1P7GA

Crystal structure of superoxide dismutase from pyrobaculum aerophilum
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
211
structure length
211
Chain Sequence
SVTTKRYTLPPLPYAYNALEPYISAEIMQLHHQKHHQGYVNGANAALEKLEKFRKGEAQIDIRAVLRDLSFHLNGHILHSIFWPNMAPPGKGGGKPGGKIADLINKFFGSFEKFKEEFSQAAKNVEGVGWAILVYEPLEEQLLILQIEKHNLMHAADAQVLLALDVWEHAYYLQYKNDRGSYVDNWWNVVNWDDVERRLQKALNGQIALKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of superoxide dismutase from Pyrobaculum aerophilum presents a challenging case in molecular replacement with multiple molecules, pseudo-symmetry and twinning.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase
total genus 72
structure length 211
sequence length 211
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1p7gA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1p7gA02
3C3SA 3RN4A 3CEIA 1ZSPA 4FFKA 3K9SA 4JZ2A 4YIOA 1EN5A 1WB8A 1MA1A 2ADQB 4GUNA 4F6EA 3C3TA 1I08A 4E4EA 1AP6A 2P4KA 1IXBA 1XILA 3KKYA 3DC6A 1ZTEA 2AW9A 1PL4A 1GN3A 1N0JA 1MSDA 1AVMA 1AP5A 1KKCA 1GN2A 3AK2A 1P7GA 3LSUA 4BR6A 3BFRA 1D5NA 3IC9A 1N0NA 1XREA 1EN4A 1PM9A 1EN6A 1BT8A 1GN6A 1IDSA 1VEWA 4YIPA 1JR9A 3QVNA 1BSMA 1WB7A 3AK1A 4X9QA 1QNMA 1ZLZA 3OT7A 1B06A 1AR4A 1XDCA 2CDYA 1AR5A 1EM1A 2CE4A 3TJTA 4C7UA 2ADPA 3DC5A 1XUQA 1GN4A 1VARA 2QKAA 3MDSA 1LUVA 1MNGA 1I0HA 2RCVA 1ZUQA 4JZGA 5A9GA 1SZXA 1Y67A 3EVKA 3AK3A 2GDSA 1JA8A 5AG2A 1LUWA 1IX9A 2QKCA 1MMMA 4JYYA 1BS3A
chains in the Genus database with same CATH superfamily
1K9MW 2ZE6A 1TUEB 4HZ3A 4FZ0A 5BXZA 5C93A 4OXSA 3P32A 1JNBA 2IJJA 4FLYA 4DV5B 3ICXA 4NB5A 1ZAUA 3H1LH 4PD4F 3ML0A 3N2KA 4L8JA 4JASA 1XL4A 3S3WA 1XILA 4CC6A 4IHJB 3CCQV 3A2FA 1VQKV 4FM0A 3DC6A 1FXKC 2LQTA 5KHKA 3CCJV 4NTXA 5HFMA 2ZE5A 1W59A 1R1BA 3EHBB 2CAZC 2DYSB 2M7WA 1AVMA 5FPRA 3B8NA 3E89A 2DWEC 3X2QC 2Z5UA 3AK2A 1FJGB 1KQSU 4BR6A 1V55B 5B5EZ 2DYRC 4HAMA 1AILA 5GONB 1SZTA 4X89A 1BT8A 2YIDA 1WA8A 2EIJC 1P7BA 1ORQC 5JH7A 2DW4A 1NR7A 2RNBA 4P30A 4UCVA 3CC7V 4X65O 4XDJA 1AR5A 2WWWA 3OEEG 1AJPA 1O9GA 5CBFA 4J11A 1W0JG 1G8MA 2RJZA 3CCRV 4RAIA 1N36B 1LUVA 5KA6A 3CCMV 2XUMA 2ITCC 4DV7B 3AG1C 1DTOA 3TXSA 3CSXA 5A9GA 1T5EA 1N32O 3UKMA 4P9PA 3AK3A 4PHZA 2N04A 3E83A 4WFFA 2XAFA 4I0XA 4O2AA 1US6A 2ATKC 4EEQA 3BVOA 5JWPA 3E8HA 4UUJC 3OFNG 1TGOA 4U3FH 4DR1O 1Y74A 1IURA 5BY1A 1YSCA 1PV0A 3C3TA 2IH1C 3SR2C 3AG3C 3M99B 1KB9F 5B3SB 5IYBO 1K7DA 5CB4A 4GCZA 1N4CA 2EIMC 1GK9A 1H38A 4JI5B 2Q68A 1V9PA 5L3GA 1GN3A 3H01A 4J80A 4PDRA 3JAWB 1WP8A 1FFXA 3A0HZ 1B6QA 4TOIA 2OT5A 3JD2A 2Z0AA 1RPOA 1MG1A 1PM9A 1BQZA 3G6BA 3JCZA 3ABKB 2YSUB 4X88A 4JYBA 2GSMB 5LXTA 1WLEA 2F43G 2QEXV 3ABMB 1NH2B 3L70H 2XT9A 4GKJO 1CXZB 4FLXA 2B1IA 5CA1B 5BR8B 1FXVA 2Q5ZA 2ZR3A 3FB6C 3TJTA 2CH7B 1GN4A 1I5XA 4IYHA 4PA7A 1S76D 4J7JA 2OCHA 1O9HA 2WLLA 1MZEA 1SQFA 3G4SV 4K3AA 1YCIA 3CXHF 4O4IB 2NR5A 3OEHG 4MS2A 4IIJA 1X59A 2UUCO 2WLIB 4TV9A 3RYHB 4PDMA 2CTPA 3ZEDA 2BTOA 3K59A 5LHHA 3SDLA 4K0KO 4Z1VA 4N23A 4PA3A 3G80A 1MOFA 3U0ZA 2IM9A 1XNQB 2X6BA 4PV1B 4TUYA 1QR8A 3FFQA 1KECA 3KCXA 4TWKA 3ZX6A 4F6EA 2V1DA 4WBNB 3CXCU 4R8CA 1GRJA 4E4EA 1SQGA 4DYLA 3UT5A 4I4TA 2CUGA 4R6ZA 1IXMA 3UCSC 1F7YA 4MSWC 2F95B 1TA8A 2AW9A 2EJRA 3R66A 3C90A 1XOUA 4UCSA 4MVSA 2E5LO 4I7ZB 3E22B 2ZQMA 4NTYA 3MHSC 4X1IB 3STLC 5IYCO 4PA6A 5LGTA 2D2CB 2Q69A 2RN9A 1D5NA 3TCUA 2EILC 4AILC 1N0NA 2QWPB 2AHZA 4I9QA 2GTSA 4RUFA 2UUAB 2JGDA 1IZ3A 1YEWA 1G6UA 4YJ2B 5IT9N 5L3BA 2X7RB 2HR3A 2QJ1A 1SQQH 5KX5A 2OCCB 1QHTA 2UXBO 3QF7A 1R3IC 2LW7A 4B3TB 1QNMA 2IJIA 3E35A 2XAGA 3HKBB 4JYCA 1BZKA 1VQLV 5H9CA 1S5LZ 3DC5A 1VARA 3QG5A 4JYAO 4AI8A 2JS5A 4X20A 1HW7A 1I94B 1K3EA 5IDJA 1VF6C 2QGNA 4WFAV 3N27A 2P7TC 2FKXA 2HVKC 2R9RB 3WB2A 4JZGA 2KQXA 2BCCH 2YIAA 2GDSA 1FXKB 3GB7C 1H8HG 1IJGA 1MMMA 4LF8B 4DXWA 3JARA 3JCUZ 1VQ7V 4J9ZB 3B77A 2QM8A 1XHZA 4W4LA 1SESA 1YITV 1S5JA 2WLNA 2XAJA 4U7OA 2AHYA 4O2BA 5LGUA 3W7XA 2YUAA 2UXCB 3HKDB 4FLTA 1W2BU 1RP3B 4X1YA 2JRIA 2QWRB 4U3JA 3B09A 3OTOB 5CA0A 2BSKB 1BMFG 4TV8B 4B3TO 4J7ZA 3MHHC 2H8PC 3K5OA 3K0GA 1P7GA 1HP8A 4OPHA 4LF7B 2Y0IA 1TUBB 4OX9O 4F6RA 1JMKC 1VQOV 3ABMC 3W7TA 1FS0G 2JIZG 4YIPA 2OCCC 5JQGA 4P9OA 4TT3G 4X64O 4X66O 4YY3B 4K8XA 1LNQA 4WFHA 1JJ2U 3MDSA 3JATB 3K9AA 2JK5C 2KB1A 1L8DA 4GZRB 1OCRC 1NTZH 3HPLC 1XBLA 1FXHA 4I4TB 3RYCA 2ZDIC 2R9IA 1QLEC 2PYJA 2CTRA 1JVMA 2EINB 3HKCB 3GWKC 4B3MO 4J9YB 1Q6UA 1F51A 4JYYA 3WG7B 1M56C 3OTOO 1SQVH 1PNLA 4LF9B 3CEIA 3G71V 5LA6A 2Y4TA 3ZJZA 4YJ3B 1OCZB 2K9PA 2ADQB 4PJ0Z 4MT8A 3BEHA 3ZN0A 4DW0A 1X4TA 4FMTA 3AG2B 4NVPA 2UUBO 4FVMA 5EZYB 2ZDIA 1ZTEA 3DXRA 2QWQB 4JV5O 5FL7G 4CZZA 2PTMA 4UCTA 2HHHO 4K8ZA 1HDJA 2R9AA 1KBHA 4DV1B 3FB7C 1H2MA 1WNSA 3JD1A 1Q7YW 3ZN1A 5EIBD 4JTCB 5LXTB 3W7SA 5JJNB 5EK0A 5CN0A 4XBFA 2IJKA 1K8AW 1SF9A 1VQNV 1IDSA 2KSDA 1UFIA 4O4HB 3VQVA 2LFRA 4NKGB 2Q7GA 3E8FA 1TUBA 2P90A 3QTCA 4B3RO 3OGIB 3K57A 3DTUB 1IVSA 3EXAA 2CE4A 1V55C 5D5PA 2EINC 3CJHA 3IGAC 1LR1A 2C2AA 4BW9A 1XMOB 2ZM6B 5D5QA 1W0KG 1QCEA 5AG2A 1RFYA 2Y4UA 4FJCC 2WA3A 5A2QN 1YIJV 1BS3A 4LH7A 5JJEB 4H33A 4ZHQA 1RM1C 1BHBA 1HR0O 1QQCA 2PI4A 1OCZC 3SPIA 1NH2D 1H8EG 4DR2O 1D2DA 4MW8A 4FLVA 1I08A 1FXKA 1DK1A 4W4KA 1FKAO 3APOA 3T1CA 1NI8A 1AP6A 1JCHA 4O4JB 4KFMA 1IXBA 3OD4A 4F6RB 2Q7EA 2LP7A 5B1BC 3ZRVA 2EX3A 3FYIB 4PI2A 4UFZA 2OIGA 2FTKA 1OHHG 4H37A 4UCRA 4LFCO 5JH7B 1GO3F 2ZIMA 4DUZB 4MVOA 5FNVA 2VRZA 4HNAB 2WLMA 2Z3YA 4IL6Z 3M7MX 2UXCO 1AI4A 1Q82W 4LR3A 1QBZA 1N33O 4TQDA 3BCCH 3G6EV 1SRYA 1NQTA 2HKOA 1P4RA 3ZRSA 4FK5C 3KDRA 5LA6B 2ZNIA 3OT7A 2DQ0A 4LF6B 2WSSG 3FKSG 4JI0O 3RBZA 2UUCB 1HR0B 3KG2A 5ITZA 1AROP 4PA4A 4GX1A 4JI3B 1DF4A 3L73H 2WPDG 3BAAA 4I9WA 1IBMO 2QDOA 4H0LB 1AJNA 5CBGA 4O2BB 2GUZA 4DRXB 4UCUA 3RVYA 4CS2A 3EVKA 1YDXA 4X64B 1ZL8B 4TSFG 4WFGA 4JI8B 3FYEB 3LDDA 2L35A 3CCSV 4CH5A 2ITDC 3RN4A 4FFKA 1JX9A 5GTHZ 2VQFB 3K9SA 1WB8A 1MA1A 1E1QG 4LFCB 3B40A 1SQXH 3ZRXA 2P4VA 4JGSA 1K73W 4DUZO 4YJ2A 3X2QB 1P84F 1M90W 3SJAC 1L0NH 3KKYA 3CC4V 1R73A 4DR4O 2UU9B 1V54C 2HP8A 1KU9A 2QWOB 2DE0X 5J2UA 2A3QA 3ETQA 4RWUA 4TV8A 1JFFA 1AP5A 1GN2A 5L3DA 3LNMB 1K34A 2JGUA 4LFAO 4DV0B 4UB8Z 1Q8IA 4D6TH 5IJ9B 5DN6G 4PA9A 2QM7A 3T1HO 3QNEA 4O4JA 1B3QA 4DV2B 2EJ7A 1NTMH 1AI7A 1VMGA 1VEWA 3CP1A 2Y0PA 2ZE8A 2PYLA 4FM2A 4DR7O 1K5QA 2FMLA 4MTXA 5CBHA 1HNXB 4JYAB 2CDYA 3ZHUA 1I94O 2E76B 3QO8A 3G67A 3JSLA 3I5DA 2ADPA 4DK0A 3B4SA 5KUMA 4N21A 2M6YA 2W6JG 5K1PA 4IIJB 4B08A 3JD3A 1QLEB 3DGEA 4DR3O 3F5TA 2Q9LA 4ZIBA 5C8YB 4WBNA 3AG3B 1AB3A 1IBKO 1S72V 3JALB 1KYOF 4MTOA 2A06H 4TUYB 3W7WA 2QTSA 3OM3B 4JZ2A 4YIOA 1WPXA 4I0XB 3A8TA 2P67A 5EYPB 3K0DA 4QJFB 3ABLC 2CK3G 2JEUA 2EZPA 4KL1A 1PL4A 2RMKB 3T4DA 1FFTB 2HFEC 1Q3EA 4LF7O 3N2GA 5L3FA 4LBEC 1GH6A 1KC8W 5FLXN 1ZL8A 2ZXWC 2DWDC 4MVZA 3LSQA 5JJJB 3D8CA 1VF7A 3BABA 4G2KA 1ZWIC 4ZI7B 3B8MA 4JI6B 1YHQV 1NZ6A 1AJQA 3CC2V 1VQ8V 2ILMA 1WA8B 3MD0A 1L1FA 3UO3A 2PGGA 3H1IH 4F4LA 5JCOA 3ZHVA 4JAAA 4CS4A 1JR9A 1BE3H 3FB8C 3CRAA 1XHXA 1B06A 3APQA 2E5LB 1RM1B 2B1GA 3D3QA 5IY5B 3ZMVA 2Q0AA 1F23A 1JJOA 4QE7A 4DV7O 1K97A 1XUQA 5LHGA 4WCEV 4ZBMA 1EFRG 2XOKG 4YHHO 4NTWA 3I55V 1GM7A 1Y66A 1M57B 4FPPA 4AQYB 2E74B 2WA4A 3N2KB 5B1BB 3R65A 4JF3A 1ROPA 1K33A 4OX9B 2K1EA 4GX2A 4JTDB 3Q4HA 4LWSB 5EC1C 3RWRD 3JD4A 4MVQA 5KA5A 3N2GB 1Y76A 2BTQA 5CA1A 1COWG 5B3SC 1SERA 3JASA 2DMXA 2E75B 1IBLB 1VQ5V 4J41A 1H2KA 2JDIG 5LYJB 2UXDB 4UVBA 2P4KA 3THOA 3SJBC 1HNZB 2CTWA 4UV8A 4JI1O 3L72H 1Q6IA 3H1KH 4ZOLB 3ABUA 4JI8O 4FZ1A 2XAQA 2RQ6A 3ZHSA 2BTQB 3P3NA 3U10A 3QO5A 1R6KA 4DV1O 5J9PC 1B04A 1H2LA 3EFFK 3HKCA 3JAWA 4JI7B 5GW7A 5CMUA 5C8YA 1Z5VA 4JI4O 3LSUA 1OCCC 5CB4B 3CHXA 3CS5A 3CCEV 4YHHB 1OCOB 1SA0A 1A32A 2GHYA 3OUSA 4I55B 4R7CA 3T1YB 1MSWD 4MVUA 4YJ3A 5LP6C 4WFBV 1OV9A 5KLVH 2YDEA 3ZHRA 2AXTZ 3SPGA 1NBMG 2EIJB 2UXXA 2ZR2A 5B1NA 4DV6O 3OE7G 5HFLA 4J7KA 5JCOC 1THZA 4G28B 4UVAA 3KCYA 2LJ2A 3ABKC 4DV0O 4C7UA 2ZM6O 4LFAB 4NXNB 1CEZA 5K1XA 1RSOB 2KKWA 4LF4B 3PN1A 5IY5C 3B2EE 3STZC 5L3CA 2ZCEA 1ENVA 4I55A 1V54B 2LGQA 4DR7B 1SA0B 2ZD9A 1BQ0A 2D3OW 1Q6HA 4NXMO 4AHCA 1J5EO 4ZKIA 4YY3O 3E8GA 3FD9A 5B1AB 4KHPB 4Z2WA 2WLKA 4JPRA 4X1YB 3SYOA 4EFBA 3K79A 2PI5A 4ASUG 2ZE7A 3HKDA 4JI4B 4B3RB 4DR5O 3ZCCA 1FOUA 4ZOLA 1XMQB 4X65B 2CGNA 3K06A 3WFVA 3ZS8C 1NU1H 2LFSA 5KUKA 3SYPA 5LL6Y 1R3KC 4RQFA 3CCVV 1VQ4V 3CE2A 2ZIOA 4CC5A 5EIBC 4X1IA 1NVPD 4I50B 3RVZA 2NNUA 4ABMA 2OYQA 2Q7HA 2Q6AA 3J80N 3OTFA 2ZT9B 1N32B 4MVRA 1YI2V 2UUAO 3IC9A 3P3PA 2YIBD 5FPOA 3CYOA 1XREA 1DGSA 4K35A 3Q4HB 2UXNA 5LGNA 1FJGO 2NN4A 3OMNB 4YXWG 3FX7A 3JATA 2VWJA 4RQEA 2AGAA 1PD3A 2FYUH 4DW1A 4DR2B 3SJCC 2KG7B 3ZMTA 1XL6A 4LFBB 3AK1A 1OCOC 3CX5F 4LF5B 5LMUB 4UCOA 1J5EB 2Y69B 3BY6A 1AI6A 4FIPC 3JSNA 4O4LA 4H13B 1MNGA 5E1AC 4CBCA 3OGCC 4H44B 3K58A 3ASOC 4CH6A 4DR5B 1NVPB 2GTAA 1D5AA 4JTAB 1VIBA 1YTFB 1Y67A 1KP3A 3MAQA 3H1HH 2F66C 3CD6V 1H5WA 1NKDA 3CMEV 3RYFA 1PL0A 1ZX3A 3ETEA 3JALA 2P22C 5H6RA 1N34O 4ZI7A 5CA0B 1PP9H 2HEPA 3P30A 1ZSPA 3JD0A 1N33B 3JAKB 1H2GA 2W0FC 4B7EA 3FAVA 5KAIZ 5CA3A 4GUNA 2QM4A 3ABLB 1URFA 1U96A 4X62B 1CP9A 4ICGA 4TQFA 5B1AC 2V4DA 4AQYO 4JI0B 4FLUA 4DV3B 2PUSA 5H2FZ 5IYZB 2WAMA 2G38A 4PDVA 3VQWA 3IFXA 1R3JC 5EBMC 1EZVH 4JI3O 3ZIAG 1M1KW 3JARB 1MSDA 1TVKB 5LBQA 4JI5O 5E79Z 3OW2U 2A7WA 3K03A 3UM7A 3JAMN 2A9HA 2YIBA 4OGQB 4A5UB 1YTFD 1Z5WA 3SPCA 3WB1A 2QKSA 2GUZB 3RYHA 4DRXA 1QR9A 1Y6XA 5BMVB 4LF8O 1KP2A 1YJWV 3SPJA 4O4IA 2UXDO 1GTOA 1Q86W 3ABTA 3ZHQA 2VQEO 3VBBA 2QWNB 1SKVA 3F7VC 1YJ9V 4EKWA 1R6NA 2DJVA 1VP7A 1ZLZA 4O4LB 4NR1A 2QE7G 2IBZH 3AEIA 4LCUC 5H6QA 1Q81W 2FL4A 4GKKB 3RYIB 2IU3A 3JYCA 2Q73A 3BHPA 2PZSA 2CTQA 2DYSC 2RCVA 4MTFA 1IBKB 1ZUQA 2EBOA 4X1KA 2HG5C 5LP6A 2EIMB 2A79B 4UV9A 3CCUV 1FFXB 1OJHA 1J95A 5IJ9A 4R50A 1OZ0A 1XNRB 2OIEA 2DOSA 3CRCA 2MK3A 4K0KB 4QPKA 1EN5A 5EZYA 4LF4O 1XQ8A 2MW2B 4QPJA 1H2NA 2F4VB 1NT2B 1XNQO 4GLXA 1E79G 1H2SB 5J2UB 3K04A 4X1KB 3WG7C 4Q20A 4U7NA 4JV5B 4GYCB 4BIZA 5GONA 3ZMZA 4X8AA 3HKEA 4J10A 1GM9A 1GKFA 4ZHQB 3IJ4A 1DF5A 4NXMB 4HBNA 4KHPO 3OR6C 2PY5A 2Q4PA 5KHJA 3GWOA 3H9VA 5KHGA 4DR3B 4L87A 4B3SB 3ETGA 1YXBA 1EN4A 3CRMA 1NJIW 1K5SA 1XMQO 1PNKA 2F1MA 2WLLB 1Y4MA 4GT1A 3SJQC 2YXLA 2PF4E 3CWBH 3QVNA 1RPRA 1Y74B 5BMVA 4LH6A 4CH4A 3CPWU 2AZ2A 1E1RG 1RSOA 1HWYA 2N74A 5ITZB 1P49A 3UQ8A 2YI8A 4DUYB 4KXRA 3AG4B 5L3EA 2JVDA 3NXSA 2R72A 3SYAA 5IJ0A 1PNMA 3K5NA 3T1HB 2F4VO 4UB6Z 4J42A 4NYKA 3U11A 1SZXA 2IH3C 3ZMSA 1KMIZ 1LUWA 4LWSA 1IX9A 1GM8A 3DSQA 5KMGA 1M4UA 3ZHTA 3O65A 5KHIA 4U3JB 2Q0OC 2B5UA 2Q8VA 2ZNJA 2YXYA 3K3WA 3A0RA 2X0LA 2ZKOA 5EC2C 3BA8A 4BW5A 4EB6A 2NLJC 2DYRB 5EBWC 2QTOA 3IC7A 1AR1B 2HLDG 3VQYA 2YI9A 2WLHA 1QVGU 1N36O 4GKJB 1Q90D 4O2AB 3ZBHA 1XMOO 3ASOB 2YS8A 5EBLC 2Q67A 2X6AA 4JI2B 1S77D 2ZXWB 1NS1A 4RO2A 3ZRWA 4DV3O 4CS3A 3K08A 4KP4A 4X20B 4EB6B 1GN6A 1PKXA 1QLNA 1M93A 5LMNO 4LF6O 1HNWO 2QSAA 4WF9V 4GX5A 1IBLO 2IW5A 1K4DC 3RT3C 1Q5OA 4DO2A 4JAVA 1M9NA 3DXRB 5F2VO 4MVMA 2HJDA 1Z2GA 5KMGB 3H1JH 3SGIA 3BA9A 2QKAA 3AG7A 1DLBA 2OTLV 1QU7A 3SYCA 5EYPA 3LNNA 3ASNC 1WAZA 2VQEB 2VS0A 4BAYA 1WP7A 5IE9A 2N05A 1CPYA 4GX0A 2VQFO 4UXNA 2BSKA 2QKCA 2R70A 1VQ9V 1MZFA 2RDCA 4QE9A 3LSSA 2LW1A 4GKKO 4IHJA 3L75H 1BCCH 3E2EA 4PI0A 2W0XA 3UT5B 2ODMA 3UO2A 1XEQA 4DV4O 1I5YA 4OPAA 3ZRWB 1OCCB 2XTAA 1S3JA 4D7TA 2HVJC 5LOVB 1HNWB 1JOYA 3VQXA 2DQ3A 3F7YC 3I56V 2UXBB 1XI1A 3RYIA 1YJNV 2XASA 2F23A 1F4NA 3NR7A 3CRQA 1IBMB 1XNRO 1BHAA 3AG2C 3A0BZ 5J2TA 5DEDA 3TXQA 4D7SA 1JPXA 3D3IA 3WU2Z 2QR4A 1L0LH 2DN9A 3OAAG 2HHHB 2QA4V 2WLIA 4TV9B 3HKEB 1K4CC 3AG4C 1YVWA 2Y48A 4KUMA 2CGOA 1VQ6V 1EN6A 5JVDA 3RYCB 2GBOA 2GV9A 5KHHA 2JJ2G 2P5OA 1VF5B 4HYOA 4X9QA 3RGBA 2W6IG 1FPOA 1AR4A 2H94A 1XDCA 4JI7O 1OCRB 4DR4B 4B3SO 5TISZ 5IWAB 1KUQA 2IU0A 2JGDB 4DV5O 3S3XA 1FD9A 4WFEA 5B1OA 5JQGB 4LNUA 1EZJA 5IYZA 1N34B 1G4YB 5IJ0B 5LYJA 2EIKB 4I5SA 2YEVA 4DK1A 3OR7C 3L74H 3E22A 2BOBC 1MABG 4DV6B 3D36A 1WN7A 4FLWA 3JASB 3C3SA 4QNHB 2FB5A 4MTGA 1Y76B 3TGUH 4DUYO 2JS3A 2P06A 4QGPA 3F5WC 1VQPV 3J81N 5LP6B 1KD1W 3GVMA 1GAXA 4LF5O 3L71H 2XAHA 2O57A 4BIUA 3HKBA 5GTIZ 1N0JA 2F93B 4JAUA 2EIKC 1G1XB 4PELA 4IGGA 3J7AU 4MW3A 3RFRA 1M57C 2OWOA 1TAEA 5IWAO 5FNVB 2KG7A 3WB0A 2YC0A 1YZBA 4QIWF 3E8BA 4FFBB 5B66Z 2OTJV 3W7UA 3L9DA 1FYJA 3O9OA 1R6TA 1N8RW 1BSMA 3FAVB 2YXHA 3E86A 4P2ZA 3LDEA 3CCLV 1UJWB 4BIOA 2WLJA 4JI2O 4LF9O 1JFFB 2ETNA 4G27B 1TVKA 5H5NA 3RYFB 4DR1B 4FFBA 4Z1MG 3OUFA 3SYQA 3KZIZ 4RUEA 2YICA 3LUTB 1GMGA 3VOUA 1AI5A 2HJFC 3ETDA 1I0HA 3K5LA 5KX5B 1I7FA 4LNUB 5LMNB 3QO7A 1VF6A 1KKDA 2JJ1G 1FAFA 3ZMUA 3HB3B 1BGYH 4LFBO 4HNAA 4JI6O 1R3LC 1SC5B 3SPHA 3JAKA 2E3CA 5LMUO 4CH3A 1YF2A 2P6JA 4DV2O 5LOVA 3TETA 4EFEA 2A0LA 1EBOA 1SETA 5BZBA 4DR6B 1HNXO 3TK1A 1VQMV 2CH7A 1F4MA 2BOCC 3BRCA 2EILB 1NTKH 3HR0A 3D36C 3T2MA 3OMIB 4B7KA 2B9ZA 3CRRA 1U97A 2L6LA 2XHBA 1M5IA 3CB2A 4I50A 5KAFZ 3ASNB 2UU9O 2X6CA 1KKCA 2YEVB 1WJZA 4IYIA 5BR8O 2V7QG 1WPBA 1BL8A 2JEXA 2EULA 3BFRA 3AG1B 4FM1A 3K5MA 5LHIA 1Q43A 3RW0A 4X62O 1UPGA 3T1YO 4B3MB 3OMAB 4BWAA 4UVCA 1K92A 4DV4B 4PDLA 1NR1A 2XNDG 1SQPH 5DECA 3FB5C 1WB7A 2H3OA 2AZ0A 3T4ZA 4E2LA 3CJHB 4NXNO 4LP8A 1HNZO 4JI1B 1EM1A 1M56B 2IJHA 2UUBB 4IT5A 5IYDO 4X66B 2BE3A 3LDCA 3PJSK 4XDLA 1QVFU 5JVDB 3M8AA 4Q6GA 1SS3A 4FLZA 2EZOA 4LC1A 3IAYA 2LGWA 3CMAV 2ARHA 4O4HA 1PPJH 2VWKA 2ZINA 4DR6O 4XDKA 1S0VA 1S5HC 1JA8A 5J2TB 2LO1A 1SQBH 3BPZA 1JQ0A 5DM6V 2Y69C
chains in the Genus database with same CATH topology
3C3SA 3RN4A 3CEIA 1ZSPA 4FFKA 3K9SA 4JZ2A 4YIOA 1EN5A 1WB8A 1MA1A 2ADQB 4GUNA 4F6EA 3C3TA 1I08A 4E4EA 1AP6A 2P4KA 1IXBA 1XILA 3KKYA 3DC6A 1ZTEA 2AW9A 1PL4A 1GN3A 1N0JA 1MSDA 1AVMA 1AP5A 1KKCA 1GN2A 3AK2A 1P7GA 3LSUA 4BR6A 3BFRA 1D5NA 3IC9A 1N0NA 1XREA 1EN4A 1PM9A 1EN6A 1BT8A 1GN6A 1IDSA 1VEWA 4YIPA 1JR9A 3QVNA 1BSMA 1WB7A 3AK1A 3KDRA 4X9QA 1QNMA 1ZLZA 3OT7A 1B06A 1AR4A 1XDCA 2CDYA 1AR5A 1EM1A 2CE4A 3TJTA 4C7UA 2ADPA 3DC5A 1XUQA 1GN4A 1VARA 2QKAA 3MDSA 1LUVA 1MNGA 1I0HA 2RCVA 1ZUQA 4JZGA 5A9GA 1SZXA 1Y67A 3EVKA 3AK3A 2GDSA 1JA8A 5AG2A 1LUWA 1IX9A 2QKCA 1MMMA 4JYYA 1BS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C3S A;  3RN4 A;  3CEI A;  1ZSP A;  4FFK A;  3K9S A;  4JZ2 A;  4YIO A;  1EN5 A;  1WB8 A;  1MA1 A;  2ADQ B;  4GUN A;  4F6E A;  3C3T A;  1I08 A;  4E4E A;  1AP6 A;  2P4K A;  1IXB A;  1XIL A;  3KKY A;  3DC6 A;  1ZTE A;  2AW9 A;  1PL4 A;  1GN3 A;  1N0J A;  1MSD A;  1AVM A;  1AP5 A;  1KKC A;  1GN2 A;  3AK2 A;  1P7G A;  3LSU A;  4BR6 A;  3BFR A;  1D5N A;  3IC9 A;  1N0N A;  1XRE A;  1EN4 A;  1PM9 A;  1EN6 A;  1BT8 A;  1GN6 A;  1IDS A;  1VEW A;  4YIP A;  1JR9 A;  3QVN A;  1BSM A;  1WB7 A;  3AK1 A;  4X9Q A;  1QNM A;  1ZLZ A;  3OT7 A;  1B06 A;  1AR4 A;  1XDC A;  2CDY A;  1AR5 A;  1EM1 A;  2CE4 A;  3TJT A;  4C7U A;  2ADP A;  3DC5 A;  1XUQ A;  1GN4 A;  1VAR A;  2QKA A;  3MDS A;  1LUV A;  1MNG A;  1I0H A;  2RCV A;  1ZUQ A;  4JZG A;  5A9G A;  1SZX A;  1Y67 A;  3EVK A;  3AK3 A;  2GDS A;  1JA8 A;  5AG2 A;  1LUW A;  1IX9 A;  2QKC A;  1MMM A;  4JYY A;  1BS3 A; 
#chains in the Genus database with same CATH topology
 1K9M W;  2ZE6 A;  1TUE B;  4HZ3 A;  4FZ0 A;  5BXZ A;  5C93 A;  4OXS A;  3P32 A;  1JNB A;  2IJJ A;  4FLY A;  4DV5 B;  3ICX A;  4NB5 A;  1ZAU A;  3H1L H;  4PD4 F;  3ML0 A;  3N2K A;  4L8J A;  4JAS A;  1XL4 A;  3S3W A;  1XIL A;  4CC6 A;  4IHJ B;  3CCQ V;  3A2F A;  1VQK V;  4FM0 A;  3DC6 A;  1FXK C;  2LQT A;  5KHK A;  3CCJ V;  4NTX A;  5HFM A;  2ZE5 A;  1W59 A;  1R1B A;  3EHB B;  2CAZ C;  2DYS B;  2M7W A;  1AVM A;  5FPR A;  3B8N A;  3E89 A;  2DWE C;  3X2Q C;  2Z5U A;  3AK2 A;  1FJG B;  1KQS U;  4BR6 A;  1V55 B;  5B5E Z;  2DYR C;  4HAM A;  1AIL A;  5GON B;  1SZT A;  4X89 A;  1BT8 A;  2YID A;  1WA8 A;  2EIJ C;  1P7B A;  1ORQ C;  5JH7 A;  2DW4 A;  1NR7 A;  2RNB A;  4P30 A;  4UCV A;  3CC7 V;  4X65 O;  4XDJ A;  1AR5 A;  2WWW A;  3OEE G;  1AJP A;  1O9G A;  5CBF A;  4J11 A;  1W0J G;  1G8M A;  2RJZ A;  3CCR V;  4RAI A;  1N36 B;  1LUV A;  5KA6 A;  3CCM V;  2XUM A;  2ITC C;  4DV7 B;  3AG1 C;  1DTO A;  3TXS A;  3CSX A;  5A9G A;  1T5E A;  1N32 O;  3UKM A;  4P9P A;  3AK3 A;  4PHZ A;  2N04 A;  3E83 A;  4WFF A;  2XAF A;  4I0X A;  4O2A A;  1US6 A;  2ATK C;  4EEQ A;  3BVO A;  5JWP A;  3E8H A;  4UUJ C;  3OFN G;  1TGO A;  4U3F H;  4DR1 O;  1Y74 A;  1IUR A;  5BY1 A;  1YSC A;  1PV0 A;  3C3T A;  2IH1 C;  3SR2 C;  3AG3 C;  3M99 B;  1KB9 F;  5B3S B;  5IYB O;  1K7D A;  5CB4 A;  4GCZ A;  1N4C A;  2EIM C;  1GK9 A;  1H38 A;  4JI5 B;  2Q68 A;  1V9P A;  5L3G A;  1GN3 A;  3H01 A;  4J80 A;  4PDR A;  3JAW B;  1WP8 A;  1FFX A;  3A0H Z;  1B6Q A;  4TOI A;  2OT5 A;  3JD2 A;  2Z0A A;  1RPO A;  1MG1 A;  1PM9 A;  1BQZ A;  3G6B A;  3JCZ A;  3ABK B;  2YSU B;  4X88 A;  4JYB A;  2GSM B;  5LXT A;  1WLE A;  2F43 G;  2QEX V;  3ABM B;  1NH2 B;  3L70 H;  2XT9 A;  4GKJ O;  1CXZ B;  4FLX A;  2B1I A;  5CA1 B;  5BR8 B;  1FXV A;  2Q5Z A;  2ZR3 A;  3FB6 C;  3TJT A;  2CH7 B;  1GN4 A;  1I5X A;  4IYH A;  4PA7 A;  1S76 D;  4J7J A;  2OCH A;  1O9H A;  2WLL A;  1MZE A;  1SQF A;  3G4S V;  4K3A A;  1YCI A;  3CXH F;  4O4I B;  2NR5 A;  3OEH G;  4MS2 A;  4IIJ A;  1X59 A;  2UUC O;  2WLI B;  4TV9 A;  3RYH B;  4PDM A;  2CTP A;  3ZED A;  2BTO A;  3K59 A;  5LHH A;  3SDL A;  4K0K O;  4Z1V A;  4N23 A;  4PA3 A;  3G80 A;  1MOF A;  3U0Z A;  2IM9 A;  1XNQ B;  2X6B A;  4PV1 B;  4TUY A;  1QR8 A;  3FFQ A;  1KEC A;  3KCX A;  4TWK A;  3ZX6 A;  4F6E A;  2V1D A;  4WBN B;  3CXC U;  4R8C A;  1GRJ A;  4E4E A;  1SQG A;  4DYL A;  3UT5 A;  4I4T A;  2CUG A;  4R6Z A;  1IXM A;  3UCS C;  1F7Y A;  4MSW C;  2F95 B;  1TA8 A;  2AW9 A;  2EJR A;  3R66 A;  3C90 A;  1XOU A;  4UCS A;  4MVS A;  2E5L O;  4I7Z B;  3E22 B;  2ZQM A;  4NTY A;  3MHS C;  4X1I B;  3STL C;  5IYC O;  4PA6 A;  5LGT A;  2D2C B;  2Q69 A;  2RN9 A;  1D5N A;  3TCU A;  2EIL C;  4AIL C;  1N0N A;  2QWP B;  2AHZ A;  4I9Q A;  2GTS A;  4RUF A;  2UUA B;  2JGD A;  1IZ3 A;  1YEW A;  1G6U A;  4YJ2 B;  5IT9 N;  5L3B A;  2X7R B;  2HR3 A;  2QJ1 A;  1SQQ H;  5KX5 A;  2OCC B;  1QHT A;  2UXB O;  3QF7 A;  1R3I C;  2LW7 A;  4B3T B;  1QNM A;  2IJI A;  3E35 A;  2XAG A;  3HKB B;  4JYC A;  1BZK A;  1VQL V;  5H9C A;  1S5L Z;  3DC5 A;  1VAR A;  3QG5 A;  4JYA O;  4AI8 A;  2JS5 A;  4X20 A;  1HW7 A;  1I94 B;  1K3E A;  5IDJ A;  1VF6 C;  2QGN A;  4WFA V;  3N27 A;  2P7T C;  2FKX A;  2HVK C;  2R9R B;  3WB2 A;  4JZG A;  2KQX A;  2BCC H;  2YIA A;  2GDS A;  1FXK B;  3GB7 C;  1H8H G;  1IJG A;  1MMM A;  4LF8 B;  4DXW A;  3JAR A;  3JCU Z;  1VQ7 V;  4J9Z B;  3B77 A;  2QM8 A;  1XHZ A;  4W4L A;  1SES A;  1YIT V;  1S5J A;  2WLN A;  2XAJ A;  4U7O A;  2AHY A;  4O2B A;  5LGU A;  3W7X A;  2YUA A;  2UXC B;  3HKD B;  4FLT A;  1W2B U;  1RP3 B;  4X1Y A;  2JRI A;  2QWR B;  4U3J A;  3B09 A;  3OTO B;  5CA0 A;  2BSK B;  1BMF G;  4TV8 B;  4B3T O;  4J7Z A;  3MHH C;  2H8P C;  3K5O A;  3K0G A;  1P7G A;  1HP8 A;  4OPH A;  4LF7 B;  2Y0I A;  1TUB B;  4OX9 O;  4F6R A;  1JMK C;  1VQO V;  3ABM C;  3W7T A;  1FS0 G;  2JIZ G;  4YIP A;  2OCC C;  5JQG A;  4P9O A;  4TT3 G;  4X64 O;  4X66 O;  4YY3 B;  4K8X A;  1LNQ A;  4WFH A;  1JJ2 U;  3MDS A;  3JAT B;  3K9A A;  2JK5 C;  2KB1 A;  1L8D A;  4GZR B;  1OCR C;  1NTZ H;  3HPL C;  1XBL A;  1FXH A;  4I4T B;  3RYC A;  2ZDI C;  2R9I A;  1QLE C;  2PYJ A;  2CTR A;  1JVM A;  2EIN B;  3HKC B;  3GWK C;  4B3M O;  4J9Y B;  1Q6U A;  1F51 A;  4JYY A;  3WG7 B;  1M56 C;  3OTO O;  1SQV H;  1PNL A;  4LF9 B;  3CEI A;  3G71 V;  5LA6 A;  2Y4T A;  3ZJZ A;  4YJ3 B;  1OCZ B;  2K9P A;  2ADQ B;  4PJ0 Z;  4MT8 A;  3BEH A;  3ZN0 A;  4DW0 A;  1X4T A;  4FMT A;  3AG2 B;  4NVP A;  2UUB O;  4FVM A;  5EZY B;  2ZDI A;  1ZTE A;  3DXR A;  2QWQ B;  4JV5 O;  5FL7 G;  4CZZ A;  2PTM A;  4UCT A;  2HHH O;  4K8Z A;  1HDJ A;  2R9A A;  1KBH A;  4DV1 B;  3FB7 C;  1H2M A;  1WNS A;  3JD1 A;  1Q7Y W;  3ZN1 A;  5EIB D;  4JTC B;  5LXT B;  3W7S A;  5JJN B;  5EK0 A;  5CN0 A;  4XBF A;  2IJK A;  1K8A W;  1SF9 A;  1VQN V;  1IDS A;  2KSD A;  1UFI A;  4O4H B;  3VQV A;  2LFR A;  4NKG B;  2Q7G A;  3E8F A;  1TUB A;  2P90 A;  3QTC A;  4B3R O;  3OGI B;  3K57 A;  3DTU B;  1IVS A;  3EXA A;  2CE4 A;  1V55 C;  5D5P A;  2EIN C;  3CJH A;  3IGA C;  1LR1 A;  2C2A A;  4BW9 A;  1XMO B;  2ZM6 B;  5D5Q A;  1W0K G;  1QCE A;  5AG2 A;  1RFY A;  2Y4U A;  4FJC C;  2WA3 A;  5A2Q N;  1YIJ V;  1BS3 A;  4LH7 A;  5JJE B;  4H33 A;  4ZHQ A;  1RM1 C;  1BHB A;  1HR0 O;  1QQC A;  2PI4 A;  1OCZ C;  3SPI A;  1NH2 D;  1H8E G;  4DR2 O;  1D2D A;  4MW8 A;  4FLV A;  1I08 A;  1FXK A;  1DK1 A;  4W4K A;  1FKA O;  3APO A;  3T1C A;  1NI8 A;  1AP6 A;  1JCH A;  4O4J B;  4KFM A;  1IXB A;  3OD4 A;  4F6R B;  2Q7E A;  2LP7 A;  5B1B C;  3ZRV A;  2EX3 A;  3FYI B;  4PI2 A;  4UFZ A;  2OIG A;  2FTK A;  1OHH G;  4H37 A;  4UCR A;  4LFC O;  5JH7 B;  1GO3 F;  2ZIM A;  4DUZ B;  4MVO A;  5FNV A;  2VRZ A;  4HNA B;  2WLM A;  2Z3Y A;  4IL6 Z;  3M7M X;  2UXC O;  1AI4 A;  1Q82 W;  4LR3 A;  1QBZ A;  1N33 O;  4TQD A;  3BCC H;  3G6E V;  1SRY A;  1NQT A;  2HKO A;  1P4R A;  3ZRS A;  4FK5 C;  3KDR A;  5LA6 B;  2ZNI A;  3OT7 A;  2DQ0 A;  4LF6 B;  2WSS G;  3FKS G;  4JI0 O;  3RBZ A;  2UUC B;  1HR0 B;  3KG2 A;  5ITZ A;  1ARO P;  4PA4 A;  4GX1 A;  4JI3 B;  1DF4 A;  3L73 H;  2WPD G;  3BAA A;  4I9W A;  1IBM O;  2QDO A;  4H0L B;  1AJN A;  5CBG A;  4O2B B;  2GUZ A;  4DRX B;  4UCU A;  3RVY A;  4CS2 A;  3EVK A;  1YDX A;  4X64 B;  1ZL8 B;  4TSF G;  4WFG A;  4JI8 B;  3FYE B;  3LDD A;  2L35 A;  3CCS V;  4CH5 A;  2ITD C;  3RN4 A;  4FFK A;  1JX9 A;  5GTH Z;  2VQF B;  3K9S A;  1WB8 A;  1MA1 A;  1E1Q G;  4LFC B;  3B40 A;  1SQX H;  3ZRX A;  2P4V A;  4JGS A;  1K73 W;  4DUZ O;  4YJ2 A;  3X2Q B;  1P84 F;  1M90 W;  3SJA C;  1L0N H;  3KKY A;  3CC4 V;  1R73 A;  4DR4 O;  2UU9 B;  1V54 C;  2HP8 A;  1KU9 A;  2QWO B;  2DE0 X;  5J2U A;  2A3Q A;  3ETQ A;  4RWU A;  4TV8 A;  1JFF A;  1AP5 A;  1GN2 A;  5L3D A;  3LNM B;  1K34 A;  2JGU A;  4LFA O;  4DV0 B;  4UB8 Z;  1Q8I A;  4D6T H;  5IJ9 B;  5DN6 G;  4PA9 A;  2QM7 A;  3T1H O;  3QNE A;  4O4J A;  1B3Q A;  4DV2 B;  2EJ7 A;  1NTM H;  1AI7 A;  1VMG A;  1VEW A;  3CP1 A;  2Y0P A;  2ZE8 A;  2PYL A;  4FM2 A;  4DR7 O;  1K5Q A;  2FML A;  4MTX A;  5CBH A;  1HNX B;  4JYA B;  2CDY A;  3ZHU A;  1I94 O;  2E76 B;  3QO8 A;  3G67 A;  3JSL A;  3I5D A;  2ADP A;  4DK0 A;  3B4S A;  5KUM A;  4N21 A;  2M6Y A;  2W6J G;  5K1P A;  4IIJ B;  4B08 A;  3JD3 A;  1QLE B;  3DGE A;  4DR3 O;  3F5T A;  2Q9L A;  4ZIB A;  5C8Y B;  4WBN A;  3AG3 B;  1AB3 A;  1IBK O;  1S72 V;  3JAL B;  1KYO F;  4MTO A;  2A06 H;  4TUY B;  3W7W A;  2QTS A;  3OM3 B;  4JZ2 A;  4YIO A;  1WPX A;  4I0X B;  3A8T A;  2P67 A;  5EYP B;  3K0D A;  4QJF B;  3ABL C;  2CK3 G;  2JEU A;  2EZP A;  4KL1 A;  1PL4 A;  2RMK B;  3T4D A;  1FFT B;  2HFE C;  1Q3E A;  4LF7 O;  3N2G A;  5L3F A;  4LBE C;  1GH6 A;  1KC8 W;  5FLX N;  1ZL8 A;  2ZXW C;  2DWD C;  4MVZ A;  3LSQ A;  5JJJ B;  3D8C A;  1VF7 A;  3BAB A;  4G2K A;  1ZWI C;  4ZI7 B;  3B8M A;  4JI6 B;  1YHQ V;  1NZ6 A;  1AJQ A;  3CC2 V;  1VQ8 V;  2ILM A;  1WA8 B;  3MD0 A;  1L1F A;  3UO3 A;  2PGG A;  3H1I H;  4F4L A;  5JCO A;  3ZHV A;  4JAA A;  4CS4 A;  1JR9 A;  1BE3 H;  3FB8 C;  3CRA A;  1XHX A;  1B06 A;  3APQ A;  2E5L B;  1RM1 B;  2B1G A;  3D3Q A;  5IY5 B;  3ZMV A;  2Q0A A;  1F23 A;  1JJO A;  4QE7 A;  4DV7 O;  1K97 A;  1XUQ A;  5LHG A;  4WCE V;  4ZBM A;  1EFR G;  2XOK G;  4YHH O;  4NTW A;  3I55 V;  1GM7 A;  1Y66 A;  1M57 B;  4FPP A;  4AQY B;  2E74 B;  2WA4 A;  3N2K B;  5B1B B;  3R65 A;  4JF3 A;  1ROP A;  1K33 A;  4OX9 B;  2K1E A;  4GX2 A;  4JTD B;  3Q4H A;  4LWS B;  5EC1 C;  3RWR D;  3JD4 A;  4MVQ A;  5KA5 A;  3N2G B;  1Y76 A;  2BTQ A;  5CA1 A;  1COW G;  5B3S C;  1SER A;  3JAS A;  2DMX A;  2E75 B;  1IBL B;  1VQ5 V;  4J41 A;  1H2K A;  2JDI G;  5LYJ B;  2UXD B;  4UVB A;  2P4K A;  3THO A;  3SJB C;  1HNZ B;  2CTW A;  4UV8 A;  4JI1 O;  3L72 H;  1Q6I A;  3H1K H;  4ZOL B;  3ABU A;  4JI8 O;  4FZ1 A;  2XAQ A;  2RQ6 A;  3ZHS A;  2BTQ B;  3P3N A;  3U10 A;  3QO5 A;  1R6K A;  4DV1 O;  5J9P C;  1B04 A;  1H2L A;  3EFF K;  3HKC A;  3JAW A;  4JI7 B;  5GW7 A;  5CMU A;  5C8Y A;  1Z5V A;  4JI4 O;  3LSU A;  1OCC C;  5CB4 B;  3CHX A;  3CS5 A;  3CCE V;  4YHH B;  1OCO B;  1SA0 A;  1A32 A;  2GHY A;  3OUS A;  4I55 B;  4R7C A;  3T1Y B;  1MSW D;  4MVU A;  4YJ3 A;  5LP6 C;  4WFB V;  1OV9 A;  5KLV H;  2YDE A;  3ZHR A;  2AXT Z;  3SPG A;  1NBM G;  2EIJ B;  2UXX A;  2ZR2 A;  5B1N A;  4DV6 O;  3OE7 G;  5HFL A;  4J7K A;  5JCO C;  1THZ A;  4G28 B;  4UVA A;  3KCY A;  2LJ2 A;  3ABK C;  4DV0 O;  4C7U A;  2ZM6 O;  4LFA B;  4NXN B;  1CEZ A;  5K1X A;  1RSO B;  2KKW A;  4LF4 B;  3PN1 A;  5IY5 C;  3B2E E;  3STZ C;  5L3C A;  2ZCE A;  1ENV A;  4I55 A;  1V54 B;  2LGQ A;  4DR7 B;  1SA0 B;  2ZD9 A;  1BQ0 A;  2D3O W;  1Q6H A;  4NXM O;  4AHC A;  1J5E O;  4ZKI A;  4YY3 O;  3E8G A;  3FD9 A;  5B1A B;  4KHP B;  4Z2W A;  2WLK A;  4JPR A;  4X1Y B;  3SYO A;  4EFB A;  3K79 A;  2PI5 A;  4ASU G;  2ZE7 A;  3HKD A;  4JI4 B;  4B3R B;  4DR5 O;  3ZCC A;  1FOU A;  4ZOL A;  1XMQ B;  4X65 B;  2CGN A;  3K06 A;  3WFV A;  3ZS8 C;  1NU1 H;  2LFS A;  5KUK A;  3SYP A;  5LL6 Y;  1R3K C;  4RQF A;  3CCV V;  1VQ4 V;  3CE2 A;  2ZIO A;  4CC5 A;  5EIB C;  4X1I A;  1NVP D;  4I50 B;  3RVZ A;  2NNU A;  4ABM A;  2OYQ A;  2Q7H A;  2Q6A A;  3J80 N;  3OTF A;  2ZT9 B;  1N32 B;  4MVR A;  1YI2 V;  2UUA O;  3IC9 A;  3P3P A;  2YIB D;  5FPO A;  3CYO A;  1XRE A;  1DGS A;  4K35 A;  3Q4H B;  2UXN A;  5LGN A;  1FJG O;  2NN4 A;  3OMN B;  4YXW G;  3FX7 A;  3JAT A;  2VWJ A;  4RQE A;  2AGA A;  1PD3 A;  2FYU H;  4DW1 A;  4DR2 B;  3SJC C;  2KG7 B;  3ZMT A;  1XL6 A;  4LFB B;  3AK1 A;  1OCO C;  3CX5 F;  4LF5 B;  5LMU B;  4UCO A;  1J5E B;  2Y69 B;  3BY6 A;  1AI6 A;  4FIP C;  3JSN A;  4O4L A;  4H13 B;  1MNG A;  5E1A C;  4CBC A;  3OGC C;  4H44 B;  3K58 A;  3ASO C;  4CH6 A;  4DR5 B;  1NVP B;  2GTA A;  1D5A A;  4JTA B;  1VIB A;  1YTF B;  1Y67 A;  1KP3 A;  3MAQ A;  3H1H H;  2F66 C;  3CD6 V;  1H5W A;  1NKD A;  3CME V;  3RYF A;  1PL0 A;  1ZX3 A;  3ETE A;  3JAL A;  2P22 C;  5H6R A;  1N34 O;  4ZI7 A;  5CA0 B;  1PP9 H;  2HEP A;  3P30 A;  1ZSP A;  3JD0 A;  1N33 B;  3JAK B;  1H2G A;  2W0F C;  4B7E A;  3FAV A;  5KAI Z;  5CA3 A;  4GUN A;  2QM4 A;  3ABL B;  1URF A;  1U96 A;  4X62 B;  1CP9 A;  4ICG A;  4TQF A;  5B1A C;  2V4D A;  4AQY O;  4JI0 B;  4FLU A;  4DV3 B;  2PUS A;  5H2F Z;  5IYZ B;  2WAM A;  2G38 A;  4PDV A;  3VQW A;  3IFX A;  1R3J C;  5EBM C;  1EZV H;  4JI3 O;  3ZIA G;  1M1K W;  3JAR B;  1MSD A;  1TVK B;  5LBQ A;  4JI5 O;  5E79 Z;  3OW2 U;  2A7W A;  3K03 A;  3UM7 A;  3JAM N;  2A9H A;  2YIB A;  4OGQ B;  4A5U B;  1YTF D;  1Z5W A;  3SPC A;  3WB1 A;  2QKS A;  2GUZ B;  3RYH A;  4DRX A;  1QR9 A;  1Y6X A;  5BMV B;  4LF8 O;  1KP2 A;  1YJW V;  3SPJ A;  4O4I A;  2UXD O;  1GTO A;  1Q86 W;  3ABT A;  3ZHQ A;  2VQE O;  3VBB A;  2QWN B;  1SKV A;  3F7V C;  1YJ9 V;  4EKW A;  1R6N A;  2DJV A;  1VP7 A;  1ZLZ A;  4O4L B;  4NR1 A;  2QE7 G;  2IBZ H;  3AEI A;  4LCU C;  5H6Q A;  1Q81 W;  2FL4 A;  4GKK B;  3RYI B;  2IU3 A;  3JYC A;  2Q73 A;  3BHP A;  2PZS A;  2CTQ A;  2DYS C;  2RCV A;  4MTF A;  1IBK B;  1ZUQ A;  2EBO A;  4X1K A;  2HG5 C;  5LP6 A;  2EIM B;  2A79 B;  4UV9 A;  3CCU V;  1FFX B;  1OJH A;  1J95 A;  5IJ9 A;  4R50 A;  1OZ0 A;  1XNR B;  2OIE A;  2DOS A;  3CRC A;  2MK3 A;  4K0K B;  4QPK A;  1EN5 A;  5EZY A;  4LF4 O;  1XQ8 A;  2MW2 B;  4QPJ A;  1H2N A;  2F4V B;  1NT2 B;  1XNQ O;  4GLX A;  1E79 G;  1H2S B;  5J2U B;  3K04 A;  4X1K B;  3WG7 C;  4Q20 A;  4U7N A;  4JV5 B;  4GYC B;  4BIZ A;  5GON A;  3ZMZ A;  4X8A A;  3HKE A;  4J10 A;  1GM9 A;  1GKF A;  4ZHQ B;  3IJ4 A;  1DF5 A;  4NXM B;  4HBN A;  4KHP O;  3OR6 C;  2PY5 A;  2Q4P A;  5KHJ A;  3GWO A;  3H9V A;  5KHG A;  4DR3 B;  4L87 A;  4B3S B;  3ETG A;  1YXB A;  1EN4 A;  3CRM A;  1NJI W;  1K5S A;  1XMQ O;  1PNK A;  2F1M A;  2WLL B;  1Y4M A;  4GT1 A;  3SJQ C;  2YXL A;  2PF4 E;  3CWB H;  3QVN A;  1RPR A;  1Y74 B;  5BMV A;  4LH6 A;  4CH4 A;  3CPW U;  2AZ2 A;  1E1R G;  1RSO A;  1HWY A;  2N74 A;  5ITZ B;  1P49 A;  3UQ8 A;  2YI8 A;  4DUY B;  4KXR A;  3AG4 B;  5L3E A;  2JVD A;  3NXS A;  2R72 A;  3SYA A;  5IJ0 A;  1PNM A;  3K5N A;  3T1H B;  2F4V O;  4UB6 Z;  4J42 A;  4NYK A;  3U11 A;  1SZX A;  2IH3 C;  3ZMS A;  1KMI Z;  1LUW A;  4LWS A;  1IX9 A;  1GM8 A;  3DSQ A;  5KMG A;  1M4U A;  3ZHT A;  3O65 A;  5KHI A;  4U3J B;  2Q0O C;  2B5U A;  2Q8V A;  2ZNJ A;  2YXY A;  3K3W A;  3A0R A;  2X0L A;  2ZKO A;  5EC2 C;  3BA8 A;  4BW5 A;  4EB6 A;  2NLJ C;  2DYR B;  5EBW C;  2QTO A;  3IC7 A;  1AR1 B;  2HLD G;  3VQY A;  2YI9 A;  2WLH A;  1QVG U;  1N36 O;  4GKJ B;  1Q90 D;  4O2A B;  3ZBH A;  1XMO O;  3ASO B;  2YS8 A;  5EBL C;  2Q67 A;  2X6A A;  4JI2 B;  1S77 D;  2ZXW B;  1NS1 A;  4RO2 A;  3ZRW A;  4DV3 O;  4CS3 A;  3K08 A;  4KP4 A;  4X20 B;  4EB6 B;  1GN6 A;  1PKX A;  1QLN A;  1M93 A;  5LMN O;  4LF6 O;  1HNW O;  2QSA A;  4WF9 V;  4GX5 A;  1IBL O;  2IW5 A;  1K4D C;  3RT3 C;  1Q5O A;  4DO2 A;  4JAV A;  1M9N A;  3DXR B;  5F2V O;  4MVM A;  2HJD A;  1Z2G A;  5KMG B;  3H1J H;  3SGI A;  3BA9 A;  2QKA A;  3AG7 A;  1DLB A;  2OTL V;  1QU7 A;  3SYC A;  5EYP A;  3LNN A;  3ASN C;  1WAZ A;  2VQE B;  2VS0 A;  4BAY A;  1WP7 A;  5IE9 A;  2N05 A;  1CPY A;  4GX0 A;  2VQF O;  4UXN A;  2BSK A;  2QKC A;  2R70 A;  1VQ9 V;  1MZF A;  2RDC A;  4QE9 A;  3LSS A;  2LW1 A;  4GKK O;  4IHJ A;  3L75 H;  1BCC H;  3E2E A;  4PI0 A;  2W0X A;  3UT5 B;  2ODM A;  3UO2 A;  1XEQ A;  4DV4 O;  1I5Y A;  4OPA A;  3ZRW B;  1OCC B;  2XTA A;  1S3J A;  4D7T A;  2HVJ C;  5LOV B;  1HNW B;  1JOY A;  3VQX A;  2DQ3 A;  3F7Y C;  3I56 V;  2UXB B;  1XI1 A;  3RYI A;  1YJN V;  2XAS A;  2F23 A;  1F4N A;  3NR7 A;  3CRQ A;  1IBM B;  1XNR O;  1BHA A;  3AG2 C;  3A0B Z;  5J2T A;  5DED A;  3TXQ A;  4D7S A;  1JPX A;  3D3I A;  3WU2 Z;  2QR4 A;  1L0L H;  2DN9 A;  3OAA G;  2HHH B;  2QA4 V;  2WLI A;  4TV9 B;  3HKE B;  1K4C C;  3AG4 C;  1YVW A;  2Y48 A;  4KUM A;  2CGO A;  1VQ6 V;  1EN6 A;  5JVD A;  3RYC B;  2GBO A;  2GV9 A;  5KHH A;  2JJ2 G;  2P5O A;  1VF5 B;  4HYO A;  4X9Q A;  3RGB A;  2W6I G;  1FPO A;  1AR4 A;  2H94 A;  1XDC A;  4JI7 O;  1OCR B;  4DR4 B;  4B3S O;  5TIS Z;  5IWA B;  1KUQ A;  2IU0 A;  2JGD B;  4DV5 O;  3S3X A;  1FD9 A;  4WFE A;  5B1O A;  5JQG B;  4LNU A;  1EZJ A;  5IYZ A;  1N34 B;  1G4Y B;  5IJ0 B;  5LYJ A;  2EIK B;  4I5S A;  2YEV A;  4DK1 A;  3OR7 C;  3L74 H;  3E22 A;  2BOB C;  1MAB G;  4DV6 B;  3D36 A;  1WN7 A;  4FLW A;  3JAS B;  3C3S A;  4QNH B;  2FB5 A;  4MTG A;  1Y76 B;  3TGU H;  4DUY O;  2JS3 A;  2P06 A;  4QGP A;  3F5W C;  1VQP V;  3J81 N;  5LP6 B;  1KD1 W;  3GVM A;  1GAX A;  4LF5 O;  3L71 H;  2XAH A;  2O57 A;  4BIU A;  3HKB A;  5GTI Z;  1N0J A;  2F93 B;  4JAU A;  2EIK C;  1G1X B;  4PEL A;  4IGG A;  3J7A U;  4MW3 A;  3RFR A;  1M57 C;  2OWO A;  1TAE A;  5IWA O;  5FNV B;  2KG7 A;  3WB0 A;  2YC0 A;  1YZB A;  4QIW F;  3E8B A;  4FFB B;  5B66 Z;  2OTJ V;  3W7U A;  3L9D A;  1FYJ A;  3O9O A;  1R6T A;  1N8R W;  1BSM A;  3FAV B;  2YXH A;  3E86 A;  4P2Z A;  3LDE A;  3CCL V;  1UJW B;  4BIO A;  2WLJ A;  4JI2 O;  4LF9 O;  1JFF B;  2ETN A;  4G27 B;  1TVK A;  5H5N A;  3RYF B;  4DR1 B;  4FFB A;  4Z1M G;  3OUF A;  3SYQ A;  3KZI Z;  4RUE A;  2YIC A;  3LUT B;  1GMG A;  3VOU A;  1AI5 A;  2HJF C;  3ETD A;  1I0H A;  3K5L A;  5KX5 B;  1I7F A;  4LNU B;  5LMN B;  3QO7 A;  1VF6 A;  1KKD A;  2JJ1 G;  1FAF A;  3ZMU A;  3HB3 B;  1BGY H;  4LFB O;  4HNA A;  4JI6 O;  1R3L C;  1SC5 B;  3SPH A;  3JAK A;  2E3C A;  5LMU O;  4CH3 A;  1YF2 A;  2P6J A;  4DV2 O;  5LOV A;  3TET A;  4EFE A;  2A0L A;  1EBO A;  1SET A;  5BZB A;  4DR6 B;  1HNX O;  3TK1 A;  1VQM V;  2CH7 A;  1F4M A;  2BOC C;  3BRC A;  2EIL B;  1NTK H;  3HR0 A;  3D36 C;  3T2M A;  3OMI B;  4B7K A;  2B9Z A;  3CRR A;  1U97 A;  2L6L A;  2XHB A;  1M5I A;  3CB2 A;  4I50 A;  5KAF Z;  3ASN B;  2UU9 O;  2X6C A;  1KKC A;  2YEV B;  1WJZ A;  4IYI A;  5BR8 O;  2V7Q G;  1WPB A;  1BL8 A;  2JEX A;  2EUL A;  3BFR A;  3AG1 B;  4FM1 A;  3K5M A;  5LHI A;  1Q43 A;  3RW0 A;  4X62 O;  1UPG A;  3T1Y O;  4B3M B;  3OMA B;  4BWA A;  4UVC A;  1K92 A;  4DV4 B;  4PDL A;  1NR1 A;  2XND G;  1SQP H;  5DEC A;  3FB5 C;  1WB7 A;  2H3O A;  2AZ0 A;  3T4Z A;  4E2L A;  3CJH B;  4NXN O;  4LP8 A;  1HNZ O;  4JI1 B;  1EM1 A;  1M56 B;  2IJH A;  2UUB B;  4IT5 A;  5IYD O;  4X66 B;  2BE3 A;  3LDC A;  3PJS K;  4XDL A;  1QVF U;  5JVD B;  3M8A A;  4Q6G A;  1SS3 A;  4FLZ A;  2EZO A;  4LC1 A;  3IAY A;  2LGW A;  3CMA V;  2ARH A;  4O4H A;  1PPJ H;  2VWK A;  2ZIN A;  4DR6 O;  4XDK A;  1S0V A;  1S5H C;  1JA8 A;  5J2T B;  2LO1 A;  1SQB H;  3BPZ A;  1JQ0 A;  5DM6 V;  2Y69 C; 
#chains in the Genus database with same CATH homology
 3C3S A;  3RN4 A;  3CEI A;  1ZSP A;  4FFK A;  3K9S A;  4JZ2 A;  4YIO A;  1EN5 A;  1WB8 A;  1MA1 A;  2ADQ B;  4GUN A;  4F6E A;  3C3T A;  1I08 A;  4E4E A;  1AP6 A;  2P4K A;  1IXB A;  1XIL A;  3KKY A;  3DC6 A;  1ZTE A;  2AW9 A;  1PL4 A;  1GN3 A;  1N0J A;  1MSD A;  1AVM A;  1AP5 A;  1KKC A;  1GN2 A;  3AK2 A;  1P7G A;  3LSU A;  4BR6 A;  3BFR A;  1D5N A;  3IC9 A;  1N0N A;  1XRE A;  1EN4 A;  1PM9 A;  1EN6 A;  1BT8 A;  1GN6 A;  1IDS A;  1VEW A;  4YIP A;  1JR9 A;  3QVN A;  1BSM A;  1WB7 A;  3AK1 A;  3KDR A;  4X9Q A;  1QNM A;  1ZLZ A;  3OT7 A;  1B06 A;  1AR4 A;  1XDC A;  2CDY A;  1AR5 A;  1EM1 A;  2CE4 A;  3TJT A;  4C7U A;  2ADP A;  3DC5 A;  1XUQ A;  1GN4 A;  1VAR A;  2QKA A;  3MDS A;  1LUV A;  1MNG A;  1I0H A;  2RCV A;  1ZUQ A;  4JZG A;  5A9G A;  1SZX A;  1Y67 A;  3EVK A;  3AK3 A;  2GDS A;  1JA8 A;  5AG2 A;  1LUW A;  1IX9 A;  2QKC A;  1MMM A;  4JYY A;  1BS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...