1P77A

Crystal structure of shikimate dehydrogenase (aroe) from haemophilus influenzae
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
265
Chain Sequence
b'MDLYAVWGNPIAQSKSPLIQNKLAAQTHQTMEYIAKLGDLDAFEQQLLAFFEEGAKGCNITSPFKERAYQLADEYSQRAKLAEACNTLKKLDDGKLYADNTDGIGLVTDLQRLNWLRPNQHVLILGAGGATKGVLLPLLQAQQNIVLANRTFSKTKELAERFQPYGNIQAVSMDSIPLQTYDLVINATSASVDAEILKLGSAFYDMQYAKGTDTPFIALCKSLGLTNVSDGFGMLVAQAAHSFHLWRGVMPDFVSVYEQLKKAML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate 5-dehydrogenase
publication title The crystal structure of shikimate dehydrogenase (AroE) reveals a unique NADPH binding mode
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
total genus 98
structure length 265
sequence length 272
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1p77A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1p77A01
3AOEA 3OJLA 2ZYDA 3KHUA 1K6XA 2HO5A 4P22A 4YT5A 3ZNQA 4ZVVA 1HRDA 3VH2A 3WYCA 1RM3A 1PQPA 3FNGA 2EGGA 4B4OA 5AXCA 2Y68A 4WPGA 3U62A 2P9CA 4MVJD 1KVQA 2HRBA 3OICA 2G17A 4MVJE 3D4OA 4FIZA 3COSA 5F1KA 1Z45A 1PJ2A 3ITDA 4BO1A 5L4NA 4ZRMA 3HFSA 4YA6A 5F1OA 1YBMA 3AI2A 3TZQA 4YTEA 4AJLA 1IUKA 1GUYA 3JQAB 1R16A 4WLNA 4E30A 1DC5A 1DAOA 3K73O 2EW2A 4A27A 1R66A 1PJLA 1HXHA 4YQZA 5I8WA 1WW8A 3AOGA 1BVRA 2ZK7A 4RVHA 1ZSNA 1R4NB 4LGVA 4Q3AA 1I3NA 4P8RA 5ICSA 1N7HA 3JQCA 3GUCA 3X2EA 4E5NA 2HK7A 3VH1A 3GGGA 4LW8A 4ZQGA 4IBOA 3CZMA 4ZQHA 2RH8A 1YWGO 4CV1A 3WIDA 3G3EA 3OECA 1V3TA 1CQJA 3EW7A 3GDOA 3INRA 4GVXA 4CM4A 3DBLB 1R0KA 3MJSA 2PGLA 1GYQA 2UDPA 2NQTA 4Y6PA 2NVUB 4L76A 3T4XA 4BMSA 4Y6SA 4JP2A 1CEQA 1TT5A 4B8ZA 2TMDA 4IIVA 4U5QA 3EMKA 4XGNA 4GGPA 4BS9A 5KWEA 2DU8A 1Y5MA 3K6JA 1E1NA 3QWFA 1NBOA 4MVJH 3TOXA 5HS4A 1Q0HA 3JQ6A 2E82A 5IDWA 5MDHA 2QW8A 4YT8A 2E6UX 4DBZA 1GZ3A 5AVOA 5F5LA 4BNLA 1H9AA 1EZ4A 4IS2A 3MJVA 4DC1A 4RVFA 3Q2KA 5IG2A 4EITA 3PEFA 3S1LA 1DIRA 5L40A 3OM9A 3WWZA 3PQDA 5G4KA 1ZKMA 5G0UA 4BKUA 4XIYA 4QT0A 2O3RA 3UCXA 4RCVA 4NR0A 4ZQFA 4F45A 4K1LA 1B8PA 4HP8A 3A06A 3VHRA 2AXQA 2I3AA 4JJIA 4PVCA 4D0RA 1B26A 3OA2A 3NJ4A 3WXBA 3GN1A 5C7OO 4BNFA 1TB4A 1VC2A 1KC3A 3ADPA 4QFDA 4N18A 4ALNA 4B7CA 3HN7A 3W1VA 2FPGA 3RBXA 3SEFA 1E3LA 4OL9A 4PG4A 1C0LA 3NV9A 4A10A 4R1NA 4JNKA 3P7MA 1KVRA 5KJFA 5L45A 4J4TA 3HQ4O 4U8GA 3Q11A 1R12A 4LN1A 3R3JA 3B6ZA 4W7IA 1DDOA 3HADA 3FF4A 3ZHZA 3AUTA 3F4LA 2UV8A 4I9HA 2D4AA 2HKIA 5IZ4A 4J2OA 3QVTA 2GR9A 4ITUA 4RVUA 1HZZA 3VZPA 4WCFA 3WDSA 4C4OA 1LLQA 3EK2A 4FC6A 3ZWAA 1E3WB 2B35A 4BO7A 5COBA 4R01A 2QQ5A 2ZB3A 2HJSA 4X54A 4IJKA 3ZHYA 3ZZNA 4O6VA 1Z73A 2JJYA 1V9LA 4D3DA 2EG9A 1VI2A 1E7QA 3F6YA 5A9TA 3E8XA 4IJVA 6LDHA 3C24A 4XYBA 1KVUA 1I3KA 1B8UA 1E5LA 1GQ2A 5K6AC 3DB2A 1EE2A 1QR6A 2EP5A 3ZWBA 1YS4A 2GPTA 1E1LA 4QO7A 3RFXA 4YWJA 3RUIA 5JS6A 3NT2A 4AL4A 3DBRB 4J49A 5C3MA 1LSJA 1X7GA 1E0DA 1NNUA 1SOVA 1KERA 5LC1A 1WWKA 2FHSA 5I7EA 1DFHA 4CMCA 1MP0A 3VKUA 3ZWOA 3KBOA 1SNYA 1D1TA 4WLUA 5JLAA 5T6BA 5ILOA 3KVOA 3JQGA 2H63A 1EVJA 3HG7A 4HNHA 3ROKA 4UVEA 2Y1GA 1MLDA 1DHRA 1ZK4A 3H9UA 3WOHA 1I2ZA 4BL5A 4Z6KA 5ITWA 4IINA 3WTCA 1V0JA 4DQUA 4Z9FA 5A02A 2ZIZA 3FBGA 4TVOA 3BMQA 3TFQA 4BO2A 4ALLA 1EVIA 2XPCA 4TZTA 3PDUA 3OIGA 4BO9A 5MGBA 4QECA 3VZQA 4J90A 3CPSA 1E92A 4I5FA 1YE3A 3AUSA 3I4FA 3ZGYA 5CPBA 3ZWYA 5DBGA 2FZWA 4MIEA 3CEAA 1UXKA 4BB6A 3PWKA 4E32A 2C0CA 3PHLA 1G6KA 1TT7A 2Y1DA 3U0BA 1ZSVA 3ROQA 2JHFA 3IIEA 3P19A 3WS7A 1DLJA 1XEAA 2C5AA 3DO5A 3ZU3A 3WYBA 5BSHA 1KETA 2X0IA 3SJUA 3PGXA 3JQEA 1ZW1A 2EWMA 2EV9A 3M6IA 4WNIA 1B7GO 4IM7A 4BO6A 4JP3A 5L7TA 2X9NA 4LVCA 3ZWVA 3S2GA 2O4UX 3GFGA 4CM7A 4FGSA 3KB6A 2ZTMA 1JAYA 1I10A 1X1EA 2C07A 3H5RA 3OH8A 4HKTA 5FFFA 1L1FA 4CUKA 1L7DA 1M66A 1U1IA 3QA9A 1C1XB 4R1SA 1E77A 1JA9A 4DYDA 5KKCA 4BNZA 4BNNA 1DFIA 4PLPA 1PTJA 1Q0LA 5ER9A 3U3XA 4BKRA 3PIDA 4LMPA 2ZB7A 2NTNA 3KYCB 4NBVA 3C1OA 3O8QB 4NG5A 2NM0A 3V1TC 2EKLA 5AQ1A 1NPTO 3WGHA 1NR1A 4AJHA 3VPFA 1PJSA 1RYEA 2DUUA 2FR1A 4JJFA 3S2EA 3S2IA 4DTIA 3CKYA 3C1AA 1NVTA 3D7LA 3DZHA 3NDJA 4YAGA 4CMJA 1LC0A 2BFMA 2NU7A 5TSDA 3IUSA 1P1JA 1U7HA 3V2HA 3G17A 3RQSA 3O38A 1UZLA 1UP4A 4BNJA 1MGOA 2GZ2A 1AHHA 2O7SA 4QSMA 4XD2A 1GUZA 2XAAA 3ZV6A 2I5PO 1YL5A 2XOXA 1HYEA 4JBIA 1BW9A 3L07A 2X0RA 3NUGA 3D4PA 3DAPA 3OETA 1ZCJA 4CMAA 1LI4A 3OEYA 2DTDA 1YVEI 1UAGA 3VDQA 3HHPA 2VRCA 3DHYA 2PZJA 1MUUA 1PGNA 3WBFA 3OFSA 4R54A 4IDCA 5I7FA 1FDTA 5JCXA 5ITVA 4FSHA 2X9GA 1C3VA 4UVIA 3QSGA 2PTGA 5GZ3A 3GZNB 3F46A 1A5ZA 2FRDA 3DZGA 1E3EA 4OSOA 3RD5A 5CEFA 3H2ZA 1E5QA 4XX0A 3EVNA 4OXNA 4WOJA 5FI3A 1QKIA 1IULA 3WICA 1B3RA 1GZ6A 2OHXA 2QZZA 3JQBC 5BNFA 1PX0A 3DMTA 4IXWA 3LT1A 5L4SA 1Y1PA 3EDMA 3VPGA 4UREA 3ZWMA 4S1VA 4CM6A 3LF1A 1F17A 3QRWA 4CUJA 4DREA 1U28A 4IUYA 4CM9D 4ZHSA 2VYVA 2G82A 3ZU5A 1BGVA 1LDBA 4MINA 5I7SA 4FFNA 3QWHA 4PLZA 4D46A 4QEDA 2W2KA 5JAIA 2W2LA 1F8GA 1FXSA 3IKTA 1N8KA 1DIBA 2VWQA 5B1YA 2I99A 2D1YA 3LDHA 3BMCB 3ORFA 3KXDA 4CLEA 2X0NA 5B4TA 1DC6A 3JYQA 4A03A 2H5LA 3ETDA 4D43A 1NPDA 3G0OA 4MVJM 1HDCA 1GZ4A 2JD0A 2OL4A 4CQMD 2PZLA 4UULA 4IGEA 4D7AA 5TLSA 5DCYA 3L4SO 3BA1A 4JJGA 3AU9A 5FEUA 5A4DA 1SBYA 3AOEC 4XYGA 1OI7A 3I6IA 4L8VA 3RJ5A 1JLLA 3HN2A 3O9ZA 4W7HA 1ORRA 1DC3A 2PGJA 2VOEA 3PLRA 3AFNA 4NZ9A 4PN3A 4LCEA 1YL7A 4H15A 1IHXA 2GNAA 3FNEA 3WNQA 2Q2VA 2VZ8A 5IZCA 4F3YA 1HKUA 5G4LA 3IS3A 4F46A 3W4IA 4DL9A 1T1RA 3H2SA 2VQ3A 1IY8A 1UXIA 4DBVO 3WQQA 2CF6A 4ID9A 1B15A 3FN4A 1ZXBA 3AUAA 4OOEA 5TC4A 3FWNA 3HDYA 1LDYA 4URFA 3HB4X 4FFRA 3ANMA 2YJZA 3HWRA 2HJRA 4QFCA 3JQAA 4WNCA 5GY7A 1ISGA 2Q46A 2X1HA 1LA2A 4ND4A 2VYND 1PS9A 3JYOA 3JQDA 4PG5A 4P4GA 1HT0A 2CSUA 5HBRA 4H7PA 3DQPA 4DMLA 4YPOA 3RU9A 1R4NA 1HEUA 1XELA 4MKXA 4F6CA 5ADHA 5JAZA 2VNAA 1ZJZA 3RWBA 3WLEA 1X0VA 4R16A 4EJMA 3AM5A 3QE3A 2BLLA 2NUAA 5TRTA 2Z95A 4NJMB 4ND1A 4D42A 3WNVA 2JAPA 2P9EA 4CMKA 5JY6A 3UH1A 1GPDG 2DBRA 5JXWA 1P1FA 4TROA 3JD1A 1O89A 2V6FA 4DVJA 4M89A 1H93A 2GF2A 2NVUA 5I8ZA 3WGOA 3AK4A 1HTBA 3IP1A 4XDZA 1UXGA 2O2SA 3PJGA 1LSUA 3KM0A 1QP8A 4KMSA 5KNLA 3GT0A 1SMKA 2P5YA 1HZJA 1YB5A 3RSHA 1T25A 4P4LA 4CMEA 3FWZA 2GDZA 4RL6A 4Q3BA 1RWBA 3F9IA 1B3BA 2NACA 2V6MA 1E1KA 3ASUA 3C7DB 4YJGB 2ZKLA 3PYMA 3D3WB 4LMRA 2AQIA 2Z1MA 3MCVA 5CHEA 4D3FA 4PLFA 1TVEA 3D5TA 4NBUA 5FI5A 4FN4A 4OM8A 3W8DA 4E13A 3SC6A 3D1LA 4M49A 3D0OA 1RM0A 1DOHA 4WEOA 1EUDA 3GDGA 2ZYAA 2WWRA 4I8XA 2DFDA 4S3MA 3VZSA 2Q2WA 2OBNA 4UUPA 3WSVA 3B1KA 3KSDO 1N9GB 4OQYA 4MOWA 1UDCA 1CYDA 1PS0A 1NWCA 1SCUA 2C54A 1O9BA 3DTTA 3QQPA 1M6WA 5TT0A 5TIIA 4DUPA 1PJ4A 4L4SA 3G49A 2HMTA 4BO4A 5JNLA 2YZ7A 3K30A 4Q3CA 4DGSA 4J91A 1LEHA 3JQ8B 3DOJA 1A27A 3F4BA 4N5MA 1MFPA 2P5UA 3KUXA 3ENKA 4GAEA 4NFYA 3RVDA 3E82A 1K0UA 3QVXA 5CDGA 5G0SA 5GMOA 9LDTA 4E5KA 4ND3A 4DRYA 1DO8A 4ALJA 4YT4A 2Y1CA 1R15A 3BZUA 3GG2A 3GAZA 5THKA 2OMEA 4CR6A 3U4DA 1E3WA 5A9RA 2P2SA 1O5IA 4NBRA 1NAIA 1BSVA 2VT3A 3BHIA 4WCFC 4FS3A 1VL8A 1LU9A 2YV1A 4XGIA 4AFNA 2POQX 2OBYA 4I9NA 4NQZA 4AG3A 3ZH2A 3WFJA 3GY0A 3KSUA 1HYHA 2C2XA 5B4VA 1VJTA 1LBEA 3ICPA 4QQRA 4Q3DA 2NLOA 3QJ5A 1ZMOA 1P33A 2DAPA 2R6JA 3ZWPA 5B12A 4H16A 3ITKA 1EE9A 4GMGA 4KWHA 3UN1A 4W6ZA 2EJVA 4FJ1A 1J0XO 3DBRA 3PYLA 4BO3A 1VSVA 3RCBA 2GASA 1HSOA 4GI2A 1JW9B 4CV2A 1OZAA 4YB8A 3JD0A 4ZQBA 3ZV5A 3VH3A 2VUSA 3ABIA 1YB4A 2UUOA 2OUIA 5F3RA 5CDSA 5JCJA 2FPIA 3RC1A 2CZCA 3HDHA 5CG2A 3NTQA 1Z6ZA 1E7WA 2VT2A 3DDNA 1TLTA 4I5DA 1U3WA 2HCTA 1J49A 1SEVA 1XR3A 4PVDA 3AY6A 4UVHA 4JCOA 4GBJA 2Q4EA 4BUCA 4A0SA 1WMAA 3WGIA 2GUGA 1PIWA 2ZYGA 3RFVA 1ZBQA 1RM5A 1CRWG 5G0VA 2HAEA 4A2CA 4CODB 1YGYA 1AGNA 2VHYA 3AM3A 3SC4A 4CQMB 3TDKA 1QMGA 1X13A 3TN7A 2B4QA 2IEDA 3OEWA 2Q50A 1LLDA 2W90A 1VPDA 3TZKA 3UCEA 1XU7A 1E7RA 1YOVB 3VPHA 1F12A 3RROA 3ONEA 3KZVA 4MVJA 4Q3NA 1PR9A 3W4JA 4YXFA 1ONOA 3GVHA 2X86A 2Y1FA 5IDYA 4DLLA 4KDFA 4J1QA 3JYPA 3FI9A 2YY7A 4II3A 1Y9EA 4A26A 1MC4A 4IQ0A 5TGDA 1PL6A 1MA0A 1EEHA 5A04A 3LC7O 1KEUA 1SB9A 1N1GA 1C1XA 4RVGA 3D4NA 5F1PA 5IAAA 3IKVA 4EZBA 4EBFA 4L74A 5FWNA 1FK8A 1WZIA 1Z74A 5THQA 1UAYA 1U8XX 5AYVA 2O23A 5HM8A 5KCZA 6ADHA 1T2AA 1XCBA 1KC1A 2HMSA 1JU9A 4J4HA 4OH1A 1NR7A 2E4AA 4CJXA 2HRZA 1WLYA 1LLUA 4OXYA 4WASA 3O8QA 4DQVA 4CPDA 4KDEA 2EHDA 4CM3A 4K26A 4MKRA 4TRMA 4E2XA 5I9MA 2J5KA 3CZRA 1ZEMA 3DL2A 1GDHA 2VOJA 2GCGA 3GVCA 1N2SA 4TRRA 5CG1A 1QYXA 1Y8RB 3WG9A 4WOKA 4BNVA 1T4BA 2A9FA 3FR7A 3DOOA 2HK9A 1K89A 3B1FA 3D5QA 3MOGA 3RIHA 3UCFA 1Y6JA 5DCWA 1PWXA 4AJOA 3NGXA 2QIOA 4Z3KA 1ADCA 1KY5A 4NFHA 2VZ0A 3ZHXA 1PZHA 1XGKA 3LT4A 3H3JA 4ILKA 2X6TA 5U4QA 4B3IA 1T2DA 2B36A 2OP1A 1LRLA 1T1SA 7ADHA 2WYVA 4YJHB 4GSLA 2VRBA 2FZEA 2PH5A 3K5PA 4CM5A 4GWKA 4R69A 1DBVO 3G79A 5AOVA 1GAEO 4F6LA 3LYLA 1J4AA 4DWVA 2W4QA 3UFXA 2LDBA 1P0CA 1QRRA 4GMFA 3JD3A 2C59A 4BNMA 4O0LA 2EP7A 3F1LA 4B3JA 1C0IA 4RV9A 4IDBA 1C0PA 4CLDA 3O03A 3RUCA 4DMMA 4GX0A 2PV7A 1KVSA 4A73A 2HDHA 4O63O 4BMVA 2H1SA 4WEQA 2J3HA 3QVOA 3EAGA 3IJRA 1ULSA 3AW9A 3NDRA 3SLKA 4E6PA 3ROPA 2IRWA 1MC5A 4DPLA 1UP7A 1NTOA 1OAAA 1QYVA 5FF9A 4YBZA 3DMTC 2AQ8A 4J7UA 2Y99A 5LDGA 1CF2O 4M1QA 5KVSA 3KLPX 3UKOA 5JW6A 1WDKA 3TL2A 4FOSA 1DC4A 4JXKA 4EI2A 4TVBA 1I2BA 1YDEA 1DHTA 5A05A 5DN9A 1ZZEA 3U5TA 1GU7A 2O2YA 3I6QA 3AJRA 3BMCA 4MDHA 4PLYA 1SEPA 2B37A 2HLPA 2YQ4A 4J2HA 1FMCA 3MJ4A 3GRPA 3TL3A 2E49A 4IS3A 3T4EA 4M8SA 2R00A 2Q1WA 5G0WA 3WTBA 2I3GA 4NBWA 2NU9A 3I52A 1GADO 3BMOB 3FTPA 4K6CA 1YH3A 3ROMA 4BOYA 1NQ5A 4RVSA 4GLOA 4C7JA 5T64A 4DQXA 2QZ9A 2YYYA 1XLTA 3Q6IA 1BRMA 4FD3A 1I8TA 2PGDA 3IOYA 2I65A 1H6DA 1CETA 2GN8A 4WECA 2UVDA 3BAZA 4PLVA 5JE8A 4E5MA 2EGHA 1LC3A 3GN2A 3CIFA 3E6AA 4UUNA 5ES3A 3FR8A 4HFNA 4KUGA 2I6TA 3K96A 4IDEA 4IXTA 4RLSA 2EKQA 1KY4A 4J43A 2PLAA 4UUOA 4B4VA 2B83A 4BQPA 3LLSA 5EN4A 5IZCC 1JKFA 4IQGA 1YBVA 4UVDA 2ZB8A 4FB5A 2NU6A 1GCOA 2X58A 5EIOA 2DBZA 5AXBA 2DQ4A 2UUPA 4LVUA 3AWDA 2AE2A 2AQKA 4FPXA 5JFOA 1E6UA 1CJCA 2BKAA 2O3QA 2VNSA 3LZ6A 1UH5A 3K8ZA 4MVJI 1MG0A 3GUYA 2SCUA 5JMPA 2FWMX 4IIUA 1HLPA 1ISIA 4XKJA 1D4FA 1U3TA 1JQBA 4PGFA 1YONA 1S7CA 3GZ4A 1LXCA 1PJCA 3INTA 5H83A 3O26A 1U3VA 2C7VA 1E3IA 1KBZA 3CSDA 3TZCA 2W98A 3E5RA 3V2GA 4NJMA 5JDCA 5L7WA 2IXBA 5CAEA 1VSUA 2I67A 5DCUA 4KUEA 4IY1A 1ADBA 4PZDA 5EQFA 2Y1OA 3H7AA 5EL0A 4L9RA 3NX4A 1DIHA 1ZO8A 1E3JA 3AY3A 3H9EO 3I1JA 4Z0HO 1K2WA 1PGQA 2WYWA 1PJQA 4E4YA 4MKZA 3T7CA 3DONA 4JROA 4O5OA 2ZQZA 3QHAA 2NVBA 4J4BA 5BNTA 2O4CA 5F21A 2G1UA 4J7CA 1XU9A 3DMYA 1I36A 2AEMA 3UOGA 1VLLA 4BV8A 5JY1A 1T2EA 2XXBA 3L4BA 1EBFA 4GX2A 2CFCA 1RM4A 2A4KA 3I3OA 3NT5A 4OKIA 4NDNE 3MWDB 5BSFA 1TXGA 2HU2A 4YJGA 5I9LA 5KVQA 3KEQA 3D3WA 1I32A 4CMEC 4WE3A 3V1YA 4E5YA 4Y98A 2JCYA 3BTSA 1KVTA 4OXKA 5IN5A 1ZSYA 4FC7A 4J9UE 1I30A 4TRNA 3FTNA 3KO8A 4Y9DA 4RQUA 4NH4A 1PJBA 2D5CA 4KUHA 4D45A 5ICMA 2UYYA 4A5OA 5DOVA 3ON5A 4NJOA 2I9PA 4YR9A 1V3UA 3U4IA 5L9AA 4XYLA 1PQUA 3I9KA 1B16A 1BXZA 1PZGA 1OC2A 1TI7A 1ZVMA 3EHEA 3QWBA 3OQ1A 3MWEB 2EW8A 1VKNA 2VWPA 3G1UA 4I08A 2HMUA 3U9LA 1P44A 4O59O 4E12A 4FR5A 1GV0A 1BHSA 2C29D 3GR6A 4IJUA 4Q3EA 1MV8A 1X7DA 2OXIA 1H2BA 3R3SA 2FP4A 4AICA 3HSKA 1AHIA 3FD8A 1ARZA 4I9UA 5KJ1A 2Q45A 3RU7A 1HE4A 2PA3A 5DDIP 3K31A 1GL3A 2FN7A 3Q9UA 2X7HA 1X0XA 2X23A 5TNXA 1UZMA 2YQ5A 3AUUA 5IXYA 2NQ8A 1O95A 1GCUA 3OQBA 1DFGA 2A94A 3RC9A 3AM4A 3JQFA 1GQYA 4YT2A 4YACA 3BMNB 2E37A 2EERA 1BWSA 3GLQA 4AJ4A 2YDYA 4XDYA 2Q3EA 3L0DA 3L9WA 1FDWA 2QG4A 5JC1A 1T24A 1W0CA 4R51A 4AVYA 1U5CA 4OOFA 4YDRA 3I83A 2QX7A 3C3XA 4Z0TA 4HX5A 4JBGA 3JQ9A 4GVLA 4JLWA 5IJZA 5EPOA 3NDIA 1ONPA 1P1KA 1IL0A 3AI3A 4JN6B 4FJ2A 2AEJA 2O3JA 5HWSA 3PHGA 4KP7A 1VL6A 4IGFA 3OJFA 3LC1O 1LSSA 1P3DA 2CVOA 3PRJA 4BVAA 2GSDA 3QWIA 4W9NA 1T4DA 2BRUA 3QWAA 1B14A 1T2FA 2OFPA 4HY3A 4RDIA 1O94A 2GZ3A 4CM9A 3RC2A 1DB3A 3E9MA 3BTVA 4W82A 3QV1A 4TQGA 5A3JA 1G0OA 1ID1A 2YUTA 1O6ZA 1IZ0A 3I4CA 1HF3A 3KRTA 4MIYA 4XR9A 3CXRA 3UXYA 1Y8QB 2JL1A 1M6HA 3ETEA 1WDLA 1F8FA 3TWOA 3Q3CA 3H4VA 2NTVA 4HFJA 2D2IA 1BVUA 4BNTA 4FDAA 3QY9A 5T67A 3MJTA 5HRUA 3KEOA 4WLFA 4CM1A 2IYOA 5EERA 3WX0A 1UP6A 5TJ9A 4CQMA 1IE3A 3IJPA 1MXHA 3N74A 2DBVO 2IZ0A 2B0JA 4UUMA 1M67A 1VRWA 1LX6A 2GO1A 4BMNA 2VUTA 4YJFB 1VJ0A 4PG7A 1YOVA 3RAJA 4WKGA 1NX6A 4ZGWA 4PRLA 4BO0A 1U4SA 3LVFO 4J1TA 4ALMA 1NQTA 4NBTA 1DLIA 1ZJYA 3SLGA 2H6EA 3VKVA 1NQAO 3BHJA 1I5RA 1Y5RA 2ILTA 4PCVA 4OQZA 4ZA2A 1CWUA 3PQEA 4PG6A 3UUWA 3WBBA 3GDFA 1GFSA 2JCVA 3IP3A 4UEJA 3FPLA 5I9NA 1YJQA 3WQSB 4RPLA 1UDAA 4BQRA 4HADA 4PLHA 1YBAA 1ENYA 3ONFA 4Y8VA 1U7TA 4B8WA 3K9QO 2QHXA 2E48A 1UR5A 4OIMA 4J1SA 3AI1A 4YAKA 2JAHA 2VYNA 3H9QA 3C7AA 1NP3A 4B4WA 1UDBA 1K5HA 1HLDA 1LQTA 1V6AA 2PWZA 4RVDA 3PHHA 5L51A 2Z1NA 4DPKA 4DYVA 1B2LA 5HS6A 2QRKA 3QW2A 1HYGA 1V8BA 4XJSA 3CTMA 1GV1A 1UZNA 4TMFA 4NK5A 1N5DA 3EY4A 3KTDA 3ZWNA 2EJWA 3P2YA 1HDYA 3E5MA 3U4HA 4DPMA 4J9VA 1Y8RA 2PD6A 4IDGA 1QYCA 2Y0CA 2Q49A 3DC2A 5IXSA 1KEVA 1GTMA 1WP4A 5GZ1A 2G0TA 2BD0A 1DXYA 3R6DA 5EJ2A 3MJCA 1FDSA 4XRRA 1PGJA 4RPHA 3IQDB 1PEDA 4II2A 5A06A 5IN4A 3ASVA 4RF4A 1HETA 1DPGA 1GEGA 1Q7BA 1LTHR 4H3VA 3I9JA 2Y05A 3EUWA 2WD7B 1H94A 3H5NA 4K28A 1A4UA 3JD4A 4YJHA 3SVTA 4HV4A 5BSGA 1ADGA 1I24A 3ONDA 4GSKA 2X22A 4OJNA 4TKMA 4HFMA 1UUFA 3DBLA 1FF9A 1BG6A 2FMUA 2IZ1A 2ZJ1A 4L4XA 4N7RA 5B37A 5TT1A 3W6ZA 4AJEA 5A03A 4MPDA 4NU6A 2UAGA 2RCYA 3DEYX 3B20A 4HBGA 2FSVA 4FQ8A 4BO5A 4FFMA 2VCYA 5A5FA 3ZW9A 2O3SA 2DPGA 3DFUA 4E2WA 1NASA 5CDYA 2HK8A 4K9DA 3DZIA 1D1SA 3GOHA 3FNHA 3A28A 4CR8A 4JK3A 2WTBA 3DXFA 2IODA 4ZN6A 5JYEA 3P5SA 2Q1UA 2PZKA 3OSUA 3G1TA 3HZZA 2VWHA 5JAMA 2WE7A 3PJFA 5JSFA 2JFGA 4EJ0A 3INGA 4WJZA 3S55A 1NWHA 5BNIA 5CP8A 4K6FA 2ZJ0A 4CL3A 1YQGA 1JTVA 2R2GA 4L0QA 3A9WA 2AG8A 2A92A 3CE6A 3PXXA 3U4CA 4D0SA 5U9CA 3CMCO 1PZEA 1W73A 4GH5A 1I33A 1PQWA 1KIFA 2YFHA 4L73A 2GERA 3DTYA 4EUEA 1KS9A 1QLJA 1AUPA 2P9GA 3HB5X 4NNJA 3DZFA 2BGLA 4MO2A 1EFLA 1A71A 5JDIA 3LT2A 1EQUA 1D8AA 3IL2A 3BMOA 1WZEA 1VE9A 3LC2O 4EGFA 4G2NA 4YAJA 5C7LO 1DIGA 1BXKA 2OO5A 2R00C 1NPYA 2NSDA 1W4ZA 1I3LA 2DBQA 2WJPA 4EYEA 4Z9XA 5GZ6A 1ENOA 3ZV4A 4XB2A 4AJ2A 3F1KA 4UVGA 1SAYA 2OOSA 1V3VA 3VPXA 1TEHA 4WLOA 2JD2A 4R3NA 3RKRA 2WYUA 3H8VA 1E3SA 1P31A 2G5CA 1BTOA 3EZYA 2Z5LA 5BQFA 4IJWA 3GEMA 4BHTA 4M86A 1IPEA 1OFGA 5HA5A 1VL0A 3GK3A 3RASA 1A7AA 3WGGA 1EMDA 1ENPA 4RO0A 4DC0A 4GL4A 4BNHA 4MVJP 1GD1O 1WMBA 3NT4A 4NPCA 4D79A 1P0FA 3GVPA 1ADFA 1C0KA 2D3TA 3JQ7B 4PG8A 4PLCA 4CLRB 4YRDA 2C7GA 4O1MA 1I01A 1IB6A 5B4UA 3GNSA 2OZPA 5HTOA 4PRKA 1GPJA 5IFLA 1V35A 2YFQA 2QRJA 4G65A 4YYZA 1MX3A 1JWAB 3B70A 3M1LA 1YXMA 4YJDA 1EDZA 3NEPX 5DZSA 3K2BA 3DOCA 1PGOA 2X9VA 4RF3A 5JC8A 3OIDA 3HNPA 3I9NA 1HWYA 4BKPA 1ZFNA 2LDXA 1M75A 2RAFA 5KOIA 3SJ7A 1JKIA 4ZD6A 2GLXA 1U4OA 3C85A 5TF4A 3TZHA 3SX2A 3GNTA 1AXEA 4XR4A 3GA0A 3X2FA 4YCAA 2WDZA 3GHYA 3M2PA 4BB5A 4KTVE 5KVCA 1DEHA 4EUHA 3TNLA 3GEDA 1VKOA 4CMIB 4BGUA 3AY7A 4G5HA 4TWRA 1AN9A 3TFOA 1N1EA 2X4GA 3D3EA 3VOSA 5K0ZA 4RPJA 2ZCUA 4R4JA 4LCJA 4PIVA 3TJRA 1IZ9A 1XIVA 2BMAA 2CDBA 2AA3A 3WSWA 1ML3A 1BDMA 2VHWA 1U2DA 2J5QA 3E9NA 3L4BC 1EK5A 3H65A 1B0AA 3VDRA 2IEBA 3PPIA 1RYDA 5ENDA 4XA8A 3WFIA 3MTJA 1NFFA 1K6JA 3TPCA 4CLHA 4BNGA 4CUZA 3EGOA 4KQWA 4BV9A 4E31A 2IYPA 2O50A 1LQUA 4L75A 3F47A 3B1JA 2V7PA 2AHRA 4MVJG 1NFRA 5T5QA 2XXJA 1ZIDA 4IDDA 5KJEA 1C14A 1LRKA 2NVWA 4RPKA 1EDOA 4WUVA 3RFTA 4BNUA 4EEXA 3GPDG 1ZUD1 2O48X 4FFPA 1H6BA 3PIIA 2BF7A 1OOEA 3V5NA 4XB1A 4CM8B 2DKNA 1QG6A 4IMRA 3PZBA 5AXDA 5DP1A 3BIOA 3K2EA 5JAQA 1ISMA 3KYCA 4KZPA 1E7SA 4FFLA 2O3UA 3DAFA 3FRJA 2VZ9A 4OHUA 4ZJUA 2V6GA 5I7VA 5KJCA 3BYZA 3OJ0A 3PK0A 4AJPA 5DF1A 2VHZA 3WMWA 1UXHA 1Z7EA 1ZEJA 3I5MA 3ZU4A 5L95A 2TMGA 3WB9A 5IF3A 5J23A 4CMGA 1ZK1A 2C20A 1Q1NA 4OGWA 3BMNA 4ONEA 5G2OA 5DULA 2YDXA 4FFOA 3UF0A 1LNQA 3JQFC 3GGPA 1FJHA 2Y0DA 4AJ1A 1S6YA 4MP6A 1K6IA 2AEFA 4NU5A 3OHSX 5EINA 3ETGA 5EESA 1GYPA 5L4LA 3PWSA 3OMLA 3V1UA 3DHEA 5KVVA 2PKQO 3L6EA 1EQ2A 5JPIA 1HSZA 1YO6A 2NU8A 1N92A 3NJ8A 3JQ9C 1F06A 1ISFA 1SB8A 1X7HA 1XKQA 1VM6A 1XYGA 4JBHA 2P4HX 1R0SA 4U6SA 3OJEA 3ZNOA 4XZ3A 1A72A 3FNFA 4ND2A 4DIFA 4GGOA 3GZNA 3F5QA 1N7GA 3UVEA 4EEZA 1CERA 4Q9NA 1DSSG 3GNQA 2BELA 4I1IA 4W9NC 4BIIA 2JKVA 5A9SB 1P77A 4FJ0A 1R6DA 4DIBA 5JO9A 1KOLA 1PGPA 2BFOA 3VPSA 3JYLA 4GWGA 1HDGO 3ANLA 2CF5A 1Y8QA 2CY0A 4EDFA 5CDTA 1VJ1A 2CUKA 4J3FA 1FDUA 1NHGA 5BT9A 4PZEA 1DJNA 3A1NA 1O0SA 4XIJA 2V65A 3UHAA 1X14A 2OGUA 1P1HA 4NI5A 1SZJG 1HDXA 2NTJA 3PFFA 2RHCA 1PL7A 3HUDA 4E2ZA 1HL3A 3GVIA 4MJLA 5IDXA 3L77A 3LSYA 2YHIB 2WMDA 1P1IA 5EQDA 3W8EA 4RJTA 4YJFA 3I9OA 1GY8A 2IZZA 3HJAA 4B3HA 3A4VA 5CDUA 4BGIA 1E1MA 4R3WA 1SO8A 2ZB4A 2D8AA 2EKPA 3WIEA 3LK7A 3IDSA 4OAQA 1YDWA 4IZIA 4BO8A 3FHLA 3FSRA 3MZ0A 4IDAA 3LU1A 1U3UA 4E3ZA 2BI7A 3ZI0A 1WAMA 2AQHA 5L7YA 1A9ZA 3D64A 2VWGA 4AJKA 1C1DB 2HUNA 3OF2A 2Y1EA 4XWYA 4U7WA 1DAPA 5L3ZA 4Y6RA 5CEJA 1YQDA 5DP2A 1GUFA 1E7MA 2W8ZA 3JYNA 1I3MA 1YL6A 1PL8A 1QORA 4IMPA 5C5IA 4RDHA 2FSSA 4JQCA 1M2WA 1PJTA 2PKQP 3GC6A 1Y7TA 3PP8A 1R37A 1JN0A 1QSGA 3HDJA 4R5MA 2CNBA 4XQ9A 3IMFA 3EZLA 4CLOB 4CR7A 3VTFA 2FY8A 4BNIA 4CV3A 4LK3A 4C7KA 1R4MB 2DC1A 3GRKA 4BNYA 1GYRA 4TKLA 4XQGA 3STHA 3U09A 5C7IO 4FW8A 1CDOA 3VTZA 4RZHA 4HNGA 4R1TA 3V8BA 3ZCXA 2ZATA 3ZV3A 2EF1A 2PR2A 1BXGB 3JSAA 3R1IA 3DBHB 4EW6A 3GF4A 3BTUA 4M54A 4CV0A 3Q0EA 4R68A 1AE1A 1LDNA 3QIVA 2J3KA 2WD7A 1IHYA 1F0YA 3LQFA 4G81A 1H6AA 1B8VA 4WGGA 1NAHA 4E21A 2X5JO 2QRLA 1D3AA 3WYEA 3TOZA 1ULUA 1U9JA 5FYDA 1T2CA 5KTKA 4BKQA 2EEZA 1A4IA 5K9ZA 1EUCA 3PHJA 5T8KA 2D5AA 2ET6A 3W6UA 4YVFA 3KYDB 4TSKA 3GFBA 4ROSA 4E5PA 1EK6A 3PFWO 5L53A 4B7UA 4OSPA 2NADA 2BFAA 1LSOA 2DT5A 3PGJA 4FOOA 4XQEA 3RUEA 4CLXA 2RIRA 4NIMA 1YRLA 5DBIA 3S2FA 2J3IA 4CQLB 1Q0QA 4YAEA 3HDQA 2PZMA 3ADOA 4GKBA 3RUAA 1I2CA 1H2HA 3NTOA 1DIAA 2B5VA 1J6UA 1XSEA 4RF5A 4BKOA 3WWYA 4XQCA 4CMHA 1GQQA 2DPHA 1N9GA 2Y93A 1JWBB 3NKLA 4RORA 1U8FO 1EBUA 5EMHA 3CMMA 3PI7A 4JX8A 3NGLA 1MFZA 3IUPA 2PK3A 2ZQYA 2IDZA 3F3SA 3TSCA 1HDZA 3LT0A 4CL8A 1QYDA 3KOUA 4YQYA 1L7EA 2HSDA 3JQ8A 2D0IA 3ZWWA 2HMWA 4FBGA 2IE0A 5DNAA 2GD1O 4RF2A 3MEQA 4NMHA 3CINA 1T26A 4DIOA 3E9QA 3RUDA 4J1NA 5JDIC 1D7OA 1ONNA 4RLHA 3W8FA 4RZIA 2DLDA 3GHHA 3RUHA 4MP8A 1XQ6A 2VHVA 1Z82A 3TRIA 3GMDA 2DTXA 1GR0A 3T7EA 2VN8A 3Q9NA 3DAGA 2CVZA 2VUUA 2WEKA 3RBZA 4P4NA 3UGKA 3N58A 5ER6A 4LISA 1Z7BA 1XWFA 2I66A 4J0FA 2DTEA 1X15A 4J0EA 3F5SA 5A1TA 1UXJA 3ICCA 4A7PA 2RBEA 3LF2A 1Q7GA 4J7XA 2X5OA 3FCOA 3GPIA 2ZTUA 3JQ7A 2CMDA 1GEEA 4CLRA 1KEWA 2EIHA 1YKFA 5U1PA 1XG5A 1QV7A 4IQ8A 2X8LA 4Q39A 5COQA 3ZNPA 1G0NA 2Y0EA 3GQVA 9LDBA 2B69A 3Q1LA 2YW9A 4DLAA 2DVMA 1CQIA 4LRSB 1LUAA 1EFKA 2AG5A 3OIFA 2NV6A 3PVZA 3UICA 4BNKA 3RKUA 1XQ1A 2QYTA 3HE3A 3WR5A 3KYBA 4HUJA 2VTDA 1BMDA 5G0TA 1A9YA 3MJEA 1ZXLA 4CM4B 1PZFA 4XJTA 2YHUA 1HE2A 4UEKA 1NVGA 4GLLA 1W8DA 3GMSA 4J6FA 2Y66A 4IPTA 4U0KA 2D59A 3RUFA 8LDHA 3WJ7A 1TT5B 1W6UA 3C8MA 4D44A 4QX6A 2JD1A 1CIVA 3ZDFA 1JDJA 3C1TA 3E1KA 5KKAA 3DZKA 4IZHA 1JVBA 4JIGA 1LDEA 4BNWA 2I76A 1ZK3A 3S8MA 2VRCD 4CMIA 2YV2A 4BNXA 3MTGA 3NYWA 3KSZO 8ADHA 2J8ZA 2DUWA 1H0KA 2P91A 1H9BA 4DXHA 1ZK2A 3V2UA 1KEPA 4N5NA 2GGSA 3HFGA 3PTZA 1LDMA 4OKNA 5G4KB 3ZHBA 3WQRA 4FGWA 2O7QA 1JAXA 4QXMA 4B4UA 2WE8A 5JYDA 2A35A 2Q2QA 2Q99A 5TS3A 3VVBA 2CD9A 3ZWCA 2IXAA 1Q2XA 1PSDA 5TJHA 4PFJA 5F5NA 2AMFA 2NNLD 5DOZA 2BGMA 3U49A 1U5AA 3RC7A 1WXDA 2BGKA 3I9MA 3EYWA 1J5PA 1QLHA 4U0JA 4QO8A 1PJ3A 3DR3A 5T57A 3K92A 2VYVD 1SC6A 1WPQA 3LLVA 4E2YA 3JTMA 1EUZA 4U6QA 3I9LA 4KOAA 2PNFA 5A5EA 1AXGA 1IYZA 2W2LD 2FPPA 4CM8A 1SPXA 5JO0A 2F1KA 4PLTA 5H82A 1Q7CA 2Y67A 3ZN2A 1E7YA 3PZRA 4WCFB 1M76A 3O4RA 1H5QA 4INAA 3PJEA 2C82A 4Y67A 4M87A 3W4KA 3E03A 2B4TO 1OBFO 1OC4A 1WNTA 3CH6A 4N54A 3PQFA 2Q1TA 3JD2A 4UAGA 1X1TA 4XGKA 3NTRA 4XRGA 5COAA 3SXPA 5BSEA 4GKVA 2HQ1A 4QUKA 4D3SA 3OP4A 2F00A 5K6AA 4TRJA 3L9XA 3DBVO 1OMOA 4J16A 1ZNQO 1MB4A 3E18A 5IDQA 3JV7A 4YAIA 4XYEA 2CDCA 3RI3A 2PFGA 4YEDA 4EUFA 1RKXA 2BFPA 3GVXA 4IDFA 4B7XA 4RPGA 1JKJA 4N5LA 3C7CB 4D41A 4WLEA 3UW3A 5TX7A 3KETA 4MP3A 3UAGA 3CUKA 2BH9A 3L6DA 4DLBA 3R0IA 3AU8A 2JFHA 3PLNA 1TA4A 3I23A 4EJ6A 2BI8A 3KV3O 1P1RA 1DRUA 3ZU2A 4ZICA 3JQAD 2XF8A 4Z3DA 1NM5A 1HDRA 2O3TA 1HE5A 4R41A 5C37A 1WDMA 3JQGB 5A9SA 2C2YA 2BHLA 1PU2A 2X0JA 4MVJF 5BR7A 1IOLA 3NAQA 4GQAA 1HDOA 4KTTE 5ENVA 3JCZA 3BMQB 3L6OO 4XYMA 5TQVA 4PLGA 3PHIA 1EVYA 1JVSA 1ZMTA 2DFVA 2FOIA 3AFMA 4B79A 2B5WA 2GRAA 1QXSA 4LRTB 4R9SA 3DFZA 2FR0A 2AE1A 4QTZA 2B4RO 4BGVA 4ZQEA 3BTOA 3QP9A 4KWIA 3DHNA 4E0BA 1G1AA 2VTEA 5JMWA 1MG5A 2X5KO 2FR8A 4R9RA 4Z0PA 3BHMA 2YHIA 4NFSA 2VHXA 3FBTA 1ISJA 4MIOA 3PYXA 1U2GA 4BGEA 1IPFA 1MXFA 3BXXA 4UEOA 4YRAA 1ENZA 4Z9YA 4R5HA 1DRVA 4YRBA 3QVSA 4I5EA 1PWZA 4M55A 3E48A 3RJ9A 4ALIA 5CPFA 2PKRA 3A14A 1P9LA 3PJDA 3SBOA 1KYQA 1I0ZA 2GZ1A 3ZWXA 3WJAA 1YB1A 3IAHA 4AJIA 1C1DA 3WLFA 3ST7A 3H6KA 3WGZA 5CFZA 2G76A 1FDVA 1RPNA 1K3TA 3P2OA 1A7KA 1P74A 1YJ8A 4TZKA 3GAFA 1SOWA 1NQOA 1XA0A 1QV6A 1XDWA 1Y9AA 3ZNNA 2NWQA 1ZK0A 1LLCA 3GG9A 4PZCA 2JFFA 2JCXA 1XHLA 1WVGA 3OJOA 1HE3A 1DJQA 1YQXA 5JBIA 4AJNA 1LDGA 1LRJA 1NYTA 1P45A 4NK4A 4CLOA 2QYSA 2PD4A 2RH4A 3GH3A 4FCCA 1EVZA 1R4MA 1RJWA 3WGYA 2Q4BA 3N7UA 5DT9A 3ULKA 3ZW8A 4DA9A 1ISHA 3Q2IA 2GN4A 1R0LA 3H9GA 1O8CA 1DRWA 3M2TA 2J6IA 4I5GA 4E33A 2JHGA 3QVWA 1BXGA 5KJ6A 4LSWA 3DBHA 1BDBA 1Z75A 4P38A 2V6BA 3ENNA 3VZRA 2J5RA 4JGBA 2EXXA 1BW9B 2CVQA 2C5EA 3NRCA 1NXQA 4OO3A 3PWZA 5KIAA 2ZTVA 3WMXA 4OYRA 7MDHA 3PDJA 3ANNA 1NVMB 1QYWA 2DM6A 3DZJA 4LSMA 3H5AA 4WCDA 3FPCA 3TQHA 1E6EA 3KLMX 5JDCC 2WM3A 2PH3A 3DZBA 3DWFA 1NFQA 3RBVA 4W4TA 3WGTA 3GEGA 4WLVA 3VAZA 4KQXA 2PD3A 3JQBA 4ZRNA 2P4QA 4RGBA 3KYDA 4ESOA 2PY6A 3MOIA 2OP0A 3IC5A 5T8KC 3VH4A 4W99A 3EVTA 5LDHA 4ND5A 4CMBA 3OBBA 4PLWA 2WSBA 2GYYA 2HMVA 1ZH8A 4R1UA 3VVCA 2YV3A 4GX1A 3VC7A 4CQLA 5CEEA 3OQ6A 4ZU3A 3WGQA 2Q1SA 4ALKA 1PR3A 5JCJD 1F14A 2P68A 3TZ6A 5LCXA 1Y81A 4XEHA 2AW5A 3M1AA 5A3VA 2ZTLA 4HWKA 1E6WA 4AJJA 2J3JA 2ZCVA 1H6CA 4HXYA 4WK6A 5DBFA 2GN6A 1LJ8A 2OORA 2W2KB 3GGOA 3EC7A 5H81A 4RQTA 3TF5A 4NHEA 3OA0A 4OMUA 4XCVA 2RHRA 3H3FA 2WD8A 4GPD1 3H9JA 2GN9A 3QLJA 4HFRA 5ILGA 4GX5A 1NHWA 1UJMA 1PS8A 2CDAA 2H9IA 5AXAA 4L4RA
chains in the Genus database with same CATH superfamily
3WL5A 1EK2A 4Q4CA 2VHUA 5D3KA 5ALPA 3KHUA 4U7TB 4KV7A 2FFHA 4YT5A 2ODTX 1G64A 2AUMA 4JP5A 5TV2A 3ZNQA 4DUZB 3K70B 1RYFA 4EHLA 1BWPA 1TF5A 1ZA2A 3DEAA 3KCNA 2EGGA 2FW6A 3N2GA 5SICE 3D6HA 4B4OA 3U62A 2GTPA 2NVOA 1OGIA 3DT6A 1M34A 2BVNA 4WA7A 5AVXA 5KDDA 1XDUA 1DX4A 1YFZA 2G17A 3H99A 2C5HA 2IOFK 2INGX 2VT7A 3COSA 3D43A 3FYUA 3OY2A 3QMVA 4FIZA 4NBNA 5DNEA 5F1KA 3ZI7A 4AKGA 5L4NA 4G84A 4S1OA 4MQ5A 5KX5F 1ADJA 1G41A 4KL8S 3BXFA 1M1ZA 2WU3A 3HJUA 4G4JA 5TPWB 1FL9A 3WFZA 2PKYX 3PFIA 3AI2A 3WYAA 1HDIA 1L7VC 2J46A 3BGIA 4KK3A 2IPMA 3TSYA 5AVQA 1CVRA 2VNHA 3RRNA 1IUKA 3O1JC 4D92A 3EA0A 2UXBB 1M83A 1OZHA 1SXIA 2IUTA 1XTUA 3D2CA 2EKBA 3K73O 2VBCA 3L04A 4C0JA 1KEKA 4OPMA 4C0SA 2C0PA 4RXTA 2HOQA 4TLMB 2AHOA 2QLLA 4J0HA 4OB8A 3VAAA 5JQWA 1E4EB 1VTKA 1WW8A 2ZK7A 3AOGA 3G9XA 4RVHA 4FKMA 5CDFE 4IZ6A 2XSZA 1ZMBA 2EQ5A 5KWIA 4QHTA 1DV2A 3FUTA 4L3VA 4Q3AA 1I7QB 2HQOA 3ESCA 2IC5A 2CDRA 3MFYA 1J99A 2HK7A 5BW4A 4DBLC 3ZCVA 4LW8A 1GG9A 2RAVA 1KOJA 1QZUA 1VGQA 2FW1A 4IBOA 4IWXA 4WX2B 5BWOA 2RH8A 5CXQA 2Z6AA 1XZMA 1HK7A 3WIDA 3G3EA 3ZIDA 3T3EA 4JKIA 2A9VA 2BM9A 3N2EA 1UL1X 4RSHA 4WGFA 3ZHVA 1C3XA 4B80A 2VCEA 3DBLB 4CKZA 3F6CA 1ZA1A 1GYQA 2UDPA 3PD0A 4ZVNA 1FFXB 2NVUB 1WJGA 3I1FA 1O7JA 2B92A 4OQNA 3T4XA 4JP2A 2JFUA 4WK0B 4XGNA 1XL0A 3EMKA 2O8CA 3K9HA 1Y5MA 3K6JA 3NIBA 1E1NA 3QWFA 4B47A 3L41A 3TOXA 1N1MA 2HF7A 4J0GA 4EO9A 2E82A 3WNZA 5IDWA 1O9GA 1R0CA 4GLFA 3P94A 4I1YA 5AVOA 5F5LA 4ZOCA 3SYLA 4BNLA 2VPZA 1NDHA 4I4TB 1TKBA 2F1RA 3Q2KA 5CNJA 4EITA 5AVVA 1EDEA 1X7WB 1B0UA 4IOMA 1N25A 3RIGA 1L5QA 3B12A 3WWZA 4DR3B 1JR3D 1QIHA 3ZDYB 1E61A 1TIPA 1C5KA 2HFJA 4QT0A 1OTXA 4J76A 1SKYB 1JNXX 4RCVA 4PQYA 221PA 4B1FA 1FXWF 1Z2AA 2QP9X 3KUCA 3R75A 2IH5A 4Y6QA 2AXQA 2I3AA 2BFEB 4IHJA 4ETIA 5K4HA 4YP6A 4ODIA 3J81A 3AV0B 4TL6A 4BNFA 5E95A 1TB4A 1VC2A 3T0FA 3ADPA 3FTFA 4B7CA 4H3SA 2FPGA 3RBXA 3SEFA 4A0QA 1SC4A 1IIBA 5TMPA 2REQB 4PG4A 3NV9A 5INTA 4PWYA 3T1YB 4HH0A 5IT4A 5I7WA 1N32B 4RV4A 4W7IA 3B6ZA 5HZKA 2A5YB 5K05A 4HAXA 4IGAA 1JHVA 2RHLA 1RU3A 1BE0A 3AUTA 3F4LA 3S3TA 5FNZA 5JH7F 4I9HA 1XEWX 3UPTA 1TUEA 3ZWQA 1E3QA 5BSRA 4OB6A 5KTSA 3QVTA 4G25A 1UOPA 2HF8A 3ZTWA 2VLIA 1S3IA 2VDUE 2ZSFA 3ZWAA 2VJDA 2B35A 5FPTA 3WSTA 4B48A 1JDNA 3K09A 4X54A 2FHPA 1SKMA 4PZPA 5LBUA 3ZZNA 4OHCA 4CKWB 2GA8A 2Y0PA 1Z73A 1ZNZA 4NG4A 4CG3A 4G0VA 5KPDA 1VI2A 3FYCA 5A9TA 1N2OA 2DT8A 4IJVA 4ZRDA 3UEOA 2JI7A 8ATCA 1USVA 4KKXB 3C24A 3SY8A 3WWOA 3TECE 4XYBA 1SZCA 3FXAA 3KTOA 1XNRB 2BMWA 3GLVA 2PAAA 1B8UA 3JPYA 3NBFA 3P2EA 1UK9A 2ILVA 3GEPA 5C8XA 5K6AC 1ZNYA 3DB2A 2HX1A 3OVMA 5MN4A 5BR4A 4M21A 3UIEA 4N3CA 4FWTA 2BFCB 2O8NA 5EMMA 4KXXA 3G02A 2ZRFA 2JK1A 1XFDA 4CCAA 5FL7A 4YWJA 1IBLB 4CQNA 1CR2A 4AL4A 3DBRB 4J49A 1PE0A 4CL3A 4ZPXA 2R5FA 4NECA 3VPSA 5IDVA 2IU6A 5E8RA 2RI1A 5KNDD 2FSFA 1E0DA 1DBQA 1EP3B 1SZDA 1WWKA 2FHSA 4TKUA 5B2ZA 1AQJA 1DFHA 2IOYA 4G8BA 5FR1A 4CMCA 1BDJA 5L6MB 1AUXA 5LXTB 1SNYA 5JROA 1Y5LA 4K9QA 3LW8A 2CFRA 5G02A 1KP3A 4HNHA 2C3PA 3EVBA 4BLPA 4ZDKA 1NM5C 1FQWA 3LPMA 1I2ZA 3ZEIA 5KQLA 2KX7A 3LY7A 2ZAOA 1OLXB 1V0JA 1Z12A 3K4QA 4M46A 5HIIA 3WTCA 5A02A 3KKNA 2LZ0A 3I62A 3IUJA 4JLVA 4HQ0A 2H17A 2AUNA 4BO2A 1NQXA 2XPCA 5BSMA 3TMYA 4LRUA 2XGSA 3R9XB 2ZRLA 3K9WA 5CX1A 4A8TA 4QECA 3VZQA 4J90A 3ZHCA 1Z62A 3CPSA 1HX7A 3TBFA 1X92A 4I5FA 3ZGYA 4WV3A 2VTBB 1QGED 4MKGA 2CUTA 5DBGA 3ZWYA 4I50A 4MIEA 3I5XA 5ERYA 4O3MA 3CEAA 3TI9A 4BEWA 2C0CA 4D4LA 1G6KA 2G6BA 3OU7A 3AF4A 3L5OA 3HB1A 1YNSA 1ZSVA 2CYCA 1NVUQ 4I36A 1LBQA 4NYJR 5B1IA 1XEAA 2IEGA 4MQEA 5GM1A 1Y1KE 1Z6GA 1U6JA 5EP3A 3IEMA 2C8LA 3KKPA 4CEHB 3UWPA 1ID8A 1U0GA 3AG5A 1O5OA 5BY2A 1BQEA 3NWJA 1JLSA 2EV9A 1J5EB 4M8KA 5G41A 1LK0A 3ZZ1A 5L7TA 3RS5A 1JEYA 4TZ0A 2BISA 4G0PA 4LVCA 4MO9A 3S2GA 1E2NA 2PSSA 3A31A 4ENPA 4CM7A 2RKWA 4FMPA 4FGSA 4F7DA 1IBMB 4FU0A 3K05A 2ZTMA 4XTCS 1L1FA 4HKTA 1STOA 3O31A 5FFFA 4CUKA 6REQB 1FFEA 4FYWA 3AW8A 4EMSA 4R1SA 4ZC1A 1QOQB 2OXCA 5KKCA 2EJUA 4BNZA 2BGUA 2FKNA 4XWAA 1EI9A 3GZJA 4UNSA 1SU4A 3C41J 4LZOA 5K1ZA 2FMKA 3V8RA 4MUXA 5AHXA 2PGAA 2Y4OA 4G5YA 1S96A 4Z4IA 4BFWA 4D9KA 1IXZA 2C8KA 3DM5A 4WN3A 1VKZA 2X6RA 3LYAA 1X94A 3PIDA 4O8ZA 2QROA 2IYNA 1V1JA 1HQYE 2DJ5A 3KYCB 4NBVA 4W5OA 4LYDA 1LY1A 2ZVDA 1QK5A 1RXEA 3C3JA 4ZGGA 4FGLA 4H9GA 4RK5A 3O8QB 4NG5A 3SF8B 5AQ1A 3L79A 3K9FC 4MJXA 1P5HA 2OHHA 3QJGA 4N7MA 4AJHA 3BGOS 1PJSA 4TTVA 4IGIA 5CB6A 2FOLA 2CLMB 2F7SA 2DUUA 3LCCA 2XNHA 3HKCA 1RYZA 3HV2A 4XXHA 3S2EA 4FWIB 3C1AA 4PZYA 3DZHA 1MTZA 4L78A 5ETJA 4M7PA 1IXSB 5TSDA 3BE8A 5F4BA 5G3YA 2UKDA 3T4UA 3QF7A 2PA0A 3PEEA 8ABPA 3O38A 3IPRA 2ZW9A 3T1VA 3E9ZA 3M1IA 1QIEA 5DNWA 5LOVB 2GZ2A 2Q3MA 2VBIA 3B3AA 2XBLA 2XAAA 4QFMA 4X45A 1E2DA 1RCUA 4BBPA 3H05A 3OOHA 5CB0A 4CIBA 1EXWA 1P7PA 2OBXA 3UJ9A 4JBIA 2X0RA 2VJYA 3D4PA 3DAPA 3AVYA 2W83A 5FFNA 4H60A 4EYSA 4JJKA 3M6VA 3IV7A 4U7DA 3VDQA 5FOVA 1X1SA 4D8UA 4TUYF 3TQTA 2OENG 3RVQA 1XTPA 1L7PA 1HLFA 1MUUA 1P1BA 1ZGCA 2PFSA 5IU6A 5JCXA 5BURA 1RIFA 3KXPA 2I1QA 4UVIA 4Q4AA 3QSGA 3ZJYA 2PTGA 4XUEA 4K6GA 2ADOA 1TUIA 3NIFB 3F2VA 1TCVA 3SQWA 4EPXA 4UTPA 3FOEC 1P2UA 1NOJA 3H2ZA 2Z5VA 1E5QA 5HNKA 3EZNA 1SVKA 2VR1A 2OCDA 4TMZA 1OWLA 3QHPA 2F67A 1UMKA 2V7EA 4UM8B 3OAAD 1GZ6A 5KOYA 1KH2A 1PR0A 2DERA 1PX0A 2J4CA 1A50B 4C4ZA 3X1WA 4WFJA 1FFHA 2Y2VA 3U7QB 1A8IA 3EDMA 4WBXC 4ZOBA 4WKCA 2Z4RA 2O2DA 4UREA 1H4TA 4FYXA 5AT1A 5GJBA 3LF1A 1F17A 3QRWA 4H1UA 1KRWA 1EWKA 1T2NA 5A1JA 2O8DA 4Z5XA 4HDAA 5C5CA 2G82A 5HIKA 2I4OA 3EQ9A 2JFBA 3H19A 1AMNA 1JPUA 3VXKA 2OV2A 3BSYA 4MINA 5C8DA 3QWHA 1QPBA 1NBMA 4WXPA 2O9JA 1SVSA 5JAIA 3ZY3A 5EJGA 1F8GA 2I29A 2VXYA 4JQOA 1N8KA 2Q3DA 2VWQA 2FQXA 2JJ2D 1QDEA 2HHLA 5DLPA 1SY7A 4CLEA 3ORFA 3KXDA 4AXXA 4CHTA 3WKBA 1QO7A 2CJWB 2WZDA 4HPWA 4HUQA 4MV7A 3SLRA 2AOVA 5HKBA 2D62A 3R3UA 3C3MA 1Z5GA 2H5LA 3GRCA 4KK4A 1COWA 3ETDA 1NPDA 3G0OA 4MVJM 3GMTA 1B4DA 1T4GA 4P82A 2UUCB 1GZ4A 4KO2S 3TTWA 2OL4A 2NU9B 3NHWA 1P3Y1 3GRFA 4I7EA 1ZUIA 2ROQA 1H5UA 2RK3A 4IGEA 2GVDC 3M5PA 3OZUA 2JJQA 3QOWA 3L4SO 1BJTA 3D8HA 3EBPA 4NX2A 2IOQA 3LPLA 3PQ2A 4JJGA 1Z2EA 1SBYA 4XYGA 3VPAA 4OXRA 1E0KA 3I6IA 3KJGA 3NV7A 5CLGA 4LPSA 4EA8A 3HN2A 3BKWA 3FM9A 1E5TA 1X8XA 1XMSA 5I9TA 4F96A 2ODNA 4AG5A 2PGJA 3CEHA 4QDXA 3AFNA 3SJZA 4PN3A 2P4UA 5LP6A 1XTVA 5JBIA 1GT91 1IHXA 1MV5A 1WR8A 1U6IA 2HSZA 2ZJBA 2BKEA 3CG4A 1NVBA 4PF1A 1WPGA 1G7CA 1J21A 2OV8A 3IS3A 5FV7A 2OCXA 3W4IA 4N8DA 4FXOA 1T1RA 5AI5A 3PIRA 4XLLA 1ZIPA 2DPXA 1V25A 4BLSA 1UM9A 1R74A 2X2EA 4H17A 1U1DA 1XQYA 1ZXBA 4AQ7A 4W8OA 3QY0A 2C7PA 2AFIA 1A2BA 3FWNA 4GOND 1X8LA 1VHTA 5AKJA 1OAKA 5EWLB 3UUGA 4NOJA 3VNRA 1W30A 3ANMA 5JWRA 3A0RB 1G55A 1QF7A 4KYUA 4WY5A 5J2UA 2HJRA 3JQAA 1JHRA 1MH9A 2IGTA 3KR1A 4FLFA 5CIWA 3GELA 2X1HA 1LA2A 4N40A 1RHUA 4RKYA 4TSFA 1PS9A 4JC0A 3JYOA 1UPBA 5J59A 1D2RA 1V5GA 1OWMA 2O54A 3H1AA 4YP5A 2V58A 2ZJYA 3OJXA 4N9WA 1OTYA 4YRRA 1QU3A 1COZA 4FB4A 1Z8NA 2H7XA 3DQPA 3SR3A 3RU9A 1XELA 1HEUA 4G1BA 1SBQA 2FKAA 5IEBA 1B74A 4IUDS 4ZMSA 3EQ8A 4R8VA 3V1KA 2QVCA 3HDTA 4OYYA 4EJMA 4QDTA 2DPLA 2P4SA 2VDWB 2VP0A 3AM5A 3IAFA 3NBYC 2OUKA 1M2VA 4HN9A 3WLRA 4YR7A 1PFGA 1TLFA 2C03A 3QNWA 4BQQA 2P9EA 3BRCA 3EIFA 4RKRA 3O0DA 4NV1A 3U0VA 2DBRA 1P1FA 1V2GA 1AGYA 5BPHA 3JD1A 2YYZA 4A36A 1O89A 4M9XA 5K01A 3TGWA 5B2FA 2VTVA 2HQRA 4DVJA 5I8ZA 4RK6A 3MT7A 3AUJB 1FJXA 3PCTA 5BSKA 5BWCA 4R8KA 2Z98A 4E5VA 3O0TA 2CKMA 5A7GA 1LSUA 1FMJA 1N0WA 1WUIS 3E05A 3V4SA 4BEBA 4D9NA 1GGJA 3ZXYA 1QH8A 4AUNA 1EK0A 3PE6A 4BXOA 4LDPA 3P9PA 3GT0A 1SMKA 2P5YA 1YB5A 1E2UA 1Y0BA 2IYUA 5E4JA 4P4LA 5IKPA 4GUDA 1PEAA 5BSTA 1Y8ZA 2GDZA 4BLRA 4IGKA 4QDKA 4RL6A 2NO0A 1FUUA 1RWBA 2NACA 3HP4A 2ZKLA 3PYMA 1Y5NA 2AQIA 3OSZA 2QD4A 2WD9A 2YR0A 1TVEA 2F17A 4FN4A 1XNJA 4Y6OA 4BU1A 3SC6A 2VF4X 3N75A 2AK3A 4UPDA 4RWZA 2MJLA 4BJ6A 3EGXB 2O2XA 1ZOSA 3CLTD 3I42A 3LGXA 4NKRA 4QYIB 4I8XA 1D6NA 4LE1A 5BYBA 4ETMA 1FIUA 4II7A 2QU8A 1E9VA 3FOBA 1YRYE 3KTAA 4NRDA 4QBIA 3D4BA 2AS0A 2R65A 3DDCA 3Q15C 3B1KA 4G5XA 5E0KB 1J1IA 2QG9A 1KE1A 1NU6A 4KXYA 1SXGA 3ADKA 4JEUA 4B3CA 5BOSB 3KXIA 4OQYA 1UDCA 1W5AA 2FX2A 2PMDA 2VDMB 3SHFA 1XPJA 3V8VA 1NWCA 5KTPA 2O6LA 1OKKA 5LQSA 3CRNA 4X7BA 3W2TA 2QLNA 2XTZA 3E9CA 3QQPA 2JW5A 1OV4A 5TIIA 3CUUA 2R86A 2FGKA 2O20A 4EWLA 4L4SA 3TNFA 4NZNA 2HMTA 3ZVRA 1CG6A 2OLEA 2CL6X 1U9YA 1LEHA 1YJXA 3H2IA 5JZBA 2IEAA 3DOJA 3F4BA 5DI3A 1X39A 4ZQCB 3KUXA 3RLFA 2B8TA 1TF7A 2GEUA 2LKDA 4KPUB 4M1MA 4P4SA 5G0SA 5KI6A 1H4SA 4GPZA 4FDUA 1QOPB 1EBBA 1E1CA 2IXTA 2A0WA 1DO8A 2VDQB 4ALJA 4IRMA 5DM60 2PO7A 3N86A 4YT4A 3FIUA 4NVRA 3R5FA 3UT6A 1R15A 1NUSA 1WA5A 4UQPA 2GB4A 3FSGA 5I51A 4CR6A 1ZL0A 1E3WA 4F1KA 2ZJAA 1BYIA 2GM3A 2NOAA 5A5VA 3BHIA 5AH0A 3ZTTA 2E1RA 4QUEA 2AOTB 4FS3A 1VL8A 3NBAA 3NHBA 2O5VA 3M6WA 4XGIA 4J29A 5C7YA 4L6IA 1E9AA 1L4LA 4NQZA 3WO1A 3ZH2A 1MNQA 2OV1A 3WFJA 2FPWA 1W85A 1HYHA 1CS0B 5ILQA 2C2XA 3IPCA 5B4VA 4QGGA 3DE2X 4FFVA 2GXSA 2QY9A 1LBEA 2H1WA 2XECA 2VP9A 3HKEA 4TLAA 4E09A 4Q3DA 1GNRA 4S0XA 3U17A 4F3NA 3OT4A 4XFKA 1M3SA 3M81A 4GYJA 2R6JA 4P1ZA 2XUAA 5B12A 3HGMA 5E8JA 5KSWB 1CDEA 5HTKA 1QFMA 4KWHA 4W6ZA 5JCOA 4OCZA 4FJ1A 5JRZA 5ALLA 2D7DA 3PYLA 1RKUA 4Q15A 2QB5A 3RCBA 1DU4A 2PQ6A 1EFPB 2HSWA 3C5WP 3TTVA 4LC9A 1F6DA 1FJ2A 1JW9B 2XQKA 3OIYA 3UOWA 3T5MA 3VR2A 3FMFA 5IXJA 1OZAA 4FMDF 3JD0A 4JA0A 4G41A 3HPQA 4LDZA 4JS0A 2VUSA 3ABIA 4HAVA 2J7PA 1JJIA 4BRZA 4LF9B 2FPOA 4UJ5A 4F7WA 4EELA 4PTYA 3JWIA 1QHNA 4YRZA 4M7RA 5REQA 4R81A 4DARA 4XD7A 2FDCA 3ZE7A 3LOPA 3PUKA 3RAEC 5CG2A 4H6PA 1U7ZA 4BQOA 4ZK2A 1C3OA 2A9JA 2GCIA 3NTQA 1E7WA 4P84A 4X7RA 4Y18A 121PA 1XR3A 3GAAA 1NZDA 4HNVA 4EKYA 3AY6A 4E1AA 1VMAA 1T0UA 2CNLA 2J9FB 5F3RA 4LAFA 4JCOA 4WH0A 2Q4EA 4BUCA 3OZAA 1WMAA 2GUGA 1PIWA 2ZYGA 3RFVA 3K72B 2AH5A 1AO0A 1FU4A 1KP2A 1K27A 4C14A 1NVDA 2HAEA 3SM9A 1YGYA 4JSYA 1D9ZA 4R0MA 3AM3A 2IBMA 2XH8A 1TJPB 2FV8A 4YDHB 5ERGB 1CX9B 3UAWA 4GM0A 5A4IS 2VXCA 2PCLA 2XMDA 5IULC 5KNBA 2JVKA 2F3QA 3MMZA 2QIPA 5F2EA 1FS5A 1P3JA 3RIYA 1X8KA 2IEDA 1LLDA 3MRSA 4O4LB 2XCRB 3TZKA 1CY7A 3UCEA 2ZYVX 1XU7A 2RGEA 1YOVB 2W6MA 4KBYA 1R0YA 5F7ZA 3PFKA 1MIOB 2H4ZA 5JSZA 3W4JA 1VGVA 4TXMA 5ALNA 2WWFA 3CVJA 5DBHX 4URZR 1ONOA 1IHDA 5FBVB 5JS1A 2WF7A 1WLSA 2CHFA 2QV0A 1KMIY 3S44A 1VPEA 2C3UA 3JYPA 3GA7A 5HXAA 1LX7A 4LVOA 1JB9A 1VSTA 1MC4A 4IQ0A 3CLRD 1PL6A 6Q21A 4G3XA 4H1WA 3KQHA 2ZBQA 2A57A 1UOQA 2GPJA 1ZI6A 1W46A 2IU4A 4MQMA 4FOPA 3PXAA 4M9CA 1ORDA 4MH0R 4RMJA 4UD2A 3SIPA 1C1XA 3WMEA 5I3CA 4S05A 2EFEB 1FMTA 1MVNA 4BCCA 3W3AA 5IAAA 4EZBA 4DJTA 5JQGB 1FK8A 2XUDA 1ZD2P 2Q3FA 3Q40A 5THQA 3CN9A 1NJ8A 6ADHA 4DUGD 3VOBA 1GLVA 4HH3C 3TAUA 5A71A 5AVRA 5F98A 4BQSA 4V3BA 3OZSA 4MV0A 2BEUA 4H7KA 5HFNA 1JDZA 1MKYA 3B82A 4ZO7A 3RHFA 2AKEA 2B3DA 4PSKA 3S2ZA 3T3GA 3UH0A 4Q47A 2WSLA 4CPDA 1RCTE 4DQVA 2ATCA 3SOZA 2PJDA 3C6MA 3FWYA 2GHRA 3UQZA 4BECA 1SPBS 2GCGA 2VOJA 1CQXA 3N1UA 3PBKA 2FUNB 1E0SA 4PNEA 4NYIQ 5DN6D 3WG9A 4Z1OA 4L08A 4BNVA 2A9FA 2DSNA 2GJ8A 3DOOA 4MWZA 4MA0A 1X7YB 1C2TA 2XQIA 3RIHA 2COEA 2OQRA 1PWXA 1QCCA 1YQQA 5A0VA 2J08A 2ANCA 3M6LA 4WTOA 3SXUB 1C4XA 3MFQA 2A2ZA 2H0QA 2VZ0A 1PZHA 3JS5A 3LT4A 4KDRA 4KV9A 4ZPJA 1R10A 3E15A 2C7RA 3NXKA 4B3IA 2B36A 4X3PA 2VQEB 3MGAA 5SZJA 1T1SA 4BLUA 4QE3A 1ZVVA 1RQPA 4YJHB 2WYHA 4ZCRA 3KZ1E 1TTQB 3LOQA 1X7ZA 4CM5A 5L8VA 3BE6A 4U2BA 2C5BA 4EG1A 3S8YA 4F6LA 1HPLA 1G2OA 2DYKA 5EGNA 4DWVA 3PENA 4AZTA 1P2GA 1P0CA 1IXKA 1QRRA 2UU9B 4BNMA 1EXDA 2CEAA 2O52A 4JYMA 1YIAA 1W52X 3R6GA 1C0IA 1EQAA 1XYYA 2P2CA 1SBTA 1C0PA 3OLYA 3X1XA 4IVQA 4CG0A 3ZVNA 2DWPA 3P26A 4RA6A 3T1QA 4GX0A 3V2IA 4C20A 1H23A 2V9PA 4Y2PA 1IBCA 1QS0A 1ZCZA 2BR4A 2Q21A 2PV7A 3AR9A 4GRDA 1YVUA 1JA1A 4IIJB 3T3DA 5FTMA 4C2BA 3KR0A 4QZVA 4BMVA 3IEIA 4GXNA 4RD4A 2FRDC 2QTBA 4HSEA 4ZOLB 4KQEA 5P21A 1EAMA 2HWYA 3DC7A 4O4HF 5CTAA 3UKDA 3VPCA 3VC2A 3MB5A 2XRZA 2D1FA 1MX1A 2IRWA 1MC5A 1U9CA 2YX1A 4MA5A 1UP7A 1NTOA 2FLVA 4WQMA 1PFQA 4C4RA 7GPBA 4D57A 2AB0A 5LZ9A 1WHTA 2OBFA 3AONB 4RANA 2BMJA 3LHIA 3ZY5A 4X66B 2FPRA 4MUEA 1GG8A 5D3MA 3ANTA 2GKGA 2WLSA 2BGNA 4M1QA 4QRDA 2WFAA 3KLPX 5DGDA 3U48A 5JW6A 2XJ9A 4LG1A 2NUPB 2WKQA 4OF4A 4TV9A 1N4AA 4FSXA 3V7NA 4EI2A 1T1IA 4KEAA 4TVBA 4G0XA 2MU1A 3CISA 4M3NA 3O8OB 5CD9A 1DHTA 1XZJA 3A1TA 3G88A 5A05A 4JA2A 4OAOA 3E81A 5CA0F 1GU7A 1TDJA 1LBIA 2O2YA 3MRVA 3BMCA 3LWNA 4PLYA 4HVTA 4X6UA 5DTMA 3WV5A 2HLPA 3H11A 1G21A 3OCXA 3R6WA 4KLNA 2PQMA 1FRVA 3K7EA 5J4KA 4GSYA 4U1RA 4M8SA 2R00A 1J70A 1G60A 3UT5A 4NBWA 2PSHA 2EKZA 1KDVA 1XRRA 3B5EA 2B2CA 4YP0A 3VVLA 3W2IA 5LQAA 3O3OB 1Z13A 3IRVA 2I33A 3H3XA 4DQXA 2OHIA 2QZ9A 3AF2A 3PGLA 1BRMA 3RYFA 1J25A 1I8TA 2PGDA 1C3EA 4Z8YA 1CZRA 4Y9TA 1DGQA 2XCIA 1OREA 4W8GA 3FPJA 3KCQA 5K3FA 4BVJA 2BUBA 3LKVA 3E6AA 1M5RA 2DP4E 5GOTA 1BQ3A 3K96A 2L82A 2B4AA 2EKQA 3DL7A 4Q01A 2PLAA 5CXXA 3PDIB 5FYQA 3ZKWB 1KWGA 3I76A 2O14A 4R0VA 4BQPA 3PFGA 1FQJA 4BPRA 3GLHE 5B7NA 1F2UA 3HMKA 1YBVA 4F04A 4FB5A 3L0PA 3VU8A 1VHWA 4DMKA 3BL5A 3IPXA 3N8DA 1GXSB 1VMKA 1M2GA 4Z99A 2X58A 4X3CA 3OTOB 2CV0A 4ZI2A 3RG2A 1ZGHA 2W6IA 4DKXA 3KQLA 2UUPA 3PXCX 4IIXA 3EX7C 2AE2A 4IDOA 1YZ3A 4JD5A 1I4OA 5CCBA 5CT9A 3LZ6A 5FH9A 1JZSA 1UH5A 2O57A 3K8ZA 1CCWA 2OE2A 1Z83A 4QBGB 5BQOA 3RSZA 2I7XA 3R7SA 3WB0A 4QG3A 3IMKA 2QR3A 3WYDA 3WWEA 3NH9A 3SR0A 5JMPA 5HJ7A 4IIUA 3V1LA 1HLPA 1O8BA 2QX4A 1OH6A 1NL3A 1MB3A 4PGFA 1YONA 5EJEA 4C7BA 1T3GA 4PFSA 2OB1A 4YRBA 4LRQA 1M5TA 4DV2B 2R8OA 3E27A 1TU3A 1U3VA 1E3IA 4C29A 1N8SA 2O19A 2Q6KA 2I34A 2R6AA 3TZCA 2Q9AA 4B0OA 1WDWB 3BHNA 2ID9A 3E5RA 5DIZA 5CFNA 1GZVA 4NJMA 1FXUA 4KQ9A 5H59A 3ENWA 2IZ5A 5CAEA 1M6EX 1RBQA 3HJCA 2RGRA 4REQA 3CE9A 2IOHA 5CBPB 4U8HA 2AMJA 1VZ3A 4Q1VA 3IBFA 3TBKA 3H7AA 3QKRA 3P71T 3W34A 1U0SY 4FNMA 1DARA 4OB7A 3UK7A 1ZO8A 1E3JA 3QF4A 5E1MA 4Z0HO 1XL1A 1N5OX 1P91A 4HF7A 2R7KA 2F8SA 1PGQA 4S1PA 1RQRA 4Q21A 4BQEA 1PJQA 1J42A 2EFGA 2FPUA 2JPDA 4NJEB 4IG9A 3T7CA 4E4YA 3TTUA 3UMGA 5A7HA 1QWOA 5BNTA 3GQBA 3CUSA 3DMYA 2AEMA 3ZHQA 4ND6A 4Q3LA 1T2EA 4MYUA 1FUKA 4UASA 7REQB 4LQDA 4B6EA 4LTNA 4GX2A 2A4KA 2CFTA 3I64A 3DEJA 4K81B 2GHIA 1UK8A 1IJFA 1KQ3A 2IYWA 1GRRA 2ZEJA 4QYTA 3G5MA 3TOCA 3NHZA 2QRVB 3A6ZA 1KK0A 3GLSA 4WE3A 1CRLA 5TPZD 4UTXA 2YJ3A 2H9YA 4EMUA 1KVTA 3FZGA 4MWTA 1ZGJA 3A8TA 3NASA 1WD7A 4OLAA 2J3LA 3ZIUA 4JOSA 1PQ4A 3FTNA 4DLVA 4Y9DA 4F72A 2D5CA 1QHSA 2QMQA 4PC1A 1FP4B 5J9FA 4A5OA 1NBIA 3DKKA 3ON5A 1A5SB 2J6HA 1BJRE 4R1LA 4C4TA 4YR9A 3U4MA 3W79A 4DDVA 3MSXA 4XYLA 3OUTA 4EJ0A 1GCIA 1ZVMA 1L5OA 3FVQA 3QWBA 5CR9A 3IHTA 3OQ1A 2EW8A 3G1UA 1TCUA 3HCOA 2HMUA 2WHPB 4I08A 3U9LA 1H8EA 1IZ7A 3E0XA 3KWMA 4C21A 2JLCA 4IO0A 2PMWB 2AKYA 5KHAA 2Q8NA 4MRNA 3WL3A 3R3SA 1FLVA 4AICA 1HT2E 5CFQA 1OASA 1SIOA 3EVAA 5TVGA 3K1AA 5F52A 5FR2A 1AHIA 1Y7PA 4DPKA 2CFOA 4DV1B 2I6SA 2QUZA 4EDHA 4WNYA 2PXAA 2HI0A 1NXOA 2JI9A 1X0XA 3Q9UA 5K20A 5K09A 5B3LA 1E20A 3D8UA 5IXYA 4NCJA 2NQ8A 1O95A 2Z3VA 1MNAA 3KEGA 4ARZA 3L82B 2UYQA 1ZJJA 2AF3C 2QN7A 1QGYA 5A3RA 2JGMA 4LIPD 4HLUA 3UAZA 2CE2X 2X8JA 1GQYA 1F51E 3OFJA 4OYLA 3M6UA 2YBDA 3KZXA 1H1TA 1BWSA 2DFKB 1N8TA 4OUDB 5FAXA 1B6TA 2ZZNA 3CHYA 4R2KA 2Q3EA 1DKRA 1FDWA 3QPAA 3OX1A 1T8WA 5M04A 4P34A 4OOFA 3LO8A 4YDRA 2QX7A 4UARA 5BQPA 2ZR7A 4JBGA 3U6KA 1W0KD 3JQ9A 1LFAA 5EE0A 5HVNA 3GEEA 3NDIA 2F62A 2EHJA 2NZXA 3SBDA 2WWYA 3E58A 4TL8A 2VPTA 2NU8B 4AWBA 1GKYA 2O3JA 3IVCA 3P9IA 3MGKA 4X1KB 1XZQA 3OJFA 4U7PB 4LRXA 2GEFA 3F8TA 1O87A 3S99A 1VJ5A 2EKDA 3PC8A 1SUPA 4BVAA 2DXIA 3EPLA 3QWIA 2JIPA 4GEGA 1GU0A 2VHTA 4ZT3A 1Q0UA 1MHTA 1W581 3AG6A 1E8NA 4ZODA 2W43A 1P80A 2XOKA 1T2FA 4OM7A 4JI1B 3T15A 4LZPA 2OFPA 2JFXA 5DX0A 5I7OA 4WIAA 1YHZA 2H65A 2W42A 3OIWA 1CULC 3CR3C 4XPZA 4RXMA 4UHDA 1ZITA 4AYXA 3FCUB 3QV1A 4TQGA 4FQ7A 4XI9A 3VR5H 2IVZA 1BMFD 1V43A 2VS1A 2YUTA 1DWQA 3DUWA 1FTNA 3EIWA 3N8HA 3P0HA 1VFNA 1JEJA 3I4CA 3EFOA 5EWJA 3ETEA 4MGYR 1WDLA 1NR5A 2P6NA 1XP5A 3TWOA 3DMPA 5KBYA 3LLMA 3H4VA 1DTEA 5DX1A 4RA9B 5AICA 3QJYA 1G5PA 1EFVA 4BNTA 1LD3A 4ECAA 4FDAA 5CB4F 1Z18A 4ZKEA 5T67A 2R4QA 3R6TA 5HRUA 3TZBA 5KEIA 3TPFA 1UFOA 1C9JA 4H59A 4WLFA 5IAJA 5MHTA 4LJ4A 4EAQA 5TJ9A 1RP7A 2AG0A 1II9A 4CTMA 1MXHA 1DUVG 3TNDA 1PVDA 5GWXA 4US2R 3GJ8A 3H5IA 1IVYA 1KJYA 4BJ3A 1VRWA 1LX6A 1BO6A 2WJYA 2H3EA 3LUKA 4BMNA 4DRZA 2C78A 1XA3A 3QOYA 4ZVRA 3S5UA 4WKGA 3S2UA 4J03A 4GOXA 2QPLA 2O5EA 1YRWA 4PRLA 3ZGXA 2JAOA 2WSIA 5AVKA 5F2KA 2OA0A 3C6QA 5H4HA 2WHXA 3RSLA 1NQTA 1KNXA 1ZJYA 1UEJA 2JGLA 2H6EA 1OXKB 2G72A 4P7JA 1C50A 1CWUA 1AB5A 1GFSA 2JCVA 4HTAA 2TRSB 4MS1A 3S2FA 2A0UA 4OK3A 3ZVLA 1WMDA 2B94A 3FPLA 4QUIA 1YJQA 2FPGB 1H8HD 1P2FA 3D6VA 4P2BA 1YBAA 1ENYA 1U1GA 1CUXA 1XXLA 3TX2A 1TIBA 4JJAA 2VC2B 5FD8A 4OIMA 5K0EA 1YVDA 3K0EA 4IJMA 1PDWA 3AI1A 4DCGA 2BJVA 4YRLA 2V7WA 3CLVA 1G8FA 2HF2A 2VYNA 3QX8A 4O4JB 3DMHA 4P3KA 3V9AA 1NP3A 3SZ3A 4LJ5A 1HLDA 4Q1FA 3PHHA 3DTNA 2Z1NA 3A6GA 3PRYA 4WVLA 2Z43A 2KE5A 2PBRA 2ZI4A 5HS6A 4Z7JA 2BFFB 2G1KA 5FNVF 3GP8A 1HYGA 3QHQA 2ZETA 4JSTA 1V7QA 1L4BA 2PZAA 4RKWA 3DEKA 3CV3A 4X8LA 3HVUA 5FB3A 5HF8A 1GQSA 3ED1A 3ZWNA 5I6DA 4MI3A 2M2IA 3NYIA 3G2OA 3ZDRA 1B6SA 1K08A 1QZ3A 4QTTB 3U80A 1KEVA 1VSQA 3DFIA 5KAMA 5H9WA 2GFQA 3ZCUA 2X0KA 1SXJE 1DXYA 2ATEA 2WAAA 3FZNA 4LZNA 1FDSA 1SG6A 4HH1A 3HCRA 3LZDA 4KNYA 1YZKA 1EVQA 2CFSA 2QWXA 4MS3B 4RF4A 1HETA 1GPLA 1GEGA 1Q7BA 2PNJA 2ICAA 3AUYA 3UATA 1QF9A 3VV3A 4IYRA 4IHQA 3SM3A 3FDIA 4URXR 1JAIA 3W5SA 1BCRB 3OFKA 3G9QA 2X22A 4F4IA 1ZAKA 1F2DA 2YFYA 1Q1BA 2XNDA 4HFMA 4V38A 5HCNA 1UUFA 4X5OA 4F2HA 4L4XA 1Q1EA 3DEHA 4O2RA 2QJFA 4K46A 3IBSA 5AM2A 1ZWLA 3DEYX 1EUCB 2FSVA 4HBGA 3AF6A 2QPAA 4FFMA 2X7JA 3I32A 3LHDA 4R8LA 4F5YA 5AKEA 1Y1LA 1L4MA 2BIFA 4S35A 5JATA 1UMDB 3THYB 2G1PA 2VEDA 4ZO6A 1E9RA 4TSFD 5AHWA 2QL6A 3RS0A 4C04A 1GTJ1 2VCHA 3GOHA 4HDSB 3GO4A 1QZTA 3A28A 4JK3A 3QK7A 2WTBA 2JLZA 4ER7A 1Z7GA 1ICIA 3KG2A 4EW3A 5JYEA 2WAOA 3KT6A 2Q1UA 5JPDA 1S2NA 4ETNA 3HZZA 4OA8A 2O2JA 4CN8A 5FQOA 1TYDE 4DIKA 2WE7A 4OUKX 3RQIA 4NH0A 4F21A 3EN0A 3L8YA 4M1SA 2VBFA 5JSFA 3Q8WA 4G9GA 1W1IA 4TUYA 1Z3CA 3DV9A 2QZPA 4BQIA 4L3WA 2OZLA 4RD6A 2ZS7A 4AZWA 1VIYA 3PL1A 5BNIA 5DK6A 3BGVA 1GPBA 4UPVA 4AMYA 3U5ZB 4GMHA 3M9WA 2AK2A 5AJYA 1Y3DE 2OGZA 1YQGA 5EXPA 1JTVA 2J48A 4L0QA 1GQRA 4U63A 5C1IA 1Y37A 4ENWA 3O3MB 4Q0MA 3U4CA 2JFYA 2XBUA 1NDQA 1GTVA 1MCZA 3T7AA 4C9BA 1PZEA 3N5CA 4DSUA 1S2DA 1W73A 4GH5A 4MW2A 4RZ3A 3EMVA 1VSBA 3FA2A 3DTYA 1AUPA 3HB5X 4NNJA 3DZFA 5EEHA 3AF1A 1CNFA 1EFLA 1EA5A 5CJ2A 5FXMA 3IDFA 3TIXB 4B45A 1EUYA 1A71A 1LVHA 3LT2A 4P58A 5CVDA 4C0XA 2QPOA 3IL2A 1JEYB 3BMOA 1WZEA 3UHPA 4QRHA 4F2GA 4KRFA 3MC1A 2VAWA 1NPYA 2IPOA 3A05A 1W4ZA 3K9LA 3KKLA 1R2QA 1GGMA 1I3LA 2JKZA 1GPYA 1XP8A 3DP7A 2WUFA 3ETJA 4Z9XA 3GARA 4J0IA 1SUCA 2JNWA 5GZ6A 3U2QA 4XB2A 4FI3F 4JZYA 4UAUA 1QC5A 1ZLYA 1VCMA 2P7HA 3PWTA 4FYVA 5TQJA 1O9HA 3WKEA 5EVJA 4WLOA 1RXWA 4GDMA 4R3NA 1MVOA 4AY2A 1E3SA 1P31A 2NZJA 3HXKA 2Z5LA 2ANBA 1NW8A 2LCQA 4C3OB 1OWPA 4AECA 4BHTA 4I55F 5AIBA 5FTWA 1N4DA 1Q20A 5HA5A 1YCGA 3RASA 3GK3A 3WGGA 5C51B 4OXKA 1EMDA 3FYTA 3COJA 1JNYA 2NW6A 2JFZA 1Z9BA 2QTGA 3ZQ6A 4DC0A 4GBMA 1EEXB 4MVJP 3OZDA 1GD1O 3TJMA 4IRUB 3W0LB 3AR8A 4NPCA 1J06A 2ZRBA 3WKDA 4EX6A 5CVTA 3ZW7A 1P4GA 4IILA 1AUOA 1D09A 3G68A 3TNJA 3HRIA 4F11A 1BHO1 4CLRB 2C61A 1QNLA 1S8NA 1QPGA 3A1FA 3KK0A 3D6TB 2VXBA 4IEEA 3WGNA 2A67A 3NLLA 5B4UA 821PA 1C9NA 3KDPA 5KVAA 1II0A 5AJHA 3Q7RA 2X1VA 4DR1B 1GPJA 5BVHB 2PE5A 4XW2A 5LB2A 4DZRA 4A2QA 1DWPA 1V35A 2R84A 4K9OA 4MQFB 5TVKA 1KO4A 4NBRA 5CCEA 1JWAB 2SHKA 3B70A 4G86A 4DOMA 3NAMA 4I6JA 2GPAA 4XDHA 3ZD7A