1P77A

Crystal structure of shikimate dehydrogenase (aroe) from haemophilus influenzae
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
265
Chain Sequence
MDLYAVWGNPIAQSKSPLIQNKLAAQTHQTMEYIAKLGDLDAFEQQLLAFFEEGAKGCNITSPFKERAYQLADEYSQRAKLAEACNTLKKLDDGKLYADNTDGIGLVTDLQRLNWLRPNQHVLILGAGGATKGVLLPLLQAQQNIVLANRTFSKTKELAERFQPYGNIQAVSMDSIPLQTYDLVINATSASVDAEILKLGSAFYDMQYAKGTDTPFIALCKSLGLTNVSDGFGMLVAQAAHSFHLWRGVMPDFVSVYEQLKKAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate 5-dehydrogenase
publication title The crystal structure of shikimate dehydrogenase (AroE) reveals a unique NADPH binding mode
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
total genus 98
structure length 265
sequence length 272
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1p77A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1p77A01
1T4DA 1PEDA 3VVBA 3WTCA 3VH3A 4CLDA 3H9JA 2W4QA 1C1XA 4J91A 1GCUA 2FP4A 4DMMA 1U2DA 3LYLA 4NK5A 5KJFA 2CDAA 2AEMA 4NBVA 4BO7A 1PWZA 1NWCA 2AEJA 2Y05A 3H9GA 5TF4A 4CLRB 3EGOA 3WSWA 1HE2A 3ZNNA 4YRBA 2IRWA 2HMSA 3ZV4A 4UVGA 5DOZA 5DP1A 1HDCA 3AI3A 1ONOA 5K6AA 1DLIA 1LXCA 3WIDA 1MXFA 4JLWA 1LU9A 3SC4A 3H3JA 2B4RO 4TRRA 3ZHXA 3I1JA 4B7XA 2BFOA 3NGXA 4CM4B 4J16A 2B0JA 4PRLA 2J3IA 3AUSA 3OJFA 5JCJA 5L4LA 2FPIA 4RL6A 1NFRA 2VHVA 4J43A 5A04A 4RJTA 3OA2A 1YQXA 1R0LA 2JCYA 2EHDA 3QWFA 1LDYA 5L95A 1E7SA 5TJ9A 4CQLB 3R3SA 3UCFA 5ER9A 1NVGA 1T1RA 3Q9NA 3JQBC 5GZ1A 2Z1NA 1ZXLA 2VTEA 4XEHA 1FDUA 2PR2A 4NNJA 4XCVA 1SOVA 4BV9A 5I9MA 1YB4A 4GSKA 5ILGA 5A1TA 1E3LA 2YV1A 3KOUA 1WNTA 5DDIP 4RVDA 1E7QA 5J23A 4MVJP 3I23A 4FFNA 2GZ3A 4Q3NA 4GX0A 1P45A 4N18A 1I30A 4BUCA 1JU9A 1LDMA 4NJMB 5ICSA 4QSMA 4R1SA 2QG4A 2D59A 1B14A 2WWRA 3PJGA 2RH4A 1K6XA 2YYYA 2VYND 3JTMA 3CPSA 2D3TA 4XDYA 4RDHA 2YY7A 1P31A 4FB5A 1S7CA 4PVCA 3JQ8B 1GEEA 3C7AA 3FSRA 2UYYA 5EERA 5KNLA 3P5SA 2EP7A 3AFMA 3LVFO 3HJAA 1FDVA 1LQTA 1YB1A 4YJHA 3S55A 4DQXA 1LLQA 2WM3A 4RQUA 2NV6A 1RM3A 3P19A 3LC1O 1PZHA 1AHIA 2QQ5A 3D3EA 1ZSNA 4PG6A 5L51A 1YBVA 4YRDA 4GPD1 1IULA 3ROMA 1HSOA 2ZYGA 3JYPA 4PLTA 2Q50A 1E7WA 1NX6A 2ZKLA 4CQMB 1LRKA 1YL6A 1LSSA 5CPFA 3JQ7B 4BKPA 4D46A 4DWVA 2Z95A 3FI9A 3SJUA 1HE4A 4JP3A 3CSDA 5CG1A 2YV2A 2BKAA 4PLFA 1GV1A 3DBLA 4RO0A 1O94A 3ZWWA 1ENYA 3GFBA 3I9OA 1GU7A 1ZK1A 2O4UX 1NBOA 4WOKA 4BNYA 2V6FA 3JQ6A 5DT9A 1N8KA 2HJRA 1QRRA 1YJQA 1JAXA 4FGWA 2IEDA 1HYEA 2BI7A 2UUPA 3ORFA 1IOLA 1YBMA 2POQX 2TMGA 2ZIZA 4CODB 2NVWA 2NACA 3CMMA 4DGSA 1Y6JA 5DCUA 4YPOA 1A9ZA 1B15A 1WDLA 5G0WA 4A27A 3F46A 4GL4A 5JPIA 2OGUA 4OOEA 1PJSA 1PR3A 1E6UA 3D4PA 1WAMA 2XAAA 4DIBA 5AQ1A 1R66A 5KJCA 4B3JA 3F3SA 2P5YA 2DM6A 3WBFA 1ZVMA 2JD2A 3IMFA 3WFIA 1UUFA 2JL1A 2QRKA 4CM6A 3PFWO 4IS3A 4P8RA 4BGVA 4BV8A 4AJ2A 2NNLD 5HA5A 1EMDA 1Y5MA 3X2EA 1ZBQA 4PIVA 2PY6A 4NK4A 3JQAB 3C85A 1EFLA 2CY0A 3LT4A 1T1SA 3VDRA 1ZJZA 3SJ7A 2VOEA 1V0JA 3H5AA 5H82A 3RUFA 3WQSB 3WLEA 1A7KA 1P1KA 1MC5A 5KWEA 1VPDA 1R0SA 4GSLA 4Q3EA 1DRUA 2GLXA 7ADHA 4D42A 1FDWA 2D8AA 2QRJA 4W99A 4BB6A 2J3JA 3QRWA 4O0LA 4QECA 3U4DA 1E0DA 3PVZA 4TRNA 3GZ4A 1KC3A 4EYEA 1HT0A 2HMVA 4UEKA 3IQDB 3L6DA 2YZ7A 1JWBB 3U4CA 2FOIA 4CM1A 3KYCA 1ZFNA 1F14A 4QUKA 1WXDA 2J8ZA 3DAGA 1MG5A 2Y1FA 1SPXA 3KYDB 5K9ZA 3AOEC 3AY3A 1A5ZA 3GF4A 4L73A 1O0SA 3MJVA 1EUZA 1F06A 3HDHA 1YB5A 4BO8A 3MCVA 1JKIA 2DPHA 1GYPA 2VN8A 1I2BA 1UH5A 2W98A 1BDMA 1O9BA 4M1QA 2GASA 2IXAA 1JTVA 4J7XA 4BHTA 4FDAA 3QQPA 5AXDA 6LDHA 3PXXA 3S2FA 1AHHA 2ZYDA 3GQVA 3KSUA 3B6ZA 1OZAA 4PFJA 3EK2A 1EEHA 4R1NA 3VPSA 2VNSA 3GN2A 4E2ZA 3RUIA 3ZZNA 3NJ4A 3IP1A 4L4RA 4WOJA 3TZQA 3WR5A 5L45A 4DLLA 1IL0A 1I33A 3KO8A 4F6CA 2CF6A 2IE0A 3WGGA 1EQ2A 2Q45A 3JD2A 4TMFA 1DC5A 1YXMA 3FPLA 2HJSA 3ICPA 1X15A 3BIOA 3K2EA 3OEWA 1V8BA 1U2GA 4XIJA 2G0TA 2CMDA 4P22A 3ZWAA 4BQRA 4BKQA 4BNVA 5IXSA 4EJMA 2Y1GA 3K92A 3H8VA 2C54A 1EVJA 1QMGA 2OP0A 4YJGB 3K8ZA 4WE3A 3VAZA 4E30A 4L9RA 4BL5A 1P77A 3HDJA 3WNQA 1AXEA 1H6BA 3AM4A 4BGUA 1BWSA 1HDYA 1PSDA 5KVQA 5A02A 4PG4A 1JVSA 2FZEA 3S2IA 1NWHA 3DMTA 4NFSA 3WMWA 4R9SA 2QHXA 1K6IA 1NR7A 2FWMX 1WMBA 2OOSA 1B8PA 3BMNB 4UVDA 4ZGWA 4YRAA 4P38A 3DZFA 4I9UA 3O38A 2X8LA 4IGEA 5CG2A 4WNIA 3ENKA 2J3HA 2O3RA 3FNEA 5JY1A 1BXGB 2EP5A 1M67A 3F1LA 3KSDO 2G1UA 4QEDA 3TPCA 5I8WA 3KVOA 5FI5A 4WEQA 4R9RA 1D7OA 3AM5A 1DOHA 1K89A 1E3WB 1H0KA 3PRJA 4TKMA 5THQA 2WDZA 3FWZA 1O5IA 3CIFA 5DNAA 3GZNB 5HS4A 1HTBA 3PJFA 3KZVA 4UUOA 4ALJA 1T2FA 3GA0A 3JD3A 1BVUA 3EY4A 5L7TA 2Y66A 1O8CA 3A9WA 2EGGA 5COBA 1YWGO 4DQVA 1QYWA 2J5RA 4KWHA 1E7MA 1XSEA 3VZSA 3INGA 4NMHA 5GY7A 3X2FA 3LLSA 5JY6A 1CIVA 4K28A 4KTVE 2WD8A 4NFYA 5EJ2A 2W2KA 2E37A 4Y98A 3K9QO 4OH1A 3HDYA 3HHPA 3Q0EA 1GQYA 4BOYA 4IQGA 1EFKA 1KS9A 3HDQA 2DUWA 9LDTA 4BGEA 3DMYA 1LX6A 3OF2A 1L1FA 3AU9A 2ET6A 1C3VA 3PHIA 1G0NA 5B12A 4D3DA 1HL3A 2YFHA 1YQDA 3IUPA 4CLHA 4EUEA 5TRTA 1KC1A 4CM7A 5G2OA 1JKJA 4MVJM 3PPIA 4ZHSA 2CUKA 5F3RA 3E5MA 3KLMX 1YDWA 9LDBA 4WCFB 3GHYA 4BMNA 4D3SA 1ZSYA 3PZBA 4CMIA 1LC3A 4BNJA 1ZZEA 2NU6A 4OGWA 1SAYA 3OETA 4PLCA 3ZU2A 2OBNA 3GPIA 1GPJA 3NT5A 4FGSA 3PGXA 4NFHA 4Y6SA 1GD1O 1Z6ZA 1PX0A 3GGOA 3K73O 1E5LA 1E92A 1QYDA 4GX2A 5DCYA 1MB4A 4IDAA 1U8FO 5EIOA 4O63O 2OMEA 4IDGA 3NV9A 1PZFA 1PGQA 3H7AA 3I5MA 2W90A 1XIVA 3UCXA 5L7WA 2JHFA 4YR9A 4OXNA 3LF2A 1CEQA 1Z82A 3ZHZA 3VH4A 5F5NA 3I9JA 2OP1A 4AL4A 2ZQZA 1YS4A 3C7CB 4YQZA 4P4GA 1JLLA 1DHTA 2DBZA 4W6ZA 3F6YA 4H7PA 4CR6A 2X86A 4FFMA 1DDOA 3QVOA 4L74A 1U4OA 2Q1WA 4LW8A 3ZN2A 3BMOA 1GPDG 4BNXA 1XR3A 1ADCA 5DULA 1NNUA 3CZMA 1PIWA 2E49A 4RVHA 4YBZA 4BO0A 3V2UA 5CDUA 1QG6A 1V9LA 5L53A 5L40A 2X0IA 1R12A 2DAPA 4DPKA 1ZMTA 3P2OA 1PWXA 1H6DA 1Q7BA 4EITA 1OI7A 1Q2XA 1QORA 4MIEA 3UKOA 4A7PA 5I7FA 3GEMA 4UUNA 2JCVA 4OJNA 1LLDA 4FN4A 5KJ1A 1DBVO 5A03A 4J2HA 4HP8A 1ENOA 4LCJA 4EBFA 5FF9A 4B4WA 2GRAA 2CVOA 3DMTC 5IDYA 2O48X 3ZW8A 2Q46A 1QR6A 3OEYA 1ZK0A 3DHNA 3VPFA 4QX6A 2CDCA 2ZJ1A 2FSSA 1Y8QB 3FTNA 4FPXA 1U3TA 5IAAA 4ND5A 3U09A 1R4NA 1W73A 2DFVA 1GYRA 3L6OO 3RFXA 1VL6A 5B4UA 1BW9A 4R68A 4FCCA 1QV6A 2PWZA 1SCUA 4MIOA 4MKXA 2CZCA 1NHWA 4IJUA 3CEAA 3LK7A 2OO5A 2VYVD 4XQCA 3WJ7A 4J6FA 2X0RA 4ONEA 3EHEA 2F00A 3PK0A 4IDDA 4YJFA 3TZKA 1SEVA 3QVWA 3BMQB 4LN1A 4IJKA 4W7IA 4W9NC 3EDMA 1R4MA 2YUTA 1D1SA 1DC3A 1P0FA 3CKYA 1NASA 1R15A 3IP3A 4FC7A 4KTTE 2ZTUA 4E13A 4ITUA 5IDXA 2NTNA 3SEFA 1JWAB 4Y6RA 3FRJA 4YACA 4ALNA 1KVQA 4CQMD 2PGLA 1HDGO 1E3JA 1T25A 4J0FA 2DLDA 5BT9A 2B37A 3JQGA 3VHRA 2H9IA 2HQ1A 2W2LA 5A4DA 3D4OA 4BVAA 3C8MA 1RYDA 1SMKA 4ZQBA 1LDNA 4EUHA 5JXWA 4U5QA 1UXHA 3JQBA 3D4NA 3WWYA 4BS9A 2C82A 2PNFA 3RUDA 2BFMA 4HXYA 1D8AA 4H16A 3ZU4A 3D3WA 3QWIA 2EERA 2JAHA 3LQFA 4K6CA 1YOVA 4HY3A 3C1AA 4ND4A 1HEUA 3ICCA 4TRMA 2JD0A 2AE1A 3O03A 2ZB8A 1Y8RB 5TQVA 1LRJA 3GPDG 5A5FA 1TT5A 1KEUA 2EW2A 3NKLA 1EE2A 3BTUA 4DBVO 2J5KA 2AA3A 4GLLA 1D1TA 2O2YA 5BSFA 1A4IA 1IB6A 3GDOA 3N74A 4ID9A 4UVEA 5IN5A 4YAKA 5JSFA 4IJWA 1UP4A 2AQ8A 2RH8A 4CUKA 3T7CA 1CDOA 3MTJA 5C5IA 4DREA 1GADO 2UDPA 4DUPA 3T4XA 4JCOA 2FN7A 1PZEA 3EVTA 2DVMA 3U0BA 5JS6A 1EK6A 2JCXA 4BKOA 1J5PA 4OO3A 2DC1A 1XDWA 3JQAD 4E31A 3ZWPA 3DOJA 1DRWA 2C07A 3NRCA 2J5QA 3LT0A 4GX5A 2EF1A 1YRLA 1N9GB 4ZICA 1E3EA 4J0EA 1SOWA 2C2XA 4YT5A 2VNAA 4F46A 1NR1A 1DAPA 4Y9DA 4AFNA 2ZYAA 4CLRA 1U7TA 2G17A 3VKUA 1NVTA 4BNLA 3WG9A 2X5KO 4GQAA 3AW9A 3KHUA 3KEQA 1PTJA 1WDKA 4UAGA 3ADOA 4YT4A 3JSAA 1I3MA 1NAHA 3DZIA 4INAA 1Y81A 4S3MA 1EUCA 4CV1A 4CM4A 5LDHA 1ZEJA 3B20A 3TL2A 2G82A 5JC8A 2Z1MA 3TDKA 2P5UA 2NM0A 4CL3A 5ITWA 4U0KA 4QTZA 1GY8A 1KIFA 1OMOA 1KVSA 3JYLA 4WKGA 3KETA 1B26A 3GFGA 4Q3BA 4CQLA 3OP4A 3DZJA 1XU7A 4LGVA 1LLUA 1C0KA 1C1DB 4D0SA 4HUJA 2OORA 4YEDA 4AJJA 1JKFA 3A28A 1WP4A 2GN9A 3SX2A 5L4NA 4XR4A 1RYEA 4AJHA 1U28A 4LSWA 4B4OA 3UH1A 2NWQA 1Q0QA 5B37A 3GNTA 3GG2A 2GD1O 4NJMA 1T26A 4A03A 3F1KA 2GN6A 4LSMA 1K5HA 4Y8VA 3I9KA 5THKA 4FJ1A 3RKRA 3P7MA 4IDFA 3RUHA 4WCDA 4ZN6A 1HWYA 3ROQA 3WIEA 5T57A 4RGBA 3JQ8A 3RKUA 3OJ0A 2W8ZA 3WYBA 3QHAA 1PQWA 1AXGA 1KY4A 2VYVA 3PFFA 4B4VA 5F1OA 4K6FA 3V2HA 4I5GA 1UP6A 4GWKA 5I7SA 3PGJA 3IIEA 3PYMA 1BDBA 4MVJG 2GF2A 5JDIA 1ONNA 4J1TA 4ZQGA 3LT1A 4PLPA 1Q1NA 2XF8A 2YDXA 3AOEA 2BELA 3S2EA 4BNFA 1LJ8A 3SLGA 1WZIA 4ZQEA 1I8TA 3DFUA 4CQMA 2QX7A 4CUJA 2H1SA 1O6ZA 3JQ7A 4NBUA 1E1MA 2VRCD 4PZDA 4YXFA 5BNIA 1O95A 3C7DB 3IUSA 4R54A 2FZWA 4XB2A 2DTXA 2GSDA 2I3AA 1KOLA 4EEXA 1NAIA 3EW7A 3T7EA 1L7DA 3D0OA 3KV3O 3E1KA 5EINA 3FHLA 4R4JA 3MJ4A 3D5TA 3GMSA 4YYZA 2WE7A 1A4UA 5EQFA 3GDGA 4Z0HO 4ND3A 3VVCA 2FPPA 4PN3A 3K96A 2J3KA 2VQ3A 3BAZA 3KBOA 1I24A 4HNGA 1E3SA 2PLAA 3V2GA 1BTOA 2O7SA 3AK4A 4RZIA 5AYVA 3V1YA 5T67A 2WSBA 2A9FA 1PL6A 3TSCA 3ZV5A 5A06A 4GH5A 2HMWA 2OBYA 1IZ0A 4GMGA 4IIUA 5KIAA 1B8UA 1ISJA 3ADPA 5HM8A 3INTA 2FSVA 5JC1A 3UCEA 2X5JO 5ENDA 1IPEA 3A4VA 3I6QA 2XXBA 4YJDA 2PD6A 1XWFA 2R6JA 3JQEA 5T6BA 1DC6A 4B8ZA 2Y67A 3HB4X 4OSOA 2B35A 4EJ6A 2I5PO 4RLHA 1OBFO 3H9UA 5JMPA 1MC4A 4J1SA 4E5KA 1X14A 4OQZA 5JAZA 5HRUA 3JQAA 2FR1A 5I9LA 1LSUA 1X1EA 3ZHYA 3ZH2A 5KKCA 1KVRA 3RFVA 4MPDA 1N2SA 3UUWA 1KETA 2V65A 4PZEA 5JDCA 3GUCA 3HWRA 2EEZA 1HLDA 1I36A 3RI3A 2WYVA 1DJNA 3WMXA 5I7VA 1Q0HA 3W6UA 1U5CA 4I1IA 1Z7BA 3FNGA 3QLJA 2VUSA 4II2A 5JW6A 1U8XX 1XCBA 4ND1A 2RAFA 3BA1A 3I6IA 3NTOA 3BMCB 2PZLA 3IKVA 3S8MA 3T4EA 5ENVA 2CVZA 4Q39A 1U5AA 2DTDA 4URFA 2I67A 3WLFA 4XIYA 1NFFA 3L4BA 4AJKA 3IL2A 2D5CA 3ITDA 3JQ9C 3KYDA 1OOEA 4TKLA 5H83A 1GAEO 4MKRA 1V3UA 2AEFA 3LC7O 4HFNA 3CUKA 2X0JA 5G0UA 1FXSA 4HX5A 5BNFA 3TOZA 1MFPA 4ZVVA 4I9HA 5C7IO 3RUEA 1LC0A 2EJVA 4WECA 5F1KA 4MVJH 4UEOA 1CQJA 4DLAA 3PQEA 2A94A 4GLOA 3VTZA 4E2WA 4RF2A 3DBVO 1GV0A 3B1JA 4JNKA 4P4NA 2BFAA 1ZK3A 4J4TA 3PZRA 3BTVA 3JQDA 1DXYA 3PHGA 3CZRA 4BGIA 3JYQA 3SVTA 2UUOA 2NADA 3WNVA 3H5NA 2E82A 2YHUA 1XKQA 4BB5A 2CF5A 3MJSA 4FJ2A 2V6GA 4BMSA 2E48A 3RU7A 4B8WA 4ALKA 1UP7A 4NI5A 5F21A 3BTOA 4IZHA 1KY5A 5A9SB 5AXCA 1RM4A 4B79A 1TA4A 5TLSA 1PJLA 3ABIA 4LMPA 4U6QA 1PL7A 2D1YA 2Y1DA 1ZNQO 3E03A 5JDIC 3F9IA 1B7GO 2JD1A 1AGNA 3HFGA 3PI7A 3WSVA 4XQEA 1NVMB 3CH6A 4YJGA 1HDXA 3VZPA 4AJLA 1F8FA 3GNQA 3FNFA 4BNIA 4P4LA 1QYXA 4R3NA 1Z75A 2PZMA 3VTFA 2PV7A 3NDRA 1BGVA 1W0CA 3PJDA 3RWBA 4CV0A 1R16A 4WNCA 1E6EA 4IQ0A 3NX4A 1PJQA 3L6EA 1L7EA 2VZ8A 4E21A 3BMNA 4XD2A 2EJWA 3F5SA 3Q2IA 4IUYA 2PKQO 3SXPA 2QZ9A 1GZ4A 3NTQA 4KDFA 1W4ZA 3PLRA 1UXGA 4G81A 4ESOA 1TT7A 2YJZA 5GMOA 3HG7A 3G79A 1VL0A 4DIFA 1TXGA 4KDEA 3QE3A 5H81A 3PQDA 1QYCA 2VRCA 1IZ9A 4HBGA 4UUPA 5JLAA 2IEBA 3B70A 1E3WA 2B83A 1J0XO 3HUDA 1FF9A 5G4LA 4G65A 4ROSA 4BKRA 4KP7A 3GZNA 2VT3A 1ISMA 4Y6PA 4UUMA 3M1LA 1NTOA 1EZ4A 4O1MA 4O59O 2DFDA 3ENNA 2UAGA 4RQTA 2HRBA 4CM8B 2VYNA 4IDBA 3RJ9A 2ZTVA 1X7HA 3D64A 3VC7A 3WGOA 4CMKA 4Y67A 2UV8A 2X9NA 3LZ6A 4BO3A 4CR8A 1CQIA 3H2SA 2JHGA 3NEPX 1SO8A 2HSDA 5CAEA 5K0ZA 1UAGA 3PQFA 5KVCA 4WLNA 3GVIA 1I2ZA 2X23A 1C0PA 4Z9XA 2AQKA 4L4XA 4OQYA 2FRDA 4RPJA 3DR3A 2X9VA 3KYCB 4PLYA 4BNMA 4FFLA 4YDRA 4AJOA 3PHJA 5A05A 1XQ6A 1ENZA 3E48A 1NYTA 5JDCC 1YQGA 2O3JA 1Z73A 2HAEA 4WUVA 5C7OO 3E8XA 1ID1A 1B2LA 5I8ZA 1GUYA 1UDCA 2H6EA 1K3TA 2GO1A 5EMHA 2NVUB 1NQTA 4M8SA 4BO1A 1LEHA 1G6KA 3GC6A 1PU2A 4WCFA 2IZ1A 3R3JA 4XGKA 4IGFA 1U4SA 2WYUA 5DF1A 5G0TA 3RVDA 5JBIA 3WGIA 3JCZA 3DBHB 1TVEA 2G5CA 3Q1LA 2I6TA 4W9NA 4D45A 2B4TO 4E4YA 2VUUA 3L4BC 3ON5A 1H9AA 4JROA 3W4KA 4IY1A 3RROA 1B3BA 2CD9A 3NTRA 1OC2A 1PJBA 3WJAA 4N5LA 4WPGA 1NXQA 1UXKA 1N92A 2P4HX 3HFSA 5DBIA 1YE3A 4CMHA 1EDOA 2EW8A 4JGBA 3CE6A 3M2TA 1OAAA 2DT5A 2Q3EA 3NJ8A 1AE1A 2B69A 3I52A 4MKZA 4NG5A 1YVEI 1X1TA 2BMAA 4II3A 1HKUA 3GK3A 2X58A 3TZCA 1VKNA 1MLDA 1MFZA 4U7WA 4NJOA 3D7LA 1IPFA 3K6JA 1N1GA 1HYGA 4E0BA 1SNYA 6ADHA 2X1HA 1ONPA 1VSVA 3UF0A 4I5DA 4BNZA 1I10A 1SEPA 4OSPA 3FR7A 4E2XA 4DA9A 3DZBA 2ILTA 4E3ZA 5BSGA 1EK5A 2OZPA 5JO0A 1AUPA 3MWDB 5TGDA 4K1LA 3W4IA 2X7HA 3BYZA 3EVNA 1VI2A 1WWKA 4AJ1A 1ZH8A 2CFCA 2VZ9A 2B5VA 1NQ5A 4FS3A 4AICA 3ZWMA 3ONDA 4EI2A 2YHIB 4FOOA 1NPDA 2BI8A 2DPGA 3WBBA 4TZTA 5A5EA 1IHYA 4DBZA 3GNSA 1VLLA 3ONEA 2V6MA 3IC5A 5T5QA 1E77A 1H2HA 3ZW9A 4CMBA 4D0RA 4ALLA 1LRLA 3QIVA 1I3LA 3LT2A 3AY7A 4NPCA 1Y9AA 2FPGA 1WZEA 1X0VA 3UGKA 1Y8QA 3NDJA 4JJFA 4TQGA 1P1FA 2GYYA 2ZCUA 3MJCA 4H3VA 3VH2A 5TIIA 4FFOA 4YTEA 4E5MA 1SC6A 1Y5RA 5IN4A 3NYWA 1PGPA 3OQ6A 5GZ6A 2GDZA 3FPCA 1HYHA 2O2SA 1KVUA 3WGQA 3AUUA 2FY8A 3OQBA 1ZUD1 3RFTA 3TQHA 5G0SA 4JBGA 3DL2A 4O6VA 2Q1TA 4PG5A 3B1KA 3IOYA 3RCBA 1DSSG 2NUAA 2PH5A 2WMDA 5T64A 1ZEMA 3BMQA 3OECA 1WMAA 4RF3A 3U4IA 4ZQFA 4IXWA 1JAYA 3BXXA 4BMVA 2BLLA 4J4HA 2Q49A 1VL8A 4WEOA 2NTVA 1V3TA 4B7UA 4OYRA 4XYBA 4LVCA 3QW2A 1DHRA 1CETA 1QLHA 2GERA 2I99A 2HCTA 1RWBA 1I2CA 4OMUA 5CPBA 3INRA 4JQCA 3L9WA 4ZRNA 4IJVA 4RPKA 3RU9A 1Q0LA 3VPHA 4CM3A 4FBGA 1T24A 1PR9A 1LLCA 3WYEA 3EMKA 1GEGA 4XJSA 1V35A 1E7RA 2VWPA 1PQPA 2NVBA 2C5AA 3PYLA 4YAIA 3I9MA 3OFSA 3EYWA 3ZU3A 4XZ3A 4JJIA 3OQ1A 4XX0A 3RBZA 3O9ZA 4AVYA 5BR7A 5JCXA 4WCFC 4KUEA 5TC4A 3QA9A 4A26A 2Q2VA 4EGFA 3PWKA 4D3FA 4G2NA 3Q2KA 1UZLA 4NIMA 2O7QA 4QO8A 1K2WA 1Y8RA 3ASVA 5FFFA 4XA8A 4DLBA 3DOCA 1I32A 2PD3A 4ZRMA 3DAFA 2C7VA 2DUUA 2PK3A 1MP0A 3FD8A 1R37A 2E6UX 3CINA 3RC2A 3CTMA 4BNTA 4J4BA 4MINA 4L4SA 2VTDA 2Q1UA 4E5NA 3BMOB 1YDEA 2HO5A 3H9EO 5B4TA 1Y7TA 1WLYA 4GBJA 2HUNA 4FC6A 4Z0PA 3FR8A 2X9GA 3DWFA 3TJRA 4B4UA 5IDQA 4NDNE 2P9EA 1NHGA 2FHSA 4MP6A 4JX8A 1HZJA 3NAQA 4JJGA 4MP3A 3AY6A 4R01A 2FR8A 1N9GA 2WD7B 1DIGA 2EGHA 3TZ6A 4KMSA 4CMEA 1YONA 3PWSA 5IG2A 1UZMA 2CDBA 1GUZA 1U3WA 5KKAA 3ROPA 4BNHA 1VJTA 4XGIA 1QSGA 1ML3A 1NPTO 1DJQA 2HK8A 1E7YA 2JFFA 2X22A 4LISA 3LSYA 2YQ4A 5G4KB 3GT0A 2OFPA 1PJ3A 5F1PA 4N5NA 3QV1A 3MWEB 1PQUA 3IJPA 3KM0A 3MOGA 7MDHA 1ADBA 1MXHA 4BNGA 3H9QA 5DP2A 3BTSA 3V8BA 4RDIA 2BFPA 3ZI0A 5IJZA 1W8DA 3L0DA 4XGNA 3DXFA 4PG8A 4PCVA 3C3XA 4YVFA 3JYOA 1TB4A 4U6SA 2Y0CA 2A35A 3UAGA 1DFHA 3U5TA 1LDGA 2NU7A 1JA9A 4XYEA 2BD0A 1BMDA 2IDZA 4M86A 1N7GA 4OKNA 4RZHA 4TVBA 5IDWA 3WXBA 2JAPA 1ENPA 1P1HA 1PS8A 3JV7A 1ULUA 1C1DA 1HDOA 3KLPX 4B3HA 4E33A 4FFPA 3F4LA 4ND2A 2EKLA 2HMUA 2ZTMA 4CLEA 5FI3A 4DQUA 2XPCA 4IXTA 5GZ3A 3TZHA 5ITVA 1DIAA 4EW6A 1E1LA 4DIOA 4AJEA 4EEZA 4GVXA 1GQQA 3QVTA 1DPGA 3DBRB 4XB1A 4E2YA 4MIYA 3GVHA 1NM5A 3OMLA 1H94A 2PKRA 3TNLA 1SBYA 4Z3KA 5KVSA 4C4OA 2PD4A 1YGYA 3GVCA 3ZWBA 2PFGA 1HDRA 2AXQA 4A2CA 4FFRA 4Z9FA 1MV8A 2J6IA 4XDZA 5CDGA 4XKJA 2OL4A 3AJRA 1GTMA 1PS9A 4N5MA 5IFLA 5JO9A 1XA0A 3R0IA 1N5DA 4RLSA 4KUHA 1F0YA 2Y1OA 3V5NA 1ORRA 4DTIA 3AI1A 3GRKA 4R5MA 4MOWA 1P1RA 5AXBA 1I01A 1U3VA 3K30A 4ZA2A 2VWQA 5HTOA 4A73A 4H15A 3JQ9A 1VRWA 2Y1CA 4XYLA 3GN1A 4IMPA 5COAA 1DO8A 4OIMA 4TZKA 5KJ6A 2GPTA 3FF4A 2Y68A 3MTGA 2IXBA 4ZQHA 3V1TC 3VZQA 3AOGA 5LCXA 1VJ1A 1EE9A 4NBWA 5CDSA 3VKVA 4M89A 4JBHA 1XG5A 3H4VA 3HE3A 1DFGA 4MJLA 4AJPA 2YW9A 1H5QA 4K26A 2ZK7A 3W1VA 1UAYA 1GYQA 3OIFA 5TNXA 1U1IA 1P1IA 3GGGA 2ZB7A 4BNUA 3GOHA 3A14A 2PA3A 2QYTA 3WGYA 5JMWA 4FR5A 5TSDA 4DVJA 1J4AA 3RUAA 2ZATA 1EQUA 3LF1A 2Q4BA 3ZWXA 3QP9A 2B36A 1F8GA 3ZNOA 4CM5A 4MVJD 4MDHA 1NFQA 1CJCA 5MDHA 3QWBA 1FMCA 1T2DA 5FYDA 1V3VA 3BHJA 3ASUA 4RCVA 3Q9UA 2P4QA 1F17A 2R2GA 4LCEA 1ISIA 3R1IA 3RC1A 3HN2A 3WGZA 1PL8A 1WPQA 4MP8A 4IM7A 4G5HA 4RF4A 3RBVA 4BO4A 1HETA 3O8QB 1UJMA 1ZO8A 1ZXBA 3OICA 3WQRA 1Y1PA 3DHYA 4PG7A 2HU2A 4PLWA 4CMEC 2BGKA 2VHYA 2LDXA 1YO6A 4GVLA 2GN4A 5TT0A 2AG8A 3TWOA 1Q7CA 4I5EA 4XJTA 4R69A 1T2EA 2P9GA 1E1KA 1X13A 5FWNA 4HFJA 5ADHA 4QFDA 3Q6IA 4GKBA 4JBIA 3ANLA 3H2ZA 3IS3A 5C7LO 4OL9A 1VM6A 1YKFA 1HF3A 2WTBA 1B3RA 3E6AA 4CUZA 2Y1EA 4WLUA 4XYGA 4A10A 2FR0A 2B5WA 2QW8A 3GG9A 3COSA 3ITKA 1C1XB 1X0XA 4TRJA 4M49A 1NQOA 1IY8A 4WK6A 3DQPA 3RASA 5JYDA 3ZHBA 5I9NA 1ZKMA 3EC7A 4I08A 3GRPA 3GY0A 3TN7A 4IBOA 1HRDA 1J49A 3TRIA 3WOHA 2QRLA 3BMCA 2C7GA 1IHXA 3IJRA 2X5OA 1MUUA 2Y93A 3UXYA 4OOFA 5KVVA 3AI2A 3DB2A 2PTGA 3OM9A 1ZJYA 3UOGA 1JW9B 2P9CA 5ER6A 3FNHA 3RAJA 4GKVA 3MOIA 3D5QA 4XRRA 3RC7A 3QWAA 4HV4A 4LK3A 4YQYA 2O3SA 2P91A 4PLGA 3RSHA 1XGKA 3KYBA 1P1JA 3FBGA 1M66A 1ZK2A 5JYEA 4L0QA 2H63A 1JQBA 1LSOA 2QZZA 3RC9A 5BQFA 1DIRA 2X0NA 3E9NA 2VWGA 2LDBA 4QT0A 3G1TA 4R3WA 4NZ9A 1A27A 3OH8A 1NPYA 5JAMA 5KCZA 3GVPA 4ILKA 2AQHA 3H5RA 3DO5A 4YB8A 3AM3A 1YH3A 1T2AA 3ST7A 1K0UA 1EVZA 1H2BA 1RM5A 3GEGA 2R00A 3F5QA 5JE8A 2VZ0A 3FWNA 4M55A 4NBTA 1CERA 2GN8A 1XELA 3O4RA 3DAPA 2DU8A 3DDNA 4IIVA 1DIHA 5A9SA 1ULSA 4IQ8A 3E9MA 1JDJA 3Q11A 4QQRA 2D5AA 2DTEA 3U3XA 1DRVA 4CMAA 4M87A 3ULKA 1U9JA 3WICA 4KQXA 3ANMA 4N7RA 1M2WA 3L07A 1H93A 2Q99A 4R1UA 3M2PA 2RCYA 1P74A 1QP8A 3VPGA 5L7YA 1ZW1A 2PZJA 4I9NA 1ADFA 2Q2QA 1RJWA 2UVDA 1XEAA 1UR5A 4BQPA 4JIGA 4J9VA 3NT4A 3KRTA 5TT1A 3RD5A 1EBUA 4NU6A 3ZNPA 4YJHB 4DMLA 1QKIA 3EZLA 3WYCA 4HWKA 4J7UA 4UVHA 1PJCA 2RBEA 5L9AA 2H5LA 3DC2A 1HLPA 4WLEA 2CNBA 1KERA 4PLHA 1XHLA 5IZCA 3OBBA 1PGOA 2I3GA 3VDQA 1NP3A 1LNQA 4CM9D 1GZ3A 1HXHA 4J9UE 2FMUA 1DLJA 2D2IA 3E9QA 3QSGA 4OM8A 1BRMA 3LLVA 4UULA 3PTZA 1BHSA 3AWDA 1BVRA 2A92A 1DFIA 5KOIA 1P9LA 3MJTA 4DPLA 3C1OA 1RPNA 1PJTA 3LDHA 1SB9A 2WYWA 3C1TA 3K2BA 3DBLB 4YCAA 4YWJA 3ZV6A 2D4AA 4CM8A 5K6AC 2AHRA 1ZSVA 1C0LA 4W82A 3NUGA 2O3UA 3OSUA 4NR0A 3RJ5A 8ADHA 1DEHA 2WEKA 3QJ5A 4PLZA 3PHLA 3L9XA 4CLXA 3VOSA 4J1NA 3GR6A 5DCWA 3FTPA 4IZIA 4MVJA 2EKQA 2EG9A 1UZNA 2C5EA 2NQ8A 4A0SA 1A71A 3F4BA 1FJHA 2Y0EA 3OJLA 1EVYA 4XWYA 4ALIA 3HADA 4L8VA 3ZCXA 3G3EA 5HWSA 5I7EA 3Q3CA 2A4KA 4CR7A 4PVDA 2ZB3A 2VRBA 5F5LA 4AJ4A 4QO7A 2IZ0A 4CV2A 4QFCA 1BXGA 2BGMA 3FN4A 1HE5A 2NVUA 3WGTA 3DZGA 4AJNA 4U8GA 4KUGA 4EUFA 3GGPA 1ISFA 4LVUA 2GR9A 2JFGA 4E32A 2DBVO 1YL5A 3GEDA 1IE3A 1XYGA 2EIHA 4B7CA 4YAEA 2NU9A 3DBHA 2I65A 1XU9A 4BNNA 2Y99A 2C20A 4ZU3A 3M1AA 1Q7GA 4JK3A 5G0VA 5A3VA 4D44A 1E5QA 2HK7A 4JXKA 1WW8A 3FCOA 4YA6A 2BF7A 3MJEA 1I3NA 4OXYA 4GGOA 4IMRA 1N7HA 2I66A 3K31A 3U9LA 4PZCA 3WTBA 3PP8A 4DL9A 5CFZA 4F6LA 1BXKA 1KVTA 3TFQA 1KEPA 3G17A 3K5PA 4LRTB 3I9NA 3MEQA 4DC0A 1OC4A 2NTJA 1CF2O 4HNHA 5CHEA 3JD4A 1SZJG 1UDBA 2OHXA 4OAQA 2E4AA 2YFQA 3EAGA 3JQFA 3N7UA 4YAJA 5CEJA 1EUDA 3LU1A 4R1TA 1GR0A 2R00C 1TI7A 3I4CA 4J3FA 4IPTA 2C29D 4FD3A 2AW5A 2BGLA 5EN4A 2F1KA 2GZ1A 1M6WA 4E5PA 1T2CA 5TS3A 1WVGA 1KYQA 3ZV3A 1E1NA 1PGNA 3ZWVA 5JAIA 4BO2A 1H6CA 2C2YA 3H3FA 4WASA 3IDSA 2OXIA 2C0CA 3PDUA 4WGGA 3WS7A 2OUIA 1D3AA 3U4HA 2NSDA 3H65A 5ICMA 2RHRA 1LQUA 3DZKA 2YV3A 2YHIA 3SLKA 3WFJA 2CVQA 3UN1A 2I76A 3I9LA 1R6DA 3ETGA 1SB8A 1V6AA 2VCYA 4TSKA 5TX7A 3NT2A 5KTKA 2QYSA 3PWZA 3HQ4O 2V6BA 5DBFA 1FDSA 5U9CA 1XLTA 4KZPA 1IYZA 1I3KA 2W2LD 2ZCVA 4J1QA 5EL0A 1GUFA 5LC1A 1UXIA 3HB5X 5DBGA 1I5RA 4JN6B 4R41A 4RVSA 2P2SA 4Q3DA 4C7JA 4ALMA 4LRSB 3KTDA 1P3DA 3GUYA 3OJOA 3E18A 5IZCC 3NDIA 3ZWNA 4FSHA 3KEOA 5AVOA 4CL8A 4IDEA 5T8KA 3AU8A 3RQSA 4XR9A 3TF5A 1B8VA 2I9PA 3PEFA 1LSJA 1LI4A 1H6AA 3VH1A 3MZ0A 4MVJI 2X4GA 1TLTA 4WJZA 5DZSA 3GVXA 4AG3A 2O50A 4D79A 2Z5LA 3ONFA 4D43A 4F3YA 3NGLA 3W4JA 4J49A 4RPGA 2VOJA 3HNPA 3UVEA 1P33A 1VC2A 3JD0A 1F12A 4CM9A 3PDJA 4Q9NA 4W7HA 3QY9A 4DC1A 1VSUA 4FW8A 5AOVA 4OHUA 1E6WA 3FBTA 3LC2O 5TJHA 5FEUA 3TFOA 3DEYX 2IYOA 2HDHA 1GFSA 3AUTA 4TVOA 1ISGA 3G1UA 4R5HA 1K6JA 1LBEA 4YAGA 3KSZO 3IKTA 1ZCJA 1FK8A 1PJ4A 2DBQA 4A5OA 4FJ0A 1VKOA 3DOOA 3PYXA 1YBAA 4RF5A 1QYVA 3ZNQA 3GH3A 1J6UA 4N54A 3KXDA 5A9RA 5CEEA 5ILOA 4XRGA 1GCOA 5BSHA 4DXHA 3W8FA 2AG5A 4E6PA 4MO2A 4K9DA 2HLPA 2YDYA 2VWHA 3UICA 3KUXA 3U49A 2GUGA 2W2KB 4RVFA 3SBOA 1VE9A 2AMFA 2IODA 4BO6A 5IF3A 1KBZA 1S6YA 4R51A 4U0JA 3CXRA 4GWGA 3BHMA 4UREA 1JN0A 4CPDA 1B16A 4Z3DA 4YT2A 1RM0A 1AN9A 5CEFA 1B0AA 1W6UA 2VUTA 3AFNA 2VHWA 1C14A 1QLJA 2BH9A 4L75A 1BXZA 3W6ZA 4KOAA 2RHCA 4TWRA 3HSKA 1JVBA 3G49A 3DZHA 3GMDA 3C24A 5DN9A 5L3ZA 4NU5A 4Q3CA 3L77A 4CMIB 5MGBA 3JQCA 5ES3A 3RUCA 2GCGA 4FOSA 2GNAA 3R6DA 5JAQA 3W8DA 3PLNA 3EUWA 1U7HA 2VHXA 5EQDA 2HKIA 4NHEA 1M76A 1Z74A 4GMFA 4TROA 2Q1SA 3JQFC 1KEVA 4LMRA 1PJ2A 4IDCA 4GX1A 3EZYA 1KEWA 3BZUA 3VPXA 4B3IA 4NH4A 5B4VA 3S2GA 5IXYA 4J7CA 2WD7A 4HFMA 5CP8A 1ZIDA 4ZJUA 2P68A 1T4BA 4IS2A 1YL7A 2NQTA 3WX0A 3HZZA 1Z45A 5EESA 1EDZA 4KWIA 1I0ZA 3DONA 1ADGA 2IZZA 3D1LA 3M6IA 4KQWA 4RPLA 4RVUA 5IZ4A 1X7GA 1TEHA 3TOXA 5G4KA 4XYMA 4WLVA 1GL3A 3S1LA 4DPMA 4M54A 2WE8A 3A06A 2YQ5A 4NBRA 4PRKA 5U1PA 4PLVA 3OHSX 2B4QA 4L76A 4BIIA 4J2OA 2Q2WA 1DAOA 1M6HA 3ETEA 2O23A 2PGJA 3WQQA 4WLOA 4CLOA 3PJEA 2DKNA 3GLQA 4GAEA 4FQ8A 4YT8A 1HSZA 4AJIA 3UFXA 1FDTA 3SC6A 4R16A 5B1YA 4FIZA 3ZWYA 5JCJD 1R0KA 3WGHA 3OA0A 1LUAA 1VJ0A 4RVGA 1MG0A 3H6KA 3E82A 3RIHA 4HFRA 1Z7EA 5C37A 4D41A 1UXJA 3F47A 2SCUA 2G76A 3W8EA 1A72A 4E12A 2D0IA 1RKXA 2DBRA 1A7AA 3O26A 5T8KC 3RBXA 8LDHA 4DYDA 1DIBA 1Y9EA 1ZMOA 2HMTA 1N1EA 2HK9A 1QXSA 4ZD6A 3P2YA 4C7KA 3VZRA 3ZWCA 3I3OA 3DBRA 4HKTA 2DQ4A 4Q3AA 1GZ6A 2BRUA 1G1AA 1PGJA 4PGFA 3ZDFA 1LTHR 1PZGA 2JFHA 2RIRA 1OFGA 5BNTA 3L4SO 1R4NB 4OXKA 4MVJE 4BO5A 4WLFA 5A3JA 1LDBA 3DTYA 1EVIA 1BW9B 1YJ8A 2EXXA 2PKQP 2WJPA 4EJ0A 2CSUA 1LA2A 2JKVA 4HADA 4EZBA 2EV9A 1ISHA 4S1VA 4CJXA 2ZJ0A 2C59A 4CV3A 4GI2A 5L4SA 4X54A 1MA0A 3ANNA 4Z9YA 4I8XA 3I4FA 1XQ1A 4YJFB 3STHA 3OJEA 4BNWA 1MX3A 3WWZA 4Z6KA 3OIDA 1QV7A 1R4MB 2BHLA 2ZB4A 3ZWOA 3QWHA 4UVIA 2NU8A 5CDTA 2GGSA 4XQ9A 5COQA 5C3MA 2X6TA 3OIGA 1HDZA 4I5FA 4QXMA 3GHHA 4MVJF 3ETDA 3GAFA 3PIIA 3E5RA 3QVXA 2PGDA 3BHIA 4DYVA 3JQGB 2EKPA 1U3UA 5A9TA 3ROKA 2AE2A 3CMCO 5BSEA 4CMCA 1NQAO 2XXJA 3ZGYA 1CRWG 1BSVA 3ZU5A 5DOVA 1ZK4A 3G0OA 4RV9A 1P0CA 3GAZA 5AXAA 3DFZA 2HRZA 3JD1A 4XQGA 4BNKA 2ZQYA 3WDSA 1H9BA 4NQZA 2TMDA 3AUAA 1D4FA 2O3TA 1HZZA 2GZ2A 3B1FA 5HBRA 1IUKA 3PIDA 1DB3A 3I83A 5KJEA 5U4QA 1LDEA 3GDFA 3IAHA 3D3WB 4IINA 4D7AA 1YOVB 2AQIA 3JYNA 1A9YA 3HN7A 3N58A 4JP2A 2QIOA 1CWUA 2XOXA 2PZKA 2Y0DA 3KB6A 4W4TA 2EWMA 5EPOA 4CMGA 1ARZA 3UW3A 5LDGA 1P44A 4EDFA 1X7DA 2PH3A 2JJYA 2V7PA 3DHEA 1TT5B 1BG6A 5HS6A 2NLOA 3O8QA 4Z0TA 1EBFA 3A1NA 4CLOB 2O3QA 1G0OA 2O4CA 5CDYA 3DTTA 1UDAA 2Q4EA 3UHAA 4UEJA 3QVSA 4GGPA 3TL3A 3U62A 2VT2A 1HE3A 1WDMA 1C0IA 1E3IA 4OKIA 1M75A 4F45A 4RORA 1MGOA 1CYDA 1GDHA 3WB9A 2IYPA 1DC4A 5JNLA 4E5YA 4J90A 4RPHA 4O5OA 1GQ2A 3PHHA 4CMJA 2VHZA 2ZTLA 4BO9A 1PS0A 4BKUA 3V1UA 5JFOA 4DRYA 1O89A
chains in the Genus database with same CATH superfamily
3J7AC 4D92A 4I4IA 1T91A 3D2LA 4UXHA 3SYRA 5M2QA 1QANA 1UKEA 4Y2SA 4CLDA 3CWCA 3EZ7A 4IO0A 4GMDA 3EDRA 2CNDA 3PIRA 3QVKA 5FHRA 2MJLA 4F9EA 3L1IA 4JJ4A 3LYLA 4DMMA 5KJFA 4I0WB 4DHEA 1IXZA 2BVNA 2HCRA 4JB2A 1QWSA 1PWZA 1JDVA 4NBVA 4BO7A 4PRZA 1CRZA 2Y05A 3NTXA 4DZTA 1LFDB 1FP7A 1ESNA 8OHMA 1J1UA 3NHJA 4MW0A 3CVYA 3GLHE 3H1BA 5KYXA 4LECA 3HI4A 4HXGA 5LQUA 1DS6A 1C5KA 2EKZA 3GU3A 2A7QA 1YMQA 4XUEA 3SDSA 3QKRB 4X7RA 2CD7A 1Y3AA 4MPJA 2VDNB 2XGSA 2NXCA 5LBIA 4M6WA 3Q3GE 2HF2A 1GAJA 3WQHA 3W6NA 1MEOA 4B7XA 3I2JA 5FR1A 2B0JA 4PRLA 2EQ5A 2J3IA 3EY9A 4QUAA 1PLKA 3SMQA 1TVMA 2PE5A 3DHVA 1QOZA 2RGUA 3GX1A 4J43A 4Y2JA 4IIJF 3ZJUA 4XW2A 2YRWA 1RD4A 2F3SA 4U2FA 4XVQA 5EYPA 4MVCA 2CNKA 2MINA 1BE6A 1RZ3A 3TGPA 1JHQA 1NVWQ 3VVMA 2XVXA 3OZVA 1E7SA 2VIIA 1O96A 3GJRA 2ACWA 4CQLB 5LP6B 3UMFA 4DUGD 3JQBC 1RTKA 5GZ1A 4KMOA 4XEHA 2XUFA 1SZPA 3CLVA 2F3UA 4IKOA 3ZZTA 2PR2A 3DXZA 4XCVA 1SOVA 4U9HS 5HDQA 5EJIA 4O2LA 4BV9A 2WP8J 1GT6A 1YB4A 1V7ZA 1GFIA 3N2EA 3O4HA 4XM2A 3SR0A 4CKZA 1CUWA 1YZVA 1E3LA 2B92A 4GBMA 1AXRA 4OGFA 1T15A 2JK1A 4A8TA 1WNTA 2DT8A 3EFBA 5DDIP 5DHFA 4ZYVA 2UYCA 4QNRA 1OAOA 1ESZA 1M6VB 2GZ3A 2ZJ7A 2KJQA 4LTMA 2OHHA 1ULHA 1YB2A 3QKTA 4DV4B 4MWDA 3M6LA 4BGDA 4DQLA 1LDMA 1O5OA 2BV3A 2I91A 1OXVA 2D59A 1B14A 1MR3F 3TZBA 3PJGA 2RH4A 4AG5A 5AI5A 3AUJB 3ZE0B 3WRXC 5JZBA 4HNVA 3CZ4A 3AM1A 2P62A 1DAMA 1U2TA 1YI8A 4RDHA 4RJJA 1C3OB 2YY7A 2QT1A 4MW1A 5AW6A 1EUYA 3JQ8B 4B82A 1ACMA 2CXTA 4F38A 2WWFA 2BFFA 2EP7A 3TLBA 5BSRA 1XJCA 1H65A 4TLCA 2HT6A 1TQ4A 4JSRA 3E4DA 4Q47A 3U6KA 3N2KB 1YB1A 3RF6A 4DQXA 1P29A 5CBPB 2QD5A 4GNRA 1SUAA 4RQUA 3HLKA 2NV6A 3FX2A 1M5TA 2W6JD 3LC1O 3AF5A 2QQ5A 1PTKA 3OZXA 1GVNB 4YI5A 4PG6A 4ICIA 2WIFA 4WNAA 4HEA6 1E9EA 4M37A 1IULA 2AOWA 4NH0A 1KSJA 1HSOA 4RETA 1UC9A 1V4VA 2Q9UA 4MKHA 3Q8MA 4FUTA 4IGIA 4DLZA 1FMTA 1LSSA 4JB0A 3SQLA 1R8XA 2BDEA 3H8SA 3C4JA 3HZOA 4D46A 4F4UA 2ES4A 1JPNA 5LIRA 4RZ3A 4M21A 3VO1A 1R0CA 3OM0A 3K72B 3SJUA 4DNFA 1HE4A 4JP3A 1V95A 1Z8HA 2AS0A 1KDTA 2JFNA 4NOKA 1L8OA 1D4ZA 4KX3A 4QGAA 2DUMA 1AMOA 5KC8A 4F5EA 5CYGA 5CG1A 4IOJA 1TMGE 1ZD4A 5DTEA 2JLAA 3HFRA 2PT6A 2XUOA 1ENYA 2O19A 4IILA 1QB7A 3M9XA 3E2MA 3A04A 3GFBA 1VGVA 2O4UX 1NBOA 1OX6A 4KYTA 4RA9B 3JQ6A 1GIAA 1JFSA 4E1VA 2EYUA 2YS6A 4CCWA 2BI7A 3IQZA 4E03A 5ULLA 2V9CA 3ORFA 4KE8A 1XDUA 4TV9F 2XD4A 4AS3A 1YBMA 4Z7OB 2C77A 4ON9A 4GMKA 4A8HA 4X65B 1X3SA 5CGQB 3HCPA 1PUXA 1B15A 1VJCA 2XTMA 3BC1A 3C48A 3O4FA 2ZWVA 3LZCA 3S81A 5TARA 1E4VA 3F46A 9ATCA 1IY0A 4I1PA 1L5OA 1PJSA 4UOEA 2CJXA 1CCWA 4DIBA 2QRVA 5AQ1A 4O3MA 1L4NA 2O05A 3R4CA 4B3JA 1EGQA 3CNHA 3I30X 2O8BB 1U28C 2PJUA 4PC6A 5EE9A 3RRJA 4M9UA 5K3AA 4IWNA 3VFDA 1LQ2A 2XB8A 4J8PA 4ZVUA 1LW6E 1P60A 2B7LA 1MEEA 2JD2A 2OCPA 3GYGA 4FBLA 2JL1A 3PFWO 2VC2B 4EVSA 4NZNA 3EQ6A 1C8LA 1H2FA 3FCEA 4NENB 1ZBQA 3FYUB 2C8VA 1QIDA 1WLSA 1GCAA 2LNDA 3MRVA 2O2ZA 3UKDA 3H2BA 2C4HA 4F85A 4H08A 1VFPA 2VOEA 2YICA 3DKKA 3W9YA 4MW9A 5CTJA 3OIVA 2XE6A 1H23A 4R8RA 5F35A 5H82A 1X1RA 1EPUA 2C98A 5HK8A 3WLEA 3WQSB 4D6XA 2CLOB 3IYLW 1MC5A 1VPDA 1KYZA 3COYA 1DRUA 1W76A 3EMVA 1OYVA 3HRKA 1AVTA 2I4IA 3LBNA 2G6TA 1MOPA 3FUUA 3QRWA 1SGWA 2ID4A 4O0LA 2OHVA 4X5OA 4QECA 1F2TA 1E0DA 3IQHX 2C2BA 3F6RA 3G9QA 3MELA 4HDNB 2H2AA 1PDWA 3IQDB 1JIVA 2YZ7A 1WG8A 2WWTA 1IVSA 1PFGA 3KYCA 4A9AA 2HDNB 3AG5A 1LPMA 3O8RA 3REQB 2QAJA 1MG5A 1XQYA 4O2AF 4HGPA 4WNYA 5ALJA 4Q4JA 2FZKA 4YV0A 2Q4RA 4MA0A 4V38A 4C43A 4ZVPA 4EF5A 3PV0A 2QP3A 3RB8A 3MJVA 4LHXA 2B8NA 2QSYA 2C94A 3SJAA 1HT3A 1NSTA 5FOVA 4GM0A 4Y2QA 1BDJA 4D9NA 1MH9A 1YULA 1V8DA 2JIQA 2GEUA 1XPJA 3EEFA 3L46A 5F64A 1IOZA 4ZO9A 3E9ZA 4QPCA 4BHTA 3E4CA 3GD5A 4NBNA 5LVAA 1XPUA 1Q12A 2EZTA 1RKUA 1AHHA 2ZYDA 4PFJA 3EK2A 4R1NA 3GBSA 1ZAYA 3OCUA 3N07A 3RUIA 1RT9A 2DR3A 1Q11A 2GPAA 2RK3A 2XE8A 3VOBA 3KX2A 4DG9A 3UY4A 4MLDA 3IP1A 4DV6B 3LGAA 4DLLA 3AEXA 4MA5A 3AILA 5KTNA 3WGGA 3NHYA 1F7UA 2Q0SA 5JU6A 2B7CA 1O9GA 3LPCA 1HE1C 3FPLA 4HYEA 1NLMA 5IJWA 3BIOA 1CVLA 1UT5A 2KI5A 3OEWA 1EB9A 5EMJA 5JCXA 1J8FA 4LXYA 2G0TA 1JHYA 3STWA 3I5UA 3DVSX 4HJXA 3EVCA 3GJ6A 3K92A 3H8VA 5EHGA 1ULBA 2C54A 5DK6A 4B76A 1CQXA 4OBEA 3K8ZA 4WE3A 4DVGA 1V6CA 3B5IA 1XC7A 5CA1F 4BL5A 4R2WA 1P77A 3EZ6A 3CG0A 1I7LA 1H6BA 3QF4A 3T94A 3BSSA 4GM1A 3WOVA 5KVQA 3KSBC 4PG4A 4C4YA 221PA 3R20A 1Z8DA 2EFDB 3V8MA 4EHIA 3GEBA 4CN9A 3K35A 1ZM4A 1E99A 3DCIA 5JT1A 2YNMD 4NFSA 1UMDA 2QX6A 4KH0A 4UDOA 2WYIA 1N6LA 4KPUA 5ARBA 3D7MA 5BOVA 1XD9A 4EMTA 3UMBA 3SQNA 1EWKA 5IT9A 3MN1A 4AMGA 4JKOA 2BGJA 3OUZA 4DHWA 3Q10A 4OB8A 2IEYA 3TYXA 3PC8A 1JFTA 1H2YA 1S2GA 3AESA 4P38A 2PWPA 3IHLA 4ZARA 3V1MA 4BV3A 1XNQB 2D0PB 2VDJA 3ZGVA 3X43A 1X7YA 2P9YA 4B6JA 5FWXA 4EJ2A 4PO9A 2NZWA 2ATIA 4EHBA 3KSDO 2G1UA 1RFGE 3UMMA 3AI7A 3HM2A 3GFRA 3KVOA 1WB5A 2FTKE 3AM5A 4KG7A 1K89A 4FE3A 2O1EA 1QAMA 3E2IA 5THQA 1O5IA 4BC0A 1NUQA 5JATA 3PPWA 5DNAA 2A0UA 3GZNB 5HS4A 1EGHA 3UJ9A 3SEAA 3L04A 3ANTA 3RTAA 3RYIB 1SWWA 1HM5A 1T2FA 3IVMA 1BVUA 3PFHA 4ALJA 5JNWA 1EM6A 1O8CA 1WCIB 3RHFA 2EGGA 1TJ4A 1RWNA 3DE4X 1YWGO 3ESZA 3NQ41 4RNCA 4Q9IA 2J5RA 4ZEXA 4XM1A 1SBZA 3ZQ4A 1Q22A 1E7MA 3MERA 5K8TA 5U4XA 4EYGA 3GLHA 4X63A 3B3FA 3O47A 3X2FA 4QEKA 1NI4B 2H1RA 3ZDZB 3V2IA 1GZ7A 4QYXA 3JY6A 2VLBA 3QFTA 1EWRA 4NFYA 2W2KA 5IAJA 3ZR4B 3KZMA 4B4KA 2I7XA 3K9QO 2JFPA 2OUKA 4DJ5X 4I9GA 3Q0EA 2F17A 5A4AA 4BOYA 2AD5A 2WHQA 1N7JA 4IQGA 5FLYA 4W5TA 2PG3A 2G0AA 3ZD8A 4HDSB 4PYJA 2WWVD 4BGEA 3DMYA 5JASA 1KFEB 1L1FA 3SSOA 4NATA 1G0NA 4DV3B 4G5SA 4EARA 2Y1XA 1A1VA 1QU3A 5BXYA 5CFRA 4DLUA 1QHHA 2NO7A 4HNTA 4EUEA 2JRLA 4FEGA 1KC1A 4MARA 3F3YA 5AK5A 4ZVNA 5G2OA 1X7ZB 4GE0A 2VJMB 4DYHA 4ZHSA 2CUKA 2SKCA 1ST3A 3OQIB 1GXSA 3I2FA 4X6UA 1T29A 1E2LA 3GHYA 2X8WA 4LBWA 5BRNA 2BEVB 4BMNA 4RHEA 3RYHA 4BNJA 1ZZEA 3KOXA 2EHJA 1C9EA 2GETA 5BV2P 3E7PA 5IAKA 5HUQA 3GELA 1JAIA 3OPYB 4BFUA 4FGSA 3F5MA 1GD1O 5C8YB 5F2EA 1E5LA 1E92A 4PFSA 1U2RA 4QTTB 5ELLA 2J85A 1QHGA 3EQ8A 1Q15A 2LV8A 4OD0A 1MB4A 2M2IA 4WFJA 1OFHA 4N76A 4O63O 2ZSJA 4OQ4A 2TSYB 1XTZA 2X9LA 3D7NA 4WZAB 3THOA 3LGXA 2RGNA 2ZR8A 3M6WA 1D2NA 3CHYA 4I19A 4MMXB 3U1BA 1E2UA 3I5MA 4OLJA 4PGHA 5GOZA 3R23A 5JISA 3J81A 1F0PA 1JF8A 1N57A 1P5HA 4YR9A 2CN1A 3LF2A 3UWSA 3ZHZA 1P2SA 1FFCA 3DGFC 1CR2A 1Z2NX 2C8JA 3W5JA 3I9JA 5IFKA 2Q9AA 1SHJA 2YCLA 3GJXC 1T9KA 3HA5A 3KQQA 4A2QA 4AXBA 1AKVA 1K9VF 2ZQZA 1ESMA 5GOTA 2C1XA 3U7EB 3MD9A 1DAKA 2WYHA 4KB5A 5J4KA 3HLYA 2DBZA 3NTLA 4JOCA 1L5MA 1Z4MA 4C6HA 4YP1A 1OT5A 4YPFA 4A3SA 1SC4A 2GJAA 3PICA 3SIPA 4CR6A 3RYCA 1E9RA 4FFMA 2B78A 1MAHA 4L74A 2IP4A 2G1KA 5DEIA 1DTSA 4G1EB 4PXAA 1SQFA 3RNOA 3QLVC 2BR4A 4JUFA 5EKDA 3BMOA 3SNHA 2D13A 3DNFA 4PZ9A 3PFKA 3WKAA 4BNXA 4HXEB 4PWZA 1J22A 4GOKA 1Z25A 1LTQA 4P33A 5KQMA 2F8TA 2PU5A 2CMFA 2E49A 4OHFA 2C5FA 2G06A 4WK2B 1F8UA 1KO5A 2BMDA 2QW0X 2CFIA 2UZIR 3THYB 5L40A 1R12A 2DAPA 4ZC1A 2F43A 4DMCA 1E1DA 1U6IA 1XTTA 1DARA 2X3UA 1V48A 1JA1A 1OI7A 1Q2XA 2BKEA 3EJWA 2A1UA 4MIEA 4XLTA 1YUMA 3FNBA 3KQMA 1CJMA 2F3RA 4DB4A 4FN4A 4DCSA 1EX9A 5A03A 4HP8A 1TM1E 4NICA 3H42B 4MUKA 2PKYX 3LUCA 5FF9A 4W5QA 2GRAA 3CS3A 3QVGB 1XJ5A 1RU3A 4QJBA 4UM5A 3OUTA 3LUHA 4W1PA 2Q46A 1YZNA 4NMWA 4IZOA 1T1IA 3O3OB 4YRCA 5FPHA 2F55A 1CKEA 1LZKA 2LIPA 1EAYA 2GJSA 3FPSA 3M4NA 4C14A 1DBPA 5ICFA 1A1SA 3CNBA 2FFRA 4HG2A 5KPDA 4ARIA 3QITA 3KJHA 2IS6A 1Y8QB 4XFDA 5JJKA 5B3JA 2PS1A 1U3TA 3WAKA 5AESA 3VR2D 2BGNA 4K8RB 1R4NA 2DFVA 3WO0A 3K5HA 4WN9A 1E60A 1VL6A 4RM3A 1T8YA 4UNNA 3W7AA 1KGSA 4IUCS 2I6FA 2PWZA 3CW8X 4GPEA 4MIOA 4X6YA 1W85A 4MKXA 2IDKA 5EUBA 5H70A 3H11B 2G8NA 3DG9A 2D54A 5KTPA 2YNMA 3LK7A 1YRYE 2VYVD 2XV1A 1G8KA 1J7JA 3QH4A 2GWRA 2OESA 5MN5A 2OG1A 3V80A 1I7DA 1ZCFA 3EHEA 2LPMA 1SIUA 2OC4A 4E4TA 5AO9A 1Y6RA 4IDDA 3QVWA 5H4GA 3T4UA 4K05A 4L6IA 1R4MA 2YUTA 4AYXA 2Q2OA 4NYIQ 1L7PA 1NASA 1PNQA 1R15A 2FUKA 3PNLA 4KNVA 3DL4A 4ITUA 2JGDA 3D0KA 4RY9A 2GCOB 1E5DA 1VHLA 2FRXA 3GJYA 4CGZA 1QH9A 5K03A 4HTAA 1RJGA 2FWRA 1KVQA 1XOIA 2OO7A 4F5WA 5IHXA 1RADA 2Q4TA 1HDGO 2GPWA 1E3JA 1HDEA 1ZU5A 2YIVX 3TNJA 1PZNA 4N49A 2HQ1A 1ODTC 4EMBA 5J43A 5A4DA 5C0OE 3LI2A 5LQRA 3AB7A 3FZNA 1LW7A 1T34A 3CEMA 2RAUA 3PT9A 4ZQBA 1LDNA 3AONB 1QG0A 4NSNA 4OB7A 4NCAA 2OZLA 4U5QA 3GUVA 2FNAA 4TYWA 1P3Y1 3WWYA 4TLEA 3W5CA 4DR1B 1NR5A 2PNFA 2JGMA 1WQ1R 4AKHA 5HFJA 4WK0B 1DAFA 5G02A 2QORA 1TLLA 1ZAKA 4BEBA 1KI3A 2WW8A 3ZU4A 4XUCA 3D3WA 2JAHA 4CNQA 2WUVA 3BE5A 4K6CA 1YOVA 4HY3A 4ND4A 5E9WA 5AVWA 3BT7A 5ESXA 2QENA 3ICCA 4J7AA 4TRMA 2G4VA 4NBLA 2Z5GA 4BJHB 1E2MA 3NIDB 2ZB8A 1Y8RB 2GH1A 2FA9A 4AIIA 1HQDA 5A5FA 1GG9A 3OMWA 1TKBA 4HH3C 3JRXA 3KEFA 5HF9A 2MYPA 1XZIA 2Q4DA 5E1MA 2EW2A 5BUQA 4YCCA 4QASA 2JFXA 4EFMA 1EE2A 3A31A 4G86A 4XVRA 2J5KA 4DBVO 4DE5A 2O2YA 2ODPA 2VXBA 3GDOA 4YAKA 5JSFA 2NUPB 2PUVA 4UVEA 3O75A 2ZDHA 3OU6A 4IJWA 4GXNA 1SXJC 3ZV7A 3OZEA 1CDOA 3T7CA 2HYIC 4DREA 3I9V1 1TZCA 2L17A 3UK7A 4F5DA 1VE3A 1P9RA 3T4XA 2YWBA 2HJ9A 4Z5XA 2G70A 3WHLA 4TQAA 4IR7A 2JCXA 4LYYA 4QRHA 2XUQA 1A8QA 4E31A 2YX1A 1T4CB 1CUAA 2WVGA 3NRCA 4KCGA 1QLWA 3HR8A 1UWKA 2UYQA 3LT0A 1LB1B 1IC6A 2V0GA 3W6PA 1N9GB 2HLHA 3NALA 2P1ZA 4J0EA 1UWVA 2N42A 2PT7A 2JDID 4V1CA 4UKDA 3CE9A 4YT5A 2V54A 1YMUA 5IYZA 1P0QA 4P9NA 1AOXA 2ZR9A 3SHWA 1DCTA 4F46A 1NR1A 5JFTA 2GCNA 1XUOA 2GO7A 3QEMB 5KYWB 1G60A 4CLRA 5F33A 3KQYA 1CEEA 3I2YX 2X5KO 2OV6A 5LA6A 3HK2A 2B9VA 4GIBA 3MLEA 4JI1B 4XVCA 5B58C 1VLVA 3TX2A 4ARCA 3KHUA 2I3DA 5LJIA 1PTJA 1P18A 1Y9ZA 4BQFA 4YT4A 3Q5EA 3ERCA 2QPTA 3HNRA 1SOUA 1TA0A 2IWHA 5CK5A 3TVDA 1K3FA 5AKZA 4M76B 3C3YA 3LSTA 4CM4A 3ZJVA 1B74A 4MRMB 5EGNA 3TL2A 5JC8A 4RFSB 3UAXA 1T36A 5HE8A 5L3SB 3ZDBA 2GCEA 4QTZA 2AUTA 1M2VA 2BTOA 4U2KA 2AI2A 3H9CA 1SHTX 1XL0A 3B78A 3OD1A 3ZY4A 3KETA 5LLSA 1CUFA 4Q3BA 4UBLA 5CM9C 1OJ7A 1NXOA 3LXUX 3DZJA 3U26A 4LGVA 1J1IA 2CEKA 1C1DB 2FJ0A 5JSZA 4HUJA 2V7XA 4M1YA 5K8VA 3AVXA 3OIUA 1U0EA 1J24A 3CKLA 3NM5A 4G1MB 3ZZUA 1OA0A 2FCRA 2OB1A 3N8GA 4OEHA 2AOXA 4MQ6A 1KE2A 4RHYA 3DE7X 4NV0A 3SX2A 4AJHA 5JYCA 3GDWA 4DLWA 2DLCX 3DBIA 4XLZA 3O4JA 1JG6A 3LQYA 4JVLA 3PNMA 5JNRA 1YDMA 4F5ZA 1IY2A 1I4LD 1TYZA 1W9MA 3GNTA 3U6BA 5BR8B 1JQAA 2GD1O 1X7XB 4BEWA 3TAUA 4YHBA 2GN6A 1KJJA 2DFNA 3VR2A 1JT9A 4CYMA 3ZVKA 1KIAA 4AZ0A 3LAWA 1C81A 4HAXA 4V24A 2G04A 3P7MA 3RKRA 4OXXA 3ZBPA 1N34B 1W5TA 4BX0A 1HWYA 5CGZA 4BQSA 4IDQA 1X74A 3SE7A 1YZKA 1YU6A 5DXJA 2HXGA 3RKUA 3O4VA 2W8ZA 3U3MA 2PIAA 3QHAA 2W2XA 4CNBA 1PQWA 2BHTA 2OD2A 2DWCA 2VYVA 3PFFA 5EIEA 1UMKA 1JIQA 4I5GA 3V2HA 5LQKA 3IBFA 2VPZA 1SCIA 1YQUA 3FWYA 3ESDA 3PNSA 4JV5B 4KO1S 5FJIA 2GF2A 3ECCA 2BGGA 1HNWB 5LMZA 1UKZA 4OKSA 1RAHA 5FPTA 3ROGA 3LT1A 4DG8A 3EIHA 4ZDIA 3WZLA 1KQPA 1KU6A 3G9TA 4G5RA 4UCXA 2XUHA 4TLMB 1O6CA 2J87A 1HV8A 1WZIA 2FR8C 3JQPA 1L7OA 1VXRA 4WGFA 2OFFA 3IUQA 2QTZA 1VPLA 1W1UA 1KDYA 2H1SA 4EVQA 1NVKA 3JQ7A 4NBUA 3B9RA 1E1MA 4K6MA 4EHHA 1V3QE 5BNIA 2VPWA 3C7DB 4B43A 2JVJA 1AX9A 4KYVA 1KYTA 4XB2A 4EB8A 3E3LA 4ZT7A 5HNKA 2QTMA 1L7VC 3EW7A 3VO8A 1L7DA 3D0OA 5EINA 2FW1A 2YVLA 4C08A 3CLSD 4R4JA 1C7FA 3MJ4A 3GMSA 2WE7A 2CLKB 1NMYA 2RKWA 5FULA 1L5KA 4ZYUA 2I4LA 4LJ9A 1Y7IA 4Q4HB 5HX7A 3MCWA 2PT9A 2FPPA 4EMUA 4PN3A 4JASB 2IHNA 3EIFA 1RI5A 2XMGA 5KAMA 1E58A 1AUOA 2DPYA 3BAZA 1V1RA 2M6RA 2RG1A 3BWCA 5TE9A 3AR7A 3H5LA 5BYJA 4V1CI 1ORTA 2NSJA 2PLAA 1R0WA 1UODA 2WAYA 2O7SA 4EO7A 4O02B 4DZZA 5AYVA 1XNJA 3HJBA 3WBJA 5T67A 2RGBA 2D1RA 3PFIA 4JT8A 4M99A 1GQOA 5GV7A 1AKQA 4RH1A 4TSFD 5A06A 3P1JA 2K5UA 2PM8A 4KN5A 4MI9A 4V0LA 4D8XA 5I01A 2HQSA 1OW3B 1QK5A 3AR6A 3IBTA 1ISJA 1TJYA 3ADPA 4O0MA 4BVHA 1WF3A 3JX9A 1QCDA 4MI3A 2VP4A 1H69A 3GFPA 1R0BA 3UCEA 4OFBA 1IPEA 4JZKA 4RADA 4ZPJA 2XXBA 1Z2DA 2X0KA 5F76A 3VNUA 1OU0A 5ED0A 3IVXA 3JR7A 2JGFA 3EPPA 4ZT5A 1G5FA 3OLZA 1PEKE 5T6BA 1QHSA 4MUAA 4TT3D 3V9AA 9GPBA 1JJBA 2R6DA 2JHAA 4ER3A 2OLJA 3HB4X 4O4LA 5PGMA 1VP3A 4HTFB 1OBFO 5JMPA 1MC4A 3RE1A 1GZSA 3KCQA 1RYHA 3HBMA 3SSMA 1NM5C 2J4DA 5JAZA 2CB9A 3IRUA 2FR1A 3RSZA 3O0DA 1KVRA 3A6EA 1A2BA 4KRXA 1N2SA 3U9SA 3UUWA 5CFOA 5HXAA 5LMCA 4ZYLA 3E9DA 2Y77A 4DRZA 4PZEA 1ZG3A 3UHOA 5JDCA 1W36D 3IBGA 4QVKA 1I36A 2V7BA 4R6XA 1DJNA 3KV1A 4QQNA 3WMXA 3WBFA 1Z06A 3H4MA 5I7VA 2C0QA 1Q0HA 2JDIA 4ZTZB 4L57A 4F92B 4PGMA 3FNGA 2A1TR 1FS5A 4ZU1X 4YMLA 4PV7A 3RADC 1XCBA 3IQIX 2AOTB 2RAFA 1L5ZA 3I6IA 1I1HA 2VNKA 1K8YB 2IYAA 1G8AA 1UEIA 5C1IA 2CVZA 2ZITA 4HWSA 4OP2A 4P34A 4Q39A 3SY8A 2HF8A 4NV1A 1PYDA 5I7WA 4WBNB 4AN4A 2EFEB 2ZRAA 4XIYA 2E4XA 1K68A 2P6PA 2Q8PA 2D5CA 3NWBA 1H66A 4CKBA 1ZLYA 1XAJA 1GAEO 2IPXA 2DERA 2AEFA 2JH9A 5B53A 2H2GA 3WQBA 4ZVVA 4MJXA 2C99A 3R9WA 3EXHB 3L0YA 3NU1A 2EFHB 5B64A 1LC0A 5C7IO 5G41A 3WISA 4WECA 2W71A 4C9BA 1Z6TA 4CRWB 1EGAA 4GLOA 4KPGA 4RDXA 4HUQA 2B98A 1N2ZA 2HK6A 4E2WA 4TYNA 1E61A 1ZICA 2C58A 4QBFA 3RC8A 5K6RA 4Q34A 2RB5A 4EPWA 1DXYA 3DQZA 3CZRA 1YJCA 2FI1A 1GPBA 3H5NA 2E82A 2YHUA 4RD0A 1TEXA 2WSMA 2VJCA 5FTKA 3U7FB 2AG1A 2XDAA 4C0XA 4RY8A 1XKQA 1XXHE 5CMLA 2CF5A 3T9BA 3NKFA 3UWMA 2HF9A 1KF0A 3GEEA 3K8OE 4O08A 3KG2A 4XPIA 5L6MB 2GYVA 4JJ7A 4BMSA 2W22A 4B8WA 2FDCA 3L6BA 1VSBA 3NIGB 4NI5A 2O6HA 4TV8B 2P11A 5EWMA 3SKVA 3BTOA 3V34A 3A6ZA 3PF8A 1KY5A 3R5KA 3F2IA 3Q88A 4IV8A 5IUNC 1DQPA 5DYYA 4B79A 3CZQA 4PPGA 4CEJB 2V9PA 1E2HA 1EP1B 1ZGCA 2OT3B 2QDKA 2D1YA 4J0GA 4KODA 5FIUA 3T7JA 3D7KA 4M7PA 1OIVA 2PQ0A 5JDIC 1MB0A 3RM3A 3JWJA 1B7GO 4J1TC 5LNK6 1E8MA 3O1HB 1Z7YA 4JELA 4WSOA 1FXWA 2VLIA 4XH9B 5DISB 3WSVA 4QG7A 1TCCA 1YGPA 1J33A 3VZPA 1F8FA 3GNQA 5AR1A 3KOOA 1N3LA 2GRUA 2AUNA 3L5KA 3DAOA 3IO5A 3VTFA 3TW4A 2V03A 2VTKA 3PJDA 3SICE 4UBKA 4CV0A 1JLRA 3P32A 3O83A 4IQ0A 5GADl 3L6EA 4ARSA 1L7EA 3VAAA 4BZXA 5KOJB 4IXNA 5DLPA 1UEJA 4GXTA 3TLCA 1M8PA 3NUQA 4XD2A 2EJWA 1T8WA 1L8XA 2FPLA 4QOSA 2J3MA 1E9CA 1VKHA 4OFWA 3BCUA 2QU7A 2XZLA 1VHWA 4KDFA 1Q83A 1MO4A 1YZUA 2L42A 1UBCA 2YJZA 1IVYA 3ILHA 1VL0A 3EF1A 3QXCA 2GCIA 1R8SA 3HKBA 4KDEA 1OT3A 1GAWA 1YR3A 2AXEA 4P98A 3T1VA 3AR9A 4YMSA 1IZ9A 2QPOA 4F3NA 2P9TA 2XNDD 1X7WB 1RWKA 5E6RA 1E3WA 2WSYB 1J0XO 3MIZA 2ZJFA 4PSCA 5H16A 4KNWA 5G4LA 4KP7A 2CZGA 1OY1A 1KDPA 2W8BA 4PS0A 5B7PA 4GL2A 2P67A 2X6QA 2XLBA 2ST1A 1R6AA 1QFYA 5KSZA 4EW1A 1P1BA 1ZHFA 2XCQA 3DWEX 2DPLA 2E89A 2H06A 2PPVA 1OXMA 3KHTA 2VYNA 2XGJA 3D3QA 1LK7A 5K3OA 3WYGA 3FJOA 3KVRA 3HBAA 3MCTA 4G6ZA 4DJDC 3LV8A 2N0SA 2J7PD 2BISA 1D03A 3LZ6A 4WI1A 4BO3A 3QKWA 2JHGA 4JDUA 3SFZA 1DWQA 4MROA 3ZDRA 2XYHA 2LR0A 4B3DA 4GUAA 1CTQA 4D02A 3OWOA 5KVCA 2WTAA 5SYMA 1AGXA 1Q0PA 2PU7A 3KPJA 3DS8A 1XZAA 2Z6VA 4L4XA 1EG7A 3DFIA 4TSFA 2X9VA 5CYFA 1XTRA 4YDRA 4H7FA 4X64B 4RS3A 1WZ2A 3DL7A 3AF2A 5AJUA 5A05A 3ZW7A 4GOOD 5G1NA 4PC3A 2PA0A 1UT6A 4HWGA 3TO5A 2ZVDA 4TXHA 1YQGA 4CIAA 3EGWA 4G5XA 2BR5A 5DM4A 5I9TA 3LH5A 1NULA 2H6EA 1K3TA 4UZFA 3GPLA 1AMUA 1NQTA 2A8YA 4BO1A 1G6KA 4TT3A 4G4SO 4EBFA 4XGKA 1O4WA 2YL2A 4IGFA 2XW6A 3IURA 1PT8A 2FUG1 5EC8A 2RK4A 3AYXB 4LQLA 4L5IA 1MN6A 3JCZA 2CL7X 5LBUA 7ABPA 3BIJA 1RXYA 2I6TA 4W9NA 1JS1X 1OIXA 3ON5A 5K0TA 1H9AA 1UEXC 1M6EX 1O97D 3RVMA 2MHCA 1NVBA 3NTRA 1KHHA 1Z5PA 1OC2A 2OA0A 1PJBA 5BSTA 4KR6A 1F6BA 5KIAA 3D6HA 3QEOA 2ANCA 5A2QA 3QELB 4FILA 5DBIA 1RQPA 5JFGA 4CMHA 3DMPA 4I55A 4O4JB 10MHA 3NR2A 1RHRA 4MVWA 2XJ4A 4JGBA 3CE6A 4MAMA 1S2LA 1IWPB 5JQGA 1J7KA 3I2GA 4JGGA 1ODKA 1KARA 4IHJB 1YVEI 1G9XA 1X1TA 4R1MA 4DY6A 4ZYYA 5LP6F 1IK6A 1I13A 3MG9A 4PIMA 3TZCA 1MJGA 1VKNA 1MLDA 3L40A 1GTVA 2ODQA 4NJOA 4U7WA 4F1KA 1TUEA 2HM7A 4EW2A 4PSAA 2OKGA 5AKGA 1SNYA 3KFVA 2XMRA 2PFSA 2G5PA 3MT8A 4N0QA 2JA2A 4Q4AB 2JAUA 5KQSA 4K9PA 4I5DA 5BSUA 1BH2A 4BNZA 3I8XA 1G3IA 3PPXA 1CV2A 1N7IA 3K0CC 3L1JA 2PRZA 5AUOB 4P3XA 5BMVB 3AJAA 2QAIA 3ZG6A 3PQ6A 4ZPXA 2PTHA 2OFOA 4G5FA 1GPKA 5IBCA 2I2DA 3L8EA 5TGDA 1QDUA 1GKLA 1M2GA 3H05A 1O3YA 4GXRA 1I4DD 2WZBA 4GR5A 4H17A 4UTRA 4K03A 1GGVA 1FLNA 1WWKA 3CF4A 3OX3A 3PQ8A 3UJBA 3S27A 3AXSA 2ZETA 3TR6A 1DJPA 1B43A 3FDFA 1II0A 2B5VA 3QBJA 4Q7KA 2IQIA 2CYBA 4FS3A 2J0QA 1JQDA 3DYIA 2CJWB 4FOOA 4H6PA 1A97A 2DCMA 5KAPA 1NPDA 2BI8A 2DPGA 3JS5A 3RH0A 1SY7A 4L9AA 2GEJA 1BWPA 4KL8S 1ZW6A 2R7LA 3STXA 3OJCA 1EWTA 4MITA 1KU0A 5DM70 1VLLA 1RCFA 2V6MA 5T5QA 3I2KA 1E77A 3ZHCA 1IBSA 1SD5A 3BS4A 5LQMA 3ZW9A 3I6ZA 4QBGB 4MV6A 4E70A 5TQJA 5HKOA 1WQ4A 3KJGA 5FR2A 4ALLA 2ORYA 4JVSB 1I3LA 1Y8ZA 2P6OA 4EJSB 5ERYA 3DB1A 4MWBA 4BFYA 4JYAB 4H3VA 1AA6A 3VH2A 5AVUA 1YB6A 3F6BX 4N6GA 2AX3A 3UAYA 1LVHA 4YTEA 5DTMA 2QTAA 4QKQA 3C7KA 4E5MA 2ODBA 3P71T 3T1QA 3NONA 3NYWA 1R4ZA 4JYZA 3WDLA 4DKJA 2XVZA 4C21A 3PHCA 4TZ6A 4OQPA 2FLKA 3R0XA 2DXIA 3WGQA 3IDAA 1KYXA 1M1YE 4O1HA 3VISA 1G17A 3FTQA 3OQBA 4L3OA 1OHHD 4B85A 4QOJA 5G0SA 1J8DA 3DL2A 4JBGA 4O6VA 5CVJA 4NTZA 4G0UA 2ZSAA 3KOWA 4KR0A 5LLDA 3N9IA 1RAGA 3W78A 4ZYZA 5T64A 1ZEMA 4RF3A 1B42A 1WMAA 4HLQB 1TOAA 3G2LA 5AVYA 2FSIA 4ZVKA 3SNKA 2GQ0A 3IOMA 1U9ZA 1VL2A 3P8ZA 2G4CA 4BE7B 2D2EA 4EG5A 1JEAA 1V3TA 3EVBA 2FEPA 2C7RA 4GMHA 2X14A 3HO8A 1RJ9A 2H1LA 2IE8A 2XNDA 2Z6UA 3S2SA 2Y6VA 3BXOA 1JYFA 2B20A 3DLAA 3R5JA 1RWBA 2JI8A 1AF4A 1I2CA 2NXWA 4HNAB 1J42A 2WWWA 5ES4B 3W3ZB 5LOVB 1N5IA 3DCNA 4M7RA 3UBMA 1TMOA 3RW9A 4Z7NB 4PO1A 4RPKA 1YCDA 5HJ7A 1SKMA 3PUXA 4QOGA 1NSFA 3P0EA 4LRYA 3OKAA 4URYR 4CM3A 3H87A 4NEQA 2OG2A 4J94A 3C98A 1D4AA 1JXMA 4JHLA 4KQEA 4ABYA 4BRSA 2VXYA 4URZR 1GEGA 4YJ2A 1SOMA 5FORA 2ZJ8A 1E7RA 1GN9A 1XPOA 3HKDA 1PQPA 2C5AA 3AJDA 3PYLA 1NP6A 2J7PA 4ILEA 5H80A 3OFSA 3JATB 3REFA 4XX0A 1G42A 5AT1A 4LJRA 5HZKA 3B5JA 4O4HF 3ORRA 1ESCA 2AGVA 3QMVA 1ESDA 1UBUS 2BHSA 3QA9A 4MKFA 4NQRA 4QFBA 4A26A 3EG9B 2VDPB 4G2NA 3Q2KA 4XFJA 1OX5A 5C8XA 1KZYC 4Q6BA 4IAOA 3RTBA 5E7MA 5FFFA 1ZJJA 2RFLA 1GZVA 1Q5PA 3I92A 4DLBA 5LZ8A 2F67A 1XZLA 3K1TA 2ZULA 4KWEA 4RSHA 1UC8A 4ZRMA 3DAFA 5KYYB 4RIFA 2LKDA 3TLGB 2DUUA 1R37A 2E6UX 3GMIA 1I6LA 3CINA 2H4WA 3V8PA 1RLIA 1DAGA 1AQLA 1YDEA 3H9EO 3LUFA 2NP7A 3BEDA 1RFLA 1VLZA 1FNNA 2BZ0A 2NOAA 2PAAA 2F64A 2QU8A 2NZVG 4Z7QB 3ZXYA 3DEZA 2VCEA 4MUFA 1R10A 1XXHA 3IMEA 3CX4A 3FR8A 3SCZA 3T7AA 2FSFA 4YMVA 3DWFA 4XWKA 1VYUA 3AEUA 4QSHA 1SHUX 2G83A 4YJKA 2PUEA 1TVKB 3UWPA 2O7NA 5DTIA 1X80B 4NDNE 1K08A 4M8IA 1UBLS 1DTEA 4EY6A 3N2NA 1O77A 2W0MA 2H2DA 2I6XA 4PQRA 2AJCA 4BDSA 3A4TA 3AF6A 1JQKA 2QV0A 3HV0A 3HMQA 5HQJA 3AJ8A 3FOBA 5FA8A 1FVFA 2BC9A 4PYIA 3A32A 1Y1LA 3RSQA 1J25A 5DLDA 3M3PA 2EGHA 3RT1A 2VUIB 4GRIA 4ZOLF 4OUDA 4C1NA 5KC9A 2DWPA 4G36A 3ROPA 2K87A 3IX7A 1NRXA 2Q5CA 4L28A 3WIBA 5B6JA 2WIJA 1OR8A 1Y37A 3NIWA 1Q16A 2HK8A 1E7YA 3BHNA 3K16A 4MLZA 2QMOA 3LSYA 1VSQA 1UDWA 1OXSC 3O1LA 1N78A 3DULA 1D6MA 4YFVA 1XCJA 3OKCA 1PJ3A 4N5NA 1WO8A 4OHMA 2I7DA 4GE3A 3MOGA 1QVRA 3IEIA 2BJVA 1QIGA 1ZQ1A 1G5RA 1U2QA 1WV0A 3B2NA 5HIIA 3EIEA 3KDAA 1CS4C 3WB0A 3HL4A 4TYPA 4EY3A 4ZCTA 1T8RA 1T9CA 4QU8A 3EASA 3G2NA 3RFUA 4G2TA 1WL8A 3WNZA 4DLKA 4PCVA 4R6WA 1AO3A 5HKBA 3JYOA 3B12A 5BYAA 1R5BA 2Y0CA 3K32A 1BXRA 2RMKA 3EZXA 4P84A 1LDGA 2CVFA 2NU7A 3AIOA 1GGFA 4XYEA 3DLIA 1UFOA 3KTOA 2QW1A 4TMZA 2SCUB 1NURA 2B4YA 4OKNA 1R0YA 5JEDA 1PNRA 4MK4A 5ICCA 1GRVA 4MS3B 1ENPA 1N0IA 1HDOA 4YV2A 4E33A 2HN9A 1H1LA 1LBHA 4ND2A 2HMUA 2ZTMA 3U7QB 2CBXA 4N41A 5FFMA 2MYNA 3VHXB 4EEKA 5BV7A 2Q5IA 5KYUA 1JG1A 1TGYA 2XPCA 3L8YA 4KACA 3T9CA 2IS4A 5GZ3A 3C3MA 2QVZX 4MUYA 5ITVA 3PUIA 4WZBE 1JQLB 2G36A 1UK9A 1WXQA 3QVTA 1TUBA 4DV7B 1GLNA 4CKWA 3VC2A 4MIYA 1BC5A 1NVVQ 2EZUA 3FOWA 3KE9A 3FFWA 3FYTA 3TNLA 5IM4A 1F60A 4KQ1A 3JR3A 4S0XA 2PD4A 2A59A 1FEZA 3ZWBA 4PGAA 2AXQA 4OQXA 3FGNA 2P0YA 5CM2Z 1HO3A 4FFRA 4RA6A 1MV8A 5BORA 3O31A 1R27A 5IJ9B 2P90A 1CZNA 4D82A 2OL4A 3WL3A 1ZRMA 1C9YA 3CNNA 1AUQA