3ABIA 4XIYA 8LDHA 5JE8A 5EERA 5COBA 4E31A 5A02A 1U2DA 2O4CA 3LT0A 3FBTA 5CEEA 1V0JA 4GLOA 2CF5A 1ADBA 1YB1A 3LDHA 4RF4A 4YB8A 4E2WA 1EUDA 4Z9YA 3I23A 4BB6A 3BMNB 3Q3CA 1MXHA 1JDJA 4LK3A 1E7QA 5F5NA 3COSA 3UN1A 4DRYA 3DBHA 3I9KA 4TMFA 4WLUA 3CMMA 3P19A 3C7CB 4II3A 4B4WA 3WGQA 1V8BA 3NDJA 1SAYA 4TZTA 1B16A 4GQAA 4K6CA 3JQAB 1P1HA 2GSDA 4IGEA 4MP6A 4Y8VA 1GUZA 2B4TO 2UDPA 3CXRA 3O03A 4WLEA 1KY5A 2CFCA 3WGGA 4FDAA 4XA8A 4RL6A 4YCAA 4CLXA 3NDRA 1YONA 4KQXA 3STHA 1CYDA 1H6BA 3WGTA 1IB6A 2EGGA 1C1XA 3ZU2A 3DZHA 3WYCA 2GRAA 1E3JA 1GDHA 1A5ZA 2ZYAA 1ARZA 4M55A 4Z3KA 2W90A 1ZEJA 3ZWNA 2JD1A 1GZ3A 2GN4A 2GPTA 3G1UA 1JVSA 4CMEA 4NBRA 4Q3EA 3TZCA 3BMQB 4CM5A 5L53A 4OKNA 2HMUA 1DC5A 4DQVA 1DHTA 3RJ9A 2IEDA 3PWZA 3IJRA 5ER6A 3BYZA 2Q1TA 3RC1A 4MVJG 2I9PA 3ZWCA 4R54A 3U5TA 1ZCJA 4BO6A 1VRWA 2B5VA 3FR8A 4TRNA 3S1LA 1F17A 3IMFA 3RAJA 3H7AA 2D5AA 3I6QA 4D0SA 3OSUA 3WNVA 1BDMA 5ES3A 4JNKA 3ZGYA 1IPFA 2X0NA 3H5RA 3CMCO 1I3KA 3FNEA 3IKVA 1HDXA 2HRZA 3VPFA 2EHDA 2O3SA 3AUSA 2X0RA 4GSLA 3WWZA 5ICSA 5KVSA 3V2GA 4YPOA 5A4DA 3ANLA 4W9NC 2GN8A 4BNWA 2I99A 4IDBA 1E6EA 4DC0A 4A03A 3MTJA 4JP2A 5JAMA 1W6UA 4A7PA 4K1LA 1RPNA 5DOVA 3UICA 1XQ6A 2XXBA 3SBOA 2P9EA 5LC1A 2A4KA 1KS9A 3OETA 4HY3A 1NYTA 1P0FA 2CSUA 3RBXA 3JYNA 3S2GA 5L95A 4OL9A 2O4UX 4DXHA 4BNYA 3IDSA 2E6UX 1E6WA 4BB5A 5BSFA 2G0TA 1B14A 3LT1A 3C24A 1AHIA 4TKLA 3QW2A 1X14A 1XSEA 5I8ZA 4B4VA 2NTNA 4CLOA 1T4BA 1UJMA 1VL6A 4XDYA 2IYOA 4YJGA 4EUEA 1V6AA 1ADFA 4YR9A 4GWGA 4BGUA 5TIIA 3KB6A 4N54A 2GLXA 4J49A 2CDAA 4IS2A 4BO9A 4PLVA 3H9UA 1Q0HA 1D1TA 4R1UA 4D3FA 1NVMB 3NJ4A 5EJ2A 1LDBA 3K2BA 5FEUA 1B3RA 5ADHA 1MLDA 3Q6IA 4RPJA 3O4RA 3U0BA 2V65A 5JCJA 5KWEA 2ZATA 4GBJA 4JN6B 3ZCXA 3N58A 3I3OA 3L77A 1PJSA 3MEQA 4D3SA 1HRDA 1J49A 3HN7A 2C07A 1UZNA 1ADGA 1KIFA 2AHRA 4QFCA 4D44A 1KVRA 3KZVA 1Y7TA 3IC5A 4OMUA 5IJZA 4CQMB 4PGFA 4ZQHA 1RM0A 1Y8QB 3ANMA 3FF4A 4Y6RA 2CVZA 1IPEA 1P0CA 1YOVB 4ZQGA 1VE9A 4BV9A 3PJFA 1CWUA 1PWXA 5JAIA 2WYUA 4BNZA 2PK3A 2H5LA 1YBVA 5JAQA 1G0NA 1LXCA 1PZHA 4L74A 1XLTA 4DLAA 4NK5A 4IJVA 1QR6A 1IZ0A 4E12A 3RUFA 1WZEA 3IAHA 2P4QA 2Z95A 3KHUA 4UEKA 4IQGA 4DYVA 1JKJA 3ZU4A 3AUTA 4BO1A 1BGVA 1H6DA 1U4SA 4O1MA 3D4PA 4XB1A 2CVQA 1D8AA 3B1JA 4IQ8A 4MVJF 3DHEA 4I5GA 3GR6A 4OQYA 1CIVA 2HSDA 3AFMA 3WR5A 1HDZA 2JFHA 3KEQA 4EW6A 1PJTA 4Z0PA 3R0IA 1ADCA 4NMHA 2NU8A 4BNTA 1HE4A 4XQGA 3SVTA 1AE1A 4YBZA 4B7UA 1MX3A 4CV3A 4R1NA 2I65A 5L3ZA 4IJWA 5DP2A 1ISMA 3ZWBA 1YWGO 2X9VA 4HFJA 4I5FA 1PGPA 4R16A 4ZD6A 2BRUA 4BO8A 4DBVO 3B6ZA 4NI5A 2D2IA 1IYZA 4OJNA 2PH3A 1C0IA 1R4MB 4BKOA 2RHRA 1GYQA 2DQ4A 5C7IO 3FCOA 2FP4A 1A27A 2JCYA 4BKUA 3TFOA 3AM4A 5IN5A 4DBZA 3F3SA 3TQHA 2O3JA 1GR0A 1P1KA 1Y1PA 3BTSA 3KUXA 2C54A 3OEWA 4FD3A 4Q3AA 4Q9NA 1TLTA 3NDIA 5L4SA 4RVDA 2HAEA 2Q2QA 3GGOA 4MVJH 3E9MA 3RASA 4C7KA 2IEBA 2C7GA 4KWIA 2VWPA 3H4VA 2AQKA 3RVDA 2PNFA 5L45A 3GZNB 3CKYA 1DAOA 4N18A 1HLDA 3QV1A 1LSJA 1MXFA 2X0JA 3NGXA 4LRSB 1C0LA 2YFHA 1UDBA 1GZ6A 2XXJA 1LEHA 1HDGO 2HKIA 4BGVA 4RQUA 4IUYA 3GDFA 2NWQA 4BKRA 1N2SA 4YWJA 4YA6A 1W0CA 5BSGA 4UUNA 3Q11A 2I3AA 3FTNA 4E2XA 1LJ8A 3JQFC 4MVJE 1LDNA 3PTZA 2B4RO 2VT2A 1SPXA 4UAGA 3MOGA 4YAKA 1I32A 3ENKA 4WCFC 1YS4A 4ALIA 5A5FA 4FN4A 4YQYA 1H93A 3M2PA 2TMDA 4PRKA 3EYWA 4DC1A 1F0YA 2PZMA 1QP8A 1U2GA 3PDJA 4Z9XA 5J23A 4GX0A 2B0JA 1NHGA 1ORRA 4LMRA 2DU8A 5GZ6A 2I66A 3H9EO 1XGKA 3F46A 3L6EA 2BF7A 1TB4A 1WLYA 2VYVA 4G81A 3RUIA 1ZK2A 4H7PA 2EP5A 2IXAA 5ITWA 1IUKA 1H0KA 3K73O 3PYXA 4PVCA 3GY0A 4QQRA 3WXBA 4DL9A 4GLLA 4CLEA 3MJEA 4KDFA 5T64A 4CLRB 1UAYA 4CQLB 4L73A 3MJCA 3GQVA 4DWVA 3MJVA 3U49A 1HDYA 2XOXA 2C82A 5HA5A 4WE3A 2V6FA 4B4UA 1X15A 2P9CA 3CTMA 3KVOA 4FIZA 5IDXA 2NU9A 5CHEA 3RQSA 4PIVA 3P2OA 1XCBA 3RI3A 4S1VA 2Q49A 4PG7A 3NKLA 2J5KA 1LLCA 4K9DA 3JV7A 5EIOA 4UVIA 3PVZA 2ZTMA 4OXYA 3AU9A 1ZK0A 3GA0A 1VL8A 1R15A 5T5QA 2BELA 3JYPA 5THQA 3JSAA 5B4VA 2P9GA 1KC3A 2R2GA 3PZBA 4I08A 3WQQA 3TZHA 3ZWXA 3TL2A 3RFTA 1Y5MA 1R37A 1KC1A 4DIFA 3ZZNA 5DCYA 4BNIA 2WD7A 2X86A 1QORA 2C5AA 3WLEA 3ZNOA 5KJFA 2DTXA 1Z7BA 4JLWA 1TA4A 1MV8A 3TOXA 4O0LA 3VTZA 4QECA 4XYMA 4DLLA 1KVSA 4FJ0A 1DC6A 2UUPA 4CUKA 4J0EA 1NVTA 5DF1A 1JAYA 1L7EA 3DO5A 3OJLA 4CMIB 1GTMA 2ZYGA 1HDRA 2X1HA 1DJNA 2CMDA 3T4EA 3NT2A 4XX0A 2VNAA 3L07A 3VDQA 2IRWA 4AJNA 4LSWA 5IDWA 4R68A 2AMFA 3Q1LA 3V1YA 2GO1A 1A71A 1R16A 1R4NA 3WSWA 1PGQA 4ZU3A 1UZLA 2X9GA 3I1JA 2PD4A 3DBLA 2Q1WA 4D41A 2DM6A 3B1FA 4Q3DA 4AJHA 1H94A 1YXMA 4YRDA 4BNJA 4RLSA 2J6IA 3AM3A 3DL2A 1QYDA 4WLFA 4J6FA 4K26A 4PLWA 1XDWA 2YHIA 4W7HA 5EN4A 4D0RA 1JWBB 3JQGA 2CDCA 2OOSA 3ZDFA 4QUKA 4GVXA 1O6ZA 5I7SA 4BQRA 5TJHA 4FB5A 4I8XA 2NV6A 2Q3EA 1ZVMA 5U4QA 3G1TA 1JKFA 3GG9A 4PZCA 4RDHA 1HKUA 1F8GA 2IE0A 2GZ2A 2VZ9A 3AY3A 2VHZA 3PHJA 1O94A 3ZWVA 5FYDA 3PK0A 4EJ0A 4NBUA 4WLVA 5A9RA 4PZDA 3SLGA 5THKA 4EJMA 1NWHA 2HCTA 5COAA 4B7CA 4Z0HO 5TT1A 1NNUA 4LMPA 3Q2KA 5F1KA 5JC8A 3DEYX 1NTOA 4WCDA 3OJ0A 3GDOA 4E5KA 3IL2A 1DC4A 4E5PA 2PLAA 1YBAA 1Y8RB 1K6JA 1HE5A 1UXKA 4NPCA 1V35A 4CR7A 1OOEA 3LYLA 2PFGA 3AK4A 4HWKA 4RGBA 4XRRA 2C20A 3HE3A 4Y98A 4BNKA 5JCJD 2WDZA 4M89A 1R66A 3AU8A 3PQFA 1GUFA 4ALKA 4YYZA 4MVJI 3AOGA 3JD3A 4M1QA 3ZWOA 1PJQA 3JQAA 5TC4A 4MO2A 4BNLA 3JD2A 1YB5A 2G17A 3ONFA 1VL0A 2YW9A 2GR9A 5KIAA 3D4OA 4KOAA 5B1YA 3LLVA 1G6KA 3OBBA 3ROPA 1C0PA 5DDIP 3EDMA 3KRTA 5T67A 3JQ9A 4GKBA 4XGKA 2C29D 4Z3DA 4KWHA 1P9LA 2EXXA 2WD8A 1IHXA 2FPPA 3PFFA 2IYPA 3HN2A 4I9HA 4U8GA 3ZHBA 5BSEA 1U9JA 1EK5A 2BMAA 4CMAA 4H3VA 1UXJA 3BMQA 3PI7A 4IDGA 2JL1A 2X7HA 2HQ1A 1OI7A 3QVXA 3C7AA 1R12A 1K6XA 1CERA 3KLMX 1R0LA 4ZQFA 3CE6A 2W98A 4E2YA 3WS7A 2DUWA 4BO3A 3KYCB 4R69A 2VOJA 1VJ1A 1NVGA 3DWFA 1BSVA 5FI5A 3TZQA 5L7TA 3HSKA 3NUGA 2WE7A 4UEJA 4JBGA 3SEFA 1D4FA 1EFLA 1OFGA 2P5YA 4R9SA 3ZW8A 1W73A 2DT5A 4H15A 4OSOA 3R3JA 3R6DA 1ZO8A 3ZWYA 4PLZA 5JMWA 1H6AA 1DRUA 5B37A 3VZPA 4CM6A 3OFSA 2B83A 1ZZEA 1I2ZA 2AQIA 3MWDB 3OHSX 4IDEA 1DO8A 1QLJA 1CETA 1YB4A 3PJEA 1QG6A 5DBIA 5JBIA 1LLDA 1PGJA 2EEZA 4EEZA 2FZEA 1SNYA 4F3YA 3PYLA 3BTUA 3NT5A 5A04A 1LSSA 4BS9A 1EDOA 1GCUA 5G2OA 3U62A 3ZV6A 1D1SA 4FFOA 4MINA 2RIRA 3WFJA 4GL4A 1K5HA 2QIOA 5F3RA 1B8UA 3EHEA 4OXKA 3HUDA 4XJSA 1QYVA 4TVBA 2Q2WA 5AXDA 4RPLA 5I7VA 3NRCA 4YVFA 4Q3NA 1A4UA 2Y1EA 5ENVA 1SOWA 1SBYA 4IXWA 4TKMA 4URFA 2X6TA 1VI2A 2O7SA 3HHPA 1GCOA 4E21A 1ZH8A 2FOIA 2ZJ1A 1GQ2A 3DBLB 3GMSA 4L75A 4O6VA 1KEWA 4JXKA 4BNUA 2I67A 4EGFA 3ETEA 2AXQA 5KVVA 5A9SB 1PL6A 1DJQA 3PHGA 1XWFA 5HRUA 3W4JA 4DPLA 1QYCA 4CV1A 3ETGA 4MP3A 4ONEA 4HBGA 4B79A 3D64A 1VC2A 2EKLA 5AQ1A 3KYDB 5TNXA 1MC5A 4D3DA 1OMOA 3A06A 3I9LA 2ZKLA 1NQAO 1P45A 3H9JA 4AVYA 2E48A 5TS3A 1SCUA 3PYMA 1A9YA 1A7AA 2FWMX 2DUUA 5G4LA 1I2CA 3I9OA 4QXMA 2DPGA 1ZXLA 3GGPA 3H2ZA 2HMVA 1DIHA 3I6IA 3GVIA 3QY9A 4IINA 5EQDA 3WMXA 3ULKA 4U0JA 3E1KA 4DYDA 4HUJA 3P7MA 2YV2A 1JAXA 3EVNA 1FMCA 1Q0QA 3IP1A 4CQMA 2Y0EA 2Q1UA 1Y8QA 2PD3A 5JDCC 2DPHA 1MGOA 1YOVA 4J1SA 3WGIA 1T25A 4L0QA 2NM0A 2ZYDA 5TSDA 4DQUA 4OOFA 1PX0A 4DUPA 5LDGA 2VYVD 3D5QA 3AY7A 2A35A 1Y6JA 2ET6A 1HL3A 1PZEA 3JQCA 3SC6A 3NTQA 1CQJA 1YE3A 3DXFA 1MA0A 1YH3A 1TT5B 4G2NA 4ESOA 2VHYA 1BWSA 4NDNE 3D3EA 2PZLA 1HE3A 4ZHSA 4RDIA 4XCVA 4OOEA 4UVEA 4IIVA 2WJPA 1F12A 1KYQA 3OA0A 4O5OA 3CH6A 4OO3A 3HWRA 2Y05A 1PEDA 2W2LA 2GZ3A 3DDNA 2FPIA 3DZJA 2CDBA 4N5NA 2PKQP 3ZU3A 4RVGA 5U9CA 1QV6A 5TRTA 3VZRA 3VPGA 1CQIA 1B7GO 1ZK3A 5H83A 2YYYA 3C85A 4AICA 3KETA 1XU9A 2Y93A 2F1KA 1I24A 5EESA 1J6UA 1K6IA 1NR1A 4R5HA 2Y1CA 3RROA 1QLHA 4CPDA 4XEHA 3T7EA 4GMFA 3JYQA 2A9FA 5BR7A 4FS3A 1B26A 3UXYA 4CM9A 1LI4A 2HK8A 4FOSA 3O8QA 5U1PA 3W1VA 1U3VA 2X22A 2YY7A 4F6CA 4FFMA 3JQ7B 1UUFA 3U09A 5FF9A 1ISGA 5I7EA 3SX2A 1SZJG 1KOLA 1DFGA 3RUCA 3U4DA 3MTGA 2VHXA 2QRJA 4ALNA 1WNTA 3NV9A 1R4MA 4NG5A 1GEEA 3U9LA 4Z6KA 1CJCA 5TF4A 2EP7A 1J4AA 1AN9A 4CL3A 2PZKA 2NVBA 1XA0A 4ND3A 5TX7A 2IZ0A 1ZSNA 3QHAA 1BXGA 4U7WA 3VPSA 3KYBA 3IS3A 4AFNA 1T1RA 3B20A 4RZIA 3IQDB 2BI7A 5IXYA 3MJ4A 3MWEB 1NAIA 1I30A 4WLOA 2DVMA 3PRJA 4GSKA 5CDYA 1XQ1A 3PJDA 1X13A 2Y99A 4CMEC 1AUPA 3AM5A 5EINA 1BDBA 5CDUA 2IDZA 1LTHR 1RJWA 4TQGA 1HLPA 1NR7A 2PA3A 1LDYA 4R3NA 3DFZA 2HU2A 5T6BA 1DEHA 3UAGA 3GZNA 4ITUA 2C0CA 4CJXA 2WYWA 3RU9A 1WDLA 3DONA 3OQBA 3GZ4A 1TI7A 2BFOA 3FHLA 4WECA 1ISFA 3VKUA 4YEDA 2H9IA 3H9GA 3QWFA 3JD0A 5CEFA 4B3HA 3LU1A 4BKQA 2JCXA 4OSPA 5DBFA 3WGOA 5JC1A 2DAPA 4ZA2A 1GEGA 3DFUA 4U6QA 2CNBA 3X2EA 3QVSA 3PXXA 1LC0A 1CDOA 4BNVA 5IDYA 2NU7A 3ST7A 1T24A 4E32A 2VYND 4PLFA 3IJPA 1BRMA 4IIUA 2B37A
chains in the Genus database with same CATH superfamily
4AG3A 3NHLA 4Q05A 3HGTA 1HFWA 1RP7A 3HB4X 1MO2A 4OGLA 4KGZA 2AMVA 1UCFA 2X3FA 4RPIA 3ND6A 4JI4B 1XPRA 1ADJA 4QUHA 2O2HA 5J2TF 3SS7X 1W0JD 1CZNA 1W87A 4CUZA 3MJRA 1JAHA 4H9GA 5AH0A 2XDQB 3KR0A 3CRMA 4LMBA 3SC2B 3LWDA 5K3DA 5B4UA 3ENNA 2FDXA 4KWCA 2NUAA 3LO5A 1G8PA 2P2CA 2DQSA 4HAVA 2EARA 4C0LA 2XGJA 2QORA 4CLRA 1U0SY 1KDPA 3P2KA 2B4QA 3LHKA 4IHJF 1R6TA 1KYXA 3BFPA 4E3ZA 2XR1A 4D74A 2H9AA 4EENA 1SMKA 1GQYA 2QTTA 5HW0A 1KRXA 1PV1A 1XPJA 2ORVA 2YW2A 3MCVA 3GNQA 3ITKA 4G24A 5K6AA 2PYIA 5KBYA 4B3GA 3CRZA 4DT1B 3JQAD 4MZXA 4CF4A 4DPMA 3EA5A 2QZJA 3ECSA 4RJKA 3G82C 2ZU6A 1JWAB 1HNZB 4X7BA 4B7AA 3ZWMA 4DPKA 2PS1A 3T1YB 3HXPA 1MC4A 4HYTA 5DGCA 5AI8A 3DMGA 3H5LA 1P29A 2ZSUA 5IM5A 1QYXA 3VZQA 1JEEA 1TU3A 1O3YA 5KOIA 1Z83A 1QHXA 4RHUA 2YCBA 2Z5FA 3WYFA 4CYMA 3TW4A 3ZXYA 4D79A 2ZRJA 3T3GA 2RH5A 2FRVA 3M5DA 3B3JA 1EVQA 2FQQA 4XQEA 2A7QA 4BO4A 4W5TA 3ADCA 1OI2A 2CLIB 5LQMA 1QF7A 1ZG3A 1TD9A 1OXMA 4UUOA 4Q6BA 1JDPA 2H1IA 3AF5A 1YJXA 4PSKA 1GSAA 5JH7A 2HFKA 5L6MB 4WN3A 2DOKA 3AP1A 3UV6A 4EKYA 5K09A 3LECA 3VHQA 1Z56C 3ZE1B 4WOJA 4P4UA 1HZZA 4PHHA 2WKQA 3C7TA 2FF5A 2XZPA 1X1SA 4ZANA 1MTZA 1DXOA 2NPOA 3CR3C 1GHTA 2WMNB 1ZGZA 3INTA 1A8QA 3KOZA 4INOA 4C4SA 5JNTA 2XMPA 3IBTA 3HADA 3T1QA 3C8MA 3BGOS 3BXXA 3LPMA 1YL6A 4M7WA 4N3GA 3W4KA 2GXQA 4YRCA 1ICIA 1NBMD 3OQIB 4D4KA 2FFJA 2PV7A 1E61A 2ZE7A 4RNDB 4B47A 2Q7DA 5CDTA 4BLUA 1B8VA 1WB9A 2C98A 4FD2A 5CFLA 1UJ4A 4Y1GA 1XTJA 2C3UA 3PF8A 3HABA 3E9EA 3ORYA 2D1TA 5FOXA 1XLTC 3R3WA 4JL8A 3RS0A 2ORED 1E3MA 4IMRA 3B13B 2J3JA 4LISA 3KQMA 2A0WA 4HXFB 4CQNA 1GAQA 5AWFC 3RTEA 1P7WA 4X1IB 2LE0A 4GP7A 3ZLJA 3VKVA 2OO3A 4QUJA 1Y6GA 1F4LA 3O38A 3KKPA 3TN7A 1WPGA 2EGUA 3AHGA 1BA3A 3D4LA 5GJCA 4MRAA 3W2GA 2BFMA 1RYBA 3FMFA 4ND2A 3GFTA 2QVYX 4LXIA 4ARVA 4L5CA 2RARA 2FW8A 2EZ4A 2XEXA 3E9DA 4HRVA 1ODFA 4JQZA 3A7EA 3HDJA 3S8MA 3O2SB 3HP4A 4NU6A 4ENPA 2XCTB 1E9EA 4GM0A 4KR3A 1Y1TA 2GHRA 1E9CA 4M99A 4RY8A 1YJQA 1VI5A 2OTCA 4D0LB 1RJDA 2D8AA 3CNNA 4O4HA 4PWZA 4RS4A 4Y9RA 4D02A 3ZH2A 1AMOA 1G8MA 3I9V1 3DLIA 2Y0BA 3NONA 5LZ8A 4LSMA 4COOA 1NPTO 4WVLA 2XTAA 4PFKA 3C87A 4CGYA 2CXNA 3RK4A 1BS1A 1A9XA 1H23A 1T4CB 2YWCA 3AFNA 3UY4A 4US2R 3KKNA 4MR7B 5EHIA 2G5GX 4HAYA 4QQNA 2ZM6B 5HCNA 5EI5A 1FFWA 1OWNA 4ID9A 2RAVA 1AUOA 1T0JB 5K0EA 1H9BA 5CD1A 2UXDB 4F60A 2J5RA 3CO0S 1RWNA 2P30A 4NMWA 1HTBA 3VR5A 5FBVB 3HWX1 1D7OA 4CEIA 1UJBA 4TVKA 3PRKE 1INLA 3RSCA 3CURA 4QGAA 2GI4A 3ZHRA 5HYVA 2XE4A 1GL3A 1O8CA 4XX1A 4EHAA 1JPJA 1K7SN 1RM4A 2AW5A 3E82A 1P4AA 2ZIAA 4X94A 2Z8XA 4P98A 3ZJUA 1ZESA 1JTVA 5FUYA 2R7AA 1DBVO 3H42B 2ZBFA 4R81A 2PJUA 1P9RA 1G21A 1YL7A 3AI2A 2CYBA 5F3DA 3IT2A 3M9LA 4YV7A 2H0RA 4N12A 1MVLA 1CFJA 4HMQA 3FZYA 1GNQA 3IP5A 4F2DA 3Q5GA 3QTTA 4FI3C 3UNXA 3AP2A 1LPBB 2CXSA 1Q1ZA 3AEQB 5DNWA 5M29A 1W5BA 1MO6A 4I9UA 2BKXA 2DBZA 1R0BA 1KF0A 2FVXA 1DUVG 1YAHA 2Z1NA 5TVKA 5AW7A 1AMUA 3FOFC 2QHXA 5ERYA 3N74A 5FP0A 2WK1A 4DL9A 1LA2A 3W6ZA 1NXPA 3R4CA 2PT9A 3KJIA 4BNGA 4DTCA 5H4GA 1EFKA 2ZB8A 3GLHE 1G16A 1NXOA 4JI8B 4O63O 4V0ME 3R3VA 2PRJA 1K4KA 2I6QA 2UAGA 4H3KB 3B1WA 1ZOSA 3MAAC 3WL5A 5B2EA 4PZEA 3NHJA 4TQ9A 3LZCA 4TSFA 2ZJ6A 2ECKA 5IC4A 1GXSB 1O5TA 2PWYA 3C98A 3H2HA 4KBGA 4C5AA 2VJYA 5JTUA 3N75A 4OQEA 3DLHA 4FDVA 4QT0A 4X1YB 5SYMA 4ALJA 2C31A 3JASB 4XOUA 5M7EA 1YMQA 2WT9A 5GOZA 1BTOA 1DEXA 1XTIA 2A4MA 2GD6A 2P4UA 3DJYA 3FOEC 2BP7A 3JCZA 3CUKA 1DAHA 1J7JA 1XTVA 3ZE0B 3MBKA 2XPCA 1EBUA 1NOJA 3KYCA 2BBTA 5GV7A 3CLSC 5E4TA 2FJPA 5EWJB 4ZGGA 5KTYA 1V8DA 2HO5A 3L82B 4AJEA 4K28A 2FW7A 1WSDA 2FR1A 2EW2A 2X2PA 4WA8A 2ZI4A 2I6XA 3W7VA 2HV8A 2CXHA 4I4IA 3ZYCA 3VU1A 5FOVA 1Z73A 3BOSA 2JBHA 3N6RA 5JFOA 1ADYA 2VDLB 3RKUA 3EHDA 1FYWA 3KOUA 2VUTA 4P3KA 2VO1A 3SHVA 5A62A 2JEZA 4INPA 1KFBB 3K5IA 1FU4A 3JQPA 1NBEA 2V7GA 1O6GA 1EJ2A 4D6PA 2B2NA 4JQCA 1SOVA 1N6LA 3L9WA 3PHHA 3ZHCA 4CM9D 3KPYA 4BB0A 2AZXA 2PUWA 5J4LA 1ACLA 1UP7A 4OKSA 4RO0A 4KE7A 5T7BA 2C4HA 3FLBA 1H4VB 3CRVA 1LLUA 2QGFA 2VT3A 4TZKA 2D06A 1TM5E 1DL5A 1ZSYA 3K3PA 4LXGA 5FWDA 2O0JA 3HDTA 5J2UB 4MA4A 4ZFNA 1ZYUA 4X20B 4ISBA 3M6MD 3H8SA 4C1BA 5IF9A 2ZLBA 3O2NA 3IQEA 1P8AA 3KWJA 5FL7A 3DDHA 3EF1A 4AJ4A 4QYTA 4BX2A 5F7OA 2YHSA 1DOHA 2HYIC 2QUBA 3GMDA 1PR4A 2BGKA 1OXKB 2FRDA 2FSUA 3M82A 4MHOA 1H0RA 4Q7KA 5J59A 3V6LA 2HCRA 3A0UA 3SBEA 5JMPA 3Q88A 1QZTA 1G21E 2ZWAA 4D3YA 4EFDA 1BXKA 3IMEA 5CT9A 4ER3A 4F5DA 2QBYA 4HTFA 4IEEA 1FSSA 2WVHA 2DCUA 3TQFA 3PR2B 2JCVA 1C8LA 1TMYA 3INYA 5JW6A 3LG2A 2ACVA 4FX5A 4YIKA 4AG5A 4FQ5A 4P4GA 4PTZA 5IABA 1NFRA 1KK0A 2WAOA 3AL2A 2C83A 3GEPA 4RS3A 1EDZA 1JIIA 2DP4E 3KYDA 4NU5A 4DDMA 3DZDA 4B32A 4ENQA 1NZJA 1X7DA 2QN3A 3KS9A 1EWKA 4YAFA 5LXTA 2BLLA 2O3TA 2VJBA 1ZIXA 4C21A 1ZMTA 3HEAA 4HATA 2AN3A 2Q6VA 1G60A 1TFUA 3DYVA 5BQ5A 4CDMA 5DT2A 4DKJA 1OTYA 4WCFB 5BUSA 1GADO 4G1UC 3K16A 3JWPA 2ZJ3A 4AP9A 3ETHA 1FYDA 1BW9B 1M8FA 2X4GA 4AF7A 4WLFA 5K3FA 5DMHA 2BSQA 1MBZA 1UEXC 3O8LA 4G6ZA 5L3QA 4IKEA 4JVMA 3LUCA 3KXLA 1NDUA 1RWWA 2ZSHA 1W8DA 4MW1A 4Q1VA 4DWWA 1NYQA 1T0UA 1QBGA 4HDNA 5HMMA 3QNMA 1IEVA 4LW8A 3VSDA 2WI8A 1YIDA 5EA2A 1P5RA 2NQ2C 3LL4A 4YPFA 1IXZA 2PN1A 3D0OA 4NVRA 4WMLA 4BN0A 2J6HA 4FGWA 2VI5A 4LZWA 4L27A 5LD2B 1AUXA 2O07A 4PX9A 2HM7A 5AHRA 3FUUA 1Y5LA 2RGXA 4KLCA 5DV9A 3BDIA 2XMQA 4UDNA 5IAAA 1JDBC 1RXCA 1Z7WA 3RV4A 3SLRA 1JVNA 1PCXA 3H6KA 4BUZA 3QRWA 4BLVA 3KR2A 4HNGA 5U4XA 4BNDB 3AY0A 3MF4A 1C3OB 2X8BA 3H3JA 4OQMA 4TM7A 4DN6A 5BT9A 1EVLA 3X43A 3IVAA 4XVUA 2MCFA 2Y68A 1OT5A 1LPNA 3I4CA 4JOCA 5CAEB 3A2NA 1NOIA 2RGWA 4J76A 1C7ZA 4YWHA 1FF9A 1IM2A 1QFYA 1MVNA 4BBAA 4KMOA 1B43A 3OECA 3H13A 1TKBA 5K6TA 4JR1A 5M34A 2W6MA 4GZLA 3PHCA 1N9GB 4PZYA 2R5NA 3AV3A 4MLCA 4XGQA 1ZXBA 4HN2A 5F78A 2ZULA 2ZXUA 4MGZR 5AOCA 1O94C 1W4AA 4QYSA 3RDPA 4G01B 5I5EA 5DHRA 1M6VB 2PL1A 1JFFB 2ZYUX 5E8JA 1DBRA 2Y3IA 4UCWA 4C4RA 1Z8DA 2VHWA 2E55A 4OUKX 3JWHA 1YQ9A 1ZBQA 4G07A 4FCCA 1P1JA 3F7OA 1GU1A 2RK6A 1QCDA 4HD8A 1P7CA 3UW3A 5KKNB 3A6ZA 3K0KA 5BWOA 1TMGE 1AQJA 3LY7A 2B69A 4HAUA 1BXRA 2AGVA 1IZ9A 3A10A 3TZLA 1T8WA 1ZXXA 1RRFA 4LK2A 1Y33E 4FUQA 5E95A 2R4TA 1HBJA 2OV6A 5C1OA 3IIEA 3D4IA 3K1AB 2SECE 3O74A 3ZN2A 1G7TA 4C7JA 2XDAA 2P40A 4EPXA 3UMYA 2OO5C 2ISSD 4FYYA 3AC0A 4JU9A 3VNRA 4GKVA 3ZGLA 3ZQJA 3G5AA 1UINA 5A3JA 1IY2A 3HXOA 4RC9A 2P62A 3H0CA 3RHZA 4B31A 2CWDA 1RHMA 2HUNA 2I4LA 4YH1A 5DISB 3RARA 3QX7A 1MOQA 3GLTA 1LUAA 5BPHA 3TKAA 5HKKD 1DAFA 2RH8A 4JWTA 4NATA 3IEVA 4ZOQI 1KSJA 1Z6TA 3X1XA 1KVUA 4MW9A 4D9FA 1ULUA 2PT5A 3K0AB 1GRVA 2C78A 1U4NA 1XXLA 1YVEI 1G3RA 4FQ7A 4MUYA 4C9BA 5CDHA 5JV5A 3R5TA 4XPIA 1DDOA 4DDWA 3ESQA 4MKRA 5F2NA 1N2CE 1YDGA 1YMUA 3KT3A 4ZVMA 4PX3A 1B00A 2QI9C 1TU4A 2VJQA 3IBSA 2ZBRA 3KTDA 3W78A 3ZOKA 1LCIA 4BMNA 4OIMA 4R05A 4ZV9A 2I2DA 4EI9A 3ZVRA 4O59O 5JLJA 1AS3A 4RY0A 4L9AA 4BX3A 1JX6A 3ICWA 5E1DA 5CA0B 4FHDA 3KBBA 5EWLB 3HJTA 5HF6A 3RFVA 4S2UA 4EX7A 3DC2A 5IN4A 2BGUA 4MV0A 4UKDA 3AR5A 3N70A 4UNIA 1QFXA 4PG8A 1GLNA 1ZD4A 2AT1A 2UVDA 3Q7PA 3FPAA 3DWGA 3ZY5A 1DAEA 1GG2A 2AJBA 2YXDA 1XMQB 1V1JA 3IERA 2Y6VA 1Y3AA 4N48A 3OM9A 4I4LA 1IPHA 1R7RA 3BK1A 4LG1A 2R00A 4KQIA 4CTMA 1AN0A 2P2ZA 3E6AA 2OSBA 4E14A 2ZANA 1D8TA 1OWLA 2HIMA 1J20A 4LCEA 3MVEA 1Z8HA 4ZAYA 1L5LA 1VA5A 2Q0SA 3B5JA 1EE9A 4WK2B 4UBLA 4IQ0A 3IXLA 4FSXA 1LB1B 3TDNA 2P2LA 4I1PA 1PWZA 3L8HA 2UV8A 4N3NA 3QWBA 2FSVC 1MEEA 1B0AA 3PZRA 4FJ1A 1WE2A 5CDSA 2VZ0A 3WL3A 4EJ6A 3FI9A 2RHCA 4J2OA 3MBOA 2LRHA 1EVEA 1AQ6A 5CFPA 1CRWG 2XDQA 4EG7A 1QNLA 5EHXA 3SC2A 3DPIA 1EFRA 1VRVA 4P93A 3SGLA 1F2UB 3CC8A 2FEKA 4IF4A 2BFPA 2ZQ5A 1E7SA 3H2YA 2G9RA 3IOEA 4PG6A 2FEMA 4QDJA 5GZ1A 1X6VA 1ZNWA 3WB0A 3DG9A 1NNSA 4C4ZA 2BH9A 2QLFA 5MN6A 3Q8KA 1AQUA 2MINA 2X6QA 4LCJA 2ZQYA 3FSGD 2XNDA 5C81A 3VH3A 3H0KA 1TXGA 4DT1A 2W11A 3EZNA 3PEFA 1FLDA 4JASB 1M2HA 4NZPA 1IJBA 5FOSA 1CU1A 4BO0A 3T3OA 1G3MA 4DAOA 2O23A 3NMUF 1E3LA 3R9IA 3UH1A 1E0DA 1UWKA 4M9UA 5DZSA 1GLVA 4M49A 3GFSA 5J3JA 2QXYA 3ONEA 3WYEA 2D5BA 2NO7A 2NQTA 3LQKA 4LQCA 1Z0JA 2QM8A 4O4IB 4R2MA 3V42A 2IQ5A 3NATA 1XDSA 1NQTA 3DL7A 5BYBA 2JIZD 3NGLA 1ULZA 1W5TA 3JR7A 3R7SA 1JLRA 2RC6A 2YRXA 3WLRA 3CEAA 4HFRA 1R0CA 2OUIA 4S35A 3W5AA 2P78A 3RCBA 4CLHA 5FPSA 2G07A 5DXJA 3PQDA 5FKJA 4KV9A 1J2EA 4EKIA 3MS4A 1I0LA 3A14A 1BA2A 2H92A 4L22A 1P3DA 4UREA 1WMBA 3UUWA 1ACJA 1XZ8A 1Q0ZA 2QTZA 4MAFA 5HXAA 2QTWB 1T2FA 1SZPA 5I51A 4TYWA 3C41J 1OXUA 4D0GA 2O2GA 2V3VA 4ZQCB 1CLEA 1DUIA 4GLFA 1O4WA 3GUVA 2X9LA 3IH5A 2R6ZA 4N0MA 3G02A 2QYHA 1O0SA 1EYZA 3QTBA 4UUBA 1IY9A 2YJZA 5GJWC 3TR6A 9LDBA 1RLOA 4DEYA 1L1EA 1PIWA 3MK31 1UBUS 1X7WB 1G98A 1OY1A 2D8MA 4LDAA 4DWJA 2C1EA 3BMCB 3MAJA 1F14A 3MSCA 4YQZA 4Z53A 1JIVA 3RC8A 2AL7A 1KOGA 1QC5B 1X1BA 3FZEA 3OQIA 4YACA 5C8ZA 3ZE2B 1KEUA 3TIIA 4WZAE 4UTPA 4HTAA 1WXDA 3RT9A 1ZOIA 4W9NA 1U2RA 3ZKWB 5KNCA 3DSRA 2OFOA 2IU4A 3FCYA 4DCMA 1OVGA 5C1BA 1B42A 1PDVA 4IDAA 1WMSA 1FFXB 2VUHB 2JFNA 3M5WA 2LDBA 2ZJ4A 3NUZA 4NNPA 1CZKA 1LPAB 1MP0A 1Y7PA 2TMGA 1Q2UA 4B81A 2JNWA 3RVNA 4X1IA 4F2HA 1GPDG 2IUTA 4J0QA 4D9HA 2I9KA 4W82A 4WUVA 4Y1EA 5EXPA 2XRZA 2WG2A 1M10A 4F12A 1GGMA 1LF0A 3AUYA 2YFYA 2VHTA 3L4EA 4N9QA 5E2IA 3WLLA 1IONA 1OB2A 2ETXA 4J0HA 5K8UA 2Z9BA 3VMFA 1OVMA 4GWKA 3CF6R 2XLBA 4LYEA 5DTIA 1K8YB 1T5LA 5FV7A 5KU1A 4H35A 3IB3A 3RADC 3BXFA 3KQQA 3P9XA 1RC1A 2DH6A 1QGYA 2HRRA 2Z43A 3VJLA 1WDTA 3E53A 3I8SA 1C9KA 1T8RA 4RD4A 3BGVA 1K6MA 2FR0A 4OMDA 5ESRA 1ZAYA 3QKSB 1CNMA 2WWHA 4QRIA 3SJAA 3LA8A 1U1GA 4C0BA 4N5MA 3GX1A 4B8WA 5K8TA 3BN3A 3ZW9A 1X3SA 2IUUA 1FUIA 1T4CA 1WXWA 2EYQA 4V3BA 4FEYA 3VOBA 3NKFA 3AVWA 4MR7A 4KJXA 3Q8WA 1OI3A 3WQRA 4TRRA 1JHAA 4LXHA 3SSOA 1KJYA 2QJRA 2CD7A 2P2NA 3L2OB 3QK7A 4BWVA 3S1AB 2D5CA 2VSQA 1KQ3A 2ZSKA 2DY1A 3F7TA 4W1PA 1FBTA 3X3HA 5ESDA 2W2KA 1QKJA 3G6KA 3G2NA 3PGXA 1UH5A 3KV1A 1ZJ6A 3MUFA 4PC7A 4RANA 4W5WA 4EG1A 1J07A 3BIOA 4EGSA 4DNPA 4KEAA 2C7OA 1NPDA 2FZWA 2NVWA 1Z5VA 2Z2KA 3L7AA 5IEBA 2I1VB 2C84A 4KXYA 1QVVA 3ZY4A 3ZD7A 4MO9A 1M7GA 1GR1A 2AVDA 3ZG6A 1PZFA 1G5RA 4BE7B 1ESDA 4Q37A 1RJFA 2JLYA 2HZ7A 3DAHA 1VZ2A 3AEQA 3A9RA 4R5MA 2JFVA 3UA3A 2V7XA 1NUTA 3SQMA 4QYIB 4ZT6A 4DVJA 4M1SA 3C6MA 5C52B 3DNPA 3V97A 2V6IA 4AXXA 1JHUA 1I4LD 2CY0A 2PZJA 5MFPA 3ITDA 3A3YA 2A92A 2YINC 4JBHA 3CGWA 2H0AA 3NYWA 4BIIA 5CVTA 4OIFA 5JZBA 2ZJYA 1X7GA 2GAOA 2ZWOA 3A4NA 1ZEMA 3IOBA 4RKRA 2AK3A 1XI2A 2JJ1D 3UMFA 1D0IA 4EG0A 1NJ5A 1X77A 2XODA 4GH5A 4D7AA 4XVCA 1KYZA 3FUWA 5I6DA 2R8OA 2GVZC 2NT3A 3FDFA 4UPDA 3DVLA 1GXSA 5TR9A 1TQDA 4CI9A 4MAAA 1GKYA 1V47A 4YMSA 5ED0A 4TMWA 4WY8A 4X1YA 2JA1A 3JASA 3RRJA 3VO8A 1FFBA 4JX8A 1VDZA 3QEKA 4RADA 3HRIA 3TL3A 2JCGA 1S2MA 2VPXA 3EIOA 3Q9LA 3EPPA 3U2QA 4V03A 5EIEA 4C78A 1RNLA 3K9BA 4LZAA 2C4WA 1KDOA 3T5AA 3JZDA 1KI6B 3I92A 3VSAA 2CCKA 1JU4A 2QRUA 4RCZA 5EWJA 1H9AA 3MT8A 3ETJA 3NVDA 1LBIA 1JIQA 2P5SA 4IVRA 1M8JA 4ZC8A 3GAMA 1SUAA 4IP0A 3TDMA 3D5TA 3BT7A 1MJHA 2P35A 2PVPA 3IVXA 1D03A 1XPOA 7MHTA 3C8ZA 4PVDA 4MI3A 2XWPA 4L72A 2CLOB 4NR0A 3R7BA 5LYJB 3O2JA 4AO7A 3NHKA 4PNPA 2AFVA 3GLIA 2CYCA 4JDPA 4Z4QA 2ZW9A 2BGJA 1RIFA 1RJGA 2B2XA 3DBHB 1ISHA 1P75A 4QARA 5DW0A 5M3BA 4CLDA 4YRNA 5JAUA 3L5KA 3QQ5A 4MVJA 3HG7A 4LS3A 1FB5A 2A0KA 5FYQA 4LJSA 3V3TA 5HF8A 1N5LA 1U3UA 3H5TA 1LDGA 4S1NA 4QPCA 1M0WA 5HIIA 2CJXA 3L6DA 3UO8B 2REOA 2ZP1A 3I5MA 2H1OA 3TEMA 5DXFA 4MUMA 5K6AC 1Z5ZA 2W4QA 3SR4A 2NZYA 2RBEA 5JRZA 1JDVA 1S2DA 4NBVA 1E2UA 1VLMA 1UK6A 2JGNA 2WSYB 5J2UA 2WINI 3FMGA 4QNNA 3HEMA 4OBXA 4X20A 1M73E 1KJ9A 2GB4A 1EA7A 1IVNA 3QH4A 5JS7A 2OXEA 5INTA 4DZTA 4FM9A 2ODEA 1R10A 2PL9A 2QUZA 5EJFA 1C9NA 4CHTA 3GJTA 1N33B 5A0FA 3OCWA 2ZSAA 1DEOA 3AHDA 1AVTA 1ETHA 4JI1B 2J4CA 4GKKB 5J43A 1SUBA 1E9SA 4XGNA 2CZGA 5CYOA 4QEDA 3R7DA 3JQBC 2DWQA 1DLIA 3PDUA 1TLFA 5KVAA 2PM8A 1JHQA 4IDCA 3QXGA 4O33A 1FFDA 4O5AA 5JXJA 3T3NA 3G1WA 3GCGA 1IG0A 1RHQA 4LOIA 5FOQA 2CNNA 4XD7D 2FFRA 2YOGA 1KZ7B 4LIPD 1BNCA 1P7PA 4RXTA 2FWBA 2CV1A 4KZPA 1ZS9A 3GRPA 1JEJA 1GL9B 4MUBA 3OQVA 3KUCA 3UG7A 4LV5B 1HZZC 3G23A 5E9QA 4BVKA 3JQFA 2QE7A 3PTLA 3QEOA 2HDNB 3EIQA 5JCXA 4CCWA 1PL7A 3NGMA 4AJPA 4OHVA 3RUDA 2ZETA 4WCFA 3A7DA 3OX3A 5KTTA 1WCWA 3CUWA 3OZUA 4XUGB 3UK6A 2YJ5A 2KBEA 3Q0TA 3UC9A 5C80A 2XUQA 1BW9A 5K0JA 4U6NA 2GJSA 2OHOA 2XGOA 1LNZA 4OQQA 2JGLA 3BCHA 1VE6A 3WTBA 4K0RA 5EHGA 4BNNA 3GFBA 1KFEB 3W2HA 4EEXA 1O95D 1QRTA 2ZRGA 1B6SA 1OGJA 4YP9A 1PNQA 3MHPA 2XOKD 2X0DA 3UPDA 1M83A 4KQWA 3QOXA 4QASA 4DCCA 3VH4A 2VTVA 4LE1A 2RK3A 2JD0A 4GOMD 2VP3A 1UMBB 4RIGA 4BJ1A 1HL7A 3ELYA 4QDTA 3FG9A 4WOBA 4FMDB 3HBLA 4XKJA 3U60B 4BX8A 4QPPA 4DIKA 1NVKA 4LKOA 4RGQA 1YVDA 3VVMA 4BNDA 2AN4A 1C3OA 4J1TC 4PRZA 4X1OA 4PN7A 2YOHA 4WLNA 4EGCB 2EZTA 5LFAA 1LQUA 3SOZA 5CAEA 5F1OA 5HDBB 1OWOA 2ILTA 2B7LA 2FQ1A 3HUEA 3K30A 3I2GA 4J16C 4YUZA 5L4NA 4YGYA 7REQB 2R6FA 4O2AF 3ENWA 1TKCA 1P4HA 3QYAA 2B7BA 1RS0A 1Z06A 1N9GA 3GUHA 4EPYA 5IYZF 3QU9A 4ZIRB 1KZGB 1NULA 3ONVA 1BCSA 3E5NA 1C4KA 2WJZB 3IUEA 3M1YA 3NOVA 1IQPA 4OB7A 2VOEA 4YJGB 2WWVD 2GTHA 2PGLA 3D43A 1OBOA 2Q7OE 3O8OB 4M4SA 4U2FA 3H8VA 2H1SA 1E2FA 1JFFA 2W2TA 4P3XA 4DLPA 1DG9A 1ZH4A 4GI3A 4DV5B 3SQOA 2VR1A 4KUHA 2Y92A 1KI8A 1MIHA 1X9GA 3AFOA 3RRNA 4EI7A 1UPBA 5JPIA 3D6VA 2QLBA 2H2HA 4M1MA 1X38A 1W76A 1R9GA 1SBTA 2VUUA 4IKPA 3LLCA 4L8VA 4L5BA 1UZAA 3TD9A 4PY2A 1YHNA 2BFCB 1OYOA 4Q4CA 3OKCA 2OMKA 3FPEA 3I9NA 2ID8A 1V8OA 5D2CA 3SD7A 4DIUA 4EYOA 1FMLA 3QP9A 1FK8A 1PN3A 4U7GA 1Y8CA 4A8PA 1UMKA 3QFHA 3K1AA 1UPUA 1BQEA 4E07A 1E2NA 3ZIAA 4CDGA 2Q46A 3ASVA 3NTXA 1U8YA 2O20A 2J8ZA 4GQBA 4MWZA 4ND5A 3RC2A 4DS3A 1AS0A 2PAFA 2QW8A 2RGGA 2Z83A 4AJOA 1AHPA 3HM2A 3F8TA 2ZYSA 5B4TA 2JBAB 4J8PA 5JMOA 4B6FA 1CRLA 1O5OA 2AZMA 1E7WA 1QWOA 5MDHA 1QVRA 2B4AA 1II8B 1HUQA 5IF3A 3CF0A 2AI3A 3MW8A 1FFEA 4JIGA 4BGEA 4HJRA 5FBZA 4FXOA 3NNNA 1E92A 3WNQA 4BMOB 1I1HA 4R84A 5KWEA 2GBCA 2EG9A 4LBYA 2FGKA 3JR3A 3K0AA 4WJKB 5FBWB 4YMUA 1J7KA 2IU3A 1WLSA 4ZYZA 2DC1A 1I1QB 1YRAA 3PL1A 4JQSA 5IMBA 1XFAA 1ZJZA 3ITNA 3GNTA 3UJ3X 4DNFA 1XVTA 4LRTB 5H02A 5LBTA 4F3TA 1Z7EA 3GO4A 1HOTA 4M8LA 5JPDA 1SOUA 2ZRKA 3CG0A 3N3BC 4OLHA 1TAGA 3Q5EA 2C2XA 5A05A 3RAPR 4N6OA 1UMCB 5EPOA 2I2CA 5A4KA 221PA 3VR6D 5AKHA 2Y71A 5CA0A 1MO4A 3D8BA 4V0NA 5EWLA 1DFIA 3F6PA 1BG6A 3I2FA 4QAJA 4P3YA 2LBPA 1A8IA 1IEXA 2H8GA 1VG1A 3DTYA 3RJMA 2R87A 3HI4A 3WQHA 5KHLB 3PV0A 2ZYWX 3C8UA 4LOJA 5DN6A 1UBJS 4AMYA 3OC0A 2PTHA 1ZK1A 5IAOA 5I9MA 1J9EA 1TPYA 2IYLD 2WWXA 1NI5A 4LVCA 4JI5B 3WRXA 1ZM9A 1FUEA 1D1PA 2X5OA 3F5DA 4UOQA 1Z63A 1RXWA 1A8SA 5G1NA 3SC3A 5JFGA 1UM8A 4I6GA 3KUUA 4QU9A 5AKKA 1ZIPA 5CFMA 1XTZA 4UUMA 5FWNA 1HTTA 2Y8EA 3D5EA 1T3HA 4JX9A 3OLCX 3I39X 3L7CA 5FQNA 4F9FA 3WDKA 1N7HA 2XXAB 4YCSA 3LC2O 4W5NA 3BKXA 2G80A 1SGWA 2JAPA 2OEPA 2Z30A 4DJTA 1O9GA 3DHNA 3WQSB 3GF4A 5ILOA 5KKAA 1DTEA 1UBOS 1GPUA 3BWDD 3FDJA 1AB5A 3HO6A 5DSXA 4J0GA 4LZZA 5E8RA 2FYTA 5TPZD 4YDSA 2WF7A 2WUVA 2J3QA 2YNMD 3M3DA 4DHWA 2NP6A 1IXYA 1IIRA 4ZXPA 5ENDA 2IHNA 3CEJA 1FZQA 1P72A 3TOVA 4QYWA 4M0UA 4Q9IA 3E7XA 2P67A 2FP4B 3HBFA 2V0CA 5JZSA 1SVSA 2WU8A 3C1TA 2W8BB 4P7GA 2XCIA 1GYRA 3ET5A 3EAGA 4F97A 1VZ3A 3DBOB 2CHUA 4NNJA 3URKA 5H82A 1ISIA 4RNCA 4QOSA 3GGGA 1G17A 2AJ8A 2GF2A 1XTPA 3QE3A 4YRKA 3HZRA 5DYGA 1V9CA 3VHRA 2FW6A 3L1HA 4HDOB 3NOXA 2EZUA 3MGKA 1JLLB 2OAP1 3IAM6 4M37A 2WWIA 1EQ2A 5KYYB 3N3AC 4CTKA 2I4MA 2VYNA 3TEFA 5K05A 2R6GA 2AWNA 1ONBA 3CZ9A 1AK9A 1U04A 1FNCA 1ORHA 3ISJA 4GMDA 4JP1A 3VNSA 5FUQA 2O2YA 4BVFA 2I5PO 1Q6YA 3ZBQA 2GBGA 4CNBA 2KJQA 1KZ4A 4R71A 5C32A 5JS6A 4R8RA 5HE8A 3PE6A 4MPTA 5AVJA 3U3ZA 3FVQA 1QYWA 4O4IA 4NENB 1OSNA 1FP1D 1UZMA 2W71A 1X7XB 3C1UA 1DINA 3EXIB 2RB5A 1N6IA 1VLQA 1NUPA 3PWSA 1UFVA 1H3EA 4AK9A 1Q44A 2B1GA 3QW4B 2FG7C 4QDXA 3GD7A 1Q3TA 4TS9A 3V2HA 1T1EA 4A2PA 2WWWA 1L7XA 3T3DA 2VJLA 3ABOB 1QOPB 5E9WA 5ETJA 3C1AA 5C5DA 2GBPA 2H4YA 2UZ3A 3OF2A 3QPBA 2C4VA 3HP1A 4OXNA 1VPWA 2CKMA 2C8KA 1G8JA 2W7TA 1PSWA 3ADBA 1EFUA 3WB9A 3I8OA 4Z7JA 1DKQA 1O87A 1B73A 4B3BA 1X7WA 1G5PA 1JV2B 1LSOA 1LQTA 2V6GA 1KZYC 2B94A 2WB4A 3VH2A 1RPZA 3QJGA 4MUFA 2O3RA 1QC5A 5DM1A 3OE4A 2A9KA 2VQ6A 3SS8A 2PX4A 3CR7A 4QQFA 2EQBA 3GGDA 3EMDA 4YONB 3BCUA 3P5SA 2E7ZA 3KKOA 3MWJA 3E5MA 4ZVUA 2ZR0A 1DCKA 1V1RA 1Y5RA 3SZRA 1Z0ZA 4AN0A 5PNTA 3OZBA 5EZ5A 2DFNA 2X58A 5KSZA 4P34A 3N28A 1B8PA 1YGYA 3BA1A 1FFXA 1QGUB 1BU8A 4URHA 3B6EA 2D1YA 5ALKA 4JENA 2NU9B 1AM4D 5KTPA 2L69A 4QBKA 3B1XA 4RGYA 3HJCA 3IQZA 3WLFA 5JS1A 4ADSG 1OXVA 1NP3A 2ZRFA 1NVVQ 3GFVA 2XTMA 4WRRA 3PVCA 2GWHA 4Z86A 2AMYA 3PHIA 4P35A 3RBVA 3K05A 3VC1A 1BJKA 2H7VA 1UIRA 2VEOA 2VWQA 3VGJA 1N92A 5ALHA 5HQ3B 3ICEA 2PLNA 3GFRA 4U9IS 2F4NA 2QQFA 3RSHA 3WFZA 4AB1A 4AUMA 2J4DA 1X94A 4KQGA 4LF7B 2V7QD 2IYYA 4OHZA 2OHJA 4ALLA 4YUXA 2AKYA 4IH4A 1I5OA 4HMOA 4D4MA 2PZ8A 2ZSFA 3QKSA 1R6BX 3FROA 3PCTA 3QVKA 5I3ZA 4QGSA 2UXCB 1AXGA 2J7PA 1ODIA 2JFFA 3OKPA 1AHHA 2JIRA 5EHNA 3QNWA 4EUFA 4AJ1A 5HUHA 2A0XA 1M6HA 3GK3A 3R75A 1EXWA 2AN1A 1SK8A 4R3WA 3PRHA 3RRFA 1VBMA 2R60A 1GQFA 4LJ9A 1DARA 1PE0A 3U4QB 3S1AA 5LBIA 4CG2A 4AJLA 1TE2A 4IVNA 1CEYA 4U00A 1Z6PA 2DPYA 3CTPA 1P4GA 5BY2A 1SVMA 2I34A 3OZDA 3FY4A 1JG6A 4W8GA 2ZTSA 1GZSA 2IZZA 4U5QA 4HLCA 4KQJA 3RSGA 1OYYA 4XX0B 2XSZD 2QA5A 2GZAA 4RF2A 1TX4B 3S5UA 2JHPA 3QUAA 2R8ZA 4BQOA 1JEAA 2PXCA 2PWPA 2YYZA 4X7MA 1DXYA 1MO3A 2GCGA 1R5JA 2P6NA 4OF4A 4HP8A 4LNUB 1QGED 2D1RA 2QVLA 3OF3A 1P5HA 3ZDQA 3AFHA 3K2QA 4BTLA 3EA0A 1FMFA 3PUVA 2Y1LA 3M1AA 2O48X 1SC4A 3I9MA 1LX6A 1ZD8A 3H5IA 2FPUA 2GDZA 1VCNA 3TEJA 5IFLA 3GAZA 3LUFA 4DDKA 2R7LA 4XB2A 3R6GA 1K8QA 4ZEXA 4PCVA 5FR2A 3RTAA 4NFHA 1R0YA 4BX9A 1V3TA 1LFDB 3PBKA 3T6KA 1HNWB 3C3KA 4YRBA 2QG6A 1E2PA 4Z2AA 2RGDA 4LY0A 2FCRA 3OLYA 1JKXA 1E3TA 3B53X 3NAGA 4QO8A 3RUPA 3H7IA 1TVCA 4MWEA 1G55A 3WLHA 1PZMA 1U7WA 1VSUA 2BL4A 1M33A 4F6LA 4QVIA 5F98A 2Q5OA 1N6OA 1PJAA 3CRRA 4Y7DA 1OXXK 1NDQA 4RM2A 5LOVF 2IY8A 4KAFA 4P31A 4K9OA 3PFNA 1R0ZA 4A6XA 2OLJA 4TVSA 3FMOB 2YZ7A 1KVTA 3TLMA 2RMKA 4RHEA 4GYYA 1T2DA 1K75A 1MU0A 2G09A 2LCQA 3I42A 1KI6A 1YRBA 5DNEA 5A1JA 2VH2A 4MKGA 4U6SA 3IR6A 4EF6A 4EMSA 1VCOA 1CEQA 3ABIA 5JRJA 4Q4AB 4Z4FA 1WW2A 4NMMA 5EP3A 1QIIA 5CDFA 5COBA 1TO6A 3QHPA 3QFTA 2VPZA 3N5CA 4OHYA 4YB8A 2OHHA 4E2WA 2BIFA 2Q0HA 2J67A 3BC1A 1CIPA 3GWGA 4I2NA 5K3CA 2BMEA 3DD1A 2DJIA 4AIRA 3I23A 2X0KA 3DC7A 3NC1C 4WW0A 4C03A 1JDJA 4IL5A 4LK3A 4RIHA 1FUUA 1VE7A 5LYJA 1GFZA 4LDZA 3U13A 4YMTA 2GT1A 1RRCA 3DBHA 3CMMA 3F74A 3I28A 4II3A 5I7HA 3CN7A 1EK1A 1DMRA 4LYYA 1QQ5A 1NJ6A 2B98A 3KOXA 4UC0A 3WGQA 4RTOA 1GL6A 1RHRA 1WF6A 5HP4A 1B16A 4K6CA 3T9EA 1GP2A 3JQAB 2WU3A 3MS2A 1THGA 2VBGA 3FUXA 4CWAA 5JWOA 2RE8A 2Q1YA 1WQ3A 1N3BA 4WLEA 2BAGA 2O06A 2IS2A 4FDAA 4RL6A 3HKCB 1J2UA 4IXDA 4MV3A 2WT8A 5G40A 4KSCA 4DMHA 5EGSA 1Z0IA 3P20A 3TINA 1USUA 1W581 4KQXA 4CN9A 4IG4A 1CYDA 5KOJB 3NEAA 1MH1A 4FDLA 5IP5A 3TLEA 2YN2A 4JKYA 1Q6ZA 3H84A 3HB7A 4LVNA 4QWMA 5JJLA 4HPJB 4LDPA 1ZNXA 1JXOA 1QIFA 1KFJB 1N2OA 2ZYAA 3DFIA 1VI6A 1QF9A 4NYIQ 5EC8A 3ZDZB 2O8BB 2W00A 2B8EA 1YFLA 1VHTA 1GZ3A 4CMEA 2RCNA 3G1UA 1JVSA 4X84A 4Q3EA 3AUFA 1WU7A 1J2RA 2JIQA 5CRIA 3RB8A 5CURA 3VO2A 4GZMA 3EUEA 3RJ9A 3PWZA 1C1YA 4MZDA 4P2BA 3BYZA 2Q1TA 4J0DA 2QB5A 1ESCA 4G5QA 4QEKA 3ZTTA 4ZMRA 1WMDA 3U5TA 3G7SA 1ZCJA 4TL7A 3FR8A 3S1LA 3PKZA 1U0TA 2IZ5A 2JLWA 3IP9A 2FPLA 2XVAA 4YRQA 3H97A 3V4OA 1BFKA 1CZHA 2D5AA 4MV7A 2MSLA 3NB0A 1OLSA 4RD3A 3UGJA 3NWJA 3WNVA 4NARA 3FPGA 3GMTA 5ES3A 3QGMA 4JNKA 3QF7A 2X0NA 1NMSA 1Q14A 1FP4B 1C4WA 2ZI5A 4HJXA 1I3KA 1RFLA 4MPJA 4MW2A 2K2QB 1V5GA 4LXQA 2YRFA 5C34B 4QDKA 1NLZA 3AUSA 1KO8A 4Q7JB 4YPOA 5A4DA 1G3QA