1P77A

Crystal structure of shikimate dehydrogenase (aroe) from haemophilus influenzae
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
265
Chain Sequence
MDLYAVWGNPIAQSKSPLIQNKLAAQTHQTMEYIAKLGDLDAFEQQLLAFFEEGAKGCNITSPFKERAYQLADEYSQRAKLAEACNTLKKLDDGKLYADNTDGIGLVTDLQRLNWLRPNQHVLILGAGGATKGVLLPLLQAQQNIVLANRTFSKTKELAERFQPYGNIQAVSMDSIPLQTYDLVINATSASVDAEILKLGSAFYDMQYAKGTDTPFIALCKSLGLTNVSDGFGMLVAQAAHSFHLWRGVMPDFVSVYEQLKKAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of shikimate dehydrogenase (AroE) reveals a unique NADPH binding mode
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
molecule keywords Shikimate 5-dehydrogenase
total genus 98
structure length 265
sequence length 272
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1p77A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1p77A01
4B3IA 2P4QA 2VYVD 3EAGA 3A28A 3HSKA 5COAA 4CR7A 4HNHA 2ZB8A 4XWYA 4YB8A 1XA0A 2D8AA 3LLSA 4R01A 3JQGA 2X4GA 5A06A 3JQ7A 3I52A 1PJTA 4N5MA 3DONA 2GASA 4Q3CA 2J3HA 3I4CA 3K5PA 4OHUA 3GG2A 4WOKA 1EK5A 4RJTA 1KVSA 1GR0A 5A1TA 2PH5A 3KRTA 1HLPA 2W90A 3P2OA 5EQFA 4D0SA 1LQUA 4E13A 3QY9A 5B37A 4IDFA 3VDQA 3VH3A 3DR3A 4GLLA 4KZPA 2PGLA 4NHEA 1JVBA 3F6YA 4UUNA 2V65A 4BB5A 2ZB4A 1TT5B 1P1JA 2J3JA 4MPDA 4GVXA 4HWKA 4Q3DA 3ZWAA 2BH9A 2VUUA 1QYDA 4LK3A 3ZWVA 1IZ9A 3QA9A 2OP1A 1HDGO 5CP8A 2RBEA 3I5MA 2OO5A 3RJ9A 4BV8A 4UVGA 4XR4A 4BKOA 1UP4A 2A9FA 2E82A 1TT7A 2X9VA 2FZWA 1KY4A 1YL7A 3ZHZA 3B6ZA 4NI5A 1A9ZA 1U5CA 2EKPA 3RBXA 4YYZA 3KBOA 4L73A 5F1KA 1YO6A 1I3NA 3GT0A 4HADA 4L8VA 5A9RA 1E5QA 5G0WA 3ZW9A 1LSSA 3V2GA 4NDNE 5TGDA 3MCVA 4IZIA 1FF9A 4EYEA 4NJOA 1C3VA 4IGFA 4D42A 1P1HA 2YW9A 1GQ2A 4NBTA 4AICA 2C2YA 3QVSA 2X1HA 3B20A 3SJ7A 1HWYA 3UICA 3H2SA 3WGOA 1U4SA 1Q7BA 5U1PA 1D7OA 1YWGO 1B26A 1DLJA 1N9GA 4GL4A 1XSEA 2QRLA 4ROSA 5IZCA 4FFOA 2DBQA 5H82A 4JP3A 1YGYA 2H5LA 2VCYA 3E48A 5L95A 4R9SA 3AUAA 2I3AA 2PTGA 3DBVO 2PV7A 3BHJA 5EESA 4DC0A 3HDHA 3JSAA 1BXZA 3FTPA 1ZH8A 3LC2O 3A14A 3TWOA 3PYXA 3WQSB 1PGQA 2BI7A 5CHEA 5DOVA 3BMCA 2AE1A 2HMSA 1GUFA 2QW8A 1XKQA 3DBHA 3NTQA 4FD3A 4FFRA 4FJ1A 4IDAA 4XDZA 3B1KA 2PD6A 4E31A 4BHTA 4YJGB 5AXDA 3VH4A 4X54A 2PA3A 1HRDA 4TMFA 1ULSA 1ZO8A 1YOVB 3VPGA 4MDHA 3WNQA 2ZCVA 4DBVO 4RVSA 1K0UA 3FSRA 4XQGA 5T67A 1DIGA 1IL0A 3M6IA 3BTSA 2DBVO 1HLDA 3QWAA 2HK7A 4IIUA 3ZU4A 1R0SA 1NM5A 1OBFO 1V6AA 5A9TA 3VZSA 1SB9A 4Y9DA 1X0XA 4XD2A 2EIHA 5EL0A 4R51A 4F45A 4YQZA 1PJ3A 3VH1A 1I32A 1VL8A 4IJWA 7ADHA 3LYLA 1U2DA 2LDXA 4XGNA 3WFIA 1EZ4A 2R6JA 1I5RA 4JP2A 4QUKA 3ZWYA 2D4AA 5TS3A 4D45A 3U5TA 5IDYA 2BRUA 3PVZA 3EVTA 4EW6A 1QV6A 2EXXA 4BO2A 3WIDA 2JKVA 1YDWA 5TC4A 3EY4A 3GOHA 4BO8A 4D3DA 3SVTA 2BKAA 3BAZA 3FWNA 1EQ2A 3GNQA 3K96A 4R68A 5JYDA 3OJEA 4E5NA 1QYVA 3NEPX 2ZKLA 3VC7A 2JCVA 4D46A 1NFQA 1YH3A 3JQGB 5HS6A 3RROA 3UHAA 1SO8A 4IJKA 2UVDA 1WDKA 1YBVA 1MXHA 4N18A 4BGIA 3MJSA 2ZYDA 1G1AA 1JN0A 4DQVA 3PYLA 4CL3A 3AJRA 3AK4A 4IUYA 4CM6A 4R54A 4CUJA 1GU7A 5TJHA 2BFPA 4PRKA 4ZQEA 1C0KA 3PHJA 5I8ZA 2X0NA 4RDIA 2C20A 3PJEA 4CV1A 4MINA 3OM9A 3ANNA 2ZTVA 5ITWA 3VPXA 4M89A 4MKRA 2J3IA 1W73A 4HUJA 3DMYA 4OGWA 4RPJA 2VWQA 1LSUA 1M6HA 5DN9A 2NU7A 4L74A 1Z82A 1PJ4A 3GZNA 3ZWPA 2P9EA 4RQUA 3SBOA 3LT2A 4H3VA 1C0IA 3AW9A 4BNLA 2GGSA 3DL2A 4NMHA 1DLIA 5L53A 3F4BA 4I9NA 2ILTA 4GGOA 4TZKA 1EVIA 5CPBA 4DLBA 2ZIZA 5AYVA 3D0OA 4WLOA 1O8CA 1DAOA 1UJMA 2X86A 5BQFA 2XOXA 1PGPA 4J90A 1V3VA 3W6UA 1XG5A 4J1SA 3OJLA 1YE3A 3PDUA 4AJHA 3JYPA 5CAEA 1C1XB 4BNMA 1GADO 3BZUA 1PJLA 3MJ4A 3TZQA 1NFFA 2OZPA 4BKPA 1VKOA 2NTNA 2PY6A 3N58A 2R00A 5LCXA 3VVCA 2PGJA 3WLEA 3QLJA 1Z7BA 4GX2A 5TX7A 3H4VA 3L4BA 5JBIA 5TIIA 5C3MA 3P5SA 4BS9A 2C54A 2A94A 4UVEA 3COSA 4IM7A 2HMWA 3QVXA 3U9LA 4E12A 2EGGA 3H5AA 4BO4A 1Y1PA 3UKOA 1YB5A 5I9LA 2PZJA 5BNTA 2HSDA 4HFNA 5K0ZA 1EFKA 4CL8A 1NVGA 4BKQA 3WTBA 4YT2A 1E7WA 2JD1A 1B8PA 1ZNQO 4U7WA 5JSFA 5IJZA 4ZQGA 3DC2A 5JAZA 3R1IA 1D4FA 1ZUD1 4PLTA 2B69A 1FDUA 5DDIP 1HKUA 3EDMA 4JX8A 5A5FA 3KYCB 4U0JA 1GCOA 2BELA 5ER9A 3SJUA 1C1DA 1PJBA 4UUPA 3GNSA 3ZH2A 4H7PA 2OUIA 2BGKA 1TB4A 3SX2A 4GI2A 4OKIA 4YAEA 1Y8QB 4U0KA 2PLAA 4ALIA 3PWKA 5I7FA 2X0RA 3WICA 4E33A 3ZNOA 1CQJA 2FOIA 4K28A 3RVDA 1E7MA 1VPDA 1VL6A 1SEVA 1X0VA 3OA0A 5KKCA 4J6FA 1XWFA 3EZLA 1A4IA 1HYEA 4RQTA 2DT5A 1EFLA 1K6XA 3D4PA 2QX7A 3GFBA 4NNJA 3L6EA 4GWKA 3IS3A 1ONNA 3BA1A 3H9QA 4TRJA 3EUWA 4J49A 2NUAA 2W2LA 3AWDA 3O8QB 2FN7A 3CZMA 1E3LA 1LX6A 1PL8A 1I3LA 1XEAA 3GNTA 2JCXA 1GEGA 1BHSA 1ZVMA 2VT2A 3L0DA 5CPFA 1T1RA 4CMIB 4CQLB 1N1GA 1VLLA 1RYDA 4EDFA 4GMFA 1O0SA 5KKAA 3I23A 1KEWA 3DAFA 2VRCD 2HK8A 1IULA 1PGNA 3KB6A 3M1AA 4WEOA 1T2DA 4QFDA 1T2FA 3F5QA 2OMEA 3GGGA 4BGEA 3GLQA 1HEUA 2I9PA 1FJHA 3NT2A 2QQ5A 1ID1A 4BKUA 3L4SO 1D8AA 4FDAA 1AUPA 2Y99A 2YHIB 1JU9A 4IJVA 4YVFA 3BMNB 2C29D 1WLYA 2AQIA 4IY1A 3ZWMA 4IS3A 1Z73A 5EMHA 1RWBA 2B4QA 1CQIA 4PLZA 2PD3A 3B1FA 2YJZA 1KVQA 1I33A 1A4UA 3GPIA 4IPTA 3WX0A 1NAIA 1OOEA 1R4MB 3OF2A 1DIBA 1Q0LA 4E5KA 2RHCA 4KUGA 2GLXA 3ZW8A 4KMSA 1IPEA 1O5IA 2FR1A 1GYRA 1BG6A 2ZQZA 3JD0A 2FR0A 2O3RA 4KDFA 1WXDA 5KTKA 2TMDA 3WNVA 1D1SA 4R1SA 3ST7A 2YV1A 4IMRA 4WLUA 1YKFA 1UZMA 2YHUA 4I5EA 1NWHA 3HWRA 4K6FA 2Y0EA 4ALMA 1Q7GA 4H15A 1UP6A 1UDAA 1A9YA 3RWBA 1JWBB 1UR5A 4R4JA 3DHYA 3AU8A 3G17A 1P45A 3W4JA 2AA3A 2P68A 3O03A 4MP8A 5JO0A 4BNTA 2PFGA 4OJNA 3Q2IA 3GVHA 4A2CA 1B2LA 3GZ4A 4NK5A 1AE1A 1OC2A 5JDIC 4KTTE 4K6CA 4BNJA 4RZHA 1E7RA 3T7CA 4DIFA 5KNLA 3TZKA 1K2WA 1UXJA 2CVZA 1XR3A 3GG9A 4YT5A 3U3XA 2DTDA 3F47A 4TSKA 2HAEA 3BHIA 4OMUA 1GV1A 1J5PA 1DC6A 3BIOA 3R3JA 4RVDA 4IXWA 4CM4B 2B35A 4OSPA 1E77A 3AOEA 1N1EA 3ONDA 5DBFA 8LDHA 5DNAA 4TRRA 4DL9A 2ZTUA 4GKVA 2Y1GA 4E2XA 1I24A 3HADA 3IP1A 5EERA 1EBUA 3T4EA 3JQDA 3RFXA 3TN7A 5JS6A 3JQBA 1WPQA 4PG7A 2OBYA 1ML3A 1VI2A 2I67A 1QRRA 2H6EA 1XU9A 3JQ8A 2VN8A 1E92A 3KO8A 4YRBA 4LVCA 3FR8A 2VRBA 2X8LA 1ADCA 2GF2A 2V7PA 3OHSX 4D79A 4DYVA 3D1LA 3UGKA 3K8ZA 2RIRA 4AJLA 3LF1A 5L4NA 4ND1A 1XQ6A 6LDHA 4IDEA 2VWGA 5KVVA 1R66A 2HO5A 1U9JA 4XJSA 4W9NC 1QYWA 2CSUA 2IZZA 1O9BA 1O95A 2HMVA 2QRKA 2EKQA 4P4LA 3L9XA 3FI9A 3IOYA 2Q4EA 2PKQO 1AN9A 2DBRA 3AI2A 1ZW1A 3GR6A 3IP3A 3PJGA 1X14A 4OXYA 1E0DA 1ZXBA 5A02A 2AXQA 3LT4A 5TJ9A 5KJEA 2QRJA 1BVRA 3KSDO 3ZN2A 4RF5A 1A7AA 2VUSA 3D3WB 1P33A 3RUDA 3L6OO 2O7QA 4NU5A 4F3YA 2NVUA 2GO1A 1W6UA 4J7CA 5ES3A 2DFDA 2HU2A 1AHHA 1DC4A 1DB3A 3C24A 1JKFA 3E18A 3EMKA 4ZA2A 5AVOA 3WYBA 4DIBA 4JGBA 4RPKA 3AI3A 1HL3A 2E37A 4HV4A 1CYDA 3OMLA 3HQ4O 1IE3A 3TL2A 1M66A 3AUSA 1DJQA 4FIZA 2ZQYA 5DCYA 5T8KA 3GAFA 1QLHA 4O6VA 4J4HA 3GK3A 4EGFA 4XYMA 3BMQA 2P4HX 3GDFA 1FDTA 1M67A 2O7SA 3PI7A 5I7VA 1DFIA 5C7LO 1UP7A 1OC4A 4OH1A 1LA2A 1H93A 1DXYA 3BMCB 1T4BA 3QWFA 1HE4A 2POQX 1R6DA 3HB4X 3LC1O 4W82A 1IHYA 5G4KB 2DVMA 4IDDA 1JVSA 1RM0A 3S55A 1NQTA 2YQ5A 2ZYGA 3CMMA 4FOSA 3D64A 3NJ4A 2WTBA 4CMCA 3C3XA 4K1LA 2W2KB 4RZIA 4XRRA 2NTVA 1ZFNA 5H81A 3WIEA 1PS9A 3WOHA 3BYZA 3L07A 4FFMA 4ZQHA 4RO0A 2ZYAA 2VYVA 3TSCA 4WCFB 3WGZA 4G81A 1UH5A 3FF4A 4Z9YA 1GUZA 2BGLA 1GY8A 2YDYA 3PIDA 5EN4A 2HRBA 2I99A 3BXXA 3ETDA 3OETA 4URFA 2VNSA 3JD4A 4E2ZA 4AJOA 4OXNA 3UCEA 2AQ8A 5A03A 3BHMA 1LI4A 4XQ9A 3ITDA 3W8EA 1I10A 1F06A 1K3TA 1A72A 1ZEMA 2VNAA 2CVQA 3ZNPA 3C7DB 4ND3A 1CWUA 4A0SA 4Z6KA 3ADPA 4CMAA 3GHHA 1J49A 1LU9A 1CERA 3NTOA 3EW7A 1XCBA 3IKVA 1BDBA 1ADFA 3ZI0A 3V1TC 4CJXA 2OFPA 5JAQA 4K26A 2XXJA 4PLVA 2O3SA 2J5KA 2O2SA 2Q2VA 1ISIA 4LVUA 3OEWA 1HE5A 4CM7A 1N7HA 2ZCUA 3HG7A 1JTVA 1W8DA 2VHXA 3NUGA 4ILKA 3TJRA 5GZ1A 1PU2A 1NTOA 2Y93A 3AM3A 4BO9A 5KCZA 3JQAA 1I2BA 3IMFA 3V2HA 2YQ4A 5JCXA 2O4UX 1I30A 4ONEA 4OXKA 3QVOA 4DC1A 1ONOA 2DBZA 1AXGA 4CM9D 1PJSA 3DOOA 4A5OA 1YDEA 3AFNA 4EITA 2D3TA 3H9JA 3JQ7B 3FN4A 2ZATA 2GPTA 2PK3A 1QLJA 1MG5A 1R12A 3MZ0A 3HZZA 1GEEA 4DUPA 3UOGA 5BT9A 3VZRA 2PKQP 2BFAA 2XXBA 2VZ0A 3S8MA 4L4RA 1I0ZA 2EJVA 2QYSA 3JCZA 4CM4A 3MEQA 3KLPX 1PWXA 2PZKA 4YT8A 1ISGA 4Y6PA 1ZEJA 1A5ZA 1KOLA 2E4AA 3RU7A 3DFZA 3HDYA 1MG0A 5HRUA 2X5KO 2O23A 3F1LA 2C7VA 3A4VA 3WQRA 3GF4A 4L4SA 3FTNA 3TRIA 3T4XA 3NDIA 1XLTA 4J9VA 1VE9A 4Q3EA 3ETEA 1MFZA 2ZB7A 3ENKA 5TT1A 1E7YA 3DTYA 5JW6A 3P19A 2JJYA 2X6TA 4YCAA 3OP4A 2C82A 3ETGA 3GHYA 3NT5A 4MVJE 4PLYA 3RD5A 4LMPA 2Q46A 4WLNA 1NWCA 1WMBA 1QYCA 4W99A 4NPCA 4PZCA 1I3KA 1FXSA 3DZJA 4LCJA 1DC5A 1JDJA 1PQWA 5L45A 1RYEA 6ADHA 3CSDA 4JCOA 1E3WB 1NHGA 1Y9AA 1DHRA 3WGYA 3U49A 4ESOA 3KEOA 4ZICA 1HDXA 3HDJA 3LU1A 4RPGA 4B3JA 2X0IA 5U4QA 4PVDA 2ZB3A 1S6YA 2CD9A 4BNUA 2DPHA 4JQCA 4OL9A 1ZJZA 3O38A 3K2BA 3RC2A 1UAYA 3JD3A 3BTUA 3ZZNA 4FB5A 3FPCA 2RH4A 4ND5A 4WASA 2NACA 4IQGA 1OI7A 1NR1A 2CDBA 3IJRA 2W2KA 5DCWA 1QV7A 4BNVA 2C2XA 3LQFA 4FBGA 4XZ3A 4RF3A 1KEVA 5B4UA 1NAHA 2AQHA 3DMTC 3WXBA 1U8FO 4BKRA 5DULA 3RSHA 4P22A 3D7LA 3L77A 2Q45A 2GSDA 1NVMB 3ONFA 5DP2A 2NTJA 2PZMA 1B16A 3ICPA 1DHTA 4TROA 3JD2A 3U4IA 2RCYA 4AJKA 4BO0A 4E2WA 5FWNA 1T2CA 1XHLA 1GUYA 4EEZA 1ZK4A 2HKIA 3DHNA 4AJJA 1LDEA 5L40A 4WECA 5LC1A 2E6UX 4IINA 4YJDA 2VYNA 4YRAA 2Y1DA 3X2EA 3S2GA 5B12A 2WSBA 4XIJA 4PG6A 4CMEC 2FSSA 3M2TA 4P4NA 3JYOA 1LDBA 5HM8A 2V6BA 4DGSA 3N74A 2B0JA 1HYHA 1LLCA 2CNBA 4LGVA 1P31A 2O2YA 3E8XA 4P4GA 5L4SA 2Y1FA 3WG9A 1RM5A 4Y8VA 5CDYA 4K9DA 2VHYA 3H65A 1OFGA 4JLWA 1HSZA 3TZHA 1Q1NA 4RVFA 4W7HA 1DO8A 4OOEA 8ADHA 3D4NA 4PZDA 4XJTA 2WYUA 3KLMX 4Y98A 5COQA 3TZ6A 3WGHA 3PEFA 4CODB 1WVGA 1QMGA 5K9ZA 1LC0A 5ENDA 3G79A 3I9MA 5I7EA 5JYEA 1F12A 3I4FA 5LDGA 4ZJUA 4O0LA 5T57A 4GVLA 1HDRA 2DU8A 4J2HA 3ORFA 3V2UA 1XDWA 4ND4A 1P1IA 1XELA 2YV3A 2GZ2A 1C1XA 2Y0DA 2P5YA 4XQEA 3Q6IA 4D3FA 1YB4A 3OJOA 4YJGA 4A10A 2X7HA 1N9GB 4I5GA 1YL6A 1U4OA 4NBUA 3EGOA 3ZHYA 5CDSA 2YFHA 3PDJA 4XYGA 4RPHA 5AOVA 5BSFA 1GPDG 5KJ1A 1BRMA 1U8XX 4WUVA 3LF2A 3H9GA 3E6AA 3H8VA 4NU6A 1LLDA 3IQDB 3KEQA 2WE8A 3RC7A 4Y67A 2W98A 2HDHA 3R6DA 4CM8B 4PG5A 3DZIA 4J16A 4PLGA 2UDPA 2D5CA 3WDSA 3WWYA 3JQEA 5A4DA 4UEKA 9LDBA 4HBGA 3QE3A 1G0OA 1J6UA 2G17A 2X22A 3OICA 1JQBA 2JCYA 4TVBA 3QIVA 3HE3A 4NBVA 4C7KA 4PZEA 3EYWA 2YUTA 2YY7A 2ZK7A 2ZJ0A 5JC1A 5DOZA 2V6MA 3DBLA 2NVWA 4NR0A 5A9SB 5K6AA 1IUKA 1ZMOA 3IL2A 4YT4A 5JXWA 4RF2A 4WE3A 5JDCC 4MVJP 3WYCA 4JN6B 5AQ1A 2JHFA 4E6PA 3PXXA 1A7KA 3Q0EA 1LDNA 4GSKA 2O4CA 3PK0A 4RVUA 4BL5A 4B7UA 2O50A 4CM3A 3DHEA 1QYXA 4Z9FA 4PIVA 5FI5A 4QEDA 2I3GA 5TF4A 3DQPA 3OBBA 3B1JA 4E5YA 1U1IA 1VJTA 3ASVA 3FRJA 2GN8A 4JBIA 2UUPA 3MOIA 3E5MA 2B4RO 3VHRA 3ADOA 2QYTA 4BV9A 1E1LA 4A27A 2Y1EA 1JA9A 4RLHA 2FP4A 1IB6A 1IPFA 4LW8A 3U4CA 3VZPA 1LRLA 5ILOA 3PGXA 5IDWA 5J23A 1HDOA 2CY0A 3DZHA 1R15A 1VJ1A 4RDHA 4M8SA 1E6WA 4XB2A 5KJCA 1GV0A 1L7EA 2QZZA 4YJFB 5EINA 3WS7A 2YYYA 2YZ7A 2J6IA 1GQYA 5IF3A 3I9LA 4YJHB 1SZJG 3PFWO 5G0TA 5A9SA 5IZCC 4NJMB 2I76A 4YA6A 2GCGA 4DBZA 1E3EA 2PD4A 4LSWA 1I8TA 1E6EA 2W8ZA 3KYDA 2OORA 4IXTA 4YRDA 2DM6A 2WYVA 4F6CA 2FMUA 5IG2A 4BMVA 4YDRA 3RASA 4BNNA 4PGFA 3GRPA 1SEPA 3GY0A 1H6AA 5I8WA 1L1FA 5DBIA 4KOAA 4MVJD 3NYWA 1X7DA 4NBRA 4IZHA 2IZ1A 3BMOB 1VSUA 1EE2A 3OQ6A 5A05A 1C1DB 2NVUB 7MDHA 2A35A 3AY3A 4J7UA 4BO3A 1P74A 2WJPA 2JD0A 1ADGA 2NM0A 4HFRA 3RUHA 2RAFA 2VOEA 1ZKMA 3C85A 2BHLA 3HN7A 4M1QA 2VQ3A 1P9LA 1A27A 2VRCA 1WAMA 1QSGA 4DYDA 1E3JA 1V9LA 3OJ0A 4WCFA 1PZGA 1P0CA 2D59A 3N7UA 1UAGA 1NASA 4RORA 3Q9UA 4U6QA 4OQZA 3X2FA 1ADBA 1KC1A 1V3UA 2I6TA 1F8GA 2X9NA 3MWEB 3GGPA 5TLSA 3DAGA 1ZK3A 4TRNA 5G4KA 3QV1A 2EF1A 1K5HA 3HHPA 2CZCA 3VPFA 1WNTA 1KEUA 3RC1A 1P1FA 4DMLA 1NR7A 1BMDA 3AY6A 4FFNA 5U9CA 4CMBA 3SLKA 4GKBA 1HETA 1ZJYA 1Y9EA 2CDAA 1YXMA 2CFCA 2FPPA 4AJEA 4CLRB 2DKNA 1HDZA 3EC7A 3G1TA 2EJWA 3I9OA 3OJFA 5HBRA 3DB2A 4E5MA 5A04A 5JFOA 4B8WA 2OXIA 4WPGA 2GNAA 3ANLA 3JQ9A 1DIAA 3CTMA 2HUNA 3AY7A 3DZBA 4AJ1A 3JQCA 3UCFA 4PLCA 4BIIA 1VM6A 2PR2A 4FC6A 1R37A 4L9RA 3G1UA 4EUFA 3RC9A 1GQQA 1SCUA 3E9NA 4CR8A 1UUFA 2C7GA 4MP6A 4C4OA 2X5JO 1M2WA 2E48A 3EZYA 3OH8A 1ZCJA 2NU6A 1C0PA 1J0XO 3RIHA 5EQDA 1PSDA 3LT1A 1LBEA 1Y5RA 2Q50A 4HP8A 4R5MA 4AG3A 4QECA 2HRZA 2X58A 4GMGA 1ZMTA 2GDZA 1Y8RA 1WZEA 1E7QA 1RJWA 4RL6A 3KUXA 2BF7A 3BMOA 4UUMA 3QHAA 3VVBA 4Q3NA 5MDHA 3ZV5A 4MP3A 1ARZA 3FPLA 2AQKA 2G5CA 2HCTA 3WMWA 4FGSA 5BNFA 4TKLA 1YOVA 1VKNA 3E1KA 5B1YA 1KS9A 2X9GA 1T2EA 1X7GA 3OFSA 4PVCA 1BXGA 3DWFA 2FPGA 4JJFA 4D7AA 3HDQA 4ALJA 3QSGA 3ZV6A 1GDHA 1KERA 1Y8RB 1H6DA 3HFSA 3KYCA 1G0NA 3QWHA 3MJCA 2PH3A 2P9CA 3INRA 5G0VA 2DFVA 2Q2WA 4DVJA 1LQTA 3WGIA 4BNZA 3KSUA 3SC6A 4QX6A 1Y7TA 4R3WA 4KWIA 1XQ1A 3S2EA 1LJ8A 2R00C 3PQEA 5DF1A 1L7DA 2IXAA 4GGPA 5KIAA 5ILGA 1O94A 4JJGA 3BMQB 1NNUA 5DCUA 4UEOA 4XYBA 3RUAA 1CEQA 2PNFA 3PP8A 5F21A 1GYPA 4ALKA 2OL4A 4LRSB 4OYRA 2CMDA 4FFLA 1M75A 2GRAA 4P38A 1TXGA 3MTJA 3RKUA 1YQXA 4RVHA 1R4NA 4PCVA 4F6LA 1XGKA 1DOHA 1ZK2A 3INTA 4WOJA 3W4KA 4BO5A 3FNHA 3CKYA 5I9NA 1LLQA 1XU7A 3LDHA 1NX6A 3WYEA 3I6QA 3AM4A 5BNIA 2AEFA 4OM8A 3U0BA 1U3VA 4MVJA 1TEHA 3DZFA 5JMPA 4IQ0A 3BTOA 3H3JA 1P44A 3I83A 5G0SA 3U4DA 4AFNA 3PHIA 1ENZA 1ENOA 5JCJD 3CEAA 4GSLA 1V35A 4M55A 2B37A 2D1YA 4J0EA 3JQFC 4NG5A 4C7JA 1MP0A 1ULUA 1DSSG 4NH4A 3GC6A 1H0KA 2I65A 2Q3EA 3L6DA 1DC3A 3PGJA 4M54A 1G6KA 2J5QA 5THKA 4J2OA 4TQGA 4IDCA 4P8RA 2Y68A 3MJEA 2R2GA 5ADHA 3PYMA 4IQ8A 3LLVA 1KETA 4ZQBA 4GX0A 1J4AA 5L4LA 2EGHA 3F4LA 3OQ1A 5L7YA 3H2ZA 2B83A 4ZRMA 3FNFA 4DIOA 2B5VA 1B3BA 4DMMA 3VZQA 1B0AA 2CUKA 4ZN6A 1IZ0A 1E1NA 4EJ6A 3EHEA 4N5LA 3CH6A 2Q1UA 4QT0A 4S3MA 2Z5LA 3EK2A 3MWDB 1JKIA 4A26A 3V5NA 1DAPA 4J1QA 2O3QA 2NLOA 1EDOA 4NJMA 1UXIA 3E03A 3IUSA 4H16A 4HY3A 3WB9A 4CR6A 1QG6A 1LTHR 4AJPA 1MC5A 4Y6RA 2OOSA 3GZNB 4J9UE 4M49A 1LXCA 3GPDG 4FFPA 1DBVO 4ZQFA 5A3JA 4I5FA 1E7SA 1YONA 2HLPA 1H9AA 4Z3KA 3H3FA 1I36A 3V1UA 3PHGA 5F5LA 3UCXA 1AHIA 2NVBA 3LK7A 2BFOA 3RUCA 3HB5X 5COBA 1U2GA 2I66A 3ENNA 4MVJI 3TL3A 5L3ZA 1QKIA 1QP8A 3GA0A 3LSYA 3O4RA 3OECA 3FNGA 4MKZA 4AJIA 2FY8A 4CQMB 1CRWG 4UVDA 5CG1A 1LDMA 2VZ9A 4HXYA 3K6JA 2LDBA 1IY8A 3H9UA 4JNKA 4WGGA 4YAJA 2IYPA 1YJ8A 1A71A 2PKRA 3W6ZA 1MFPA 4WK6A 1M76A 4NK4A 1NFRA 1GZ6A 1E6UA 5KJ6A 2WWRA 3C8MA 2H1SA 3D3WA 1H6CA 3PPIA 4OO3A 3GFGA 5JO9A 4CUZA 1LLUA 3U62A 3UF0A 4CLEA 2VHWA 4XEHA 4WLVA 4QQRA 1M6WA 1EBFA 4GX1A 1P0FA 2WEKA 3NV9A 2J8ZA 3H7AA 5A5EA 2HK9A 1EK6A 4XRGA 1TA4A 1DEHA 3W1VA 1UXKA 5T5QA 1B7GO 1YL5A 4EJMA 4YAIA 2BFMA 1PQUA 2VOJA 1F14A 1FDSA 4Q9NA 4ZGWA 4BO1A 2Y67A 3HN2A 4G5HA 4J4BA 4B3HA 1U5AA 5DBGA 4PRLA 1K6JA 4F46A 5KJFA 3WGTA 4CLXA 4PLPA 2VHVA 3CZRA 4NZ9A 4IIVA 3OA2A 1TVEA 5KOIA 5KVQA 4MIOA 3WGQA 1NHWA 2BI8A 5JDIA 1Z45A 2EKLA 3R0IA 4XKJA 1RPNA 3DFUA 1N8KA 4XDYA 4ZVVA 4B79A 1YB1A 3JQ6A 3ROQA 5JY1A 5C5IA 3K9QO 4Y6SA 3Q1LA 2Q1SA 3RI3A 1YVEI 2VTDA 5L7WA 4A7PA 3ZWOA 2IODA 3G49A 2D5AA 4EEXA 3CXRA 5CEEA 1PZHA 4CV3A 1KY5A 3DEYX 4DPMA 3GUCA 4FGWA 2GR9A 1GTMA 4ND2A 3RFVA 3GQVA 3KV3O 2C5EA 2ET6A 3AOEC 2V6GA 4AL4A 1PEDA 4M87A 1EE9A 2JHGA 4N5NA 4UVHA 4HKTA 1R16A 1PWZA 5JE8A 3VKVA 3UH1A 3ICCA 3TNLA 4B4WA 2VTEA 3HFGA 1GYQA 1VC2A 3KXDA 1Z75A 1DDOA 2NNLD 2OGUA 4R5HA 4B4OA 3ZV4A 1GFSA 2GERA 4QO7A 1MC4A 4B8ZA 4PLWA 4RVGA 3WR5A 1Y6JA 3S1LA 3K92A 5F1OA 1DPGA 4R16A 4DPKA 3S2IA 5IDQA 3TFOA 3PTZA 5I7SA 3E9QA 3UVEA 4JROA 1MLDA 4FJ2A 4L75A 4W6ZA 4CM1A 1Q0QA 4AJNA 3OIDA 1EMDA 4R9RA 1EVJA 1NPYA 4AJ4A 1I2ZA 3H6KA 5HS4A 1SOWA 1DFHA 4CLOB 1F0YA 2G76A 1WZIA 1RM3A 3PLNA 2YDXA 4IDBA 5F1PA 2QZ9A 1Z74A 2WYWA 1KVRA 3GN1A 4IGEA 4IS2A 2QHXA 5TQVA 3AU9A 5HTOA 3GAZA 1RM4A 3M2PA 4KUEA 4O63O 1NQ5A 1E3SA 3DBHB 4CLOA 1IYZA 1NYTA 3FCOA 3GH3A 1U28A 2GN6A 5GMOA 4BGUA 1PS0A 2H63A 3C7AA 3VKUA 2O3UA 2OP0A 4E2YA 2Z1NA 5T8KC 4YXFA 3QRWA 2GUGA 4FR5A 1R0LA 3ZU3A 3DXFA 3GUYA 1SB8A 1O89A 3DOJA 4CV2A 2JL1A 3RCBA 4D43A 3F3SA 4BMNA 4D44A 4EUHA 4BUCA 1ISJA 1LDGA 3VAZA 3RAJA 2GZ3A 3ZNQA 1ZIDA 3CIFA 5KVCA 1PJQA 3GEGA 1HE3A 1SPXA 1GL3A 4DREA 1I3MA 1PZFA 2FWMX 3L4BC 1JKJA 2VT3A 2PWZA 3CUKA 4JBHA 1WW8A 1ZK0A 1ZXLA 4FC7A 4KQXA 4MJLA 2D0IA 1PGOA 4LRTB 3CPSA 1WP4A 2HJRA 4YTEA 5GY7A 1KVUA 2Y1CA 1UDBA 3I9KA 3IJPA 3KETA 5HA5A 2BD0A 4DQUA 1Q0HA 4CLDA 5G4LA 4IBOA 3NAQA 4MVJF 1CJCA 3OIFA 4N54A 5JCJA 4U5QA 2QIOA 1ENPA 1GPJA 4GAEA 3ON5A 3VTZA 3DBRA 4BMSA 1GAEO 5MGBA 1H2HA 4D0RA 4Q39A 1W4ZA 4I08A 4J43A 3ZHBA 4YAGA 2DUUA 5KWEA 2AE2A 4NFHA 1NQOA 3I3OA 3K30A 2UUOA 3FR7A 1ZZEA 3ZWXA 4BNXA 4D3SA 4WCDA 4L4XA 2C0CA 4BVAA 2A4KA 3FNEA 3KZVA 4MO2A 3GMSA 3SEFA 1RKXA 4PLHA 2BGMA 5ICSA 3FBTA 4YJHA 4YEDA 4BNHA 2IEDA 4Q3AA 2I5PO 4RPLA 9LDTA 4UVIA 5JC8A 5LDHA 3C7CB 3ZNNA 1X7HA 5L9AA 1XYGA 2C59A 4EBFA 4YPOA 1IOLA 2P9GA 4UAGA 4INAA 2P91A 1C0LA 2B5WA 4Z9XA 2JFFA 3QP9A 4CMJA 4OQYA 1EEHA 1U7TA 1YRLA 5CEFA 1PQPA 2Y66A 3C1TA 1HE2A 2WD8A 4XCVA 3GGOA 3RKRA 4I8XA 3PHLA 4E32A 4BGVA 4XB1A 2CF6A 3DAPA 4ITUA 3DBRB 1V3TA 1QR6A 4QSMA 2Y0CA 5BSGA 1EVZA 3KSZO 3TF5A 1E3WA 4B4VA 4OKNA 1KVTA 5AXAA 3CE6A 4O1MA 5THQA 1P1RA 3GVCA 5CFZA 2RHRA 3NTRA 1P1KA 4HX5A 3UN1A 4MIYA 1F8FA 4QTZA 4DQXA 5IN5A 3FBGA 3K31A 4YBZA 1ZSYA 3AUTA 3RUFA 4DA9A 4B7CA 4E0BA 3FHLA 3F1KA 1HXHA 1DIRA 4OIMA 4FPXA 1Z6ZA 1DRVA 3D5TA 1SMKA 3MJTA 1JWAB 3DDNA 2DPGA 1DRUA 1PIWA 4LISA 1JLLA 4KWHA 4MVJH 2JFGA 5GZ3A 4L0QA 3VPHA 1EUZA 1U3UA 4BNWA 3PHHA 3UFXA 4J1TA 3T7EA 1ISMA 1CETA 3WBBA 3PWSA 5IDXA 3SC4A 3A1NA 1Y5MA 2F00A 2GYYA 2Z1MA 4TVOA 4CMHA 1V8BA 4BNIA 1WDLA 1KEPA 2AEJA 4KUHA 4IJUA 1HDCA 3RUEA 1W0CA 3KYBA 4JIGA 4LCEA 1ISFA 1KC3A 3LVFO 4AVYA 2Q2QA 2IE0A 3HJAA 2J5RA 2O3TA 3DO5A 3RBVA 2NQTA 4GX5A 5AXCA 4DXHA 2DAPA 3A06A 1T25A 4XA8A 3NGLA 3ASUA 3WFJA 4XIYA 4A03A 4RF4A 2IXBA 4PFJA 5CDGA 2UAGA 3D3EA 4XQCA 4QFCA 4E21A 2IZ0A 1EUCA 4WNCA 5ENVA 1OMOA 4BO7A 3I1JA 1Z7EA 1YJQA 3STHA 3W4IA 2GN4A 2OHXA 3P2YA 1BXGB 3IC5A 5EJ2A 1ZK1A 1H94A 4NFSA 3K73O 1PR3A 5JLAA 3RU9A 2VHZA 3UXYA 1BW9A 4UREA 2WM3A 3V8BA 4BNGA 2VUTA 2IDZA 3ZWNA 4NQZA 4XGKA 1WWKA 4J91A 4CM8A 5G2OA 4E4YA 1C14A 1MB4A 1YBMA 1I2CA 3DTTA 5CEJA 2XF8A 1PGJA 4R69A 2G0TA 2EW8A 4FW8A 1GZ3A 1T1SA 4U6SA 5L7TA 3PJDA 1HSOA 4QXMA 3GVPA 4UEJA 3RJ5A 4BQPA 2X5OA 1NPTO 2DC1A 2HQ1A 4CLHA 3QWBA 4FS3A 2FRDA 3PZBA 4A73A 3JQBC 4FOOA 3PZRA 2G1UA 2IRWA 2O3JA 3QVTA 4CQMD 3JV7A 5FYDA 1V0JA 3RUIA 3B70A 3KVOA 4CMKA 1HT0A 3U09A 1BVUA 1Y81A 3ZGYA 3E5RA 4KTVE 2YFQA 1BDMA 1BWSA 1R4MA 3GEMA 1JW9B 2H9IA 1CDOA 1LSJA 2CVOA 3PQDA 4XGIA 3JQAB 5TSDA 5DP1A 1GD1O 1X15A 1EUDA 3Q11A 3QW2A 4GQAA 4W9NA 4Z0HO 4HFMA 5ICMA 2FHSA 1B15A 3QVWA 4Z3DA 2JD2A 5CDUA 1PL6A 2P2SA 4CUKA 2Y05A 5F3RA 1SOVA 4BNFA 4NFYA 2ZTMA 3IIEA 3RBZA 1LNQA 1KBZA 4TWRA 3PLRA 3W8FA 2BLLA 3V1YA 4B4UA 3ANMA 4QO8A 4I1IA 1X13A 5C7OO 1T2AA 3JYQA 1MX3A 3TFQA 4GH5A 3O26A 1FDWA 1B14A 5H83A 3Q2KA 3QJ5A 1T26A 3VDRA 3H9EO 4E30A 1DJNA 4YJFA 3IKTA 2FPIA 2AG8A 4JXKA 1BW9B 1N5DA 5BR7A 1ENYA 1FMCA 1R0KA 3O8QA 5G0UA 2F1KA 5TRTA 4BOYA 3ZHXA 4GWGA 4CQMA 1LUAA 4R1TA 1ZSNA 3C1AA 4KDEA 3D4OA 1SAYA 4EUEA 2VWHA 1S7CA 3I6IA 1HYGA 3OSUA 4EJ0A 4E3ZA 2WDZA 4WNIA 2CDCA 4R3NA 4DPLA 1OZAA 1NXQA 2DTXA 1X1EA 4R1UA 3O9ZA 3FD8A 4MIEA 1SC6A 3G0OA 3ABIA 3IUPA 4WEQA 4XR9A 3JTMA 5KVSA 4ALNA 4JJIA 2A92A 1UDCA 3AI1A 3SXPA 5K6AC 3VOSA 1LEHA 4MOWA 5F5NA 3ZWWA 2TMGA 4DRYA 1DRWA 1FK8A 5IXSA 1BTOA 2ZJ1A 5JDCA 3H5RA 3LZ6A 2Q99A 1PR9A 3BTVA 3OIGA 1MXFA 2GN9A 3ZWCA 3F9IA 3E9MA 5FEUA 2NWQA 4YQYA 1HF3A 1VSVA 2VWPA 1N92A 2XPCA 3KTDA 3WTCA 5L51A 4FQ8A 4I9HA 3DZKA 3TDKA 3NKLA 2Q49A 2HJSA 2O48X 4WKGA 1H2BA 2P5UA 1T4DA 3U4HA 3AFMA 4FJ0A 4I5DA 1VRWA 5JAIA 2FR8A 4PG8A 4S1VA 2NU8A 3VH2A 1K6IA 5IFLA 3A9WA 5IXYA 4CLRA 4MVJM 4R1NA 2EWMA 3WWZA 1NPDA 4ZRNA 5I9MA 3WQQA 3AOGA 2GD1O 3BMNA 4CPDA 4LN1A 1E1MA 4CM5A 4UULA 4RGBA 2W2LD 4NBWA 2C07A 1BGVA 1EVYA 5C7IO 3ZU2A 3NGXA 3ROMA 1PL7A 3WSWA 4ZU3A 3WBFA 1H6BA 1F17A 1WMAA 3NJ8A 4ID9A 3GRKA 3K2EA 3GEDA 3VPSA 3IAHA 4RCVA 2UV8A 2DLDA 4HFJA 3DBLB 1Q7CA 1PZEA 3Q3CA 4GPD1 4WJZA 2IEBA 2WD7A 4WLFA 1E3IA 4I9UA 3M1LA 1P3DA 3OQBA 1D1TA 4TKMA 3LT0A 1N2SA 4TZTA 2UYYA 4BB6A 1MGOA 5JAMA 1IHXA 3W8DA 1NVTA 4G2NA 2VYND 1PX0A 2EEZA 4CMGA 4JBGA 3ROPA 4HNGA 5ER6A 1JAYA 4EZBA 5B4TA 5EPOA 3NDRA 1UXGA 3MOGA 1MUUA 3NRCA 4XX0A 1Q2XA 4J3FA 3NX4A 2EW2A 4O5OA 3VTFA 3KHUA 4WCFC 4PG4A 2AMFA 2Y1OA 5IAAA 3UUWA 4PN3A 5DZSA 1D3AA 4M86A 4JK3A 3UW3A 1JAXA 1ISHA 1YBAA 2B36A 2V6FA 3ZU5A 2X0JA 4OAQA 2C5AA 4YACA 5DT9A 2Q4BA 3UAGA 4MVJG 5FF9A 2FSVA 1U3WA 2QG4A 4U8GA 1LC3A 3GVXA 4LSMA 1E1KA 1VL0A 4FSHA 2EERA 2AEMA 4WLEA 1TI7A 3GDOA 1EQUA 1QORA 3TOZA 2AHRA 2EHDA 1HZJA 2JAHA 3OEYA 2FZEA 3D5QA 3GN2A 3PQFA 5BSEA 2EV9A 2PZLA 2OBNA 3NT4A 1NBOA 2NADA 2HMUA 5BSHA 1AXEA 1CF2O 1DIHA 3PFFA 4ZHSA 2AW5A 2VZ8A 3RQSA 2NQ8A 2ZTLA 3WMXA 1UXHA 3DOCA 1EDZA 3JQ9C 4E5PA 1B8VA 3ROKA 3CINA 2YV2A 1N7GA 4YR9A 3SLGA 1GCUA 3JQ8B 3KOUA 1PTJA 1T24A 3AUUA 1H9BA 1I01A 3NDJA 1PJ2A 1SNYA 1BXKA 3P7MA 3PRJA 4G65A 3PIIA 4BQRA 1NP3A 5ITVA 3QQPA 5GZ6A 3WJAA 3KYDB 5IN4A 3ZDFA 5JNLA 3HUDA 4BNYA 5AXBA 5C37A 3MJVA 4ZD6A 1VJ0A 2SCUA 3L9WA 4XYLA 1K89A 3DMTA 3EVNA 1XIVA 3TQHA 3MTGA 4EI2A 5JPIA 4KP7A 2HMTA 3RFTA 3S2FA 4TRMA 4J4TA 2DTEA 1Y8QA 2Q1WA 4UUOA 3WLFA 4AJ2A 3QWIA 2B4TO 3GDGA 5FFFA 4DTIA 4II3A 2EG9A 2E49A 1AGNA 3PWZA 3ITKA 4RV9A 1OAAA 3PJFA 4FN4A 3WSVA 1UZLA 4DWVA 3R3SA 4Q3BA 2WD7B 2JAPA 4OSOA 3ULKA 1HZZA 4O59O 2DQ4A 1X1TA 3E82A 4IMPA 3IDSA 4LMRA 4Z0PA 1MA0A 1WDMA 3CMCO 4NIMA 4CMEA 1ORRA 2J3KA 5CG2A 1HTBA 3HNPA 3JYLA 4B7XA 4MKXA 1U7HA 3AM5A 1ONPA 4L76A 4CMIA 4CM9A 4CQLA 5JMWA 5TT0A 3I9NA 4N7RA 2NSDA 1O6ZA 1B8UA 5T6BA 3DZGA 4RLSA 4GBJA 5JY6A 3F5SA 4W7IA 4FCCA 2JFHA 1B3RA 1P77A 1YS4A 2AG5A 3C1OA 3KM0A 5T64A 5B4VA 3JQAD 3TPCA 2W4QA 3TZCA 2G82A 1R4NB 3GVIA 1CIVA 2NV6A 4YWJA 2Z95A 4GLOA 1YQDA 3JYNA 1QXSA 5EIOA 2WE7A 1LSOA 1KYQA 2YHIA 4XYEA 4DLAA 1U3TA 1H5QA 3FWZA 4J0FA 4CV0A 4Z0TA 2NU9A 2RH8A 4PLFA 3ZWBA 1GZ4A 2GZ1A 2Q1TA 3TOXA 2X23A 2CF5A 1ZBQA 5A3VA 2XAAA 3F46A 4J1NA 3WJ7A 1KIFA 3ONEA 1PJCA 5TNXA 1LRJA 4D41A 4ALLA 1TT5A 2EP7A 3I9JA 4KQWA 4II2A 1E5LA 4YAKA 1NQAO 1LDYA 1SBYA 3LC7O 1ZSVA 1HDYA 2IYOA 3Q9NA 3INGA 4BO6A 1BSVA 3G3EA 2EP5A 3ZV3A 2DUWA 4R41A 4BNKA 2D2IA 1FDVA 1LRKA 1YQGA 1DFGA 2WMDA 3JD1A 5FI3A 5HWSA 5CDTA 4IDGA 3WGGA 1UZNA 4W4TA 1TLTA 2BMAA 4OOFA 3ZCXA 1MV8A 3GMDA 4J7XA 4DLLA 2PGDA 3H5NA 1PS8A 3JQFA 5IZ4A
chains in the Genus database with same CATH superfamily
4TLDA 2QRGA 1ZGZA 2QTAA 4HNHA 3H0KA 2ZB8A 4D8XA 1R0BA 1U8YA 3IHWA 2XIQA 2D8AA 3LLSA 4DEYA 3BUSA 4V1CA 1XMIA 1DXQA 3E84A 3B9PA 3H1EA 3JQ7A 5B6IA 1PJTA 2GASA 2XKBA 4RENA 4EG3A 3GG2A 2NZUG 5CIWA 2PHZA 2PL5A 1VIDA 1OXBB 1DX9A 3GRFA 2W90A 2CHUA 2VDUE 4D0SA 2SKCA 4OHXA 3QY9A 4KQJA 4Z51A 1OH5A 1WXQA 4OB6A 4JLPA 4KZPA 4X8LA 3S6JA 1P18A 1MHPA 1NZFA 2F9FA 3L92A 3D7MA 1I9GA 2J3JA 4HLCA 4HWKA 1K3UB 2GJSA 2WIFA 5KYWA 1IZ9A 3QA9A 4IZOA 5EGSA 2CEKA 1YK0A 3CKLA 1RZRA 1OCEA 1ZUHA 1N0UA 3H2YA 4MQFA 4UVGA 3UV7A 4BEVA 1UP4A 3BXHA 3KQVA 1K7XB 2BI4A 4CNQA 2DR0A 1EM8B 1TT7A 4TPKA 4JXXA 2Z5FA 4ZO4A 4ZYUA 2OBXA 3EHDA 2VAXA 5CNKA 1BDHA 1RZRD 2BBOA 1K0FA 1Q1GA 2HLNA 4Q0MA 4HN4B 1QNLA 1RXCA 1KP3A 2EKPA 3GCDA 4GRIA 5D85A 4ZT4A 4IWYA 3ZE1B 5F1KA 3ZZUA 3MD9A 3GT0A 4E1AA 4L8VA 3C39A 4D6PA 1BYUA 4DVGA 4DQLA 1GFWA 5JHGB 4BTLA 5AOCA 1BHQ1 3AHJA 1WZ2A 1PNTA 1TGVA 2GD6A 2YJ5A 3FTDA 3LYAA 4LYEA 1P7PA 1A8QA 2RD2A 4MLDA 1YU6A 1JR3E 4IGFA 4D42A 2ZS8A 4DT1A 2XE4A 1OBCA 3AMVA 4NBTA 1GQ2A 4REMA 1SUFA 3KKOA 4FX5A 3PL1A 3GDHA 5DYGA 3I8SA 1N6RA 2J9FA 3KAKA 5KTNA 5JCOA 3SJ7A 2XDQA 3D8BA 2G5TA 1KFBB 3ZK7A 1U4SA 1EIWA 1OYVA 1V16B 1Q7BA 3QKRA 2G9NA 1U8AA 1CX9B 1J2YA 1GVNB 2P90A 4JOBA 1B26A 1W96A 4GL4A 5HZGA 5AKYA 1TAUA 5GJWC 4QQKA 4BMPB 3KKKA 1LBHA 3FPFA 3JVIA 2DBQA 2FAXA 3IHTA 3QEMB 4JJEA 3PXEA 4QL3A 3ZX4A 5JS1A 2VCYA 3SU8A 3OX2A 4F21A 1ESNA 2YR0A 4EJSC 5L95A 3AUAA 5EXEA 1HH4A 2ZJ5A 4DC0A 1TO2E 2OORC 3BRQA 4D8YA 4GBGA 1A4RA 2X77A 1Z0IA 2X6QA 4UTRA 3IOEA 1TTHA 3HP1A 2GUWA 4C3VA 4EHLA 4FOLA 1JZTA 1YZLA 2BI7A 3HYRA 4FFWA 3IP5A 5CHEA 2PXCA 3TLZA 3J80A 7REQB 1L5YA 1V4BA 1Z8HA 2HMSA 1NY5A 4W9MC 4OHZA 2IH4A 2PJUA 2QW8A 1A88A 3GEHA 3JATA 1F48A 1ZCZA 5CT5A 1ECGA 2VEDA 2Z30A 2HDOA 3B1KA 2O9JA 4OY3A 3TOCA 4YJGB 2R1TA 1E5DA 3HCNA 5AXDA 4X54A 3QEKA 4PZZA 3N0WA 4DRXB 1T3LA 3ROFA 2C5GA 1NYLA 2PLNA 4DZTA 4F4CA 1HM5A 1E3DA 2FFAA 4RKEA 3S8EA 1PR6A 4JYAB 3JWGA 5C4MA 1D03A 3LDUA 4IIUA 1F20A 3G8BA 5LJLA 1TUGA 2PBLA 3H05A 5A9TA 3A10A 4G1CA 4RH3A 3L7LA 3A4YA 4Y9DA 3WGNA 3WJ2A 2ZWIA 4Z54A 4R51A 4JBWA 1UKBA 3VH1A 3ZIAA 1DP4A 4DCUA 3UK6A 1N2HA 5JI2E 2R9VA 1YCFA 1MQ9A 1XX6A 1Z4MA 3IUNA 1AIPA 1YA8A 5FP0A 3GLGE 2EQAA 3DPSA 5GV8A 3WGVA 4DLXA 3TSOA 2G9VA 1EUQA 2LCIA 1RDFA 2E0IA 1I5RA 2R6JA 4QUKA 3ZWYA 2IOFA 2P75A 3MTIA 2D4AA 2YHSA 3UENA 1SG6A 3AEQB 4HZIA 4QUJA 1X3SA 3MINB 2W93A 4O4LB 5TDHA 1K08A 4D45A 2BRUA 2XGMA 1IY0A 3U5TA 4EPTA 4BO2A 2XT0A 3HR7A 1NQUA 4LYJA 1YDWA 3T1NA 5LWHA 1EUDB 3JZIA 3GOHA 4BZXA 1W0JD 2QMEA 4D3DA 4YDQA 3SVTA 3CPJB 4ZOCA 1Q50A 1PUXA 3NOQA 2JFUA 3C15C 3WP1B 1DKLA 3P5BA 4G36A 1YMQA 3FWNA 4R68A 3ZH9B 1QYVA 3IUYA 3IJEB 1DKPA 1P5HA 3PRYA 3QNUA 1NFQA 4L2IA 4UW9A 1Q12A 2BONA 4D46A 3IVGA 3B89A 4BQIA 5HRAA 3PDCA 5J9FA 2W37A 1THGA 1TMGE 2B92A 1UC4B 2HTEA 4ARBA 1SXQA 3ZE2B 2AL7A 5JLJA 1NQWA 1QFSA 4O4JB 3MJSA 2K2QB 2LR0A 1TTTA 1QGUA 4K03A 3UJ6A 1JN0A 2ID7A 4DQVA 1L5SA 5IC6A 5E7MA 4COKA 4D0GA 4S24A 2IBTA 3A4NA 4WKBA 4PRKA 4KITB 1XZEA 1CIJA 3FCUB 1VXOA 2NZXA 2YUIA 3HXLA 3PHJA 4RIGA 1M6EX 2C20A 2VBCA 3PJEA 4CV1A 1N5KA 1YHYA 2DBYA 4PYJA 1T29A 2CV0A 3SZUA 3VPXA 3WLMA 3TIGA 4JVOA 3LBNA 3NHRA 2ZJ6A 3DMYA 4I1YA 4RPJA 3SM3A 2VWQA 1M6HA 5ELLA 1LW6E 2FN9A 4W63A 3B60A 3KUKA 3WYNA 1BWRA 1MEJA 2QAGC 3R3VA 3PX3A 3PD1A 1G3RA 5ALTA 5FBKA 4EEKA 2WTMA 3H8SA 3NRJA 3ZTYA 1EK1A 2JIDA 1U3CA 2FWJA 2GM5A 2I6XA 2O6HA 3EA0A 3P9SA 4TZKA 5C1DA 1EVIA 1FNNA 1E2IA 4QUIA 4DLBA 4IMJB 5AYVA 2IITA 5CURA 1NU6A 1RMQA 2X86A 1ZD3A 1VLJA 2MCFA 1SZDA 2XOXA 3REFA 1W52X 1V3VA 4FTWA 3MRXA 4LFCB 3CEMA 1A1SA 1NVWQ 3PD0A 3R9KA 3W6UA 4AJHA 5CAEA 3UT5B 2N47A 1XZIA 3LOQA 3V4OA 1DUVG 1A5SB 3D0KA 3TLCA 4NXNB 3DGFC 2GJKA 1NFFA 2TECE 3PC7A 4UBLA 4BKPA 1M6NA 2NTNA 4JOSA 3LPDA 4OJQA 2PGJA 3UV6A 2HUPA 3DOIA 3WLEA 1GNTA 1OHHA 4YUVA 5DASA 5B58C 3UJBA 1QE0A 4C0SA 2WPNA 5JBIA 3VO2A 1RNLA 5IKXA 1SXPA 2ZCJA 1D4OA 3C6QA 1DINA 1T9BA 2A94A 1G8MA 1DBWA 2FWBA 2G1JA 3COSA 2HMWA 3QVXA 1M2GA 3RSFA 5KDDA 3NIFB 3AFOA 4BO4A 3ZWKA 3EVDA 1QX3A 2QZ4A 3HCDA 5JAHA 1C1HA 4MUBA 5DHSA 2EFDB 3B6MA 2II6A 3DWGA 4N0EA 4BKQA 4E03A 5KOJA 2EGUA 5BQ5A 1OXSC 1OI3A 1B8PA 1GXSB 1H85A 1ZNQO 3B3GA 3BC1A 1AKUA 3G7NA 1NULA 1NVVQ 2EFEB 4IIJA 3DC2A 2JGAA 4JFAA 1C1YA 4TUYB 5AKGA 1GM5A 1SC1A 1U7DA 4G3XA 5K8VA 1G7CA 2B69A 2Q9BA 1WW3A 3EDMA 1PTKA 5CA1F 2B8TA 2QTFA 4C5CA 4AMVA 2DKOA 1DJOA 5CYFA 5KO2A 1C1DA 1PJBA 3I9V6 1XB2A 3E9EA 4UMEA 4B45A 2BYTA 3CIOA 1T43A 2LUOA 3GNSA 5AICA 3T7SA 1K27A 4ND8B 3W2GA 4H7PA 3RHZA 3LDGA 2BGKA 2PT9A 5J4KA 1DCKA 2BGIA 1RRFA 5CVEA 1MVOA 3GCGA 4ITVA 4F84A 2PLAA 3AWIA 3CISA 2IS4A 5EE9A 3V42A 2FOIA 1Z6AA 1WSWA 1VL6A 3OA0A 5BW5A 3HP7A 4J6FA 2WINI 1GR1A 2PX3A 3M89A 2ZSKA 3IBSA 3SS8A 1JL3A 1BCSA 3QXCA 4AS3A 4GWKA 3E15A 2GBLA 3PS9A 2GKSA 2PVPA 2ZI4A 3RH0A 3QJYA 2RAUA 2XQFA 1OU0A 3H9QA 3H18A 4OPMA 1UL1X 1TKRA 4L8LA 2VI5A 2FN7A 2ATEA 3Q88A 3CZMA 2YJ3A 1E3LA 3R5JA 4IVPA 1A8PA 1O57A 1I1QB 2NX2A 2WB4A 3RDPA 3T5CA 2ZEJA 3WYAA 1P61B 4ZIRB 1W36B 1CS0A 1XI2A 1GEGA 4TWBA 3DA8A 5CPFA 1J9ZA 4FE3A 4EDFA 1U4NA 1RYDA 3QX9A 4GMFA 1QHIA 2ATXA 1BE6A 4GZ6A 1AKVA 4G1EB 2AFIB 3DAFA 2B7LA 3FCYA 3CZQA 2HK8A 4DCSA 3KB6A 4F71A 1BZYA 2RGNA 5HK8A 5A6SA 2OFXA 2OMEA 3N2KB 2F9MA 4MWBA 3I1FA 3H87A 1AVTA 2Z0MA 2VF7A 3ECCA 4NCHA 4Q9AA 4BZWA 2IVZA 3KP1A 3NT2A 1H5UA 4DCOA 1AUVA 1ID1A 2G1AA 3MLBA 2ADFA 1N5IA 2V54A 3N39C 2O1SA 2WP0A 1AUPA 3IAM6 4M22A 3SBEA 5M2QA 1JU9A 2AJBA 3IXLA 4AS1A 3UG7A 4JV5B 2AQIA 3S68A 3N0VA 1X7ZA 1OLUA 4HGOA 4QFBA 5FNVF 4KQGA 2QSZA 4JNCA 5JWRA 1CQIA 5B3JA 4PLZA 4HDAA 3L06A 1W4AA 2PD3A 2F3SA 1NRWA 3B1FA 4HEQA 3VPCA 4C43A 1KVQA 1A4UA 4R7GA 1RXYA 2QDXA 4IPTA 3ZQJA 4EM6A 1OOEA 3UGTA 3OF2A 1N2CE 1I7SB 5AK5A 1YVPA 1UOOA 1HKHA 4OHRA 3IAUA 4F9GA 2ASVA 4LBYA 5BNWA 1XTUA 2QP3A 2WWVD 4QUAA 1Q95A 2M32A 3KQYA 3NIWA 2YN2A 4J07A 1AD2A 1BG6A 3SG0A 1JYFA 2FR0A 4LC0A 3H1TA 4PGGA 1OB5A 3GP8A 4KDFA 1FW6A 2O06A 4L02A 5BYKA 1SJ9A 4AUNA 4COOA 4LY6A 3N2EA 4L16A 2IUEA 2ZUDA 3E53A 1GCGA 2AC4A 2WJAA 3I12A 4R1SA 3THSA 2VJYA 4GZMA 3KEGA 3ZLUA 4JCCA 4LZAA 4K6FA 2IYTA 2Y0EA 3L1IA 4IVRA 1YHZA 2ZS9A 4MH0R 1BXRB 1SKYB 3DE1X 4H15A 3TW8A 1UDAA 3SQXA 4WNYA 1J8VA 1T34A 2VATA 3C74A 4IDNA 2XSZA 4JP8A 4JU9A 4MI6A 4UBNA 2UVPB 3U13A 4EW3A 5ADWA 4MDFA 1BNCA 3PC2A 1MAUA 4HAZA 4KQFA 5BV0A 2G25A 2AA3A 3O03A 1ZICA 3CU5A 4INPA 4BNTA 3GVHA 3C4JA 2R65A 1JGTA 4FX2A 4NK5A 3UBMA 4A2CA 4ZDKA 1ZKDA 3FVRA 2R1VB 3NWBA 1M8FA 1XZGA 3AVYA 3T7CA 5A3SA 1V41E 2NO6A 2RB5A 3EA4A 5CCDA 3CX3A 3FHTA 2PZ8A 2CVZA 1XR3A 2ES4A 2O7NA 3DE3X 2JRCA 3TB4A 2JI6A 4Y6QA 4ARVA 3U3XA 2EQ5A 2DTDA 4IIBA 2ZT5A 4ZOBA 5LA6B 2IU4A 3R3JA 4KFSA 5G41A 1A2QA 1Q3HA 2BFWA 2X5XA 4Y6RA 2WRZA 3VNVA 1KI3A 4UU8A 5EP2A 1ZIPA 2O7VA 3AF6A 4OSPA 4ZP1A 2RSLA 4HGRA 3COPA 8LDHA 1Q0ZA 3IRVA 4UDNA 3PD7A 1VZ3A 2ZTUA 4GKVA 1E0AA 4B1FA 4WWHA 4E2XA 3VKGA 5FHQA 3IP1A 3QX7A 3KQOA 1A8UA 1MF7A 1JFFB 4J75A 3JQDA 3RVPA 5KYKA 3TN7A 2B99A 1J2RA 1CS0B 3ID6C 3JQBA 1WPQA 1I1HA 4MV4A 5EP3A 1VI2A 1R8SA 5JS6A 3ITEA 3IFSA 2DHCA 4AWBA 3KT0A 4UPDA 3M70A 1CQIB 5T4HA 4EG1A 4GPEA 5CD9A 4YRBA 4FDVA 1TQDA 2C96A 1IN6A 1QH8B 3BEOA 3L1JA 3G2JA 1T15A 2P9BA 2H85A 2VRBA 1GL6A 5MFPA 2J0VA 5M29A 1P39A 1W76A 3L7MA 2VPTA 3AR8A 2ZE8A 4KNVA 4XM0A 2IHNA 3JQPA 3OHSX 1MQSA 2ODEA 3AFGA 4ESEA 1L5GB 4MHSA 3GEIA 1QWOA 1X39A 1M54A 2F62A 4PO9A 6LDHA 4IDEA 4CE6A 4AKGA 2R7NA 1U9JA 4KYTA 4AJ9A 4YS6A 1UT6A 4F38A 2QRKA 2EKQA 3G2LA 3L7AA 1WMSA 3Q12A 5F33A 1CNEA 3BWEA 2WAAA 3IOYA 4GXNA 1X8JA 4QDZA 3FUUA 1IU9A 4RIIA 3PJGA 2RGRA 1ZN2A 3LBFA 4OXYA 1IONA 2AK2A 3R8CA 3ZUPA 2YX1A 4XVCA 4NQRA 4N48A 2XZDA 1FRZA 2AXQA 3H1BA 1FU8A 3OE7A 1TYCA 2QGFA 3LT4A 1YR8A 1P4SA 2ZE6A 3EC1A 3OESA 2ZRAA 4RVCA 2B0CA 3C4QA 4I1RA 2ECOA 2ECKA 2OV3A 3BORA 4MRVA 1HE1C 1VXRA 1UOEA 1BVRA 3BBLA 4ZT3A 3VO8A 3ZN2A 5EJ5A 3W6NA 1MX1A 2DPMA 1MA3A 3BD8A 3D3WB 4NU5A 4EWLA 1JHQA 5DBOA 3TAUA 2DFDA 4XVQA 5JCZA 3UG6A 3PSAA 1D0SA 1JKFA 3EMKA 3DVRX 2QJWA 2P5SA 5AVOA 3EH1A 4RPKA 3SVLA 2E37A 1E69A 5EKUA 1CYDA 4JVSB 2GM9A 3K1AB 5DMXA 4CEIB 5JPCA 2DPLA 1BFKA 1LCIA 2FPWA 1CVRA 2IPMA 1WSBA 1T1GA 1YIDA 2JI4A 5ICFA 3S28A 4F7WA 4O6VA 2ZYIA 4BC1A 1FDTA 1M67A 1G16A 4P7BA 1PK8A 2O7SA 2VJMA 3FYUA 3N3AC 5ECDA 5I7VA 1DFIA 4TXHA 1G6OA 1PCXA 2ZTHA 5C7LO 4XH9B 4ETIA 2H59A 4AZ3B 3C2QA 1JAZA 4KRFA 4I8DA 4OHFA 4PW0A 5K3OA 1ETUA 3QWFA 3A6GA 2CLSA 1HE4A 2BFDA 5EHGA 1R6DA 4B3JA 1IHYA 4S0XA 4BCDA 3S55A 1JVSA 4EGJA 3KQUA 3K70C 1GDTA 3WB2A 1L5ZA 4IYJA 4J0GA 2ECFA 5D86A 2GPYA 5FPSA 1C4XA 3C3XA 4MR9B 4RZIA 4YRNA 1N2ZA 5KYNA 3U1BA 2XVAA 5H81A 1YZKA 4FVTA 2UXBB 1W93A 1JKMA 4FFMA 4ZQCB 5AVWA 4ZQHA 1AKEA 3PKIA 4Q21A 3LOUA 1GRRA 1PLJA 4WCFB 1EWQA 2O8FA 5ED0A 3WGZA 3EARA 2CHFA 1GSIA 1ZAKA 1CG6A 2PDAA 5ALJA 4HEA6 4AMYA 5A4AA 1UH5A 2ZAOA 3TK1A 1FFBA 2GCNA 4YXFA 2GKGA 3MC1A 3CVUA 2PUEA 4GKKB 4Z9YA 4F60A 1PVOA 5EN4A 3IODA 1JI3A 2HRBA 1W2GA 4BYGA 2BGRA 3BXXA 3ETDA 1PO7A 4NABA 4B46A 1Z06A 3BPSA 3G9TA 1G21E 4AJOA 3E58A 1P7ZA 3CYFA 4AZWA 3AF2A 2X8JB 2TYSB 2J59A 3OPYB 3L7YA 4GNRA 3ITDA 5EYPB 1F06A 2LV8A 1A72A 4FYYA 1QDLB 4ZT6A 4ZCPA 3ZNPA 4ZT5A 5EQTA 1Y63A 3LLUA 1ZESA 4B09A 5KU1A 1PW5A 4AW9A 4QICA 1T3SA 2X2PA 5HP4A 2XWJI 4NRDA 5CX4A 3UANA 2WAMA 5K3FB 5IJ0B 3BQ9A 2GDJA 2EX4A 3IAS6 3OU2A 1DX4A 3IKVA 1R5BA 4HX2A 3ABRB 2V4MA 4YBRA 4CJXA 1CLUA 2WPDA 3HS3A 1SBZA 2XXJA 3N2LA 3FZYA 1CUHA 2C57A 2QNIA 2FCRA 2W0MA 4PLVA 3SEZA 2O2SA 5JXGA 4LE2A 5C8XA 3L18A 4LVUA 4CM7A 2P35A 3M83A 1Y6RA 2NU7B 1N7HA 4QJBA 5AKJA 3VFDA 2WFZA 2VHXA 5FO1A 4ILKA 1YMUA 3TJRA 5GZ1A 1PU2A 1QRAA 1D1QA 3QPAA 4BO9A 1KP9A 2X9QA 3FGOA 3HBLA 1TIPA 2M1XA 2PX6A 4YDHB 5EP1A 3V2HA 2O4UX 1UBTS 1O8BA 1W5AA 2OBMA 1O58A 2FVYA 3A11A 2QTCA 1CNMA 4GOMD 4KV7A 5EJ4A 2KBFA 3USCS 5DM60 1AXGA 2J0QA 4CM9D 2P9YA 3HM9A 3DOOA 2Q6IA 5KOHB 5LA6F 1XBTA 2J0SA 3S5JA 3AFNA 5B7GA 5DYNA 1N77A 4HQ0A 3KEFA 3ZLVA 2JBHA 1RZUA 2J1LA 3H9JA 4QEZA 4EA9A 4HR7A 1A8IA 4B0OA 2ZATA 2GPTA 2XOKA 4MROA 2BP7B 3USZA 1MG5A 2FLKA 5BPFA 4F8YA 2QL6A 3HZZA 3RTAA 4DUPA 2RGYA 3BSSA 4LV6A 3VZRA 2CXQA 1TEXA 3CUWA 5HMMA 4P0PB 2PKQP 4PS1A 1KQ3A 1N3LA 3GDWA 3U81A 1FL9A 1HQKA 2VZ0A 2ZYUX 3KU1A 3ELWA 4FDMA 5JANA 1I0ZA 4U9IS 2KBEA 2QYSA 1RI2A 3G0GA 1P2DA 3MEQA 1JR3A 1L2TA 1RJ9A 4HGPA 4LG1A 3ZJ5A 1PWXA 4TQUS 3A3NA 5SZKB 1OX4A 3DM9B 3V1LA 3N8HA 1J20A 1AK2A 5ARCA 1NX9A 4DKXA 2P27A 2NO5A 4C7OA 1XZCA 5HRUA 1BOOA 1Q3TA 4HEA1 1IBSA 3IOBA 1H0RA 4M98A 4RA9B 3S0JA 4G0OA 5KYXB 1CUIA 2PFSA 1IBKB 4NY1A 3A4VA 3KX2A 4TTIA 3WQRA 1DKNA 2XNJA 3GF4A 4L4SA 3HLKA 1QHGA 3OLYA 4JIMA 4KR7A 3R40A 3NDIA 3U26A 1JHPA 4G9BA 1AU9A 1MT3A 1D6SA 4Q3EA 5FIUA 5JADA 4M9UA 1B41A 4YXWD 1Z2PX 3O2JA 1G7SA 2FSVC 3IA7A 4A1FA 5JIBA 3DTYA 5LR6A 5BV2P 1OTYA 1QVRA 1DX6A 2JJYA 2C82A 2HHLA 3D0RA 2XMRA 4RXMA 1E20A 2H2GA 1IQPA 5THXA 3F74A 4LMPA 4NMMA 5K7SA 4YJ2F 1NWCA 3QYPA 1KPIA 1QYCA 3DFMA 3ZGLA 4WVFA 3V7NA 3FY4A 3K94A 1I3KA 1FXSA 3DZJA 1QH1A 2FSGA 3QELA 2PSEA 4R8RA 2ZRFA 3ER9A 5GVSA 2JHPA 1WQ3A 1KYIA 5F12A 4U2GA 4H7KA 4ZV7A 3ESQA 5ALZA 3SE0A 3FAZA 3QFCA 1OPRA 1NXTA 2UKDA 4QUGA 5EXXA 5KREA 2GNPA 2XNSA 2C5LA 4N5HX 4S1WA 1Q92A 2QK4A 1ZJZA 1EFPB 2FG6C 4TWJA 1TZKA 3K2BA 4MRNA 3LW8A 4RWEA 2P3LA 1NJ2A 2VIIA 4FYJA 2B82A 4ND5A 4JHXA 4WNAB 5LQCA 3I04A 1CEEA 1XWIA 1AUQA 2E9SA 1LWOA 3PC4A 5B3AA 1BYIA 3IJRA 3Q10A 1U8CB 3AVQA 5DCWA 1QV7A 3M81A 3ND5A 2D7DA 1FSPA 3KWFA 1T36A 2QM0A 5KWVA 2A88A 3BWMA 4MMZB 2AK3A 2V74B 3UJPA 5P21A 3F9CA 4L28A 1U8FO 4BKRA 5DULA 1NLFA 2AUTA 3V4LA 3ZJYA 3Q7SA 3ONFA 2LCQA 3UJ3X 3TJZA 1DHTA 4GR5A 5BR1A 3FZGA 2RCYA 4ERNA 1Z5UA 4RMGA 3LL7A 5FWNA 2BDUA 4RY2A 4M9QA 1YZUA 4EEZA 2BV3A 3QKRB 1GNPA 1RI4A 4F1WA 5KSWB 4AJJA 3CEJA 4R0NA 5E3HA 3HCEA 4DRZA 4CG1A 4Y1FA 2ROQA 4E7OA 4V02A 1N3IA 3SZ3A 4X8HA 1PVDA 3S2GA 4LRUA 3P9NA 1HZZC 1OQAA 3D43A 3T7JA 3DNFA 1P0MA 1UK6A 2BM8A 1GZUA 2PSHA 4C7OB 4PG6A 5BWCA 2FRDC 2LVBA 3KT6A 5TARA 3BRSA 1R3DA 5CM9C 2XZTA 1KI7A 4LWPA 5EVJA 4ER7A 1LDBA 1F5SA 1ZM9A 2YWDA 2JCGA 3N6VA 1IWBB 2W7TA 2YMPA 3V4PB 4DGSA 1JIJA 3VR0A 2J30A 2YIJA 1V5EA 4LGVA 4LJSA 3S1AA 2O2YA 3GRVA 1TJ3A 4O8ZA 5B5SA 1UKYA 2EKBA 3KSRA 3M49A 4WY2A 5F9MA 4JUAA 5I9IA 3FOFC 4K9DA 3SBDA 4C14A 4JP5A 2Z6AA 3AM1A 2C7BA 2ZR0A 2VF5X 3ZXSA 2ZWVA 1KDOA 5TS2A 3IB6A 2RK4A 3ORYA 3OCZA 3IIIA 3TBHA 5CB6A 4UM7A 1P29A 2YNMC 3MA0A 4FHGA 4PZDA 2CBGA 4Y98A 5BOVA 1UC8A 1M5UA 4I0WB 4A92A 5IKMA 3CRW1 5COQA 2JLVA 3TZ6A 3G88A 3WGHA 3L7OA 3PEFA 1WVGA 3IXMA 4EK9A 1RTTA 3JAKB 4GZ3A 4E22A 5EIHA 1WXHA 2WMYA 4RS4A 4E2FA 3KZOA 5CJPA 4B17A 4TLAA 3O4HA 4I2VA 3ZDXB 2R2AA 2G28A 4J2HA 3ZDDA 4KBGA 4XUCA 4ASUD 5JASA 4JWKA 4GXQA 2EYUA 3PFCA 4NE7A 4W1RA 5KEIA 1P1IA 2RHOA 4GRDA 4ES6A 2CBZA 2JJ8A 3RIMA 2J67A 2YV3A 1RU3A 4MWZA 1PFKA 4MKHA 4B6QA 3HCFA 2P5YA 5KBYA 1J1IA 2FX5A 4YJGA 2JVIA 2FN4A 4I5GA 4V3BA 3VYUB 5JQGA 1YL6A 3ZLJA 2XJ4A 2XCSB 1BQ4A 2YFHA 1MOSA 5AOVA 2VLIA 4HDMB 2HEIA 1GN9A 2NXCA 4ECAA 1R6BX 1RWXA 4NICA 1BRMA 3JSXA 3FPEA 1NQVA 5KQPA 3HYTA 1UIRA 5DM0A 1XL0A 2HF8A 4K8RB 4NU6A 4KB5A 1V6CA 1TCAA 1I4WA 4ZDJA 5H68A 3R6DA 2QTZA 3EODA 3FH0A 4MVYA 4PG5A 2HYIC 3MCWA 4QAQA 3JQEA 2XNKA 4TLLB 5A4DA 2VT7A 3A2KA 5BQ3A 3UAZA 2RGDA 1FP4A 3PC8C 3M4JA 4RXTA 3TJMA 3KPWA 4HAYA 4JX9A 3LKDA 3OICA 1I0LA 1GTSA 3K32A 3HE3A 3QIVA 3CH7A 2MYUA 4MQ4A 2WAOA 1DGQA 8OHMA 4TYYA 2J5BA 5CXUA 3SN6A 2A1IA 2Q5HA 2ZK7A 1KR2A 3M5DA 1V8ZA 4WTOA 2OV6A 2BGTA 2CT8A 5FPPA 3DBLA 1QQ5A 4ETNA 3L01A 1V7ZA 3L43A 1ZMOA 3TKAA 1L5KA 4P7FA 3MWKA 5JNTA 1SFRA 3LP5A 2XX3A 2B4KA 1JB1A 4RF2A 5JDCC 3R3XA 4DTCA 5J1TB 2CZGA 2OO5C 4E6PA 3CW9A 1E4VA 2CJYA 4EO4A 1A7KA 1L5FA 1URPA 3BE8A 3RHFA 3FFWA 4GPBA 4U2KA 2V9ZA 3B85A 3ND7A 2AV6A 3NDPA 4NPAA 4P4SA 2XUAA 4B7UA 2QS9A 3MSCA 4MTCA 4O4JF 1Y34E 3P2IA 1J22A 1QYXA 1V7CA 2GZSA 4Z9FA 3WSTA 3UAYA 3S44A 4ND7A 3FPBA 2X13A 2ZXFA 2XE6A 3HUUA 1GUAA 4JUIA 3GI1A 3ZIDA 4NYMR 5CW2A 1DS6A 5K2MA 2UUPA 1RLJA 2BGJA 2GF0A 5ALKA 1BS1A 3IDAA 3B7GA 3ADOA 3LQ4A 3LWNA 4LJ6A 3LW7A 4MQFB 4TV8B 2Y1EA 1JA9A 2Y6VA 3UTDA 8ABPA 3RAEC 1CZUA 3O9VA 1IB6A 4LW8A 4RLHA 4TMVA 1UMCB 2AC7A 1BH6A 4UEWA 3U4CA 4CTOA 1SVNA 1WR8A 3MLAA 1AK1A 4UHFA 5E4JA 2JGDB 1M7GA 4U63A 3DZHA 3X43A 2J08A 1R15A 4ZK2A 4U7FA 4RDHA 4RJKA 4KR0A 4M8SA 4O4LF 4GBMA 1SU8A 1L5NA 3ZDCA 1NP6A 3X1KA 1XF9A 3FZEA 2A67A 4YJFB 5EINA 1XP8A 2BSQA 2PXHA 2VK4A 3F6RA 2QUHA 1N5MA 3ZCPA 1ZOPA 5AW6A 4P5PA 3JARA 1DDGA 4TMXA 4D9CA 4TTVA 4YJHB 3PFWO 5G0TA 4N47A 5IZCC 4K2HA 1OLOA 3G02A 2IH5A 3L0SA 1L5VA 1N5LA 3FYUB 3ZE6A 3I5YA 4YLYA 1I8TA 1PEYA 2W8ZA 1RAHA 4KQKA 4NENB 2R1VA 1JSXA 3F5MA 3RVOA 1YULA 4CNBA 4QXOA 3RASA 1UKVY 3V80A 3OLZA 3AESB 1D2CA 2X7JA 1SEPA 2GAFA 4TS3A 4YMWA 3TIIA 1AM4D 2IIVA 2OD9A 3PEWA 2QVYX 2H65A 5EYPA 1JU3A 1X7DA 5E0OA 4C07A 5JJBA 4DDTA 4UQLA 2JATA 2WLTA 3BMOB 1VSUA 3CEPB 4MARA 4UBOA 5A05A 3NHAA 3AY3A 2JHCA 3RABA 4OIFA 2BR3A 1T8YA 2FOXA 4BDSA 3T3EA 4ID3A 4C0AC 4EY4A 3VDXA 2COEA 4Z7OB 2VH2A 3RUHA 2WP8J 1KEEA 1YZVA 2BHLA 2OGSA 2GHIA 1A27A 1W94A 1R8QA 3GO4A 4DYDA 2XCRB 4EJ2A 2WIAA 3WHIA 1FNDA 1T10A 3QLUC 3OPXA 4WCFA 2B7CA 3ABQB 1R1DA 2XQKA 1PZGA 2D59A 1Y9ZA 2CE7A 3NBKA 1UAGA 4IQFA 2B61A 4M0EA 3RTGA 4RMJA 1NASA 4RORA 4DV4B 5BMOA 3K0CA 2AVDA 4HQFA 4M9XA 1R8XA 1F4PA 4P7KA 4Q1FA 4LQ4A 4DLYA 4F86A 2I6TA 4C22A 3GGPA 5HG0A 5TLSA 1ESMA 4EA8A 2CLEB 3RK4A 5JMTA 1ZK3A 3QV1A 1IMJA 2EF1A 1GDDA 4RACA 2PH7A 4KMRA 4MPJA 4JI8B 2P9ZA 2Z04A 2A3RA 1KEUA 4I19A 3RC1A 4DMLA 1BMDA 1QHFA 2G04A 5HE9A 1CULC 3UJNA 1P6XA 4GKBA 3NH6A 1U94A 1YXMA 3AR9A 4KSYA 4AJEA 4DV1B 3NETA 5K2OA 4TKVB 1GOTA 3LYUA 4N3NA 5GONB 1KF0A 3OJFA 4LHVA 1IQRA 1AURA 1QC5A 1TFUA 3EWSA 1NBMA 4JUBA 4Q3LA 5K3CA 2FUKA 4B8WA 4E5MA 4WBNA 5JFOA 2PX4A 1NVAA 1DPFA 1Q6ZA 2F17A 3IIKA 4K9RA 3UB3A 1QCYA 1RXEA 4WPGA 5JBQA 2ZYRA 1NVVR 2QTMA 3AJEA 3QPUA 4RPCA 3GEPA 2HUNA 4ZVRA 1T8UA 1L7RA 3AY7A 2JAXA 2XRYA 3DCYA 3JQCA 3G2NA 3ZE8A 3EXG2 3AF3A 4CDNA 4BIIA 3TUJC 1VM6A 2HBYA 1BD3A 3G1UA 1KDPA 2H1VA 3AHIA 4R9VA 3LUPA 3NTVA 4R2KA 4TKUA 4CR8A 2C7GA 3T61A 4H1HA 1JBQA 2I71A 3E4DA 2DKFA 3G8DA 3DLIA 2B2XA 1XMSA 1V39A 3OH8A 1XEXA 2HJHA 2WJ6A 1C0PA 4JZKA 5EJ9A 1J0XO 2RJOA 5EIXA 2FV8A 1LK7A 3LT1A 4R5MA 3T3IA 3O8DA 2HRZA 2X58A 4GMGA 4Y3UA 1V96A 1WZEA 1E7QA 1RJWA 1Y8RA 2FNAA 2POCA 3KUXA 3BMOA 2GZMA 4UUMA 1SU4A 2C2GA 3HSYA 2H9AA 4HXEB 4G63A 4K0KB 1UM9B 5DK4A 1JE1A 2G5CA 1S2MA 3AXTA 2HCTA 1BCSB 2FPXA 2VPIA 4UMVA 1MV5A 1T35A 3EIWA 2BKEA 1R9NA 1YOVA 2EJCA 3E1KA 1K06A 2X9GA 5AI4A 4E5VA 4DG8A 1BXGA 2FPGA 3QYFA 2BFCB 4ALJA 5L3RA 3ZV6A 4HT3B 1UBUS 3T9AA 1Y8RB 1H6DA 3HFSA 3PE4A 4JAVC 2OVBA 2JCSA 2RIPA 1GL9B 1PJRA 4F9EA 2H3EA 2XGOA 4KKVA 3WL8A 3MILA 3M6XA 1YC5A 1YZ3A 2P9CA 3INRA 4V0KA 1LQTA 1WXGA 3WGIA 3QKUA 4BNZA 4RHEA 4REQB 3KSUA 2IPXA 1GGVA 4QX6A 3DOEA 1TQ2A 4UNRA 5JSZA 1SD1A 1NE7A 2J4FA 2NUPB 4KWIA 1IBMB 1GNSA 1ZHOA 1LJ8A 2ONZA 2VCEA 3VSDA 4JVNA 4X7PA 3CJRA 3C43A 1L7DA 3OKPA 2XI4A 1QPZA 4MQ6A 3HRHA 4ZDWA 5KIAA 1BEUB 4PNHA 1XUOA 1V43A 1P0PA 1LPBB 2B8JA 1X1QA 4FU0A 1PN3A 4PPGA 2PNFA 1GP2A 2H1FA 3PP8A 1GYPA 3EPRA 3GPLA 4OV6B 4ALKA 2OXFA 2OL4A 3L84A 3ZKWB 2BTEA 1SUIA 1YQWA 4FNAA 2YZGA 4B82A 2O5EA 4UASA 1LPOA 5K3AA 1U9ZA 4NAVA 4FWIB 1EXMA 3QXGA 2Q6TA 4P38A 1S01A 1ZQ9A 3MBIA 2P6UA 3CN7A 5CA0F 3NWEA 4PCVA 5ICCA 1I4EB 1XGKA 1B93A 1R27A 2JK1A 1ZC3A 5HPYB 4HVTA 2QVBA 3D02A 3T5MA 3K9HA 4JI1B 1LLQA 1M5TA 4ENQA 2WHXA 2YIVX 1W48A 2AG1A 4DWWA 1NX6A 2PO5A 1GGNA 3RS3A 3A1WA 5J63A 2WZCA 1CTQA 2PXAA 1TEHA 4B9AA 5A4JA 1TUBB 4Y0NA 5CJJA 3RO7A 2QTWB 3B8EA 4QYMA 5JJLA 3EVEA 2Z9BA 4V2UA 1P44A 5G0SA 5TVKA 3LWBA 2XV1A 4AFNA 4PAWA 3UPDA 2G4VA 1R0CA 3SX4A 1TX4B 1EE1A 1KAQA 1XCMA 3WLNA 2BAGA 3DMGA 1H4SA 2PQMA 1JILA 3GJSA 1YS9A 4NG5A 1RTKA 1DVRA 3ANTA 1ULUA 2Q5JA 4NH4A 1OYYA 2I65A 1UOPA 4MRSA 2MIIA 4WZBE 2JAQA 4TQGA 3TAXA 1VL1A 3UMRA 1T0HB 1XMVA 4AKHA 2R2GA 3PUIA 4WHMA 5ADHA 5KWSA 4RM2A 3G2KA 3C5EA 4MCIA 1JDPA 4ZQBA 2H07A 3FB1A 2OSVA 3NEAA 3TL6A 1GFIA 2H5JA 3KQTA 5L4LA 1DTSA 2H08A 3DO8A 5HW0A 1Z39A 2B83A 3ACCA 4L72A 1CJVC 3EXIB 2ZRPA 3FNFA 1B3BA 1NE2A 4JMPA 4RHTA 5DPMA 4MS3B 3R7AA 3SJZA 2IGTA 3L05A 3UGQA 4B32A 2OD2A 4ABTA 1H22A 1Q22A 2RKBA 1XQ9A 4NV3A 3ZD6A 1MNQA 1RLTA 3PUHA 1JKIA 3X1WA 4X95A 1B23P 1G5PA 1ZIXA 1I80A 4FYIA 3A0RB 3WNCA 4EQ6B 1EDOA 1J0DA 1NRJB 4YCSA 2GEBA 4AQDA 4HY3A 3MK31 4H16A 4Y0AA 3WB9A 2L18A 5CFNA 5F51A 2EBWA 1YFJA 2WG0A 3MWYW 3Q3VA 4KJXA 1TCUA 5CGQB 3VR5A 1MC5A 4DR7B 1RP7A 4M0MA 4OF4A 2PPLA 5JZBA 1LXCA 2XZLA 1UFRA 2DQZA 4TTJA 1VL2A 3K2QA 1U1EA 2IV7A 3GGSA 3V1UA 2J0UB 4P36A 1YHNA 2Y71A 4HNUA 3LK7A 4BMDA 4FEEA 1WSAA 3ABSB 3RRZA 1UQRA 3JAKA 4PPFA 1YDHA 5COBA 3RUCA 4EYQA 2VQEB 1U63A 4LJKA 4BZPA 1D6JA 1QKIA 5L3ZA 3O4RA 2IPNA 2Q27A 4M9ZA 2F48A 2FY8A 2EVWX 1D5WA 5LLTA 2VZ9A 2IXDA 4HXYA 2ZBFA 1O9GA 2XRZA 3W6ZA 5JQGF 1SXJA 2BF4A 3AF0A 1WULS 4BJ3A 4OQDA 1NFRA 4U7PB 1Z83A 1E6UA 1G42A 3LVRE 5KJ6A 2A9QA 1G8PA 2HHAA 2I6UA 2O8BB 3WLQA 3ZX5A 5IH7A 4ZI7A 4LVOA 4IHJA 3PPIA 4CTJA 5JO9A 1DKOA 3U62A 3NPAA 4CLEA 5CDHA 4FSXA 5F3WB 4XEHA 5FUXA 1M6WA 1T91A 4DANA 1WCXA 5A5EA 2J3LA 2C31A 2C1XA 3C3KA 5JNVA 4Z8YA 1BX0A 3HBAA 4YRCA 1SCNE 2WU3A 1UXKA 4EJMA 1B7GO 5I7WA 2ZULA 4OQMA 1T9DA 1UEXC 1FDSA 1Z4QA 4Q9NA 3PR1A 4ZGWA 3QYJA 4GPTA 1YRHA 2Y67A 4BLSA 4YI3A 1PBNA 3DJYA 3OZ7A 3ZI7A 1Q1BA 2PGXA 2XKJE 1L4MA 1U5AA 2WNIA 1TADA 1MO4A 1PFVA 2YRWA 5GM1A 2OR3A 1MAHA 4CQJA 4EW1A 4C0XA 4PRLA 4F46A 2V7TA 2F43A 2XE8A 1T4CB 3ANSA 1XROA 2AEEA 3IPLA 5G1NA 3EEOA 1OBHA 4Q12A 1WU7A 1TM4E 4NZ9A 5F35A 3GLHA 1GLVA 1TVEA 2PH1A 3A1SA 4IMIB 1TIKA 5JDIA 5DNUA 3ETJA 3R0IA 4XKJA 3U7EB 2CNLA