1P7GA

Crystal structure of superoxide dismutase from pyrobaculum aerophilum
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
211
structure length
211
Chain Sequence
SVTTKRYTLPPLPYAYNALEPYISAEIMQLHHQKHHQGYVNGANAALEKLEKFRKGEAQIDIRAVLRDLSFHLNGHILHSIFWPNMAPPGKGGGKPGGKIADLINKFFGSFEKFKEEFSQAAKNVEGVGWAILVYEPLEEQLLILQIEKHNLMHAADAQVLLALDVWEHAYYLQYKNDRGSYVDNWWNVVNWDDVERRLQKALNGQIALKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Structure of superoxide dismutase from Pyrobaculum aerophilum presents a challenging case in molecular replacement with multiple molecules, pseudo-symmetry and twinning.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Oxidoreductase
total genus 72
structure length 211
sequence length 211
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1p7gA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1p7gA02
1JR9A 1IDSA 2AW9A 1VARA 1IX9A 3DC5A 3QVNA 1EN5A 3OT7A 1EN4A 1MMMA 5AG2A 2P4KA 4E4EA 1XDCA 1BSMA 1N0NA 4JYYA 4YIOA 1PM9A 1ZLZA 2ADQB 4JZGA 1ZUQA 2CE4A 1AVMA 3EVKA 1AP6A 3AK2A 1KKCA 1B06A 3BFRA 1WB8A 1BS3A 2CDYA 3TJTA 5A9GA 1D5NA 4X9QA 3CEIA 4C7UA 1I08A 1VEWA 1LUWA 1AR5A 3LSUA 3K9SA 3RN4A 3C3SA 4JZ2A 1WB7A 2ADPA 3KKYA 1LUVA 1GN4A 1ZSPA 1MNGA 4BR6A 1IXBA 4FFKA 1N0JA 1GN2A 1XUQA 1AR4A 1ZTEA 2RCVA 1BT8A 3MDSA 1EM1A 2QKAA 3C3TA 4YIPA 1MSDA 1GN6A 1JA8A 3IC9A 1MA1A 1EN6A 1XREA 1AP5A 4GUNA 1SZXA 3AK1A 1XILA 1P7GA 1Y67A 1I0HA 1QNMA 3DC6A 2QKCA 1GN3A 3AK3A 2GDSA 4F6EA 1PL4A
chains in the Genus database with same CATH superfamily
1AI4A 4DV2B 1GTOA 4KXRA 3K9AA 5B1AC 1F4MA 1NTKH 1OV9A 2DOSA 4WF9V 3E22B 1J5EO 3SPJA 4GX0A 4DRXA 3LSQA 4DV7O 2F93B 3N27A 3E89A 3CWBH 4AI8A 4PDRA 2ZR2A 2P4KA 4EKWA 4PDVA 1WPBA 2XAJA 1ZAUA 4LP8A 5GTIZ 1W59A 3K5MA 2UXDB 1YJWV 1U96A 1JVMA 1AVMA 2ZXWC 2XOKG 2XAFA 3HKCB 3NXSA 4ZOLB 2NLJC 1CXZB 2DYRC 1WB8A 2EIJB 3ABUA 3HB3B 2CDYA 3STLC 2LGWA 2QWOB 1MZFA 1HDJA 2W0XA 2FKXA 3K08A 1I08A 3ZHSA 3RN4A 5IDJA 3C3SA 5JH7A 4X66B 3RGBA 4JI2B 3LNNA 3JAMN 3FB8C 5IJ0B 2BSKA 3AG4C 4I0XA 5KX5B 2Q0AA 3N2GB 4X1IB 3LUTB 4FJCC 5C8YA 1Y4MA 3TXQA 4FM0A 3MDSA 4JI0B 1IJGA 2ZM6B 1K5QA 3RT3C 2EILB 3M99B 5EZYB 4YIPA 4I5SA 3A2FA 4JI3B 3IC9A 1M56B 1HR0B 3OGCC 4EEQA 1YJNV 4X66O 3HPLC 3K0GA 3U10A 4DO2A 2YDEA 1SZXA 4FM1A 4FLVA 2ZDIA 3ZRWB 1VQ8V 3OW2U 3E2EA 2KQXA 3DC6A 3T1YB 3C90A 3T1HB 3K57A 2PZSA 4JI0O 5E79Z 4DV3O 3JD4A 2X6BA 2LO1A 4MVQA 2EINB 3DSQA 4JI3O 3E8FA 2RMKB 4LWSB 2YIBA 4X8AA 4HNAA 5J9PC 1IVSA 2OCCC 1TUBA 1FS0G 4DV5O 1NH2D 3T1HO 4FLUA 2GHYA 2ZE7A 3ABLC 1N32B 1NTZH 2HFEC 4X20A 2NN4A 2YEVB 3GB7C 3ABKB 1QBZA 4QNHB 5KA6A 5L3EA 3DTUB 4FZ1A 1H2SB 2QR4A 3CJHB 5IE9A 4C7UA 3SPGA 5B1NA 2GTSA 2Q68A 2OYQA 4JZ2A 1JCHA 4ZI7B 4JV5B 4PDMA 4GCZA 2HVKC 2UU9O 3T4ZA 4FFBB 5LP6A 3KCXA 2BOCC 3OMIB 3ZHTA 1ZL8A 4DUZB 4DR2B 1SQQH 4O2BB 3ZMVA 1QVFU 4DR7B 1RM1C 2M6YA 4GX5A 1VQNV 1PNMA 1XQ8A 4CH3A 4J41A 1L1FA 2R9AA 4IYIA 1YJ9V 1F23A 3ZRXA 1AR1B 1TVKA 4WFFA 1SF9A 3P3NA 3E8BA 4DUZO 3CCSV 4DR2O 1MSWD 5LHHA 1GN3A 3FX7A 2QWRB 2GDSA 2ZIOA 2LP7A 1DTOA 1KD1W 5HFMA 3JASA 4I7ZB 4DV6B 5LBQA 1SQPH 4I4TB 3H1KH 5B1BC 3TK1A 5H9CA 3LDCA 3QVNA 1VF6C 4GT1A 4W4LA 2O57A 5GONA 3R65A 2LFSA 2A06H 4QPJA 2KG7A 4ZHQB 3P3PA 1IXMA 3OTOO 1VQ4V 2Z0AA 1AROP 4PDLA 2Q6AA 3ABMC 3CRRA 3P32A 4PD4F 4LF7O 2CAZC 2WSSG 5LP6C 3OR7C 4YHHB 4I50A 4JI5B 3ZMSA 1COWG 1E79G 2YS8A 1LR1A 3TJTA 3NR7A 1QHTA 1XNRO 2Q67A 1K34A 2XAHA 1PNKA 3LSUA 4AHCA 4LH7A 5KA5A 1IBKB 2WLIB 2A3QA 3DXRB 2YXYA 2OWOA 4RUFA 1Q8IA 4UCVA 3UQ8A 4YHHO 5BR8B 1XL4A 2WAMA 3AG2B 1VP7A 4UCOA 2PI5A 2P7TC 3JATB 5B1BB 4DK1A 5K1PA 1XBLA 1AJNA 2W6IG 2CTPA 1DF5A 3OEHG 5FNVB 1M1KW 2FL4A 1PKXA 2VS0A 2ZE8A 1NVPD 1H38A 2UXBB 4KUMA 4QJFB 4B08A 2B1IA 3WG7C 4F6RB 2BE3A 4O4IA 3ABMB 5H2FZ 4JAAA 2QWQB 2WLLA 1OCOB 3FYEB 4JI6B 3ZRVA 4K8XA 2FYUH 3ASOC 5KHHA 4RUEA 4LNUA 5JJEB 2ARHA 4DXWA 3OEEG 4PA4A 1IURA 3CD6V 4LFAB 1Q5OA 5BMVA 2F4VB 2UUBO 4R50A 1SQVH 1XDCA 3OD4A 2XNDG 4JYYA 4YIOA 4UV9A 1SA0B 4JI6O 2XAQA 4TQFA 4Z2WA 3VBBA 4FLTA 2OIEA 3QO7A 1WLEA 2UUCB 4LFBO 1LNQA 2XHBA 5F2VO 5JJNB 1HP8A 2R9IA 4LF8B 2BOBC 1BGYH 3J7AU 2OTJV 3CCMV 3A8TA 3CCUV 3CYOA 3A0HZ 5JVDB 1NJIW 1YCIA 4LFAO 2Q4PA 1Q43A 3CS5A 1V55B 1Q81W 2IU3A 5LGUA 2GUZB 3H1LH 3R66A 4YJ3A 1BL8A 1FYJA 1JOYA 3UKMA 3ZMZA 5CBGA 4KHPB 4UVCA 4ICGA 4H33A 4CH4A 2HLDG 3JAKA 3K3WA 1QR8A 3GWOA 2ITCC 1FXKC 1GN2A 4X62O 3OUSA 4TT3G 4XBFA 3A0RA 2E5LB 2ILMA 5LGNA 3BAAA 2QKAA 5JCOA 1YITV 4TV9A 4UFZA 5LXTA 5J2UB 1K4CC 3F5TA 3KZIZ 5LA6B 3VQXA 3L71H 3UT5A 4XDKA 4KHPO 4MTXA 2YUAA 3CRQA 1BQ0A 3RVYA 4RQFA 2BCCH 3ML0A 4EB6A 1AI7A 3RYIB 4QIWF 3CRMA 3BABA 5DN6G 3VQYA 4LFCO 1SS3A 1PL4A 1HW7A 1KP3A 4DW0A 4UCUA 1AI6A 4KL1A 2NNUA 3D8CA 5LL6Y 1QLNA 4CS4A 1XEQA 3B8MA 1VMGA 3OT7A 4PELA 4P9OA 1BSMA 4FM2A 2JIZG 3JARA 5EK0A 4GLXA 1TAEA 1YTFD 4BW5A 1URFA 3K79A 4DV1B 1QLEC 2Z5UA 2BTQA 1VQ7V 3GVMA 4X65O 4HYOA 2Y4UA 4JYAB 3H1HH 2ZQMA 1WA8A 1YXBA 4IHJB 3RVZA 4CC6A 1SQGA 1BZKA 4JYBA 5JCOC 1L8DA 4LF9B 2JGDA 2ATKC 3HKCA 1SQXH 2OCHA 4ZOLA 4PA6A 3BVOA 3JYCA 4X88A 2CH7A 5DECA 1XMQB 3M8AA 4DV1O 3BY6A 1NR1A 3CXCU 1HNZO 5EC2C 2RNBA 1N0JA 1SZTA 5LYJB 1XMOO 2EIMC 5L3GA 2IJJA 2F43G 4JI7B 1G6UA 1DF4A 3RYFA 3WB0A 1VQLV 4I9QA 3ZMTA 5IJ9B 4BIOA 4UCSA 5IJ0A 2AZ2A 3N2KA 3K06A 2Q8VA 5KMGB 1WPXA 2QJ1A 4O4HB 2DQ3A 4JI4O 4CS3A 4QE9A 2WA4A 1KECA 2N74A 4WFGA 4N21A 4O4JA 2DN9A 1WP7A 5C93A 1I0HA 5CN0A 3X2QB 1NR7A 1OJHA 2JDIG 3JCUZ 3FAVA 2HR3A 2BTOA 1K5SA 3JD3A 2YXLA 1J5EB 4H0LB 4DV7B 4MVRA 2HJFC 3L75H 4DW1A 3ABTA 1CP9A 4J7JA 5IY5C 5D5QA 1MMMA 2QE7G 4BAYA 5FL7G 4YJ2B 3T4DA 1AJQA 2EIMB 3O65A 2B9ZA 4IGGA 3K03A 2CE4A 4MTFA 3EVKA 1AP6A 4LF4O 4WBNB 2Y0IA 1Z2GA 3JAWA 3K5LA 1Q82W 2YC0A 4J42A 4X64O 3JALB 3OUFA 1WAZA 4FIPC 4TV8A 1XI1A 1PP9H 4JTCB 3RYHB 3CMAV 5IWAB 2PUSA 3SPIA 2F95B 2VRZA 2LW7A 4B3SO 1GN4A 3CRCA 2IW5A 1R3KC 1JPXA 1ZSPA 2ETNA 1MNGA 4BW9A 4O4LB 3SYAA 5B3SB 4U7OA 2RQ6A 3BEHA 1EZVH 3OTFA 1FJGO 4FFBA 2L6LA 3E35A 3W7UA 4KFMA 4MSWC 2C2AA 5IWAO 2R70A 3EFFK 5EC1C 5BZBA 5IY5B 3ZN1A 1N33B 4WFBV 3OMNB 2X6CA 3ZBHA 5CBFA 2QDOA 2JEUA 1TUEB 4O2AB 1QCEA 3JD0A 2CGNA 4DV3B 5B1AB 5LOVA 3OR6C 2CK3G 1WNSA 2ZD9A 3RYCA 2JVDA 4KP4A 1B04A 4GZRB 5DEDA 1NH2B 2UXCO 4DK0A 1N33O 1P84F 3MHHC 4XDLA 1B3QA 2ZXWB 1YDXA 3VQVA 2HKOA 1RSOA 2DYSC 1N0NA 4DV5B 2ODMA 3HKDB 2FB5A 2DYRB 4DUYO 1PNLA 5IYZA 5EBWC 1NTMH 2AXTZ 3KCYA 4PI2A 5LMNO 3I5DA 4RAIA 2PY5A 3CP1A 4RO2A 4MVUA 4LH6A 3K58A 5CB4A 2IJHA 3AG4B 5JJJB 3CCRV 3HKEB 4JF3A 2UU9B 2LQTA 4K35A 1I5YA 4X1YA 4CC5A 3E8HA 2D3OW 1IXBA 4DR4O 1Y76B 1HNXO 4WFEA 2B1GA 1AR4A 2WLIA 3FB7C 1ZTEA 4LCUC 3F7VC 3QG5A 1VQPV 3G6EV 4Z1VA 1KKDA 1N8RW 4TUYA 3ZMUA 4MW3A 3B09A 2PYLA 2K9PA 1MA1A 3ETQA 3CC7V 4BIUA 3JD1A 2ZDIC 1XHZA 3E86A 5KHGA 5CA0B 4I55B 2Z3YA 5EYPA 1XHXA 4DR5B 4UCRA 4EFEA 1OCZC 4FVMA 3APOA 4ZBMA 5KLVH 2AW9A 2OCCB 1YSCA 2FMLA 4PI0A 1NT2B 2AHZA 1D5AA 4JPRA 4OPAA 3SPCA 2UUAO 3FB6C 5JH7B 1GH6A 1BQZA 3Q4HB 1OCCC 3CC2V 3OTOB 4RQEA 2DW4A 1UJWB 2UXNA 2GSMB 1Q6UA 5IYBO 3ABLB 2BSKB 4NVPA 4I0XB 2QSAA 1ZLZA 4JZGA 1GO3F 5JQGA 4LF7B 1BHBA 2P06A 4DR5O 5C8YB 4YXWG 3AK2A 2EJ7A 2LJ2A 3PJSK 3RBZA 1P49A 3CCVV 4GKKO 1YIJV 2W0FC 4FLYA 1XNRB 2LFRA 4J11A 1WJZA 1AILA 3OE7G 3OFNG 4BWAA 1WB7A 1RM1B 1NBMG 1FAFA 3IJ4A 4B3MO 2F66C 4R8CA 1FFXA 1NVPB 1CEZA 1OCZB 1EZJA 3ASNC 4NXNB 5ITZA 1JFFA 5CA1A 1WP8A 4IT5A 1JJ2U 4GKJO 4IIJA 1XOUA 3ZHUA 1Y74A 3ZIAG 3UM7A 4HNAB 4DV4O 4J7KA 1TUBB 3BA9A 1JA8A 3SYQA 3OMAB 2QM7A 3K0DA 3ETEA 4JI8B 3FFQA 4GUNA 2CTWA 3S3XA 2QTOA 4NXNO 4X20B 3ZS8C 4QE7A 4MTGA 4DV0B 3I55V 1M5IA 4NKGB 1K3EA 2DWEC 2RJZA 2ITDC 1RPOA 3I56V 4ABMA 2Q0OC 2R9RB 5J2TB 4U7NA 4ZIBA 3OAAG 2Y69C 3IC7A 3UO2A 2Y48A 2UUBB 4JI8O 4CH5A 1SC5B 3QNEA 2YIBD 3ZHVA 2UXXA 3IGAC 3U11A 5LP6B 5KUKA 1ZL8B 3AG7A 4PA9A 1AJPA 4DV0O 4X1KB 4WFHA 4G28B 4LFBB 1D2DA 1E1RG 2Q9LA 1H2GA 2G38A 4NYKA 4WFAV 1YF2A 3H01A 1TVKB 2WLHA 4AILC 3SJAC 4K3AA 2ZE6A 4FPPA 1KYOF 4GX2A 5CBHA 4JASA 3SDLA 3H1IH 3LDEA 3LSSA 3CX5F 1VQ5V 1WN7A 1YEWA 5KHKA 3CPWU 4IYHA 1HWYA 4UVBA 4EFBA 3W7WA 3JASB 3PN1A 4X62B 4U3JA 1SQBH 3BPZA 4J9YB 1W0KG 3B40A 1EM1A 4P2ZA 1Z5WA 3WG7B 4DR6B 5GONB 3G80A 3L70H 2KG7B 1SERA 2CTQA 5LHGA 2WPDG 3B2EE 1A32A 1S5HC 4PA7A 4PHZA 1OCRC 3WU2Z 1S72V 3ASOB 1SQFA 5KMGA 5LMUO 1P7GA 4ZKIA 2XT9A 3EHBB 1IBMO 3F7YC 4I50B 4FMTA 4LFCB 3BRCA 3WFVA 3HKBA 4J80A 3O9OA 4LF5O 4D7TA 4DR3O 4DR6O 1GAXA 5EIBC 5TISZ 1YTFB 3ZX6A 2N04A 2A0LA 2JGUA 3RFRA 2MW2B 3SJBC 4HBNA 3B8NA 5KHJA 1RP3B 4YY3O 3JD2A 2VQEO 3EXAA 1G4YB 5L3DA 4X65B 1ROPA 2RN9A 5L3FA 1H2LA 1B06A 3H1JH 2F1MA 2YICA 1X59A 1EBOA 1H5WA 1MZEA 3VQWA 5A9GA 4X9QA 5H6QA 4NXMO 4DYLA 1OCRB 3T2MA 4O4IB 1LUWA 1AR5A 3E22A 1FXKB 2WLLB 4NTYA 2YI9A 3JALA 2N05A 1HNZB 1XMOB 3SYPA 2EZOA 3CRAA 1HNWB 4JTAB 1L0LH 1SKVA 1VF7A 4H37A 3TCUA 4LNUB 4OPHA 1Q90D 2WLJA 4FLXA 2ZCEA 4CBCA 5FPOA 5B1OA 2VQFO 4JI4B 5BMVB 4JI1O 4MVZA 2IU0A 1YHQV 4QPKA 1SESA 3CCQV 1S5JA 1M57C 4LF6O 3T1CA 3AK1A 1XILA 5GTHZ 1HNWO 2OT5A 1Q6IA 3U0ZA 2Q69A 1YVWA 2YXHA 3BA8A 5KX5A 1BHAA 1VF5B 3N2GA 5H5NA 3GWKC 4X1IA 1VARA 2YI8A 4O2AA 3TETA 1IX9A 2EIKC 2GBOA 1B6QA 1M93A 4MVMA 5EIBD 5LHIA 2KKWA 1KC8W 4YJ3B 5EZYA 3MAQA 1QLEB 2XAGA 1Q86W 4B7EA 1EN4A 4B3TO 1GM7A 1AI5A 1QU7A 1KMIZ 2ZNJA 3ZRSA 2PYJA 4JAUA 1R6KA 3ZRWA 4LF4B 2MK3A 1W0JG 1FXVA 2IJIA 1ENVA 4HZ3A 3J81N 4TV9B 3CXHF 4CH6A 5LXTB 4X64B 1G8MA 3UT5B 1K33A 1S76D 1AB3A 1MABG 1D5NA 3CEIA 2P90A 1VQ6V 4J9ZB 3ICXA 4LWSA 3K04A 1VQMV 1I94O 4P9PA 4B3SB 1NQTA 2EIJC 2QGNA 1PL0A 4EB6B 2YIAA 2DMXA 4K0KO 3ZHRA 4FLWA 1K92A 3P30A 1FJGB 4G2KA 1X4TA 3QTCA 4TQDA 1ZWIC 2YEVA 4WCEV 4FLZA 1DK1A 2ZNIA 5IYCO 1MSDA 3B4SA 1GM9A 5L3BA 5K1XA 1N34O 3CJHA 3JARB 2QM8A 2EILC 4NB5A 1PPJH 1R6TA 1M56C 3BHPA 4Q6GA 2BTQB 1R73A 1T5EA 4ZI7A 1XNQO 3CCJV 1WA8B 1J95A 3L73H 4O2BA 1N36O 1G1XB 2KB1A 5CA0A 4I55A 2JGDB 4DV2O 3ETGA 2UXCB 1VQ9V 4K8ZA 3CE2A 1K97A 2CH7B 4PJ0Z 3KDRA 5HFLA 1M4UA 2EINC 3D3QA 2OIGA 1K73W 5AG2A 2DQ0A 3G6BA 3ZEDA 1GK9A 1V54C 3FD9A 5IT9N 2ADQB 4DUYB 2WLKA 3Q4HA 3ETDA 2Y0PA 3RYFB 3THOA 2B5UA 2UXDO 2V4DA 5LMNB 3N2KB 2ZE5A 3K5NA 2WLNA 4E2LA 2LW1A 2E76B 1S77D 2R72A 3ABKC 1QVGU 4I4TA 3K5OA 2EULA 1S0VA 2Q7EA 3H9VA 4NTWA 3B77A 2VWKA 4O4JB 4BIZA 4TSFG 2JJ2G 4ZHQA 4DR4B 1HNXB 4JI2O 4BR6A 2XASA 1GMGA 2IH1C 3FAVB 1F7YA 3FKSG 5JWPA 3KG2A 3L74H 1F51A 2CGOA 1R3LC 3VOUA 3CC4V 3C3TA 1R3IC 4Q20A 2PTMA 2IJKA 2ZM6O 1P4RA 3CSXA 2X7RB 1GN6A 1H2MA 3CMEV 1QQCA 3AG3C 1VQOV 1HR0O 5BXZA 1V54B 2E3CA 4PA3A 4W4KA 1YZBA 4J10A 3RW0A 4UUJC 4JYCA 3ZCCA 3DXRA 2PI4A 2V1DA 2JJ1G 3CB2A 3JAWB 2KSDA 3T1YO 4DRXB 4FK5C 2JK5C 1IDSA 1JX9A 1H2NA 2IBZH 2QEXV 2QA4V 3SPHA 1VIBA 1ZX3A 3SJQC 2UUAB 4TV8B 3JATA 2DYSB 1VF6A 1FD9A 5FNVA 2QWPB 4X89A 4JTDB 3WB2A 3W7TA 4H44B 5J2TA 2P4VA 4UCTA 4QGPA 2ZT9B 1I7FA 1TA8A 4F6RA 1MOFA 3BCCH 2CTRA 1N32O 3CCEV 5KHIA 1H8HG 4GKKB 1BE3H 2HEPA 1NZ6A 3FB5C 4MW8A 2E75B 4X1KA 1BS3A 2P22C 1IBLB 1QR9A 3AG3B 3AEIA 5FPRA 1UFIA 4UXNA 2JS5A 1Y6XA 3E83A 4B3MB 4MVSA 5B66Z 5GW7A 3KKYA 1LUVA 1K9MW 5LOVB 4JV5O 2JEXA 3M7MX 3RYCB 3MHSC 1O9HA 1SA0A 4GKJB 3TXSA 4DR7O 3DGEA 5A2QN 4F4LA 2YIDA 2Q5ZA 4R6ZA 3LDDA 1IBLO 3RWRD 2AGAA 4DV4B 2ZKOA 3AG2C 2IH3C 1KP2A 4MS2A 2A79B 4PV1B 2LGQA 1FPOA 1RSOB 5JVDA 4TOIA 1EN6A 2DWDC 3W7SA 2CUGA 1AP5A 2H3OA 2GUZA 1OHHG 4N23A 5CA3A 3OGIB 3L72H 1I5XA 4RWUA 5H6RA 2P67A 3SYCA 5IYZB 2IM9A 5KAFZ 2F23A 3QO5A 2JRIA 1Q7YW 5LGTA 2QKCA 1DGSA 4OX9B 1R1BA 1OCCB 2Y4TA 1OCOC 1US6A 5CB4B 3DC5A 4DV6O 3D36A 4L87A 1KBHA 5J2UA 1FFTB 4X1YB 5LA6A 3SJCC 4E4EA 4H13B 4UV8A 1U97A 4OX9O 5EBMC 4JAVA 2HHHB 1Y66A 1NKDA 1P7BA 3BFRA 3RYIA 4TUYB 4JI5O 1NU1H 4DR1B 1DLBA 1JQ0A 4L8JA 2H8PC 1YI2V 1VEWA 3APQA 3ASNB 5KAIZ 1V9PA 3CCLV 4LR3A 3G4SV 4NTXA 5EYPB 1UPGA 1IBKO 1V55C 2HG5C 4P30A 4FFKA 2HHHO 1KUQA 3FYIB 1FXKA 4AQYB 5BR8O 2RCVA 5CMUA 1PD3A 1BT8A 2EX3A 4R7CA 4LC1A 2PGGA 1OZ0A 2EZPA 4DR1O 3L9DA 4IHJA 5EBLC 4MVOA 4IL6Z 2ZIMA 3SGIA 3D36C 3E8GA 2UXBO 5LMUB 5JQGB 1FKAO 1K4DC 4UB8Z 3UCSC 1IBMB 3JSNA 1W2BU 4B7KA 3IAYA 1N4CA 2P5OA 4AQYO 1R3JC 2WLMA 3AK3A 1FOUA 4LF5B 4DR3B 2Y69B 5LYJA 1NS1A 2WWWA 2X6AA 1S3JA 2JS3A 3G67A 1GKFA 2A7WA 4CS2A 5IJ9A 1Z5VA 2DE0X 1CPYA 5FLXN 1H8EG 2YSUB 5B5EZ 4YY3B 4O4HA 1SETA 2VQEB 3A0BZ 1FFXB 2F4VO 2EJRA 3JCZA 4G27B 3HR0A 1PM9A 5ITZB 1JFFB 5CA1B 4IIJB 3J80N 1KQSU 1Y74B 1NI8A 2D2CB 1BCCH 3G71V 2UUCO 2DJVA 2QTSA 4MT8A 4D6TH 3F5WC 4A5UB 4B3RB 1JNBA 4LF8O 4NXMB 1JJOA 2V7QG 3STZC 4ASUG 3WB1A 3ZN0A 4GYCB 2FTKA 1PV0A 1ORQC 5KUMA 1M90W 1R6NA 1RPRA 3SYOA 2ADPA 2QWNB 4UVAA 2H94A 3MD0A 4YJ2A 1KU9A 5BY1A 4B3RO 4OGQB 2VQFB 2EBOA 2E5LO 4WBNA 4JI1B 4LBEC 1KB9F 2E74B 2W6JG 1XREA 4LF6B 2HJDA 1XL6A 4FZ0A 3RYHA 4XDJA 4TWKA 3AG1C 1FXHA 3TGUH 5E1AC 2XTAA 2QM4A 2HVJC 4O4LA 1O9GA 1JR9A 2GTAA 1H2KA 2Q7HA 3OM3B 1GM8A 3X2QC 3ZHQA 1RFYA 2L35A 1EN5A 4D7SA 5IYDO 4B3TB 1M9NA 2M7WA 2RDCA 5L3CA 4GX1A 2P6JA 2PF4E 1THZA 1L0NH 1ZUQA 4U3JB 2OTLV 1KKCA 3W7XA 2VWJA 2WA3A 2Q73A 4NR1A 2Q7GA 4JYAO 3QO8A 2X0LA 5DM6V 4MTOA 3JAKB 1IZ3A 1I94B 2XUMA 2ZINA 4Z1MG 4LF9O 3K9SA 1E1QG 2GV9A 3AG1B 3ZJZA 2A9HA 4CZZA 2K1EA 4K0KB 1XMQO 2NR5A 3HKBB 4JGSA 3SR2C 1XUQA 3HKDA 1VQKV 1K8AW 4UB6Z 1S5LZ 4JI7O 4U3FH 1JMKC 5B3SC 1M57B 3D3IA 3UO3A 1BMFG 2AHYA 3K59A 1TGOA 1K7DA 3S3WA 4J7ZA 3IFXA 1N34B 2ZR3A 1MG1A 2HP8A 1Q6HA 4I9WA 1F4NA 2AZ0A 1SRYA 4OXSA 2QKSA 1XNQB 1Y67A 3HKEA 3QF7A 3JSLA 1QNMA 1EFRG 1GRJA 2EIKB 5D5PA 1Q3EA 3CHXA 1N36B 1Y76A 4F6EA 3LNMB 4HAMA
chains in the Genus database with same CATH topology
1JR9A 1IDSA 2AW9A 1VARA 1IX9A 3DC5A 3QVNA 1EN5A 3KDRA 3OT7A 1EN4A 1MMMA 5AG2A 2P4KA 4E4EA 1XDCA 1BSMA 1N0NA 4JYYA 4YIOA 1PM9A 1ZLZA 2ADQB 4JZGA 1ZUQA 2CE4A 1AVMA 3EVKA 1AP6A 3AK2A 1KKCA 1B06A 3BFRA 1WB8A 1BS3A 2CDYA 3TJTA 5A9GA 1D5NA 4X9QA 3CEIA 4C7UA 1I08A 1VEWA 1LUWA 1AR5A 3LSUA 3K9SA 3RN4A 3C3SA 4JZ2A 1WB7A 2ADPA 3KKYA 1LUVA 1GN4A 1ZSPA 1MNGA 4BR6A 1IXBA 4FFKA 1N0JA 1GN2A 1XUQA 1AR4A 1ZTEA 2RCVA 1BT8A 3MDSA 1EM1A 2QKAA 3C3TA 4YIPA 1MSDA 1GN6A 1JA8A 3IC9A 1MA1A 1EN6A 1XREA 1AP5A 4GUNA 1SZXA 3AK1A 1XILA 1P7GA 1Y67A 1I0HA 1QNMA 3DC6A 2QKCA 1GN3A 3AK3A 2GDSA 4F6EA 1PL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JR9 A;  1IDS A;  2AW9 A;  1VAR A;  1IX9 A;  3DC5 A;  3QVN A;  1EN5 A;  3OT7 A;  1EN4 A;  1MMM A;  5AG2 A;  2P4K A;  4E4E A;  1XDC A;  1BSM A;  1N0N A;  4JYY A;  4YIO A;  1PM9 A;  1ZLZ A;  2ADQ B;  4JZG A;  1ZUQ A;  2CE4 A;  1AVM A;  3EVK A;  1AP6 A;  3AK2 A;  1KKC A;  1B06 A;  3BFR A;  1WB8 A;  1BS3 A;  2CDY A;  3TJT A;  5A9G A;  1D5N A;  4X9Q A;  3CEI A;  4C7U A;  1I08 A;  1VEW A;  1LUW A;  1AR5 A;  3LSU A;  3K9S A;  3RN4 A;  3C3S A;  4JZ2 A;  1WB7 A;  2ADP A;  3KKY A;  1LUV A;  1GN4 A;  1ZSP A;  1MNG A;  4BR6 A;  1IXB A;  4FFK A;  1N0J A;  1GN2 A;  1XUQ A;  1AR4 A;  1ZTE A;  2RCV A;  1BT8 A;  3MDS A;  1EM1 A;  2QKA A;  3C3T A;  4YIP A;  1MSD A;  1GN6 A;  1JA8 A;  3IC9 A;  1MA1 A;  1EN6 A;  1XRE A;  1AP5 A;  4GUN A;  1SZX A;  3AK1 A;  1XIL A;  1P7G A;  1Y67 A;  1I0H A;  1QNM A;  3DC6 A;  2QKC A;  1GN3 A;  3AK3 A;  2GDS A;  4F6E A;  1PL4 A; 
#chains in the Genus database with same CATH topology
 1AI4 A;  4DV2 B;  1GTO A;  4KXR A;  3K9A A;  5B1A C;  1F4M A;  1NTK H;  1OV9 A;  2DOS A;  4WF9 V;  3E22 B;  1J5E O;  3SPJ A;  4GX0 A;  4DRX A;  3LSQ A;  4DV7 O;  2F93 B;  3N27 A;  3E89 A;  3CWB H;  4AI8 A;  4PDR A;  2ZR2 A;  2P4K A;  4EKW A;  4PDV A;  1WPB A;  2XAJ A;  1ZAU A;  4LP8 A;  5GTI Z;  1W59 A;  3K5M A;  2UXD B;  1YJW V;  1U96 A;  1JVM A;  1AVM A;  2ZXW C;  2XOK G;  2XAF A;  3HKC B;  3NXS A;  4ZOL B;  2NLJ C;  1CXZ B;  2DYR C;  1WB8 A;  2EIJ B;  3ABU A;  3HB3 B;  2CDY A;  3STL C;  2LGW A;  2QWO B;  1MZF A;  1HDJ A;  2W0X A;  2FKX A;  3K08 A;  1I08 A;  3ZHS A;  3RN4 A;  5IDJ A;  3C3S A;  5JH7 A;  4X66 B;  3RGB A;  4JI2 B;  3LNN A;  3JAM N;  3FB8 C;  5IJ0 B;  2BSK A;  3AG4 C;  4I0X A;  5KX5 B;  2Q0A A;  3N2G B;  4X1I B;  3LUT B;  4FJC C;  5C8Y A;  1Y4M A;  3TXQ A;  4FM0 A;  3MDS A;  4JI0 B;  1IJG A;  2ZM6 B;  1K5Q A;  3RT3 C;  2EIL B;  3M99 B;  5EZY B;  4YIP A;  4I5S A;  3A2F A;  4JI3 B;  3IC9 A;  1M56 B;  1HR0 B;  3OGC C;  4EEQ A;  1YJN V;  4X66 O;  3HPL C;  3K0G A;  3U10 A;  4DO2 A;  2YDE A;  1SZX A;  4FM1 A;  4FLV A;  2ZDI A;  3ZRW B;  1VQ8 V;  3OW2 U;  3E2E A;  2KQX A;  3DC6 A;  3T1Y B;  3C90 A;  3T1H B;  3K57 A;  2PZS A;  4JI0 O;  5E79 Z;  4DV3 O;  3JD4 A;  2X6B A;  2LO1 A;  4MVQ A;  2EIN B;  3DSQ A;  4JI3 O;  3E8F A;  2RMK B;  4LWS B;  2YIB A;  4X8A A;  4HNA A;  5J9P C;  1IVS A;  2OCC C;  1TUB A;  1FS0 G;  4DV5 O;  1NH2 D;  3T1H O;  4FLU A;  2GHY A;  2ZE7 A;  3ABL C;  1N32 B;  1NTZ H;  2HFE C;  4X20 A;  2NN4 A;  2YEV B;  3GB7 C;  3ABK B;  1QBZ A;  4QNH B;  5KA6 A;  5L3E A;  3DTU B;  4FZ1 A;  1H2S B;  2QR4 A;  3CJH B;  5IE9 A;  4C7U A;  3SPG A;  5B1N A;  2GTS A;  2Q68 A;  2OYQ A;  4JZ2 A;  1JCH A;  4ZI7 B;  4JV5 B;  4PDM A;  4GCZ A;  2HVK C;  2UU9 O;  3T4Z A;  4FFB B;  5LP6 A;  3KCX A;  2BOC C;  3OMI B;  3ZHT A;  1ZL8 A;  4DUZ B;  4DR2 B;  1SQQ H;  4O2B B;  3ZMV A;  1QVF U;  4DR7 B;  1RM1 C;  2M6Y A;  4GX5 A;  1VQN V;  1PNM A;  1XQ8 A;  4CH3 A;  4J41 A;  1L1F A;  2R9A A;  4IYI A;  1YJ9 V;  1F23 A;  3ZRX A;  1AR1 B;  1TVK A;  4WFF A;  1SF9 A;  3P3N A;  3E8B A;  4DUZ O;  3CCS V;  4DR2 O;  1MSW D;  5LHH A;  1GN3 A;  3FX7 A;  2QWR B;  2GDS A;  2ZIO A;  2LP7 A;  1DTO A;  1KD1 W;  5HFM A;  3JAS A;  4I7Z B;  4DV6 B;  5LBQ A;  1SQP H;  4I4T B;  3H1K H;  5B1B C;  3TK1 A;  5H9C A;  3LDC A;  3QVN A;  1VF6 C;  4GT1 A;  4W4L A;  2O57 A;  5GON A;  3R65 A;  2LFS A;  2A06 H;  4QPJ A;  2KG7 A;  4ZHQ B;  3P3P A;  1IXM A;  3OTO O;  1VQ4 V;  2Z0A A;  1ARO P;  4PDL A;  2Q6A A;  3ABM C;  3CRR A;  3P32 A;  4PD4 F;  4LF7 O;  2CAZ C;  2WSS G;  5LP6 C;  3OR7 C;  4YHH B;  4I50 A;  4JI5 B;  3ZMS A;  1COW G;  1E79 G;  2YS8 A;  1LR1 A;  3TJT A;  3NR7 A;  1QHT A;  1XNR O;  2Q67 A;  1K34 A;  2XAH A;  1PNK A;  3LSU A;  4AHC A;  4LH7 A;  5KA5 A;  1IBK B;  2WLI B;  2A3Q A;  3DXR B;  2YXY A;  2OWO A;  4RUF A;  1Q8I A;  4UCV A;  3UQ8 A;  4YHH O;  5BR8 B;  1XL4 A;  2WAM A;  3AG2 B;  1VP7 A;  4UCO A;  2PI5 A;  2P7T C;  3JAT B;  5B1B B;  4DK1 A;  5K1P A;  1XBL A;  1AJN A;  2W6I G;  2CTP A;  1DF5 A;  3OEH G;  5FNV B;  1M1K W;  2FL4 A;  1PKX A;  2VS0 A;  2ZE8 A;  1NVP D;  1H38 A;  2UXB B;  4KUM A;  4QJF B;  4B08 A;  2B1I A;  3WG7 C;  4F6R B;  2BE3 A;  4O4I A;  3ABM B;  5H2F Z;  4JAA A;  2QWQ B;  2WLL A;  1OCO B;  3FYE B;  4JI6 B;  3ZRV A;  4K8X A;  2FYU H;  3ASO C;  5KHH A;  4RUE A;  4LNU A;  5JJE B;  2ARH A;  4DXW A;  3OEE G;  4PA4 A;  1IUR A;  3CD6 V;  4LFA B;  1Q5O A;  5BMV A;  2F4V B;  2UUB O;  4R50 A;  1SQV H;  1XDC A;  3OD4 A;  2XND G;  4JYY A;  4YIO A;  4UV9 A;  1SA0 B;  4JI6 O;  2XAQ A;  4TQF A;  4Z2W A;  3VBB A;  4FLT A;  2OIE A;  3QO7 A;  1WLE A;  2UUC B;  4LFB O;  1LNQ A;  2XHB A;  5F2V O;  5JJN B;  1HP8 A;  2R9I A;  4LF8 B;  2BOB C;  1BGY H;  3J7A U;  2OTJ V;  3CCM V;  3A8T A;  3CCU V;  3CYO A;  3A0H Z;  5JVD B;  1NJI W;  1YCI A;  4LFA O;  2Q4P A;  1Q43 A;  3CS5 A;  1V55 B;  1Q81 W;  2IU3 A;  5LGU A;  2GUZ B;  3H1L H;  3R66 A;  4YJ3 A;  1BL8 A;  1FYJ A;  1JOY A;  3UKM A;  3ZMZ A;  5CBG A;  4KHP B;  4UVC A;  4ICG A;  4H33 A;  4CH4 A;  2HLD G;  3JAK A;  3K3W A;  1QR8 A;  3GWO A;  2ITC C;  1FXK C;  1GN2 A;  4X62 O;  3OUS A;  4TT3 G;  4XBF A;  3A0R A;  2E5L B;  2ILM A;  5LGN A;  3BAA A;  2QKA A;  5JCO A;  1YIT V;  4TV9 A;  4UFZ A;  5LXT A;  5J2U B;  1K4C C;  3F5T A;  3KZI Z;  5LA6 B;  3VQX A;  3L71 H;  3UT5 A;  4XDK A;  4KHP O;  4MTX A;  2YUA A;  3CRQ A;  1BQ0 A;  3RVY A;  4RQF A;  2BCC H;  3ML0 A;  4EB6 A;  1AI7 A;  3RYI B;  4QIW F;  3CRM A;  3BAB A;  5DN6 G;  3VQY A;  4LFC O;  1SS3 A;  1PL4 A;  1HW7 A;  1KP3 A;  4DW0 A;  4UCU A;  1AI6 A;  4KL1 A;  2NNU A;  3D8C A;  5LL6 Y;  1QLN A;  4CS4 A;  1XEQ A;  3B8M A;  1VMG A;  3OT7 A;  4PEL A;  4P9O A;  1BSM A;  4FM2 A;  2JIZ G;  3JAR A;  5EK0 A;  4GLX A;  1TAE A;  1YTF D;  4BW5 A;  1URF A;  3K79 A;  4DV1 B;  1QLE C;  2Z5U A;  2BTQ A;  1VQ7 V;  3GVM A;  4X65 O;  4HYO A;  2Y4U A;  4JYA B;  3H1H H;  2ZQM A;  1WA8 A;  1YXB A;  4IHJ B;  3RVZ A;  4CC6 A;  1SQG A;  1BZK A;  4JYB A;  5JCO C;  1L8D A;  4LF9 B;  2JGD A;  2ATK C;  3HKC A;  1SQX H;  2OCH A;  4ZOL A;  4PA6 A;  3BVO A;  3JYC A;  4X88 A;  2CH7 A;  5DEC A;  1XMQ B;  3M8A A;  4DV1 O;  3BY6 A;  1NR1 A;  3CXC U;  1HNZ O;  5EC2 C;  2RNB A;  1N0J A;  1SZT A;  5LYJ B;  1XMO O;  2EIM C;  5L3G A;  2IJJ A;  2F43 G;  4JI7 B;  1G6U A;  1DF4 A;  3RYF A;  3WB0 A;  1VQL V;  4I9Q A;  3ZMT A;  5IJ9 B;  4BIO A;  4UCS A;  5IJ0 A;  2AZ2 A;  3N2K A;  3K06 A;  2Q8V A;  5KMG B;  1WPX A;  2QJ1 A;  4O4H B;  2DQ3 A;  4JI4 O;  4CS3 A;  4QE9 A;  2WA4 A;  1KEC A;  2N74 A;  4WFG A;  4N21 A;  4O4J A;  2DN9 A;  1WP7 A;  5C93 A;  1I0H A;  5CN0 A;  3X2Q B;  1NR7 A;  1OJH A;  2JDI G;  3JCU Z;  3FAV A;  2HR3 A;  2BTO A;  1K5S A;  3JD3 A;  2YXL A;  1J5E B;  4H0L B;  4DV7 B;  4MVR A;  2HJF C;  3L75 H;  4DW1 A;  3ABT A;  1CP9 A;  4J7J A;  5IY5 C;  5D5Q A;  1MMM A;  2QE7 G;  4BAY A;  5FL7 G;  4YJ2 B;  3T4D A;  1AJQ A;  2EIM B;  3O65 A;  2B9Z A;  4IGG A;  3K03 A;  2CE4 A;  4MTF A;  3EVK A;  1AP6 A;  4LF4 O;  4WBN B;  2Y0I A;  1Z2G A;  3JAW A;  3K5L A;  1Q82 W;  2YC0 A;  4J42 A;  4X64 O;  3JAL B;  3OUF A;  1WAZ A;  4FIP C;  4TV8 A;  1XI1 A;  1PP9 H;  4JTC B;  3RYH B;  3CMA V;  5IWA B;  2PUS A;  3SPI A;  2F95 B;  2VRZ A;  2LW7 A;  4B3S O;  1GN4 A;  3CRC A;  2IW5 A;  1R3K C;  1JPX A;  1ZSP A;  2ETN A;  1MNG A;  4BW9 A;  4O4L B;  3SYA A;  5B3S B;  4U7O A;  2RQ6 A;  3BEH A;  1EZV H;  3OTF A;  1FJG O;  4FFB A;  2L6L A;  3E35 A;  3W7U A;  4KFM A;  4MSW C;  2C2A A;  5IWA O;  2R70 A;  3EFF K;  5EC1 C;  5BZB A;  5IY5 B;  3ZN1 A;  1N33 B;  4WFB V;  3OMN B;  2X6C A;  3ZBH A;  5CBF A;  2QDO A;  2JEU A;  1TUE B;  4O2A B;  1QCE A;  3JD0 A;  2CGN A;  4DV3 B;  5B1A B;  5LOV A;  3OR6 C;  2CK3 G;  1WNS A;  2ZD9 A;  3RYC A;  2JVD A;  4KP4 A;  1B04 A;  4GZR B;  5DED A;  1NH2 B;  2UXC O;  4DK0 A;  1N33 O;  1P84 F;  3MHH C;  4XDL A;  1B3Q A;  2ZXW B;  1YDX A;  3VQV A;  2HKO A;  1RSO A;  2DYS C;  1N0N A;  4DV5 B;  2ODM A;  3HKD B;  2FB5 A;  2DYR B;  4DUY O;  1PNL A;  5IYZ A;  5EBW C;  1NTM H;  2AXT Z;  3KCY A;  4PI2 A;  5LMN O;  3I5D A;  4RAI A;  2PY5 A;  3CP1 A;  4RO2 A;  4MVU A;  4LH6 A;  3K58 A;  5CB4 A;  2IJH A;  3AG4 B;  5JJJ B;  3CCR V;  3HKE B;  4JF3 A;  2UU9 B;  2LQT A;  4K35 A;  1I5Y A;  4X1Y A;  4CC5 A;  3E8H A;  2D3O W;  1IXB A;  4DR4 O;  1Y76 B;  1HNX O;  4WFE A;  2B1G A;  1AR4 A;  2WLI A;  3FB7 C;  1ZTE A;  4LCU C;  3F7V C;  3QG5 A;  1VQP V;  3G6E V;  4Z1V A;  1KKD A;  1N8R W;  4TUY A;  3ZMU A;  4MW3 A;  3B09 A;  2PYL A;  2K9P A;  1MA1 A;  3ETQ A;  3CC7 V;  4BIU A;  3JD1 A;  2ZDI C;  1XHZ A;  3E86 A;  5KHG A;  5CA0 B;  4I55 B;  2Z3Y A;  5EYP A;  1XHX A;  4DR5 B;  4UCR A;  4EFE A;  1OCZ C;  4FVM A;  3APO A;  4ZBM A;  5KLV H;  2AW9 A;  2OCC B;  1YSC A;  2FML A;  4PI0 A;  1NT2 B;  2AHZ A;  1D5A A;  4JPR A;  4OPA A;  3SPC A;  2UUA O;  3FB6 C;  5JH7 B;  1GH6 A;  1BQZ A;  3Q4H B;  1OCC C;  3CC2 V;  3OTO B;  4RQE A;  2DW4 A;  1UJW B;  2UXN A;  2GSM B;  1Q6U A;  5IYB O;  3ABL B;  2BSK B;  4NVP A;  4I0X B;  2QSA A;  1ZLZ A;  4JZG A;  1GO3 F;  5JQG A;  4LF7 B;  1BHB A;  2P06 A;  4DR5 O;  5C8Y B;  4YXW G;  3AK2 A;  2EJ7 A;  2LJ2 A;  3PJS K;  3RBZ A;  1P49 A;  3CCV V;  4GKK O;  1YIJ V;  2W0F C;  4FLY A;  1XNR B;  2LFR A;  4J11 A;  1WJZ A;  1AIL A;  3OE7 G;  3OFN G;  4BWA A;  1WB7 A;  1RM1 B;  1NBM G;  1FAF A;  3IJ4 A;  4B3M O;  2F66 C;  4R8C A;  1FFX A;  1NVP B;  1CEZ A;  1OCZ B;  1EZJ A;  3ASN C;  4NXN B;  5ITZ A;  1JFF A;  5CA1 A;  1WP8 A;  4IT5 A;  1JJ2 U;  4GKJ O;  4IIJ A;  1XOU A;  3ZHU A;  1Y74 A;  3ZIA G;  3UM7 A;  4HNA B;  4DV4 O;  4J7K A;  1TUB B;  3BA9 A;  1JA8 A;  3SYQ A;  3OMA B;  2QM7 A;  3K0D A;  3ETE A;  4JI8 B;  3FFQ A;  4GUN A;  2CTW A;  3S3X A;  2QTO A;  4NXN O;  4X20 B;  3ZS8 C;  4QE7 A;  4MTG A;  4DV0 B;  3I55 V;  1M5I A;  4NKG B;  1K3E A;  2DWE C;  2RJZ A;  2ITD C;  1RPO A;  3I56 V;  4ABM A;  2Q0O C;  2R9R B;  5J2T B;  4U7N A;  4ZIB A;  3OAA G;  2Y69 C;  3IC7 A;  3UO2 A;  2Y48 A;  2UUB B;  4JI8 O;  4CH5 A;  1SC5 B;  3QNE A;  2YIB D;  3ZHV A;  2UXX A;  3IGA C;  3U11 A;  5LP6 B;  5KUK A;  1ZL8 B;  3AG7 A;  4PA9 A;  1AJP A;  4DV0 O;  4X1K B;  4WFH A;  4G28 B;  4LFB B;  1D2D A;  1E1R G;  2Q9L A;  1H2G A;  2G38 A;  4NYK A;  4WFA V;  1YF2 A;  3H01 A;  1TVK B;  2WLH A;  4AIL C;  3SJA C;  4K3A A;  2ZE6 A;  4FPP A;  1KYO F;  4GX2 A;  5CBH A;  4JAS A;  3SDL A;  3H1I H;  3LDE A;  3LSS A;  3CX5 F;  1VQ5 V;  1WN7 A;  1YEW A;  5KHK A;  3CPW U;  4IYH A;  1HWY A;  4UVB A;  4EFB A;  3W7W A;  3JAS B;  3PN1 A;  4X62 B;  4U3J A;  1SQB H;  3BPZ A;  4J9Y B;  1W0K G;  3B40 A;  1EM1 A;  4P2Z A;  1Z5W A;  3WG7 B;  4DR6 B;  5GON B;  3G80 A;  3L70 H;  2KG7 B;  1SER A;  2CTQ A;  5LHG A;  2WPD G;  3B2E E;  1A32 A;  1S5H C;  4PA7 A;  4PHZ A;  1OCR C;  3WU2 Z;  1S72 V;  3ASO B;  1SQF A;  5KMG A;  5LMU O;  1P7G A;  4ZKI A;  2XT9 A;  3EHB B;  1IBM O;  3F7Y C;  4I50 B;  4FMT A;  4LFC B;  3BRC A;  3WFV A;  3HKB A;  4J80 A;  3O9O A;  4LF5 O;  4D7T A;  4DR3 O;  4DR6 O;  1GAX A;  5EIB C;  5TIS Z;  1YTF B;  3ZX6 A;  2N04 A;  2A0L A;  2JGU A;  3RFR A;  2MW2 B;  3SJB C;  4HBN A;  3B8N A;  5KHJ A;  1RP3 B;  4YY3 O;  3JD2 A;  2VQE O;  3EXA A;  1G4Y B;  5L3D A;  4X65 B;  1ROP A;  2RN9 A;  5L3F A;  1H2L A;  1B06 A;  3H1J H;  2F1M A;  2YIC A;  1X59 A;  1EBO A;  1H5W A;  1MZE A;  3VQW A;  5A9G A;  4X9Q A;  5H6Q A;  4NXM O;  4DYL A;  1OCR B;  3T2M A;  4O4I B;  1LUW A;  1AR5 A;  3E22 A;  1FXK B;  2WLL B;  4NTY A;  2YI9 A;  3JAL A;  2N05 A;  1HNZ B;  1XMO B;  3SYP A;  2EZO A;  3CRA A;  1HNW B;  4JTA B;  1L0L H;  1SKV A;  1VF7 A;  4H37 A;  3TCU A;  4LNU B;  4OPH A;  1Q90 D;  2WLJ A;  4FLX A;  2ZCE A;  4CBC A;  5FPO A;  5B1O A;  2VQF O;  4JI4 B;  5BMV B;  4JI1 O;  4MVZ A;  2IU0 A;  1YHQ V;  4QPK A;  1SES A;  3CCQ V;  1S5J A;  1M57 C;  4LF6 O;  3T1C A;  3AK1 A;  1XIL A;  5GTH Z;  1HNW O;  2OT5 A;  1Q6I A;  3U0Z A;  2Q69 A;  1YVW A;  2YXH A;  3BA8 A;  5KX5 A;  1BHA A;  1VF5 B;  3N2G A;  5H5N A;  3GWK C;  4X1I A;  1VAR A;  2YI8 A;  4O2A A;  3TET A;  1IX9 A;  2EIK C;  2GBO A;  1B6Q A;  1M93 A;  4MVM A;  5EIB D;  5LHI A;  2KKW A;  1KC8 W;  4YJ3 B;  5EZY A;  3MAQ A;  1QLE B;  2XAG A;  1Q86 W;  4B7E A;  1EN4 A;  4B3T O;  1GM7 A;  1AI5 A;  1QU7 A;  1KMI Z;  2ZNJ A;  3ZRS A;  2PYJ A;  4JAU A;  1R6K A;  3ZRW A;  4LF4 B;  2MK3 A;  1W0J G;  1FXV A;  2IJI A;  1ENV A;  4HZ3 A;  3J81 N;  4TV9 B;  3CXH F;  4CH6 A;  5LXT B;  4X64 B;  1G8M A;  3UT5 B;  1K33 A;  1S76 D;  1AB3 A;  1MAB G;  1D5N A;  3CEI A;  2P90 A;  1VQ6 V;  4J9Z B;  3ICX A;  4LWS A;  3K04 A;  1VQM V;  1I94 O;  4P9P A;  4B3S B;  1NQT A;  2EIJ C;  2QGN A;  1PL0 A;  4EB6 B;  2YIA A;  2DMX A;  4K0K O;  3ZHR A;  4FLW A;  1K92 A;  3P30 A;  1FJG B;  4G2K A;  1X4T A;  3QTC A;  4TQD A;  1ZWI C;  2YEV A;  4WCE V;  4FLZ A;  1DK1 A;  2ZNI A;  5IYC O;  1MSD A;  3B4S A;  1GM9 A;  5L3B A;  5K1X A;  1N34 O;  3CJH A;  3JAR B;  2QM8 A;  2EIL C;  4NB5 A;  1PPJ H;  1R6T A;  1M56 C;  3BHP A;  4Q6G A;  2BTQ B;  1R73 A;  1T5E A;  4ZI7 A;  1XNQ O;  3CCJ V;  1WA8 B;  1J95 A;  3L73 H;  4O2B A;  1N36 O;  1G1X B;  2KB1 A;  5CA0 A;  4I55 A;  2JGD B;  4DV2 O;  3ETG A;  2UXC B;  1VQ9 V;  4K8Z A;  3CE2 A;  1K97 A;  2CH7 B;  4PJ0 Z;  3KDR A;  5HFL A;  1M4U A;  2EIN C;  3D3Q A;  2OIG A;  1K73 W;  5AG2 A;  2DQ0 A;  3G6B A;  3ZED A;  1GK9 A;  1V54 C;  3FD9 A;  5IT9 N;  2ADQ B;  4DUY B;  2WLK A;  3Q4H A;  3ETD A;  2Y0P A;  3RYF B;  3THO A;  2B5U A;  2UXD O;  2V4D A;  5LMN B;  3N2K B;  2ZE5 A;  3K5N A;  2WLN A;  4E2L A;  2LW1 A;  2E76 B;  1S77 D;  2R72 A;  3ABK C;  1QVG U;  4I4T A;  3K5O A;  2EUL A;  1S0V A;  2Q7E A;  3H9V A;  4NTW A;  3B77 A;  2VWK A;  4O4J B;  4BIZ A;  4TSF G;  2JJ2 G;  4ZHQ A;  4DR4 B;  1HNX B;  4JI2 O;  4BR6 A;  2XAS A;  1GMG A;  2IH1 C;  3FAV B;  1F7Y A;  3FKS G;  5JWP A;  3KG2 A;  3L74 H;  1F51 A;  2CGO A;  1R3L C;  3VOU A;  3CC4 V;  3C3T A;  1R3I C;  4Q20 A;  2PTM A;  2IJK A;  2ZM6 O;  1P4R A;  3CSX A;  2X7R B;  1GN6 A;  1H2M A;  3CME V;  1QQC A;  3AG3 C;  1VQO V;  1HR0 O;  5BXZ A;  1V54 B;  2E3C A;  4PA3 A;  4W4K A;  1YZB A;  4J10 A;  3RW0 A;  4UUJ C;  4JYC A;  3ZCC A;  3DXR A;  2PI4 A;  2V1D A;  2JJ1 G;  3CB2 A;  3JAW B;  2KSD A;  3T1Y O;  4DRX B;  4FK5 C;  2JK5 C;  1IDS A;  1JX9 A;  1H2N A;  2IBZ H;  2QEX V;  2QA4 V;  3SPH A;  1VIB A;  1ZX3 A;  3SJQ C;  2UUA B;  4TV8 B;  3JAT A;  2DYS B;  1VF6 A;  1FD9 A;  5FNV A;  2QWP B;  4X89 A;  4JTD B;  3WB2 A;  3W7T A;  4H44 B;  5J2T A;  2P4V A;  4UCT A;  4QGP A;  2ZT9 B;  1I7F A;  1TA8 A;  4F6R A;  1MOF A;  3BCC H;  2CTR A;  1N32 O;  3CCE V;  5KHI A;  1H8H G;  4GKK B;  1BE3 H;  2HEP A;  1NZ6 A;  3FB5 C;  4MW8 A;  2E75 B;  4X1K A;  1BS3 A;  2P22 C;  1IBL B;  1QR9 A;  3AG3 B;  3AEI A;  5FPR A;  1UFI A;  4UXN A;  2JS5 A;  1Y6X A;  3E83 A;  4B3M B;  4MVS A;  5B66 Z;  5GW7 A;  3KKY A;  1LUV A;  1K9M W;  5LOV B;  4JV5 O;  2JEX A;  3M7M X;  3RYC B;  3MHS C;  1O9H A;  1SA0 A;  4GKJ B;  3TXS A;  4DR7 O;  3DGE A;  5A2Q N;  4F4L A;  2YID A;  2Q5Z A;  4R6Z A;  3LDD A;  1IBL O;  3RWR D;  2AGA A;  4DV4 B;  2ZKO A;  3AG2 C;  2IH3 C;  1KP2 A;  4MS2 A;  2A79 B;  4PV1 B;  2LGQ A;  1FPO A;  1RSO B;  5JVD A;  4TOI A;  1EN6 A;  2DWD C;  3W7S A;  2CUG A;  1AP5 A;  2H3O A;  2GUZ A;  1OHH G;  4N23 A;  5CA3 A;  3OGI B;  3L72 H;  1I5X A;  4RWU A;  5H6R A;  2P67 A;  3SYC A;  5IYZ B;  2IM9 A;  5KAF Z;  2F23 A;  3QO5 A;  2JRI A;  1Q7Y W;  5LGT A;  2QKC A;  1DGS A;  4OX9 B;  1R1B A;  1OCC B;  2Y4T A;  1OCO C;  1US6 A;  5CB4 B;  3DC5 A;  4DV6 O;  3D36 A;  4L87 A;  1KBH A;  5J2U A;  1FFT B;  4X1Y B;  5LA6 A;  3SJC C;  4E4E A;  4H13 B;  4UV8 A;  1U97 A;  4OX9 O;  5EBM C;  4JAV A;  2HHH B;  1Y66 A;  1NKD A;  1P7B A;  3BFR A;  3RYI A;  4TUY B;  4JI5 O;  1NU1 H;  4DR1 B;  1DLB A;  1JQ0 A;  4L8J A;  2H8P C;  1YI2 V;  1VEW A;  3APQ A;  3ASN B;  5KAI Z;  1V9P A;  3CCL V;  4LR3 A;  3G4S V;  4NTX A;  5EYP B;  1UPG A;  1IBK O;  1V55 C;  2HG5 C;  4P30 A;  4FFK A;  2HHH O;  1KUQ A;  3FYI B;  1FXK A;  4AQY B;  5BR8 O;  2RCV A;  5CMU A;  1PD3 A;  1BT8 A;  2EX3 A;  4R7C A;  4LC1 A;  2PGG A;  1OZ0 A;  2EZP A;  4DR1 O;  3L9D A;  4IHJ A;  5EBL C;  4MVO A;  4IL6 Z;  2ZIM A;  3SGI A;  3D36 C;  3E8G A;  2UXB O;  5LMU B;  5JQG B;  1FKA O;  1K4D C;  4UB8 Z;  3UCS C;  1IBM B;  3JSN A;  1W2B U;  4B7K A;  3IAY A;  1N4C A;  2P5O A;  4AQY O;  1R3J C;  2WLM A;  3AK3 A;  1FOU A;  4LF5 B;  4DR3 B;  2Y69 B;  5LYJ A;  1NS1 A;  2WWW A;  2X6A A;  1S3J A;  2JS3 A;  3G67 A;  1GKF A;  2A7W A;  4CS2 A;  5IJ9 A;  1Z5V A;  2DE0 X;  1CPY A;  5FLX N;  1H8E G;  2YSU B;  5B5E Z;  4YY3 B;  4O4H A;  1SET A;  2VQE B;  3A0B Z;  1FFX B;  2F4V O;  2EJR A;  3JCZ A;  4G27 B;  3HR0 A;  1PM9 A;  5ITZ B;  1JFF B;  5CA1 B;  4IIJ B;  3J80 N;  1KQS U;  1Y74 B;  1NI8 A;  2D2C B;  1BCC H;  3G71 V;  2UUC O;  2DJV A;  2QTS A;  4MT8 A;  4D6T H;  3F5W C;  4A5U B;  4B3R B;  1JNB A;  4LF8 O;  4NXM B;  1JJO A;  2V7Q G;  3STZ C;  4ASU G;  3WB1 A;  3ZN0 A;  4GYC B;  2FTK A;  1PV0 A;  1ORQ C;  5KUM A;  1M90 W;  1R6N A;  1RPR A;  3SYO A;  2ADP A;  2QWN B;  4UVA A;  2H94 A;  3MD0 A;  4YJ2 A;  1KU9 A;  5BY1 A;  4B3R O;  4OGQ B;  2VQF B;  2EBO A;  2E5L O;  4WBN A;  4JI1 B;  4LBE C;  1KB9 F;  2E74 B;  2W6J G;  1XRE A;  4LF6 B;  2HJD A;  1XL6 A;  4FZ0 A;  3RYH A;  4XDJ A;  4TWK A;  3AG1 C;  1FXH A;  3TGU H;  5E1A C;  2XTA A;  2QM4 A;  2HVJ C;  4O4L A;  1O9G A;  1JR9 A;  2GTA A;  1H2K A;  2Q7H A;  3OM3 B;  1GM8 A;  3X2Q C;  3ZHQ A;  1RFY A;  2L35 A;  1EN5 A;  4D7S A;  5IYD O;  4B3T B;  1M9N A;  2M7W A;  2RDC A;  5L3C A;  4GX1 A;  2P6J A;  2PF4 E;  1THZ A;  1L0N H;  1ZUQ A;  4U3J B;  2OTL V;  1KKC A;  3W7X A;  2VWJ A;  2WA3 A;  2Q73 A;  4NR1 A;  2Q7G A;  4JYA O;  3QO8 A;  2X0L A;  5DM6 V;  4MTO A;  3JAK B;  1IZ3 A;  1I94 B;  2XUM A;  2ZIN A;  4Z1M G;  4LF9 O;  3K9S A;  1E1Q G;  2GV9 A;  3AG1 B;  3ZJZ A;  2A9H A;  4CZZ A;  2K1E A;  4K0K B;  1XMQ O;  2NR5 A;  3HKB B;  4JGS A;  3SR2 C;  1XUQ A;  3HKD A;  1VQK V;  1K8A W;  4UB6 Z;  1S5L Z;  4JI7 O;  4U3F H;  1JMK C;  5B3S C;  1M57 B;  3D3I A;  3UO3 A;  1BMF G;  2AHY A;  3K59 A;  1TGO A;  1K7D A;  3S3W A;  4J7Z A;  3IFX A;  1N34 B;  2ZR3 A;  1MG1 A;  2HP8 A;  1Q6H A;  4I9W A;  1F4N A;  2AZ0 A;  1SRY A;  4OXS A;  2QKS A;  1XNQ B;  1Y67 A;  3HKE A;  3QF7 A;  3JSL A;  1QNM A;  1EFR G;  1GRJ A;  2EIK B;  5D5P A;  1Q3E A;  3CHX A;  1N36 B;  1Y76 A;  4F6E A;  3LNM B;  4HAM A; 
#chains in the Genus database with same CATH homology
 1JR9 A;  1IDS A;  2AW9 A;  1VAR A;  1IX9 A;  3DC5 A;  3QVN A;  1EN5 A;  3KDR A;  3OT7 A;  1EN4 A;  1MMM A;  5AG2 A;  2P4K A;  4E4E A;  1XDC A;  1BSM A;  1N0N A;  4JYY A;  4YIO A;  1PM9 A;  1ZLZ A;  2ADQ B;  4JZG A;  1ZUQ A;  2CE4 A;  1AVM A;  3EVK A;  1AP6 A;  3AK2 A;  1KKC A;  1B06 A;  3BFR A;  1WB8 A;  1BS3 A;  2CDY A;  3TJT A;  5A9G A;  1D5N A;  4X9Q A;  3CEI A;  4C7U A;  1I08 A;  1VEW A;  1LUW A;  1AR5 A;  3LSU A;  3K9S A;  3RN4 A;  3C3S A;  4JZ2 A;  1WB7 A;  2ADP A;  3KKY A;  1LUV A;  1GN4 A;  1ZSP A;  1MNG A;  4BR6 A;  1IXB A;  4FFK A;  1N0J A;  1GN2 A;  1XUQ A;  1AR4 A;  1ZTE A;  2RCV A;  1BT8 A;  3MDS A;  1EM1 A;  2QKA A;  3C3T A;  4YIP A;  1MSD A;  1GN6 A;  1JA8 A;  3IC9 A;  1MA1 A;  1EN6 A;  1XRE A;  1AP5 A;  4GUN A;  1SZX A;  3AK1 A;  1XIL A;  1P7G A;  1Y67 A;  1I0H A;  1QNM A;  3DC6 A;  2QKC A;  1GN3 A;  3AK3 A;  2GDS A;  4F6E A;  1PL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...