1P77A

Crystal structure of shikimate dehydrogenase (aroe) from haemophilus influenzae
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
265
Chain Sequence
MDLYAVWGNPIAQSKSPLIQNKLAAQTHQTMEYIAKLGDLDAFEQQLLAFFEEGAKGCNITSPFKERAYQLADEYSQRAKLAEACNTLKKLDDGKLYADNTDGIGLVTDLQRLNWLRPNQHVLILGAGGATKGVLLPLLQAQQNIVLANRTFSKTKELAERFQPYGNIQAVSMDSIPLQTYDLVINATSASVDAEILKLGSAFYDMQYAKGTDTPFIALCKSLGLTNVSDGFGMLVAQAAHSFHLWRGVMPDFVSVYEQLKKAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of shikimate dehydrogenase (AroE) reveals a unique NADPH binding mode
pubmed doi rcsb
molecule keywords Shikimate 5-dehydrogenase
molecule tags Oxidoreductase
source organism Haemophilus influenzae
total genus 98
structure length 265
sequence length 272
ec nomenclature ec 1.1.1.25: Shikimate dehydrogenase.
pdb deposition date 2003-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01488 Shikimate_DH Shikimate / quinate 5-dehydrogenase
A PF08501 Shikimate_dh_N Shikimate dehydrogenase substrate binding domain
A PF18317 SDH_C Shikimate 5'-dehydrogenase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1p77A02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1p77A01
1M75A 3QVXA 3UFXA 5FF9A 3UW3A 2HRBA 3MJ4A 1B3RA 5L7WA 2GSDA 3QJ5A 4RVHA 1RM4A 3ZWVA 1O6ZA 3AOEA 3ORFA 3RUIA 2P68A 3FR7A 3IKTA 4PRKA 4YAKA 9LDBA 1U8XX 3TZCA 4FPXA 1E1KA 1JW9B 3MWEB 4NG5A 1EE9A 4Q3EA 1EFLA 4I9NA 2NNLD 5ITWA 4ALLA 4OL9A 1HRDA 4CM1A 3QWAA 3IJPA 5JXWA 4PFJA 5CAEA 2NV6A 2FMUA 2O4CA 4RVFA 4R1UA 3VH2A 4HBGA 2EXXA 1A71A 1OBFO 4BNLA 3BMQA 4OH1A 2VHYA 1FDUA 3IP1A 3H9JA 4R4JA 2O7SA 5DCUA 2QYTA 2Y68A 3BTSA 4E6PA 4J91A 3PYLA 5G2OA 5L9AA 4BO6A 1SB8A 5IXSA 2NWQA 4BO5A 4RF4A 3WQRA 3F9IA 2PFGA 4YT4A 3IP3A 1XYGA 1SNYA 1I24A 5BSFA 4Y6SA 4R01A 1PL6A 4NJMA 5I8WA 1RYEA 3FHLA 3KTDA 5IFLA 5FFFA 5B4VA 5I9LA 3OM9A 1LSOA 2HK7A 3FRJA 4YAGA 1E3EA 3LSYA 1ADFA 3VHRA 5JO9A 1ZCJA 1DOHA 3NDJA 3EYWA 1BW9A 1ZSVA 2GRAA 3G17A 5DOVA 4QFCA 3PJFA 3L07A 2BFOA 4IJKA 3PZBA 4G65A 4OSPA 1E7RA 4D0SA 4ND2A 3FF4A 1YGYA 5IXYA 5BSGA 3LQFA 4N18A 4F6CA 1G1AA 5JDIC 5THKA 4QO7A 2DBQA 3BYZA 2SCUA 1V8BA 3KXDA 2EWMA 3GOHA 4A10A 2G82A 4YJGB 1AXGA 1K6JA 3NTOA 5L3ZA 4MVJH 4JBIA 1DPGA 1MX3A 2ZYAA 3A28A 3FI9A 2BFMA 4ONEA 5TIIA 2AG5A 2I76A 4L0QA 1QLJA 3GG2A 3HDQA 1XCBA 4CMIB 2JKVA 2BKAA 2R2GA 3UH1A 3RSHA 1R37A 4YTEA 2P4HX 1Z7BA 3BHIA 2BGLA 1ADGA 2WYVA 3AUSA 3QVTA 4UULA 2J5QA 3GA0A 4L74A 1PR3A 2B0JA 1HDRA 1X7GA 2Q45A 3T4EA 4LVUA 2PGJA 3NDRA 4MINA 1NM5A 3UXYA 5TX7A 2AG8A 4L8VA 4IS3A 3KETA 2C20A 2PD4A 2X9VA 2XPCA 4U6SA 1V3UA 4E2WA 2W2LA 1E1LA 2W98A 4FIZA 4DQUA 3PDUA 1U7TA 4ZRNA 4ZGWA 3HNPA 1ZK2A 4ZU3A 3WSWA 5B4UA 3E6AA 1ZK1A 2Q50A 1X14A 1H94A 2OORA 3WG9A 1E3IA 1O89A 1M6WA 2EJVA 1LDGA 3BA1A 1Y8RB 5DBIA 1GUYA 3MEQA 2RH8A 3B1FA 4IZHA 2CSUA 3JQ7B 2EW2A 2Q2QA 4IQ0A 4A7PA 4JBGA 3WBFA 1R16A 3ZU5A 2G76A 4OQZA 3DTTA 2CFCA 2OP1A 3K2BA 1E5LA 1R0LA 4N7RA 5JDCC 5H82A 1N9GA 4F3YA 3CMCO 3F46A 1QYVA 4HFMA 1KEPA 3DAFA 5U4QA 2ZJ0A 3U0BA 4TZTA 5KCZA 3BIOA 3DBRB 3K2EA 1P1RA 2GN8A 2HLPA 4LW8A 1XU9A 3FNGA 2ZK7A 4DIFA 4BKPA 4B79A 4DRYA 1IE3A 4C7JA 4DYVA 1T4DA 2I6TA 3JYOA 1B8PA 2HMWA 3H2ZA 4JN6B 5T6BA 3ADOA 2PH3A 2YV2A 1BSVA 4ZD6A 5JY1A 3EAGA 3ZWNA 2FRDA 4W6ZA 1BDBA 3PHLA 4PG4A 3D7LA 3E8XA 4RPLA 4ZN6A 3D4PA 3LC7O 3KV3O 1CRWG 5HS4A 5I9NA 1M2WA 3E9MA 2ZB8A 2NVBA 1JAYA 3WB9A 3CE6A 1U1IA 1ID1A 3QQPA 5CEJA 3TZQA 5EPOA 4MP3A 2UAGA 3WTCA 2IEDA 5TS3A 5I7FA 1P1HA 4GX1A 4OXNA 5I7VA 4BO3A 3VOSA 4LSWA 1AUPA 4DUPA 4PVCA 2G5CA 3H65A 4XA8A 1UH5A 1Y8QA 2FPIA 3TSCA 2AMFA 3ZDFA 1XIVA 3OSUA 2AEJA 2RBEA 5COBA 4XGKA 2I67A 4R5MA 4CLEA 1HDCA 1OFGA 2O2SA 1GYRA 1U2DA 4WKGA 2CF6A 4OHUA 1GPJA 4J43A 1XHLA 3QVSA 3GZNA 2NTVA 1DO8A 4O5OA 5L4LA 2ZTMA 2W2LD 1KVUA 3QVOA 4ALJA 3H3JA 3GZ4A 2DBRA 3GG9A 3DBHB 5EJ2A 5BSHA 1WDLA 3ABIA 1IYZA 1U5AA 1R66A 1P74A 1A9ZA 4PLHA 4R51A 1HYGA 4YJFB 4DIBA 3L4SO 2QQ5A 3KLMX 5F21A 4CM4B 3ZNOA 3C7DB 3D4OA 1EVZA 4DTIA 3EZYA 1JDJA 1PQWA 4HP8A 3F47A 2E6UX 4IDFA 4CMEA 4D3SA 1GFSA 4E2YA 2X58A 4PLVA 3GVXA 4RV9A 3TRIA 3TZHA 3E18A 1XDWA 3PXXA 4YT5A 5TQVA 1GQQA 2NU6A 3HUDA 1U5CA 1N92A 3L6EA 3HN7A 2DBZA 4AG3A 5GZ3A 4NBRA 3ZNPA 3GRKA 8ADHA 4JK3A 5JAMA 5T8KA 3ZNNA 4LSMA 4WLOA 1F0YA 1NPDA 1I3MA 1H5QA 4RLHA 2O3QA 4FD3A 1XA0A 1DBVO 1QXSA 5JAQA 3ZV3A 1BMDA 2VHZA 1DLJA 2O4UX 1RPNA 1BG6A 1Q7CA 3TDKA 2I3AA 4YVFA 4J7UA 3TZ6A 1X7DA 2YUTA 1R4NB 2YFHA 2J3KA 2JL1A 2X4GA 4OGWA 1TT7A 1LDBA 3WIEA 4G81A 1PQUA 1I3NA 4CM8A 3R6DA 4J2OA 3WNVA 5B37A 3BMCA 1NXQA 2AW5A 4IMRA 3ZHBA 2IODA 4CR6A 1K2WA 1OAAA 4G2NA 1HDYA 4PZCA 1HTBA 2JD0A 1EBFA 1C1XA 3ZWCA 1PL7A 1EVJA 2VZ8A 4E5PA 3FWZA 4PIVA 3I6IA 5U9CA 3WOHA 1K5HA 2C5AA 3DZKA 3DZHA 5DCWA 2ET6A 4L4XA 3GDGA 1NFQA 2P9EA 3HQ4O 4GKVA 4UUPA 4YEDA 1DDOA 3U9LA 3L6OO 3G49A 3V1TC 3PWSA 3QWIA 1P1JA 4ROSA 1NPTO 1GUFA 3F6YA 3O38A 5COQA 3GF4A 1QLHA 3EC7A 5I9MA 1GR0A 4HNGA 2O3TA 1IL0A 5KKAA 4JIGA 3OEYA 4NFYA 4RLSA 4MVJG 3C24A 4CV2A 2GDZA 3DR3A 3ROPA 1IY8A 3JV7A 4Q3CA 1YQDA 3GR6A 2GASA 2Y1DA 4B7XA 4PRLA 1JLLA 4LCJA 5GY7A 1PGNA 1PZEA 4HFJA 1SC6A 3UN1A 3INGA 3D64A 1D7OA 4HKTA 4XB1A 2DAPA 3SXPA 1Z45A 1N2SA 1W8DA 2PZLA 5G0VA 2DBVO 2Q46A 5JCJA 3Q11A 5EL0A 2HMSA 4BO1A 3WFJA 1B26A 1ISHA 3JQ8A 1T2CA 4WEOA 1SPXA 2B69A 4RCVA 4GWKA 5EESA 1ZUD1 2HMTA 3WYBA 1LDEA 2QX7A 3UUWA 4DREA 4TQGA 4ALMA 3GEMA 4IMPA 3TOZA 1ZH8A 2Y93A 1JA9A 2C82A 4GX5A 1GEGA 3D3EA 1DC3A 1HF3A 3F1KA 1NWCA 4OOEA 5DT9A 3UKOA 1U4SA 1UXKA 1Z82A 3S2FA 4FFLA 1ZK4A 4YJDA 3CXRA 3ZV4A 2QZZA 4HFRA 4GX0A 2EERA 4HNHA 1IHXA 2ZQYA 4ZQFA 4OKIA 3TJRA 3OJOA 5TJHA 3AK4A 4E4YA 4GLOA 3ANLA 5TRTA 5IN5A 3W4IA 1O5IA 4WOJA 4CMHA 3MJSA 3ZV6A 4EEZA 4XKJA 5ER9A 2VWQA 3WQQA 1P9LA 3QY9A 2HMUA 4GKBA 2DU8A 3P19A 3PWKA 4XR9A 2WTBA 1G0NA 2NU7A 1B8VA 4OIMA 2XOXA 3RD5A 2IRWA 1NASA 4MVJA 4UVHA 1EQ2A 1OC2A 3Q0EA 1T26A 5L95A 2ILTA 3INRA 4EUHA 4CJXA 4E0BA 2CUKA 5CPBA 3PQDA 1ZK0A 2FPPA 2QRKA 4IQGA 3SX2A 1Y7TA 4GGPA 4CLRB 4BMNA 4ID9A 3NJ8A 4PLPA 2Z5LA 3HB4X 2Y0CA 5IZCC 3JYQA 2IEBA 4R16A 3FSRA 3NDIA 1T4BA 3ON5A 2WM3A 4IIUA 5EN4A 1PEDA 4RQTA 4DWVA 3EVNA 3BTOA 3AJRA 4YWJA 4AJEA 4DPMA 3I83A 3UHAA 3I9JA 2JAHA 1T24A 3AUTA 4CL8A 1T2DA 1GZ4A 4E5YA 4NHEA 4KWHA 3KUXA 4R5HA 4AJ2A 2VQ3A 4B8ZA 4DL9A 1VKOA 5IAAA 4QX6A 5JCJD 3S2GA 4GH5A 2P2SA 1MUUA 2A94A 4L76A 3JCZA 5L4NA 5JMWA 3RVDA 5T57A 2VUSA 1LLDA 3A1NA 3DTYA 2PZJA 4M1QA 5I8ZA 4DLLA 3HFSA 2GPTA 2DUUA 3WX0A 3CZMA 3NKLA 4RZHA 4R9SA 1XKQA 2YDYA 4IDBA 1V6AA 4ND1A 4K28A 1W4ZA 4YA6A 3NJ4A 3ONDA 1PX0A 3BMOA 5BQFA 1G0OA 5ER6A 2DLDA 3ONFA 1WP4A 1UXHA 3HJAA 2RH4A 1XR3A 3CSDA 4ESOA 2J3JA 4KZPA 1UAGA 3G79A 3Q6IA 2BELA 3DMTA 1P1IA 4WK6A 2IXAA 2HU2A 4OSOA 4U5QA 1BDMA 4RZIA 3WQSB 1JVBA 3NEPX 3IDSA 2BFPA 2GZ3A 4FQ8A 1HT0A 3ZWMA 3DZBA 4YJHB 5TGDA 2GZ2A 2CD9A 4ZRMA 3WGIA 1NTOA 5A9SB 1LRJA 4MOWA 2AA3A 3MJVA 1A9YA 3U5TA 3L0DA 3U09A 3OQ6A 3O8QA 2D5CA 1V3TA 4D45A 1HL3A 2PGLA 4GVLA 4MVJD 3PLRA 1UZMA 4Z0TA 1IPEA 5F1PA 3ZZNA 3I5MA 3LK7A 2B35A 1XWFA 2WEKA 4CLOA 3CINA 3ICCA 4WLFA 1YOVA 1ADCA 1HDGO 1Q7BA 4PG8A 4E33A 1ARZA 1EFKA 1VLLA 3B6ZA 3E82A 4R69A 3H5AA 4A73A 4J4HA 1NR1A 1PS9A 4AVYA 3PZRA 2Q1UA 1N8KA 3GNSA 2HAEA 2ZTUA 2Q49A 5FI5A 2B5WA 2O48X 1A7AA 5L51A 1BXGA 4B4UA 1PIWA 1TA4A 5G4KB 3RUAA 3MJCA 3PHIA 1EMDA 1LEHA 2GZ1A 1LDYA 1CJCA 2IDZA 7ADHA 4Y6PA 1QORA 3KVOA 2J5RA 1RWBA 3QWFA 1J49A 2B4RO 2PKQP 4LGVA 4W9NC 1BHSA 4EDFA 1OI7A 3RFXA 3W6ZA 3IJRA 2DT5A 4NQZA 4WUVA 3V1UA 3IL2A 3DL2A 1WWKA 2Q1WA 4J49A 4BUCA 1WW8A 3TOXA 4DBZA 1N5DA 1DC4A 4FGSA 2X0IA 2GD1O 3E9NA 1YBVA 3H2SA 1YJQA 3IS3A 4RO0A 4D42A 2YV1A 1Y5RA 1K89A 1C0KA 3V1YA 2C7GA 3JQCA 2C59A 3QA9A 1T2AA 1WZEA 3QE3A 1MFPA 3TZKA 1SOVA 4J1TA 3PHHA 4H15A 4H3VA 5ENVA 1IULA 3CUKA 4NBUA 2QW8A 1YE3A 1DIRA 3VPSA 1E3WA 4Y6RA 3P5SA 2QHXA 5C37A 3JQFC 4ZJUA 1BXKA 2E37A 3P2OA 5LDHA 2Z1MA 4FOSA 2EV9A 2E82A 2QG4A 1YDWA 2Q1TA 3GK3A 3QWBA 4QXMA 3WYCA 5JDIA 3AM3A 3GDFA 5BNFA 4L9RA 4D43A 4DVJA 3SBOA 4BNTA 1N7HA 2X23A 3ZWPA 5BT9A 1PGQA 4QUKA 4MVJE 1K0UA 4MVJM 4XQCA 1X1TA 5CP8A 3M1AA 1WMBA 1KY5A 1UP7A 4BB6A 3EY4A 1UDBA 1LLQA 3OHSX 3RUCA 2JCYA 4AJOA 4CLDA 1KETA 4CQLA 3N74A 4JLWA 4EJ6A 4WNIA 5K0ZA 1I3LA 4FC7A 2PY6A 5HS6A 5BNTA 1PJBA 3WGYA 2B5VA 4OOFA 3LYLA 5TC4A 3DZIA 4NNJA 2OXIA 1VJTA 3MOGA 4UREA 3PQEA 3VVCA 3ZU3A 4FJ0A 2HUNA 1NHWA 4YCAA 1QYWA 2AEMA 2YW9A 3JYLA 3WGOA 2OGUA 1HLPA 4ND3A 3TFQA 4EUFA 2IYOA 4W82A 4RPKA 2OBYA 2YHUA 1T1SA 2ZJ1A 4NPCA 4O59O 1EZ4A 1UP6A 1FDTA 2LDBA 1X7HA 2P9CA 3R1IA 4D0RA 2YY7A 3TNLA 1Y8QB 3MZ0A 4KP7A 1SOWA 4JXKA 5JDCA 5JS6A 2PD6A 4R1NA 1ULSA 1N1GA 3WGGA 4II2A 3UCEA 1UR5A 4TSKA 2I65A 1IOLA 2EF1A 1QKIA 1SEPA 2ZKLA 4FJ1A 1DIBA 3WS7A 4IGEA 2Q4BA 1MB4A 7MDHA 3GVIA 3NRCA 3DHYA 2DFVA 3RC7A 3KO8A 3W4KA 1HE5A 3GT0A 4IDEA 3KSZO 2D0IA 3TPCA 1O94A 5A1TA 4BNXA 3GN2A 4RGBA 5T5QA 1TVEA 1UP4A 3HWRA 4WCFB 1NFRA 2Y1EA 2CF5A 1O8CA 3S1LA 1HZZA 5DNAA 3BMNA 2AEFA 4NU5A 4DLAA 3K9QO 3OIGA 3R3SA 4J16A 2V6FA 1QMGA 2VNSA 3E5RA 1FK8A 1I8TA 3WGZA 4IQ8A 5EQDA 3EGOA 1UZLA 3I4CA 3BHJA 3O9ZA 3LC1O 1XG5A 4IZIA 3DOOA 4IIVA 2NLOA 1G6KA 3EUWA 3MTGA 4BNZA 3TQHA 4TWRA 2DPHA 3WDSA 4BO4A 2R6JA 4AL4A 1MXFA 1ZXBA 4FBGA 2ZYDA 1BWSA 3K92A 3MTJA 1YQGA 5A02A 5CDYA 1NQAO 4Q3DA 3C1TA 2HQ1A 2HCTA 2QIOA 4QQRA 1VSVA 3E5MA 1F12A 4FFNA 4IPTA 1MV8A 1PJ4A 2B4TO 4K26A 1LSSA 1PSDA 1ZMOA 2X1HA 4LRTB 4XIYA 1T1RA 3GVCA 1V35A 1Y9AA 3D4NA 1GEEA 1O0SA 1WNTA 3U62A 3IQDB 2A9FA 4K9DA 5A5EA 1QSGA 3LF2A 2AQIA 1ZNQO 2CVQA 4NK5A 5F1OA 1I0ZA 2GF2A 4G5HA 4ALIA 1HXHA 4BNUA 3HSKA 1QYCA 4RVDA 3OFSA 1VL8A 1JAXA 4MPDA 1X15A 1E3JA 4WLEA 1YB1A 4J0EA 1P45A 4YRAA 4NDNE 3PHJA 5H81A 4BMSA 4CV0A 3ASUA 2FY8A 1MG5A 1ZFNA 3BMCB 3NX4A 1VI2A 1TEHA 2W2KA 4UVGA 1WMAA 5I7SA 1PS8A 2DKNA 2EP5A 4RDIA 4WGGA 1QRRA 1YJ8A 4K1LA 2DTEA 4TZKA 3D1LA 1C1XB 3ZNQA 4XJTA 5JC8A 3H4VA 3JQEA 4M89A 4XRGA 1KBZA 2OO5A 3C7CB 3M2TA 3KEQA 4XJSA 5TJ9A 1A27A 1A7KA 2V6MA 3P7MA 4ZICA 4CODB 5IDWA 3FCOA 2FSVA 3FR8A 5TF4A 3IIEA 4J9VA 4PLWA 4BOYA 5JYDA 1JKFA 3GMDA 5CDTA 1B7GO 1WPQA 3E48A 3M2PA 3F1LA 4PN3A 3LT1A 3ANMA 5AXCA 5CG2A 4M54A 3NUGA 4IY1A 3I23A 3EMKA 2PLAA 3WGTA 3I9MA 1PR9A 2QRLA 2NVUA 2IYPA 5KJEA 3HDYA 4BNKA 3QSGA 2NUAA 3RUHA 1C1DA 1XGKA 4W99A 1SEVA 2H1SA 1E6WA 2X0JA 4NR0A 2D1YA 3SLGA 3VKUA 4LK3A 3S2IA 3JQGB 2BFAA 3KYDB 1ZZEA 3OQ1A 4N5LA 3UCXA 3CZRA 1DRWA 2FR8A 2C07A 1DHRA 1X1EA 5GMOA 4BNFA 4BNNA 2DUWA 3GGPA 2I99A 1ENZA 3D5QA 4URFA 2X5KO 1ONNA 3A4VA 4JJGA 3HZZA 5KJ6A 1E5QA 3PFFA 3NAQA 3DFZA 2GERA 2QZ9A 2VUUA 4WLUA 3SEFA 2OHXA 6LDHA 5JSFA 1NVMB 3H9GA 2VRBA 1C3VA 1LRLA 3QWHA 1U3UA 3LT4A 3PIDA 2Y1GA 4KTVE 4IJVA 4XRRA 1LJ8A 4J4TA 4A0SA 1PJLA 5DP1A 3OA0A 1MGOA 4U0JA 3GLQA 4E31A 3A14A 5AOVA 1Q0HA 1FDVA 4FFOA 2D4AA 1I2BA 3RC9A 5A9TA 1F14A 3VPFA 3ENKA 4DA9A 5BR7A 3ITKA 1LTHR 4IXWA 4BNWA 3LT0A 3GDOA 3L9XA 1Q0LA 2VT3A 1TI7A 2P4QA 2ZYGA 4Q39A 4I08A 4XQEA 4Z6KA 1GZ3A 5KVQA 1YXMA 4PCVA 4EJMA 4PG7A 5JLAA 1LBEA 3AFNA 4TKMA 3I9KA 3ST7A 1PJSA 1V0JA 3PHGA 4FSHA 1JU9A 1DIGA 2VWHA 3EZLA 5L45A 1HEUA 3IC5A 1N1EA 2YQ4A 1RJWA 2ZTVA 2I9PA 1W73A 1DAPA 1U9JA 3GUCA 1WLYA 3H9QA 1SBYA 3I3OA 4RPHA 1D4FA 3ENNA 3GNTA 2FN7A 4CLXA 2Y0DA 3JD3A 3NT2A 3I4FA 3GAFA 1LI4A 4K6FA 4E12A 1KERA 1I30A 3LLVA 4R9RA 2I3GA 4FDAA 5L4SA 3DBLB 1P77A 3M1LA 2B37A 1LU9A 5EQFA 1NHGA 3FNFA 3OH8A 1HWYA 4EJ0A 2EGGA 3MJTA 4YR9A 3UAGA 2HJSA 2VZ0A 3A06A 3QLJA 5TNXA 4P38A 5ICSA 1ZSNA 1YVEI 2G0TA 2X7HA 5DF1A 1GYQA 4MVJF 3ZGYA 3S55A 1JTVA 4DPKA 4P4NA 1UXJA 3F4BA 4P22A 3JQ9C 1GAEO 1U7HA 5L7YA 4B4WA 5CG1A 5CPFA 1B15A 2V65A 1DJQA 1J0XO 1UXGA 1MG0A 3CEAA 4TMFA 3R3JA 1ZKMA 5IZCA 2O2YA 3V5NA 5A03A 3HFGA 5G4LA 4KTTE 1LX6A 3HB5X 3B70A 3D5TA 2ZB4A 5AVOA 4CMIA 5JCXA 5L7TA 1IPFA 1ZXLA 4OMUA 4YDRA 4Y67A 3ONEA 5J23A 3OF2A 1E7QA 4E5NA 1YL5A 4CR8A 4L4SA 3KLPX 2CZCA 4M87A 2VOEA 2X6TA 4ZQBA 4ZVVA 1YB5A 2PNFA 2WD7B 3LLSA 4Q9NA 2PZMA 4UUOA 2EKQA 1Y5MA 4RPJA 5C7LO 1Q2XA 1OC4A 4CM9A 4EEXA 4B4VA 1YH3A 1NPYA 4D79A 1ISMA 2GLXA 4W4TA 4JNKA 3RWBA 4DC1A 3WTBA 4IM7A 3OMLA 3IAHA 5ES3A 4MKZA 5KIAA 3JQAB 2FZWA 3WSVA 4BNVA 4PLTA 2NTNA 3ZW8A 4E30A 5IDQA 2R00C 1PJ2A 5LC1A 1BXGB 1D1SA 3VPGA 4AJHA 4ILKA 1ORRA 2D3TA 1JQBA 4DMLA 4PGFA 4L73A 4Z9FA 4NFHA 5C7IO 1FJHA 1YBMA 4UEKA 4F6LA 4B7UA 3GVPA 2AQHA 4PLGA 3RKUA 3RFTA 5CEFA 1LNQA 1M66A 2EG9A 4FB5A 3H6KA 2Y1FA 2EIHA 5GZ6A 4WCFC 2GN6A 4DMMA 3QW2A 3X2EA 2HO5A 1LRKA 3FTNA 3OJLA 5ADHA 3GPDG 3U4HA 1YDEA 3QHAA 2G1UA 1SAYA 4XYMA 4BKRA 2ZB7A 2VYNA 4J1SA 4RDHA 5EMHA 2YQ5A 4EW6A 1A4IA 4D3FA 2D59A 2JHGA 2OBNA 4BNGA 4A5OA 4IINA 3VAZA 5IN4A 4DIOA 1R15A 1DFGA 1EVIA 2LDXA 3KYCB 5AXAA 3FD8A 4KUEA 3WGHA 2CY0A 3ROQA 2PTGA 3K96A 3Q2IA 2W8ZA 2TMGA 2CDAA 2O3RA 4AJKA 3RBVA 4RQUA 1E7MA 1YONA 5ITVA 4P4LA 4TRJA 4R3NA 3LT2A 5COAA 4CR7A 5CHEA 1M76A 1T2FA 1UDAA 1PGPA 4Z3KA 2X0NA 4AJ4A 5CEEA 1ZK3A 3F4LA 4CQLB 4CM9D 1GQ2A 4MVJP 4E21A 3C7AA 3ADPA 2RHRA 1VL0A 3GAZA 2V6BA 2POQX 2VWPA 3ROMA 2Q3EA 2YV3A 4O1MA 3DQPA 3GMSA 1PZHA 3GFBA 1S6YA 4IUYA 3L4BA 1MFZA 5EIOA 3I9LA 5KVCA 3UCFA 3KYBA 4M55A 3PIIA 4CM4A 4R68A 1A5ZA 3RKRA 3M6IA 3JD4A 3C8MA 1AHHA 3H9EO 2YHIA 3NT4A 4CM6A 5B1YA 4J7CA 4I5EA 2W90A 4RORA 2D8AA 1F8GA 1P44A 5JBIA 4J2HA 3JQFA 2HJRA 3ZWWA 1PWXA 3CKYA 1U8FO 2CVZA 3FTPA 4MO2A 3PGJA 1GL3A 5JYEA 1E7WA 3SJUA 1GADO 3BMQB 3FNEA 1DAOA 2JFGA 2UUOA 3OJEA 4HUJA 4UVDA 3AU9A 3S8MA 3H7AA 5K6AC 2X9NA 4WLVA 1R12A 1I5RA 4AJLA 4Z0PA 1ML3A 3T7EA 1S7CA 3QP9A 3AY7A 3PYMA 1PJ3A 4U0KA 1HZJA 2BGMA 3DZJA 5BNIA 1CETA 4P4GA 1QG6A 2VYND 3FBTA 2VYVA 2VNAA 3HE3A 3ETGA 5DBGA 2FZEA 4Z9YA 1HSOA 2B36A 1GYPA 1ZO8A 2UDPA 3OECA 1R4NA 3G0OA 3JYPA 2Y1CA 3HN2A 2O3UA 4A27A 4NJMB 1KC1A 4GVXA 3VKVA 3FWNA 4U8GA 1A4UA 2JCXA 3TN7A 1KY4A 3V8BA 4YXFA 3RBXA 1I32A 4ZQHA 5HWSA 2WYWA 1CYDA 1LSUA 4Z9XA 1BW9B 2O3JA 3RBZA 4CLHA 3GHYA 4LN1A 1P0CA 4WLNA 4OQYA 4D46A 1R0SA 4N5NA 4QO8A 1ENYA 4U6QA 4WJZA 4NBVA 3RQSA 2ZIZA 2JJYA 5JC1A 3HDJA 4I1IA 1TT5A 4JGBA 4QECA 3ZN2A 2BLLA 5KJ1A 1VSUA 4NFSA 4J9UE 1U28A 1HSZA 4ALKA 4UEOA 1ONOA 1YB4A 3Q3CA 2NQTA 3E9QA 3DOJA 2HRZA 1FMCA 4FOOA 1B14A 4AJ1A 1PJQA 1DHTA 4XX0A 1SB9A 3ETDA 4E2ZA 4FGWA 3JQBC 1JN0A 4L4RA 3WMXA 1NVTA 1F06A 3K73O 1GU7A 4BQPA 3FN4A 3KEOA 5GZ1A 2VHWA 4F45A 1ISGA 4CUZA 4O63O 4OM8A 3GGOA 3H9UA 4J4BA 3VPHA 4S1VA 3RUDA 3AI2A 4B3HA 5IDYA 1XSEA 1T25A 3D3WA 4XYEA 4ALNA 3EW7A 3K31A 1P1KA 2C29D 1AGNA 3ASVA 1NAHA 2HK8A 4EITA 4XYGA 5KJFA 5EINA 3STHA 5CDGA 3ZWBA 1NQOA 1IHYA 1DB3A 3NTRA 3I6QA 3WYEA 3KOUA 2G17A 3ZH2A 2CNBA 4NBTA 1HLDA 2YFQA 3H8VA 4JBHA 2PD3A 5TT0A 1OZAA 4FJ2A 1XELA 4RF3A 2VYVD 5I7EA 5A4DA 2OZPA 5BSEA 3AWDA 3V2UA 1E7SA 4N5MA 4K6CA 4ZQGA 1DRVA 3T4XA 3ZHZA 5ENDA 1NP3A 2V7PA 2NU8A 5C7OO 1PJCA 1NYTA 1N9GB 3ZHYA 5C3MA 5TSDA 2QYSA 4CM5A 3PYXA 3KBOA 2NVUB 3NV9A 4RPGA 1P0FA 2YDXA 1CQJA 2JFFA 3UF0A 5DULA 1E3LA 3R0IA 4JJFA 3WJ7A 1CIVA 3PGXA 2XXBA 1AXEA 1VL6A 4EBFA 4JP2A 9LDTA 1CQIA 5FEUA 1E6EA 4CV1A 4XB2A 1NX6A 2EGHA 2NVWA 3QVWA 1T2EA 1LLCA 1KVQA 2PH5A 1R4MA 4MKXA 3L9WA 4UUMA 1LC3A 1DIHA 1MA0A 3CMMA 3JYNA 4CLRA 1OOEA 3SC4A 1JWAB 1NFFA 1NQ5A 4FFRA 1CF2O 2RHCA 4O6VA 4QSMA 4GQAA 1LQTA 2OOSA 4IDCA 3WICA 1PJTA 2BI7A 4S3MA 1IB6A 4MIYA 4NZ9A 2IZZA 1L7DA 2H5LA 1R0KA 4L75A 3AOGA 3C85A 4MDHA 2H6EA 3WLFA 1Z75A 4BGIA 5KJCA 1RM3A 4EI2A 3ICPA 2H63A 1ZW1A 3U4IA 1O95A 1QR6A 3OJ0A 3VH4A 2C2XA 4GL4A 3DZFA 3ZWXA 2Q2WA 3ZCXA 4BB5A 3GQVA 2V6GA 4JCOA 4YAJA 3L6DA 3GZNB 4GMGA 3K30A 2Y1OA 1E92A 2Y05A 1YS4A 2FWMX 2ZQZA 3B1JA 3I9OA 4XEHA 4BO9A 1HDOA 2VN8A 3DMYA 4NMHA 2B83A 5G0SA 3ZI0A 3O03A 4WPGA 3FPLA 4FC6A 1KIFA 1Y1PA 4B4OA 3JQDA 3H3FA 2YJZA 1V3VA 1HKUA 4I5FA 3ZW9A 3U4CA 4OO3A 2VWGA 2GN4A 1E0DA 4JP3A 1DC5A 3AUAA 2CDBA 4R54A 1UJMA 2O50A 4GLLA 4BO0A 3AUUA 1GV0A 2JFHA 1DIAA 4C4OA 1AHIA 5G0UA 4DLBA 3LZ6A 4WE3A 5HRUA 3RROA 2VT2A 1FF9A 1I2CA 4Q3AA 3SJ7A 3PWZA 4KUHA 3ROKA 1L1FA 4BO2A 4E3ZA 4CMKA 4YJHA 4NU6A 3OBBA 2C5EA 4MP6A 3OEWA 4DYDA 5A9SA 5DZSA 1Y81A 3ITDA 2JD2A 1FDWA 1P1FA 4AJJA 1VJ0A 4E5MA 2OP0A 2HSDA 3OIFA 3DB2A 4IBOA 1KS9A 1I2ZA 1ZJZA 3Q9UA 1I10A 4B3JA 2OUIA 4FW8A 1TXGA 4IDGA 4QTZA 4I5DA 1WXDA 1E6UA 5HA5A 4MKRA 1NVGA 1LSJA 1W6UA 1YQXA 3UGKA 2NTJA 3SVTA 2H9IA 2X5JO 1P31A 4J0FA 2BD0A 4BVAA 3WFIA 4YAEA 3P2YA 2Y99A 3FNHA 1WDKA 1XQ6A 2F00A 4M8SA 4YRDA 5G4KA 3RAJA 4CM8B 4DGSA 4YYZA 4CMCA 1H9BA 4F46A 1ZVMA 3F5QA 3OETA 3LC2O 1IUKA 5JAZA 5A5FA 2RIRA 5JMPA 4JQCA 3NTQA 2P91A 3BAZA 5L53A 5KNLA 2P9GA 3EHEA 5F5NA 2A35A 5FYDA 2VCYA 4BL5A 3BZUA 1E1MA 1NBOA 4UVIA 4CMJA 3BTUA 2CDCA 1ENOA 1GV1A 1X13A 3CTMA 3SLKA 2VRCA 5MDHA 2O7QA 4BNYA 4Z0HO 2UV8A 4YQYA 1H2HA 4FR5A 1CDOA 1LC0A 5KOIA 2ZTLA 4GWGA 1HYEA 1R6DA 1QV7A 3DC2A 4E32A 2W4QA 2YZ7A 1D1TA 4YB8A 2VTEA 1H6BA 4A26A 4DXHA 4XQGA 2A4KA 1ZMTA 4RF2A 3AOEC 1I36A 2FHSA 4BGUA 2PK3A 4FFPA 2UVDA 2DTXA 5DP2A 1XLTA 3QIVA 4TRNA 4PLZA 4W7IA 1J4AA 3GNQA 4BHTA 4OJNA 3VZQA 5JW6A 1LDNA 5KTKA 4H7PA 3JQ9A 5A3JA 4RJTA 4KDFA 1AN9A 4RVSA 3JQ8B 3KRTA 3E03A 4UVEA 4I5GA 3VH1A 1FDSA 5ILOA 4DBVO 2Q99A 2J8ZA 3C1AA 4WASA 4XGIA 3JTMA 8LDHA 5KVVA 2X86A 3WIDA 4UUNA 5A9RA 2VOJA 4GX2A 4CUKA 5C5IA 1M6HA 4BKQA 5JFOA 4XDYA 3A9WA 1LLUA 2PWZA 4TVOA 4LRSB 3NYWA 3TWOA 3DBVO 4OXYA 3KSUA 1KOLA 2AHRA 2E49A 4J7XA 5JY6A 1C0PA 2NU9A 5JE8A 5THQA 4CQMA 4MVJI 4B8WA 1PGOA 1Q1NA 1PWZA 3K6JA 1Z7EA 1DFIA 4DQXA 2EHDA 5H83A 3OIDA 4BV8A 1HE2A 3BTVA 3UOGA 3NGXA 3JD1A 3IMFA 1YL7A 5JPIA 4KDEA 3AU8A 1LA2A 1Y6JA 3W8FA 1O9BA 5DOZA 4GMFA 1SCUA 3UICA 4PG5A 3PRJA 1GCUA 3HHPA 4WNCA 5JNLA 1BGVA 2R00A 3VC7A 2ZATA 2BGKA 3IUPA 3PP8A 2GR9A 4C7KA 1UXIA 3HADA 3OA2A 3OICA 2VRCD 1KEVA 4YACA 3DXFA 2YYYA 4R1SA 1B16A 4OKNA 4U7WA 1MC4A 1RM5A 1YO6A 3UVEA 1J5PA 5CDSA 3HDHA 1HDZA 2J3HA 3B20A 2EKLA 2HMVA 1NWHA 1IZ0A 3PFWO 4O0LA 4EUEA 1KC3A 3GVHA 3MCVA 1OMOA 2WSBA 1UZNA 3GN1A 2JHFA 2ZCVA 2Q2VA 4HADA 5G0WA 2P5UA 3WNQA 1ZSYA 2VHXA 4Y8VA 2WWRA 2DM6A 1K3TA 3ZHXA 1YWGO 4TROA 4WCFA 4E5KA 4E2XA 4GSKA 1H2BA 4IJWA 3QV1A 4TRRA 4Z3DA 2WMDA 3TL3A 3SC6A 4Q3NA 2GO1A 3PI7A 3AY6A 3D0OA 4J90A 2YHIB 1H6DA 4BNJA 2BI8A 3RIHA 4BO7A 1EEHA 4IJUA 4TRMA 3WWZA 3TF5A 1WZIA 2HK9A 5A04A 3V2GA 1H9AA 4XWYA 4YT2A 2HKIA 2JD1A 1D3AA 3AI3A 4UAGA 3JSAA 2C0CA 3PPIA 3Q1LA 4ND4A 2QRJA 2BF7A 5IZ4A 2DC1A 4NJOA 4XZ3A 1PU2A 4LCEA 2AQKA 3DAGA 2GYYA 3BMOB 3I9NA 1B0AA 2BRUA 1XQ1A 4TVBA 2ZCUA 4YBZA 1F17A 5CDUA 2WDZA 4MIOA 4YJGA 5A3VA 4CQMD 4WCDA 3X2FA 4QT0A 2X22A 3RI3A 3U3XA 2FPGA 2NADA 2Z1NA 1PZFA 3PK0A 5IG2A 4PZDA 4PLCA 1YKFA 3DONA 5L40A 2AE1A 3DOCA 3CPSA 3OQBA 2AQ8A 5TLSA 1QYXA 1KYQA 1PZGA 4RL6A 3PJEA 2Y0EA 2IZ1A 4YAIA 4I9UA 1ENPA 1F8FA 1EQUA 4IXTA 5IJZA 3ANNA 4KMSA 6ADHA 2B4QA 2DQ4A 1N7GA 1XEAA 2BHLA 3DDNA 3O8QB 5DCYA 1X0VA 3W4JA 1U3TA 3GRPA 3AY3A 1CEQA 2IE0A 1P33A 1LDMA 2BH9A 1BXZA 4ZQEA 3PJGA 4HFNA 3DHEA 4R1TA 4XDZA 4BKOA 1ULUA 4CLOB 1DLIA 1YOVB 1BTOA 3INTA 2TMDA 4BGVA 2RAFA 3GEGA 1Y8RA 3GHHA 4PZEA 1K6XA 2A92A 1QYDA 3JQ7A 1TT5B 2O23A 5MGBA 3FPCA 4KOAA 4QFDA 5AXBA 3RJ9A 4WOKA 2I5PO 2O3SA 1EVYA 4MP8A 5K6AA 1PQPA 3B1KA 3O4RA 2OFPA 5DDIP 4H16A 4BS9A 3PEFA 4PLFA 4TKLA 1SO8A 4J3FA 5KVSA 1MC5A 3VH3A 4B7CA 3I52A 5IF3A 1GZ6A 3IKVA 2OL4A 4OXKA 3RC2A 4KQXA 1GDHA 3W1VA 1UAYA 1JWBB 2FR0A 3DBRA 1EE2A 3FBGA 4II3A 4RF5A 5TT1A 3DFUA 3RJ5A 1NQTA 1ONPA 1K6IA 1P3DA 3JQGA 3KYDA 5ICMA 5JO0A 1EUDA 4KQWA 4HV4A 3VTFA 3ZWAA 1VRWA 4XD2A 4UEJA 1WVGA 4CUJA 1JKJA 1Z73A 5HBRA 1M67A 5KWEA 3PDJA 4EGFA 2VUTA 4A2CA 3D3WB 1GQYA 1VKNA 3RC1A 5B4TA 1NNUA 1DEHA 5K9ZA 2DFDA 3DWFA 4ZA2A 3GUYA 2D2IA 3U4DA 4JX8A 4CMEC 5T67A 3KHUA 1E3WB 4I9HA 4AJIA 3BXXA 4YQZA 1KVSA 1JKIA 2F1KA 4XIJA 5EERA 1C0LA 1U2GA 1UDCA 5AYVA 3VDRA 3T7CA 4B3IA 5T8KC 3VDQA 1E3SA 4XYLA 1MLDA 2UYYA 2VTDA 1EK5A 4GSLA 5FWNA 1MXHA 3GH3A 1DXYA 5A05A 1TLTA 4IDAA 1KEUA 4M86A 3U49A 2EW8A 3N7UA 5FI3A 2PA3A 4W9NA 4RVGA 1H6CA 2XAAA 4X54A 2OMEA 3S2EA 3Q9NA 1YBAA 2PR2A 4OAQA 5ILGA 4KUGA 1ADBA 1B3BA 3G3EA 4FCCA 1IZ9A 3JQBA 4MIEA 1QP8A 3GFGA 4CM3A 5A06A 2AXQA 2X5OA 3DBHA 2J3IA 4WEQA 2C2YA 1Z6ZA 4HY3A 2PKRA 4Y9DA 1CWUA 4J6FA 4GPD1 1GPDG 3F3SA 3WR5A 4XGNA 1VC2A 5KKCA 1R4MB 3LU1A 4LMRA 4PG6A 4YJFA 1YL6A 3DO5A 3OP4A 1RKXA 1PL8A 2JCVA 4R3WA 3TFOA 4INAA 2WD8A 5B12A 2Y67A 3PVZA 1X0XA 5DN9A 2VZ9A 1H0KA 4XCVA 3RUEA 2HDHA 5LCXA 1B8UA 4P8RA 1V9LA 3CH6A 3WLEA 4BV9A 1GCOA 4Y98A 3WWYA 1Q0QA 2VHVA 3GEDA 4N54A 3N58A 4BQRA 1HYHA 1DJNA 3VZPA 2PGDA 4CMGA 3MWDB 1CERA 2XXJA 1VM6A 1I01A 3PJDA 4CMAA 4D41A 1ZEJA 3ZU2A 3GC6A 3G1TA 5F3RA 1BRMA 3DBLA 2J6IA 4R41A 4NBWA 4A03A 3K5PA 3KB6A 1C14A 2EJWA 4NK4A 1WDMA 1EDOA 2Y66A 3NT5A 1D8AA 5CFZA 1VE9A 4JROA 1EDZA 2GGSA 3LDHA 3EVTA 3ZWYA 2EEZA 1XU7A 1HDXA 2GUGA 4EZBA 3GGGA 1PS0A 4JJIA 5HTOA 4RVUA 4MJLA 1W0CA 2DVMA 2PKQO 3ZV5A 3BMNB 3JD0A 4GI2A 5T64A 4BO8A 4AICA 4M49A 4BNMA 4DQVA 3KZVA 4FFMA 2E4AA 3PTZA 1SZJG 1EUZA 3LVFO 4BNHA 4LMPA 1I3KA 3RU7A 1DC6A 1GD1O 4WECA 1A72A 2FP4A 3MOIA 3WBBA 4AJNA 3C3XA 3H5NA 3L77A 4E13A 1SMKA 4CV3A 2X9GA 2IZ0A 1VJ1A 4NI5A 2FSSA 5JAIA 4BIIA 2P5YA 3WMWA 1ZJYA 5DBFA 2GNAA 4ND5A 3ULKA 3RFVA 1QV6A 4IS2A 1JVSA 4CPDA 1HE3A 3W8DA 5HM8A 5G0TA 4GAEA 2FOIA 3RASA 4XQ9A 4QEDA 4ZHSA 3BHMA 4BNIA 2X0RA 2WD7A 1WAMA 4NIMA 3VVBA 1TB4A 2BMAA 3AM5A 1ZEMA 2NQ8A 3CIFA 1LXCA 3RUFA 1U4OA 2J5KA 1VPDA 1EUCA 1I33A 3AW9A 3PLNA 4OYRA 3ZWOA 2JAPA 3EDMA 2WJPA 3V2HA 1ZIDA 3VPXA 4BMVA 1E77A 3VZSA 3JQAA 3W6UA 1NR7A 2DTDA 4HX5A 3K8ZA 3F5SA 5F1KA 4J1QA 4KWIA 3RCBA 1GY8A 2Q4EA 2RCYA 3QRWA 4XR4A 4AJPA 1ZBQA 2WE7A 4FN4A 5U1PA 2C54A 4BGEA 4EYEA 3HG7A 4IGFA 2W2KB 3ETEA 1B2LA 1FXSA 4IDDA 2Z95A 4I8XA 5AXDA 4PLYA 3TL2A 1EK6A 4Q3BA 3NGLA 4HXYA 2NSDA 3DZGA 3MJEA 1LUAA 3GY0A 3OJFA 1BVRA 4YPOA 3JQ6A 3KM0A 1HETA 2AE2A 2CMDA 2GCGA 1ISIA 1NAIA 4J1NA 5F5LA 4D7AA 1MP0A 2EP7A 1EBUA 2PZKA 4LVCA 4D3DA 2Q1SA 3C1OA 4YT8A 1U3WA 3W8EA 2NM0A 2UUPA 1UUFA 3L4BC 1RM0A 3AFMA 1GTMA 2CVOA 3AM4A 4DC0A 3GPIA 1DSSG 4W7HA 4NH4A 2PV7A 3I1JA 3WGQA 1PTJA 5AQ1A 1AE1A 1DFHA 2X8LA 2WE8A 2GN9A 1C1DB 3WJAA 4CM7A 4CL3A 1E1NA 2FR1A 3IOYA 1YRLA 3RU9A 1U3VA 3DHNA 5LDGA 3KYCA 2XF8A 3WXBA 1H93A 1LQUA 2E48A 1BVUA 3H5RA 4FS3A 4GBJA 4ITUA 1H6AA 1ISJA 3DAPA 1KVRA 4HWKA 2ZB3A 3E1KA 4YRBA 2IXBA 2I66A 1J6UA 1DRUA 1KEWA 4GGOA 3ZU4A 2DPGA 3AI1A 1C0IA 3Q2KA 3DMTC 2WYUA 2C7VA 3COSA 4BKUA 4AFNA 3EK2A 3DEYX 4CMBA 2D5AA 3IUSA 4PVDA 4XYBA 3PQFA 3JD2A 1L7EA 4D44A 2EKPA 3VTZA 1ISFA 3G1UA 3LF1A 1KVTA 1Q7GA 1PGJA 2NACA 1Y9EA 3KSDO 1HE4A 1RYDA 3O26A 4LISA 1GUZA 1E7YA 3VZRA 4CQMB 5IDXA 1Z74A 4DPLA 3JQAD
chains in the Genus database with same CATH superfamily
2OHIA 3F6SA 2OBXA 3U44B 3UW3A 5JQGF 3WLIA 2PUAA 5LBTA 3IOBA 3G2OA 1B3RA 2LV8A 2WJAA 3SHOA 5KSOA 2PT7A 5LA6A 4MQ4A 3SAJA 4JQSA 3FR7A 3S2UA 4B73A 3KEMA 5L3QB 4LECA 4AF8A 3AT1A 3IE2A 9MHTA 3TI9A 1E1KA 1WEKA 1I1OA 1UJ6A 3GJQA 3LMKA 4G24A 4IAOA 5DHTA 4J8PA 4U2BA 1E2IA 2KE5A 4ALLA 2BYTA 1DRJA 4OL9A 4AF6A 5JXWA 3SZLA 2R4QA 1A5AB 1WU7A 3IESA 4RVFA 5HCIA 4FXPA 4DXAA 1OROA 2EXXA 1PE0A 1OBFO 4TGLA 4OH1A 1GKYA 1U9IC 2I2CA 1YRAA 1FDUA 2IYAA 3K0AB 3WGUA 4KPEC 1EJ6A 2EF0A 4JSYA 3CNOA 3AVXA 4I4TA 2QVGA 1T13A 3N2IA 2GJSA 2O7SA 2WVJA 2G28A 1O4WA 1QTIA 2Y68A 4RVCA 3OOYA 4ZVLA 4NJEA 2WM9B 4RMHA 3Q7QA 4UCXA 1RZUA 2G6BA 5GM1A 4XYBA 4E6PA 1MAUA 3LX8A 1OHHA 1V1MA 1WP9A 2IHUA 3GDWA 3ABZA 3TLAA 1R9NA 4DY6A 1N6OA 2A3NA 2BEKA 3NVAA 3F9IA 2EARA 2FFAA 2C3UA 2OO3A 2XMRA 4MPPA 5BSFA 4Q12A 1M8JA 1M0SA 2WUVA 1AMOA 1UPFA 3OE7D 4OVKA 1EX1A 4PNEA 1HLGA 3KKMA 3T8YA 1PZXA 1GPAA 4KWEA 4RD6A 5B4VA 3OM9A 2C4UA 4DEXA 1LSOA 2NSLA 5DN6A 5JAUA 4CKBB 4N82A 1P7CA 3CCCA 5DPMA 1V2GA 3MNFA 5MGNA 4CHGA 3OWXA 2GBIA 5G1OA 2IXGA 3ENWA 3N86A 3G17A 3DD5A 3PI6A 2PIDA 1BO6A 1X3SA 3PJFA 3JR3A 2XQFA 1UKEA 3RAGA 4PY2A 3CFYA 1QAMA 3QENA 3SOPA 3ZK7A 4ND2A 1N1DA 1YGYA 1HEYA 4E09A 2WZQA 5AKIA 2ERXA 3ZBPA 1G1AA 4DW8A 3GT7A 4WY2A 2DF8A 2XZOA 5TPZA 4UU1A 2SCUA 1BC5A 2X3FA 4KGVA 4EYGA 1SURA 3GOHA 4G4JA 4W1QA 1CT9A 3CEJA 2PMKA 2OT3B 1SWVA 3T4UA 1AXGA 1K6JA 4BEJA 3NTOA 4CIAA 4MVJH 4JBIA 1MX3A 3A1UA 4YR7A 2GPJA 2HXSA 3TYXA 1GTG1 1RDFA 4RIIA 2IELA 3GG2A 3TPFA 2OQRA 2XQGA 3A6FA 2PMCA 1BJTA 1QH8B 3OE4A 4RE5A 1SZPA 3I8OA 2EATA 2AYYA 3G0HA 3QVTA 1YI0A 2JGRA 1SKBA 3S7TA 3X2SA 2HQOA 2H1OA 1TECE 4EGJA 2PGJA 4MINA 1NJ1A 2HLNA 2J59A 4O8ZA 3UXYA 5TX7A 1Q20A 3P4YA 2L0XA 4P93A 1NOIA 2HB6A 3ZDCA 1GNRA 3I04A 3ROXA 1U1EA 3KETA 2C20A 2PD4A 3TJZA 4Z2AA 1Z28A 1UBEA 1JE1A 1E1LA 2AC2A 2QORA 2H1RA 2PSHA 2W98A 1QUEA 3K5HA 5IJXA 3W5HA 4ZRNA 4EKIA 3TW0A 1OU0A 1I7QB 1UKAA 2AHOA 2ODQA 4MVWA 3Q7PA 1O5OA 4U7PB 3SYRA 2H3EA 1BH6A 1SHLA 3B7GA 3HNPA 3KTAA 3WSWA 3OQVA 5JCOC 4IDHA 1X14A 2OORA 1Z6TA 2LCFA 3BFKA 3F71A 3WRVA 4P7FA 5EJ4A 1M6WA 5A4MS 5JVDA 1XFDA 2XTAA 1LI7A 3BA1A 5CX1B 1P6XA 3MEQA 3MYYA 2RH8A 2PXXA 3ED5A 2CSUA 3P9NA 3TNYA 4IQ0A 4J0CA 3O47A 3L8FA 4URVR 2C7OA 1JHAA 4B6GA 1R16A 1QPGA 2CXHA 3F5MA 2QNRA 1KP2A 2FQXA 2Q5EA 2QGFA 3DZCA 3TNFA 1RSZA 3DTTA 1OFIA 2AX4A 4FHCA 1C8LA 1LY1A 2YJ6A 3MD0A 1W4AA 5CA1B 1SCJA 1RXVA 3GJRA 1N9GA 3UA4A 4F3YA 1T35A 2GS9A 3F7NA 4HFMA 4KVGA 3PXBA 1I6LA 2PEYA 2CUTA 4KLNA 5DTJA 3RVOA 3TI7A 2VP4A 2ZIWB 1TU4A 3ILVA 3HA5A 4CTOA 3G5MA 4MQFB 2HIGA 3FAZA 3DBRB 2WKWA 4HGPA 1P1RA 5BQOA 5IW8A 1R0WA 5BN5A 4EKGA 2G1KA 2ACKA 2VJAA 4UE3S 4LYAA 4DRYA 3UANA 1UBCA 4YCLA 4LA4A 1EUDB 1PK7A 4F85A 2I6TA 1VZ3A 2VK2A 3NHRA 4JFAA 3UJBA 1EAMA 1CUUA 1HZZC 2VJCA 1JKJB 5T6BA 2YV2A 4OHZA 2KS6A 4KQ6A 1RQ7A 4MR7A 4C4AA 3UGJA 3IQHX 2UYQA 2XH8A 3FMOB 2GVZC 3PHLA 4U02A 4YALA 4RS4A 5IYZA 4PG4A 5JU6A 4B34A 4HNAA 1MJGM 4ZIRB 5JPDA 1CY6A 4OJTA 4RPLA 4DCTA 4FZVA 1TJ5A 1KP9A 4GMHA 2ZRPA 3N9IA 1RQLA 3K32A 3QLVA 2HFKA 2QUIA 3KV3O 4XVRA 3AHEA 5EMMA 3U7EB 5HS4A 4P7BA 4UUAA 4CKWB 4U9UA 2WJZB 3CE6A 1ID1A 1YBHA 5CEJA 4CDMA 2HC9A 4MP3A 3CR7A 6CHYA 5BSVA 3A25A 1WBJB 1CG6A 4GX1A 5SYAA 1DEKA 1SG6A 5JSKA 3EG9A 3KQPA 4BO3A 4PQEA 2R65A 3LBHA 4XA8A 4GM0A 5KBYA 1GL9B 3C70A 2QZSA 3TSCA 1VMIA 1L4EA 1XAHA 1XIVA 4RKRA 3PA6A 5IT9A 1M3SA 2I67A 4XGKA 1R9GA 2H0RA 3C3BA 4R5MA 3UQZA 3DNMA 2O07A 3QE0A 1GYRA 2QN6A 2CF6A 4OHUA 3L05A 4HBZA 2O6HA 1M1UA 2P3LA 5L4LA 1DO8A 4YJ2B 2W2LD 3A6EA 2LD4A 2VBGA 1AO3A 3QTBA 4G86A 3H3JA 5K0FA 1WR8A 3GG9A 4W6QA 5BSHA 2R7KA 5I9SA 1YHYA 1V8PA 2AN1A 2FEMA 3KD3A 1A9ZA 1TOAA 3OUZA 2PUCA 5E6UA 1HYGA 2X8JB 2PN1A 4AY4A 3ICEA 4AQYB 3OT1B 1A5TA 4AP5A 4NE2A 3DD1A 3KLMX 3W78A 4BWVA 1E3QA 1T0HB 3NTUA 3N6VA 1EVZA 3USCS 1JRLA 3SJAA 3KTOA 1Y6ZA 4DJTA 5K3FB 4UDNA 3D0QA 4DJFC 4HS4A 3WNDA 5D3QA 1NKVA 2E6UX 4IDFA 4D3SA 3ISTA 4E2YA 2X58A 5KO2A 2PT5A 2CCGA 3BFVA 3WRXA 2V59A 3ACBA 1QH1A 3PXXA 1GG8A 3OKFA 4M22A 4TS4A 5TQVA 3EVBA 2AFHB 3B48A 1J2UA 3HUDA 3WDMA 5K20A 1RJGA 1XZJA 4EM6A 2RMKA 4Y0NA 4MQEA 4AG3A 1W96A 2FPWA 4OGFA 4POAA 3GBPA 4ZPJA 4Z4QA 3K0EA 1JH8A 1W30A 4CI0B 2ZJ5A 4GR5A 4REMA 3X1JA 5IC6A 2FWBA 2VHEA 5CW1A 8ADHA 4LTDA 4DV0B 4NQRA 3WLQA 3A9VA 5KQRA 1JS1X 1TADA 4C7MA 4HVLA 5J2UF 4LE1A 5CBPB 3OZDA 3QPCA 5KHLB 4ASUA 1PG0A 1QFJA 4US1R 2O3QA 5CB6A 4UOEA 5DWDA 3FOAA 3HUUA 5BPHA 1XA0A 3L7CA 4OYHA 5JAQA 1MAAA 5LUAA 3L0IB 1LBIA 1II8A 3L7KA 4CNQA 3HR4A 1UC4B 4JYPA 1JU4A 1YHNA 4KQ2A 5F3WB 4HH1A 1JSRA 1JFSA 4EPRA 2IHZA 4H7EA 4N6OA 4N0EA 2YUTA 3HJCA 1R4NB 3QUQA 2FR8C 2J3KA 4RVNA 3ZBTA 2C78A 4DCNA 1VIVA 2PVPA 4ZVRA 4KPFC 3WIEA 1MEJA 3ECCA 1K5PA 3ILSA 4G81A 1YR1A 3L7NA 3PPYA 2CVHA 3TM4A 3R6DA 1EZ1A 4J2OA 1QFSA 5B37A 1Y1LA 3IB6A 1APBA 1M1NA 2OGTA 5CFZA 4OKSA 5FTWA 3ZHBA 4UNQA 4CR6A 2IL1A 1WCV1 1Q21A 2QZPA 1TPZA 3B1VA 4K86A 4ZAYA 3RVPA 2GTHA 3UHJA 3MBOA 3ZWCA 2ODAA 1Y1QA 1EVJA 4JVOA 1JXQA 2JZOA 3BSYA 4QRDA 3R9KA 3TTSA 3N0WA 3A6GA 3IPLA 3UENA 2C31A 4E5PA 1EXMA 3T1QA 3I6IA 1X8JA 1PQ4A 4U7FA 1I5EA 3DZKA 1GG2A 1RP7A 1NRIA 3A6DA 5AKEA 1IWPB 5E8RA 1ND6A 2OLEA 1NFQA 2ZI6A 4HDOB 5GM2A 2H1FA 4YEDA 2XMPA 2GXQA 4JZYA 3TCXB 1VHLA 3PGVA 3VR0A 2VHUA 3ZCVA 5CB8A 2VXCA 5BSRA 1BWPA 1P1JA 1SXJD 2W6CX 1XZGA 2YVLA 3F6YA 4ROSA 4UPEA 1D4AA 3EC7A 3SD7A 1H2EA 2EKDA 3O2QB 2C4KA 4ETMA 1FSGA 3DZ8A 1VPWA 3VO1A 2ZIGA 3RWOA 1GLNA 2HF9A 1N5IA 2JPDA 3ACDA 4MNTA 2ZIFA 2UXCB 1M2JA 3WZLA 4KWTA 3ROPA 4Q3CA 4KO4S 1FU8A 5JASA 2IU6A 1HNXB 3GR6A 2JLXA 3RJTA 2Y1DA 4F8EA 3H5TA 1ZKDA 2V7TA 4B7XA 3LYHA 4S05A 3QPAA 1JLLA 2WZBA 1RWNA 4HNRA 1PGNA 1PZEA 3DO6A 5ELMA 1JI0A 5FNVA 2EC5A 3D64A 4CF7A 2W58A 4HKTA 2P1DA 4XB1A 1NRJB 4P81A 3SXPA 3CN9A 3QF4B 1UBLS 2G72A 1YTUA 1AK9A 2K4MA 5I4CA 3E3AA 1A9SA 2ZT6A 1NLUA 3HO6A 1E20A 4P7GA 5EL0A 5JCJA 2AI2A 2HMSA 2X14A 2ZRLA 1ORWA 3U3OA 3VI4B 3ZIAA 4ACAA 1DRKA 4BO1A 1QP4A 1B26A 1PW7A 1XMQB 1M8PA 1A3CA 1FDRA 2P1ZA 3E9YA 2B69A 4RCVA 5EMJA 1N2OA 3UG7A 3V97A 3B82A 3K5IA 1BS1A 5LQSA 1RD4A 4GYJA 2QUAA 4NEGA 3EQZA 4DLZA 2FEAA 2BR3A 3HRIA 5CM9C 1WB5A 1NJ6A 1XRRA 4G1BA 4TQGA 3UHPA 2QOEA 2W2QA 2XKAA 4ALMA 3W7BA 3B6KA 2PQ0A 3L79A 1XF1A 1SUIA 1JA9A 3V6LA 3F1KA 1DC3A 3ESCA 1JL3A 3IMCA 2VDVE 1GRVA 1Z82A 3S2FA 2WKSA 2YZNA 3QLEA 1O87A 4FFLA 4G89A 4JEHA 4YJDA 3C3KA 2J45A 3ZV4A 1CF4A 3L1HA 4GX0A 2F3PA 1J2RA 4IIGA 2GZDA 2J9XB 3DMDA 4A0QA 4G84A 4QNRA 2DFPA 3KJQA 2WMNB 5EJEA 1QH0A 2FPUA 3GEBA 4OKIA 3TJRA 3QX3A 4ZI5A 2R1TA 3KPYA 5KQGA 5TJHA 3AK4A 3BQ9A 4BB9A 4MI9A 1T5IA 1F0PA 2GF9A 3KR9A 3Q5DA 5IN5A 1C8VB 4L7QA 4WOJA 5GP1A 5BORA 3ZV6A 3WQQA 4K81B 4IHJA 2P78A 3DZDA 5HVNA 3RT1A 2AXNA 2Y1KA 2FPOA 1YT5A 5JEDA 4C04A 3MILA 1DV2A 4XR9A 3L8GA 1BWQA 1RBMA 1TJYA 1D7AA 4OIMA 1Y7LA 3RD5A 2IRWA 3FPAA 3HGTA 4KSBA 3M4ZA 3KG2A 4MHSA 4KIJA 4MVJA 3KDPA 4FBMA 3TTXA 4UVHA 4EEKA 1OC2A 1SXJE 1T26A 2QVLA 3CH5A 3F5DA 3Q0EA 4JBLA 1TNDA 2R7LA 1Y4AE 4TLMB 5EKSA 5T4EA 3H5LA 3T3IA 3ZCQA 4E07A 2XCUA 4AKHA 1PK9A 1AKMA 5DK4A 5FPPA 4E0BA 1ZK0A 3SX2A 2QRKA 1E4OA 1ADYA 2XEXA 4A1FA 3X1MA 4ID9A 4KACA 3ZUGA 1RAHA 5GOTA 3HB4X 2VCEA 2H11A 3JYQA 1C80A 2C8KA 3ND9A 2YVUA 1BCSA 1T4CB 1C29B 1ZM2A 1T4BA 1XEXB 1ZJ4A 3G13A 3NVMB 1JR2A 4IIUA 3ZZMA 4ZHQF 3EVDA 1K88A 4DANA 2IQ5A 4RKFA 4UM9B 3QUAA 2XYVA 3NPMA 4XM1A 1FZQA 4QE3A 1AGXA 2DYKA 2DQKA 1OILA 1L5HB 2WINI 3AUKA 3M9XA 5KMGA 1DAMA 1H85A 3I9JA 3R7LA 4KYUA 1T24A 3LPDA 2FNAA 3R0ZA 1KI8A 4Q1AA 2Q8QA 3UAZA 5E6SA 4AZ3A 4KWHA 1NI4A 3LKBA 4R5HA 2O59A 4AJ2A 2I4NA 2AZ4A 1GNSA 4B8ZA 4C78A 4CQJA 3MMPA 4QX6A 5B1YA 2R7MA 3VNBA 3OP1A 4TLAA 2PLRA 3UZUA 1BDHA 2OXRA 1XBTA 1ODIA 4MYTA 1U3CA 1Z35A 1R74A 3LDAA 1XXHE 1BN7A 5T57A 1Z0JA 3FSGA 2OM6A 3ZC3A 5E0KB 3OPNA 2XUKA 2JJMA 3W5DA 5BUQA 4YFYA 1N9KA 2IBSA 4LJRA 4Y0VA 2W42A 2DUUA 3EMBA 2NZ8A 2XUQA 3NKLA 4PTLA 5GIOE 3TK1A 1STOA 1XKQA 5CFMA 4WADA 3QYFA 2WHRA 2AF4C 4ND1A 5GJVC 4UTNA 3QX8A 3AYXB 3ONDA 4CU5A 4D9IA 1KDRA 2XIJA 5JCZA 2FMTA 5ER6A 2XNDD 4N4AA 2W0SA 1T8RA 3SEAA 1UXHA 3NBXX 1OREA 1RE1A 1YVDA 2RH4A 2XX3A 3MUEA 1RLTA 4DLPA 3KZNA 3TDNA 4ESOA 4NXNB 1NI3A 1QIHA 3B7PA 3Q6IA 2BELA 3DMTA 3CXUA 4WK6A 1R3DA 2WI8A 1BWRA 1NF2A 1XU4A 2HU2A 4MRNA 1N2JA 4U5QA 1WS6A 1D4ZA 1OAKA 4I1OA 3WIUA 1MZPA 5I47A 4YCJA 3BB4A 2D62A 1N3YA 1EFPA 2FQYA 1YZQA 3SS8A 1ACLA 3HCPA 5AW7A 4YJHB 5FPHA 1LRJA 2AA3A 1QCDA 2PMEA 1A9YA 3K5WA 2COKA 4D96A 3U5TA 2OFOA 1BYIA 1CDDA 3IEVA 5TMEA 3G2MA 2NW6A 3O8QA 2EBWA 1HL3A 2PGLA 4GVLA 4X71A 3PLRA 2XYGA 3FVTA 4LJYA 1CD5A 2JJ8A 2GK4A 4JLPA 4TTJA 4KRFA 2PAAA 4GOOD 4L50A 2J0QA 1BX0A 2VP9A 4AULA 3CINA 2VF7A 4PPFA 3WGVA 3B8EA 1FUEA 1Q7BA 4GPIB 4QEZA 1M54A 2Q5IA 3ZQUA 4Q6WA 4S0ZA 3B6ZA 3E82A 1P8JA 2DQYA 2KWIA 3I09A 3IBGA 3QKRA 1PFWA 3B6MA 3KZCA 1NR1A 4R69A 1XCLA 4TMYA 1HURA 2WWFA 4EKEA 1DOZA 4ZV4A 5HQ3A 2ZRCA 2ZTUA 2Q49A 5FI5A 2C94A 1XXLA 3BDVA 5FOVA 3PLAE 1A7AA 4GR9A 4ZAVA 1BVHA 1SCIA 2XYHA 3KPVA 1CUVA 4UBIA 2W70A 3VR2A 2RC6A 1DAHA 4TTAA 2O9JA 3ZPXA 3AHHA 2P9FA 1S5PA 3LUDA 3D7MA 2VPYA 3JPWA 1K7CA 2OQ2A 4R83A 3KOZA 2N1MA 5DMHA 1LEHA 1Q12A 5BW6B 4DT1B 1OB5A 7ADHA 3FMFA 4HYYA 1COWD 2YIDA 1USGA 4F91B 1PKXA 2CYBA 1QGAA 2ZIVB 1PUJA 1B0PA 4N3AA 3RYCA 1J49A 4W9NC 2O54A 3HEBA 1BHSA 4BECA 2VF8A 3RFXA 4C7VA 3RVRA 2FK8A 3TLKA 4JL8A 4LRUA 4O2BB 4Y1RB 5NLLA 5AI6A 3DL2A 3N2YA 2RE8A 2Q1WA 3D2AA 4MS1A 1I2DA 4P1ZA 1M34B 4Q9HA 4BAUA 1VG8A 1X38A 2JGFA 3ZXIA 2HIAA 3E9NA 3IS3A 4D42A 1YJQA 4RO0A 4UTOA 4EB3A 2JLYA 1QIDA 3C5VA 4X20B 1GITA 3V1YA 1E6CA 2X77A 3JQCA 3A05A 1T2AA 4Y2JA 4ZAXA 2BH2A 1VLQA 4BMDA 4F1JA 3QE3A 1T29A 1QRDA 1VHWA 3G0DA 4P0PB 4H3VA 1N6KA 4MV6A 4PRZA 3ADDA 3ABSB 1IULA 2FDXA 5DTMA 5I6DA 2E85A 1EI9A 3LM8A 4ARSA 1MHTA 3TPZA 4QA9A 1AF7A 1KDOA 3DFKA 2YC4C 2AX3A 4XIFA 4ZJUA 1ES9A 1AUQA 5F7OA 2XE7A 5ICFA 5LDHA 1AMUA 5JLJA 3LA8A 4ZDWA 2QG4A 2SBTA 2Q41A 4V0QA 2JI8A 4WA7A 1QOPB 3AM3A 3ENZA 3EXEA 2M6KA 3GDFA 3ZDQA 4BLVA 3PEWA 2ECQA 4K6HA 4L9RA 4RHEA 4D43A 5LWHA 4HQOA 4BNTA 3JAMA 2WAOA 1TZJA 2ZRAA 4K88A 4DWWA 2AN5A 2R8OA 5BT9A 1AY0A 1PGQA 3C3PA 4QUKA 3ETJA 2ZRQA 1KYIA 2KPOA 2Z8XA 2YL2A 2HCRA 1WMBA 4NAVA 1ZD5A 5BV2P 1V8OA 3OEHA 5LB2A 2OC9A 4BB6A 5LIRA 1CQXA 3EY4A 4CF3A 1ONBA 2YWJA 1Q1GA 5C51B 1UDBA 1K4YA 4BMYA 1USIA 2FCRA 1QWOA 2IPMA 1SVNA 2IU4A 3KZ1E 2HD4A 3N74A 4G41A 3ZXXA 1QBKC 1ZJ5A 2MYNA 4EJ6A 2OK8A 3L0SA 2ZPAA 3IHKA 4KDRA 1I3LA 1RHJA 3MRXA 1Y6GA 1LBTA 3IP8A 1PJBA 1RWQA 1YOBA 2ZIXA 5J47A 2QDKA 3LYLA 3SHWA 4LV8B 3OY7A 2Q3MA 3LFUA 4ZCPA 1OI4A 5IXJA 3BXPA 4BP9A 3PQEA 2Q07A 3VVCA 1Y8CA 1IJBA 2P0YA 2ZWAA 3THYB 2JAXA 2FE4A 2XGGA 1FLAA 3QVGA 1KRXA 1E5XA 3E8SA 3UB2A 3VKGA 4LSGA 4I1RA 1SA0A 2RAUA 1DIOB 1G59A 2VDWA 4EG5A 5IAOA 1QYWA 2AEMA 3T12A 3U31A 1WM1A 5JECA 4AMVA 3STUA 3TCKA 1EESA 3M9LA 2X40A 1Y3DE 4HWOA 4QYIA 3I6BA 2ID8A 4JJKA 1WXGA 1G16A 1ZIPA 1U2SA 2YHUA 3BDIA 4OLJA 3VRHA 1LWOA 2G71A 2V9PA 1EZ4A 1UP6A 1OBVA 4L3WA 4AU1A 3BWBA 3KAQA 3S0JA 3KJIA 2ZRMA 3T0GA 1ZOOA 3AR6A 1Y8QB 3MZ0A 5BURA 1MCZA 1K3FA 5JNTA 3I64A 2YJ5A 5JDCA 1ULSA 2UZ1A 3NTXA 2XJ9A 4II2A 3UCEA 5JJIA 3OLWA 3S5JA 1IOLA 1C0EA 2PS1A 1RRFA 2ZKLA 3COYA 2R6R1 1DIBA 4QJBA 3FJ1A 4IGEA 5K8LA 4DR2B 4G6ZA 4YRJA 1E2UA 3G5LA 4NNPA 2PG3A 4A8HA 3L7BA 3DHYA 2A5GA 3OE5A 5ITZA 3WHKA 3GT0A 4MYCA 3WLAA 2VPWA 2Z9CA 2D0IA 3TPCA 3K3PA 3T35A 1AQUA 1G64A 3A3NA 4X64B 1R88A 1MDBA 4EG3A 4BASA 4EK9A 1CUZA 3BMNA 2AEFA 4ZEVA 4NU5A 1G8YA 4EY6A 4J16A 1QMGA 3H86A 1E3MA 1CY4A 1T9HA 1XD8A 3R6TA 5EIEA 3K71B 1IBKB 1UZLA 3I4CA 2II6A 5B1SA 2I0FA 4BRWA 3LC1O 4XE5A 4ZYLA 1GXSB 3R5HA 4G3XA 1VSQA 1MO6A 3EUWA 5DM4A 2MCFA 3DL0A 3TQHA 2GCIA 4DMGA 4BO4A 5FLXA 4KQFA 1MXFA 4YMHA 2ZYDA 3PXEA 3HKDB 2AF3C 3ESXA 4L51A 4UE2A 5CDYA 1NQAO 2HQ1A 2VBCA 1W85B 3FUUA 2OXTA 3EASA 2QIOA 3MTBA 3UWSA 3C5EA 3D0KA 3WLSA 1PX2A 4ZOLF 3UTDA 1YRQA 1XTBA 1IEWA 1YE8A 5TDHA 5HKKD 3LQYA 5KSYA 1NBEA 3WL5A 1ZUWA 1GSAA 1Q1BA 2XHEA 1T1RA 5EIAA 4AN0A 4D92A 2O8BB 1QIMA 2FW8A 1WSAA 1Y9AA 3A1WA 3WBKA 1QK3A 3WXMA 1E5VA 1WNTA 1FQKA 1XZLA 2IC5A 3C7KA 1IMJA 2UZIR 4H1HA 5CYPA 4NAUA 1IK4A 3LF2A 2AQIA 1ZNQO 4NK5A 4HQFA 2PNJA 1HXHA 3I4LA 3A1EA 3MPOA 5LOVF 1V6CA 2ZUCA 3MLAA 4RVDA 4W5QA 1XO1A 4UM5A 4GC9A 2PQ2A 1CZLA 2PSEA 1X15A 4HPWA 3KE9A 5BOVA 3EAQA 1P45A 3KKOA 5EJ7A 5DV9A 4V0SA 5DO9A 4MPTA 2W2TA 4CIBA 2PUJA 1XZMA 4G5OA 5E2BA 4A3SA 3IURA 4U7HA 3LP5A 1DELA 4OHWA 2FLVA 4A6EA 1P18A 4EQ6A 5KOHA 5H9WA 3BMCB 3NX4A 2VHCA 3C5WP 5JARA 2A0FA 1SOMA 1S9DA 3BL5A 1Z07A 3KKQA 3P2MA 1QRRA 5CJJA 1YJ8A 4HXEB 2M1XA 5HZMA 1SBCA 4PC7A 2WUFA 3CLSC 3H4VA 1CY8A 3HV0A 2QN7A 2VKQA 4M89A 4HGOA 5LNK1 1AGRA 1HDIA 3U3RA 2AFVA 4WBNF 3KEQA 4XJSA 2CMGA 4RUKA 2V6MA 2ZR9A 3FW1A 1J06A 5KSPA 1A50B 3P7MA 3MJHA 2FFQA 5T7BA 4HDRB 1ZUHA 3DTNA 3S2YA 1OHHD 3NR2A 3L4JA 3OIWA 3E1GA 1O94D 4PX9A 1JKFA 3H8SA 2QN2A 3BWVA 1V7QA 5CDTA 2ZT7A 4P4UA 2BC9A 3L0ZA 3ENQA 1P4AA 1O95C 2FSIA 3L7YA 3LOQA 4DJJA 1PW5A 3HR7A 4Q24A 4X1IA 2VTBB 2ENWA 3ANMA 2FUG1 3QUSA 4P31A 5CG2A 4WK4B 2R47A 4RLQA 2Q6VA 3BGIA 1ZGCA 5BSUA 3WGTA 3WIVA 3I9MA 1PR9A 4PSDA 3KQVA 4U2GA 3TVDA 3HJGA 4N65A 3WKAA 6REQA 3GARA 3T9FA 2H1SA 1GGJA 3KD2A 3QITA 4LK3A 1MIOB 1ZESA 2JBAA 3B9BA 3JQGB 1JKMA 3KYDB 4N5LA 1RC1A 1G8FA 2I33A 3DWGA 2I55A 3GJTA 2C07A 4RZSA 5I9TA 1KI7A 5GMOA 1KEKA 3DV2A 2HPZA 2V97A 7GPBA 4FGJA 1ENZA 4BZXA 2HHHB 3VHXA 3EMVA 4IRUB 2UXDB 1H4TA 2QSYA 1RACA 2WAYA 1KZ1A 3PFFA 1GUDA 4YRGA 4S1TA 5TPZD 2QZ9A 3KIPA 3B3QA 3LUGA 2WVGA 2OHXA 2XEDA 4EKNB 2WG1A 3GLUA 3HJNA 2AFRA 4UXHA 3F7TA 5GONF 1N25A 4W63A 1C3VA 1IIRA 3QWHA 4HL6A 4HWTA 3SYMA 4I4IA 2Y1GA 4ENPA 3FA2A 1C2YA 2ZU6A 4IJVA 3DMHA 4XRRA 5EHZA 3PSHA 1BQ3A 2G5TA 4J4TA 4L8FA 3U39A 4A0SA 3UAOA 5LR6A 4AZWA 3EFEA 3HJBA 3LHIA 3OA0A 3O1IC 3OKPA 4K9KA 1WVMA 1O97C 5LP6A 2NZXA 1NG9A 3R5XA 3F6BX 4N76A 4MWGA 2ZE5A 3A14A 4UJ5A 4AYTA 4RJ2A 2HPHA 3ND8A 3QX7A 3RC9A 1FRZA 1Y82A 1F14A 3VPFA 1NF3A 4N0MA 4ZT6A 5HBGA 4DA9A 5BR7A 3ITKA 1Q3HA 1LTHR 2XADA 4IXWA 4IQ4A 4MLCA 3RYTC 3GOQA 4GZ6A 3GDOA 4DBLC 2B25A 1W0KA 1Z4PX 2VT3A 3R8XA 1F2TB 3D6MA 4P7KA 1TI7A 2IUSA 3C6BA 1RPAA 5ALJA 4OHCA 1ZMRA 2GZAA 2J5XA 3TQRA 2Q28A 4Q39A 3IDFA 2XAUA 4JJEA 4KYTA 3Q0IA 2QPTA 1NONA 2X2FA 5D3ZA 1M5TA 3GGCA 4RPIA 1HTWA 5ILQA 2PSJA 3PCRB 2QE6A 4PG7A 1TJPB 1LBEA 3B38A 1I4TD 1Q74A 2GEFA 4IRXA 4KXXA 4LDPA 3OOSA 2QTGA 5SYNA 3ST7A 2G4VA 1NTRA 2FE1A 3PHGA 1BIFA 4FSHA 3AQIA 1PF7E 3JAKB 4OB6A 2VWHA 5E7IA 3JASA 3EZLA 3ZDAA 1EGVB 3LPMA 3KQQA 1ZUNA 4MJ7A 1JHUA 2QD5A 1TW2A 1W73A 1DAPA 1LK5A 2D0PB 3V8VA 1JLKA 3FUTA 3DBOB 1QQ7A 5L8VA 3GUCA 3DA8A 2Z8YA 2P27A 4C6RA 4EHHA 1D4FA 2RB5A 5CLQA 3EEFA 4JI3B 1KOGA 4MV9A 2FOXA 5EKUA 3EIEA 3ZE9A 4CLXA 5HZGA 3BK1A 3I4FA 5AI9A 4E12A 2XZDA 1CZKA 3PNPA 4CEHB 1I30A 1F51E 2TRSB 1YTLA 4JOCA 4PO3X 4QKQA 4GIBA 2GMWA 2QL5A 3A11A 2H9YA 3ZWDA 4FFBB 1MBZA 4L5CA 4H60A 4HCJA 4EL0A 1P77A 1R6XA 4A2PA 4YCBA 5EQFA 5SY4A 4NE7A 3K15A 3O1LA 1Q44A 1J9EA 1Y7PA 2IOHA 3OQHA 4EJ0A 2EGGA 4FEYA 2PZAA 4UTVA 4YR9A 4REQB 2P77A 4ZXFA 3A06A 5TNXA 3V8EA 1ETUA 3TUZC 1E3TA 4NBNA 1B93A 1B8NA 4IIJF 4IDQA 2R48A 2X7HA 4IIBA 4O1IA 5AHWA 4HYEA 3RNLA 3U61B 4Y1EA 3SNKA 1Z2EA 3TM5A 3G88A 4P4NA 1FS5A 4ZP1A 4DRXA 3TOVA 4TKUA 4HYTA 1VG0B 4S35A 1TA0A 3MCAA 4B85A 5TVGA 2Z30A 5CPFA 1TMKA 4DA7A 2IYYA 1B15A 2V65A 3CKKA 4I81A 4DLNA 3KT8A 4M4SA 2YZGA 4UDXX 5IZCA 4A6DA 2G9UA 3MQ4A 1J70A 1KJ9A 1Q11A 1F6DA 5FUYA 2J9FB 3B70A 2JRCA 3D5TA 3GBSA 3N1UA 2PKCA 3ZCRA 1YI1A 4YGYA 1YRHA 2QTNA 1ZXLA 4KXMA 4OMUA 3QEOA 3ONEA 4YDRA 5IKEA 2QD1A 4F04A 5TQ0A 5J23A 1FUYB 2IGBA 1V8DA 2C8VA 2WM8A 5IU6A 1E7QA 4BLRA 4E5NA 3IBFA 3P0JA 2YH2A 4RXUA 4KYIB 4DV1B 4BQNA 2ZGVA 4YONB 4RTNA 3DHWC 5LKRA 1ZCZA 1YB5A 2WD7B 3VNRA 3IIIA 1S3SA 1WF6A 2PZMA 4FINA 3HM9A 5ARCA 5ELXA 2EKQA 1P62B 5JG7A 2PRYA 1PVVA 3C5HA 1DAEA 4B4VA 2B98A 3K1YA 2CXXA 3OPYA 4W4TA 3V2IA 3U2QA 2IKQA 3V55A 4A1OA 4YRNA 1QQBA 5BO5A 1E2KA 2YNMD 4YI3A 5JEEA 5JMOA 4DMFA 4HRVA 1G42A 1RBYA 3WSVA 2R8XA 3ZW8A 2NTNA 4NULA 1UEIA 3RFUA 4RZ3A 1I4WA 5LC1A 2IDJA 1WPXA 5DGIA 3S68A 4ILKA 1ORRA 1QGUB 3LVQE 4MUMA 3MGCA 1P2UA 3H5WA 5FUBA 2NQ2C 3DFMA 3T7KA 3OCYA 4DCMA 4RMNA 1N2EA 2CFIA 2FB9A 2FFJA 2H0AA 4L73A 2HCBA 1DDGA 1GZSA 1PR4A 3NQ41 4NFHA 1FJHA 2OE2A 3EA5A 4QFMA 2R6ZA 5F76A 5C7IO 4L8WB 2K2QB 4F6LA 4B7UA 1A76A 2AQHA 3GVPA 1FTYA 4PLGA 3RKUA 2C4TA 5EJ8A 3EB9A 2VH1A 3PENA 2VNHA 2EZ8A 4JC4A 1M66A 2Z2IA 1EWVA 2EG9A 2XXAA 3BS4A 3DS8A 3N87A 1BD4A 3I53A 2QGNA 2OHJA 3H6KA 2EL7A 2GN6A 3ZK9A 4LI0A 4DMMA 4F7DA 2QXTA 1RJDA 2HO5A 3F0TA 1NXPA 1TM7E 2HGZA 3U4HA 4Z4EA 5AM1A 4EGAA 1KI2A 3SYNA 1SAYA 4XYMA 2ISSD 3RSOA 2ZB7A 2YX1A 4J1SA 4RDHA 3TQFA 4F2WA 5K05A 2CXSA 2V1UA 1RXSA 3KAKA 4EW6A 4D3FA 2PUDA 2A88A 1HR0B 1ZWKA 3CV3A 3HY6A 3PIRA 2XKJE 4A5OA 3GLFE 1US8B 4DIOA 1OLSB 2HA4A 2BFBB 1NY6A 4DUGA 3KYCB 3HDGA 4ZWNA 3WYNA 3UJDA 3IGFA 3NC4A 3MWLA 5EJFA 3Q2IA 3THSA 1PDOA 4JITA 4C87A 3VJRA 2O3RA 1REQA 2CXQA 4FGLA 1WLSA 1ZNYA 2ACVA 4AJKA 3II6X 2PWBA 3MSCA 4RM3A 2B5OA 3AHFA 5EIFA 3JW8A 4EWLA 4BU0A 5HFJA 3FKQA 4P4LA 4TRJA 3GLHB 5EE0A 2M6LA 3LT2A 2QM3A 3NM6B 5CHEA 3OTWA 5JH7A 1R50A 3B2QA 3A3YA 1PGPA 3L06A 1ICIA 4P4SB 1U65A 5A7GA 1G4HA 1W5FA 4UFPA 1BOFA 2WMOB 2QV7A 4AO6A 3C48A 1QP7A 5JD3A 4FCWA 4CDGA 2XD9A 4LNUB 4MVJP 1CY7A 4BATA 3ICWA 2A1IA 3GAZA 2VWPA 1Y1RA 5A7HA 1Z3CA 2YV3A 2ES4A 5M7EA 4GP7A 2B94A 4M9CA 4UMDA 4ZOEA 2FPLA 4KQ9A 2XA1A 4CKCA 2C4NA 4R2HA 3N2KB 2EZ4A 3MOSA 4FGUA 4AZ0B 1UIMA 1SULA 2ZR7A 3ZOKA 4D3YA 1E1RA 3GRZA 5JZBA 3KYBA 5J2TB 4M55A 1IRIA 3D8BA 4JQZA 4WAUA 3T3GA 1FBNA 3JD4A 4GI5A 2YWHA 3H9EO 3NT4A 5ERYA 3E7DA 1RU3A 5C32A 2DQZA 4TTIA 4UNPA 4J7CA 2HDOA 4XPIB 2W90A 5F5XA 2PGXA 4RORA 4TS1A 2AI1A 3V7NA 3W2GA 3VXKA 5IJ0A 13PKA 4UQPA 4PIMA 2ZEJA 4ZI7F 3JQFA 2HJRA 3NC0C 2CVZA 3FTPA 4MO2A 4O4LF 1AUVA 3CB2A 4JOSA 3R76A 1GL3A 1MX1A 3UK1A 5JYEA 5T3UA 1E7WA 1PV2A 1D5WA 1TQ8A 3AEXA 5EQJB 4DJDC 3BMQB 3I9FA 2WFAA 1DAOA 4JLKA 4LCBA 4K2HA 4PGMA 4PSVA 4EA7A 5M5BA 3BT7A 4EX6A 1I5RA 4AJLA 1DAGA 2DHRA 3HLYA 3AKCA 1J8VA 1ZD9A 3EZGA 4DLRA 2Z5FA 2WJ6A 4R8VA 4UM9D 3O4IA 3WGKA 3AY7A 3PYMA 5DYTA 3V4PB 3V8NA 5AVRA 2MSLA 3HBFA 1F8YA 2J7PD 1KE2A 2WG0A 4DCVA 1XJQA 1CETA 1R0ZA 2JFNA 3MGKA 3QKSB 4M0KA 4RXTA 2G08A 2ZZNA 5AUQA 4K1XA 1KYZA 4IV8A 1ZI9A 1VIMA 2VNAA 2Y92A 3FBTA 2WY2D 3DJFA 3T9CA 4IMJB 5B7PA 1N4DA 3I5UA 5KKAA 3CEMA 2OQVA 3TSOA 2GEKA 1YR8A 3Q9SA 4FIDA 5BY2A 4ZTUB 4PBTA 1MORA 3DM5A 2R5NA 3HBAA 1YGPA 3ZVMA 4IH4A 4A27A 3QI2A 4NJMB 1C4KA 3AL3A 4GVXA 3LOPA 4RCYA 3FWNA 3VKVA 3W8NA 5IHPA 5ALSA 3TGLA 2PUTA 3KVRA 3SXUB 3ZQ4A 2F1IA 4R2KA 3TN7A 2JK0A 2QQFA 3V8BA 3WK5A 3NTVA 4M1MA 2C2WA 1UBRS 1T3ZA 3KXKA 4FU0A 4YP5A 4RH3A 4Z9XA 3NASA 1BW9B 3DQZA 4KIGA 4XWWA 5FTNA 2BIFA 4LN1A 2C0PA 1UINA 1CF9A 3UH0A 4J0QA 4HDCA 1D2GA 4UMFA 4GE3A 4HUTA 1F2UB 2ZJ7A 1ZR4A 1J2JA 1P3JA 1J22A 1U1FA 1YZFA 2JZNA 2OOKA 1KZYC 1I2MA 1C4WA 1NYRA 2OFFA 3KE8A 3ROFA 4HLDA 1OKKA 3RF6A 2CLEB 1U2GC 1O1YA 3PD7A 5MFZA 4NS4A 2BLLA 2ZYSA 3DCNA 1VSUA 4NFSA 1MO4A 1E8DA 1CZOA 1U28A 2QU8A 4HLCA 3W90A 2Y4OA 3G2QA 3HI6A 3IOEA 3MERA 1E4EA 4JSTA 5EWLB 3LIIA 3ND7A 2NQTA 1RYYA 3E9QA 2NPFA 1YIAA 5LYJF 1BVYF 3R6LA 1S9HA 4ZKDA 2Y4NA 2HSEA 5AR1A 3D02A 3ODPA 1N2CB 2IYUA 3B2NA 1JN0A 2AC4A 4EVQA 2DX7A 4EY8A 5ICGA 1AV6A 1ECLA 2FVXA 4YHHB 4IUDS 1XQYA 2C1XA 3LBYA 5KYVA 4YCNA 4CUZA 4OM8A 3FSGD 4J0DA 1CDZA 4J4BA 4NVRA 4EENA 1M74A 3RUDA 3I5AA 3L7JA 3Q1KA 4RD3A 1XSEA 1T25A 3QEJA 4ZOBA 5FUMA 4ECEA 3EW7A 1S1CA 3CX4A 3P9CA 1AGNA 4RH0A 1VKRA 1AURA 3O1JC 4R7TA 1UMKA 4C9BA 2VXYA 1G291 1ONSA 1UEXC 1NQOA 3RHSA 5LPNA 1EXDA 1RBZA 2VQDA 2Q6IA 3HH8A