1P7GA

Crystal structure of superoxide dismutase from pyrobaculum aerophilum
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
211
structure length
211
Chain Sequence
SVTTKRYTLPPLPYAYNALEPYISAEIMQLHHQKHHQGYVNGANAALEKLEKFRKGEAQIDIRAVLRDLSFHLNGHILHSIFWPNMAPPGKGGGKPGGKIADLINKFFGSFEKFKEEFSQAAKNVEGVGWAILVYEPLEEQLLILQIEKHNLMHAADAQVLLALDVWEHAYYLQYKNDRGSYVDNWWNVVNWDDVERRLQKALNGQIALKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Structure of superoxide dismutase from Pyrobaculum aerophilum presents a challenging case in molecular replacement with multiple molecules, pseudo-symmetry and twinning.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Oxidoreductase
total genus 72
structure length 211
sequence length 211
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1p7gA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1p7gA02
1GN6A 1MNGA 3KKYA 4GUNA 1IX9A 1PL4A 4F6EA 1N0NA 3RN4A 1LUWA 1N0JA 1I08A 1LUVA 3CEIA 1WB7A 2CE4A 4BR6A 4JYYA 4YIOA 1GN4A 1XUQA 4C7UA 1AR4A 1VARA 1AVMA 1AR5A 1AP5A 3DC5A 1GN3A 3EVKA 4YIPA 2ADQB 1ZLZA 3LSUA 3QVNA 2ADPA 2RCVA 1MSDA 3TJTA 1KKCA 3AK2A 1EN5A 1P7GA 1BS3A 1BT8A 1VEWA 1Y67A 2AW9A 1MA1A 2CDYA 3C3TA 1EM1A 3IC9A 4X9QA 1WB8A 3DC6A 1GN2A 1XREA 4FFKA 1QNMA 3MDSA 1IXBA 1EN6A 1BSMA 1D5NA 1EN4A 2QKCA 3C3SA 1ZTEA 4E4EA 1JR9A 1ZSPA 3OT7A 1ZUQA 1I0HA 4JZGA 3AK1A 3K9SA 1AP6A 1XILA 1JA8A 1IDSA 1XDCA 2GDSA 1B06A 3AK3A 1SZXA 3BFRA 5AG2A 1MMMA 2P4KA 1PM9A 4JZ2A 2QKAA 5A9GA
chains in the Genus database with same CATH superfamily
5B1OA 4LF5O 3KCYA 1KU9A 3ZN1A 4MSWC 2EIKC 3BA8A 4J42A 2P5OA 1Y6XA 1IXMA 4CH5A 3UM7A 1YJWV 5B5EZ 2NR5A 1JPXA 4PI2A 2DOSA 2CTWA 2DWEC 2Y4TA 2BSKB 3HKEB 2DWDC 3D3IA 3G71V 3WU2Z 5EK0A 3CCVV 2JK5C 3SPIA 5GONB 3ABKB 4LFBB 1AJQA 1ZLZA 2N74A 4DUZO 4JYBA 3RW0A 4J7ZA 4OX9O 4JI6O 3JAKB 1THZA 4DR1B 4GCZA 3CJHB 3ABLB 1VQ6V 1KMIZ 1YSCA 2X6CA 2DN9A 3TGUH 1Y67A 3IC7A 3JSNA 4IHJA 4YHHO 1EM1A 3VQYA 2PYLA 3ZEDA 3ZHUA 1NI8A 4LFCO 2WPDG 3QNEA 2L35A 1NVPD 2LFRA 4A5UB 1XMQB 4I50A 4O4IB 3HPLC 3T2MA 4LF4O 4DRXA 3O9OA 1IURA 5CA0B 1S5HC 3O65A 1YXBA 1K4CC 4BAYA 2ZXWC 4DUYB 4DR3B 3FYIB 1KBHA 2WWWA 3B40A 4NR1A 1Y74A 3R66A 1SQXH 4BIZA 2EULA 4DW1A 2R9IA 1Z5WA 4TUYB 4I55A 2CH7B 1AROP 3ZJZA 1XOUA 3T1HB 1Q43A 1E79G 4B3TB 4TV9A 2F43G 4LR3A 4GX1A 2UXCO 5LOVB 2R70A 3A8TA 1K8AW 2OYQA 4JV5B 3CXHF 4FJCC 4J10A 2IW5A 1V9PA 4KP4A 1KKDA 3RYFA 3OGCC 2E76B 3OEHG 3ABMC 4MVMA 5D5QA 1MABG 5JJEB 4FFBB 1FKAO 3GWOA 3HKEA 4YJ3A 1VQKV 4YIPA 3L70H 4HBNA 3K0DA 4LH6A 1SZTA 2YI9A 5JH7A 1DF4A 2H94A 3JAKA 4DV4B 3Q4HA 4GT1A 1OHHG 2A06H 2Y4UA 1BT8A 4KHPO 4K3AA 4DR2O 5IYBO 1NQTA 2EZPA 1W0JG 3ZMZA 2EJRA 1NT2B 1ZWIC 1IBMB 3SJQC 5E79Z 1M93A 1SA0B 5LHIA 2QKCA 4DV5B 4YY3B 5IWAO 4QNHB 3AG1C 4JI5B 3CMAV 1GAXA 4LF8O 3QO8A 1EBOA 1YTFB 1SETA 3ML0A 1FXKC 3JARA 3UO2A 3M99B 2CUGA 3K5OA 1YJNV 1YHQV 2WA4A 4GKJB 1YI2V 4JYAB 5B1AB 1SRYA 1IXBA 2CH7A 4B7EA 1GH6A 1W0KG 3C90A 5CA1B 3P32A 4B3RO 3I5DA 2ZR3A 4PELA 4ASUG 3F7VC 1LUWA 2KSDA 3NR7A 2HP8A 4H0LB 1R6NA 2Q8VA 4XBFA 5LOVA 2YDEA 3I56V 3D3QA 3G6EV 5KHKA 2F1MA 4H44B 2QEXV 5KX5A 1FD9A 1GN4A 3UKMA 3CCSV 4WF9V 2PUSA 4HNAB 1S77D 2UU9B 1AP5A 1HNWO 2OIEA 5FNVB 1Q90D 2AZ2A 2ZT9B 5KHJA 2CGOA 3QVNA 1HNXO 1TVKA 1ORQC 4FLUA 3OM3B 1TA8A 1YVWA 1V55B 2BTQB 1KP3A 2VRZA 1N8RW 2UXBO 4EB6B 2Y69B 1NTMH 3PN1A 3ABLC 3U10A 2UUCO 1WAZA 4OPHA 1IBKB 2FMLA 1M57B 3RVZA 4XDKA 4ZBMA 2ATKC 3SYOA 2CDYA 5L3CA 2IJHA 2AHZA 4DR7B 4QIWF 3P30A 1HNZO 2RNBA 3SYAA 1VQMV 4DO2A 4L8JA 2YXHA 4MW3A 1GN2A 5LGNA 2HG5C 1YDXA 2XAGA 4LWSB 2XAQA 3E35A 3W7SA 1NVPB 1IZ3A 4O4JA 3FYEB 4CH6A 1SF9A 4JI2B 1TUEB 5KA5A 3K9SA 3P3PA 1EZJA 4QPJA 2QTSA 3OUSA 4P9PA 2Z3YA 4IL6Z 3K3WA 1H2MA 2Z0AA 5B1BB 4FIPC 1I7FA 1R3KC 1OCCC 2IU0A 1A32A 4UVAA 4F6RA 4P30A 1Y66A 1GKFA 1DK1A 1KUQA 5L3GA 4N23A 1R3LC 4IGGA 4QE9A 3RGBA 2QTOA 1ZX3A 1Q6HA 2Q6AA 4DYLA 4JI4B 5BR8O 4X20A 2EBOA 2YIDA 1PD3A 4GYCB 4J9YB 3E86A 2WLLB 4Q6GA 3BA9A 1P84F 3HB3B 3GWKC 5LBQA 1N36B 5IYCO 1F23A 3CWBH 4X62O 4LBEC 3OMAB 3SPHA 2B1IA 3T1CA 3ASOB 3NXSA 2ARHA 2CTRA 2M6YA 5CBGA 1I5XA 2RCVA 2QA4V 3UCSC 5IJ9B 3TJTA 3BPZA 3D8CA 2X6BA 4B3SO 1XMOO 3L72H 4UCUA 4NTWA 3E8BA 2PYJA 1YEWA 4EB6A 2Q7GA 5IYZA 1OV9A 5FPRA 5KLVH 5B1NA 4X89A 1UFIA 3OTFA 1U97A 1JNBA 5DM6V 1BZKA 5IY5B 1XNQB 4B3MO 2DMXA 3ABTA 2EX3A 3ZMSA 1S72V 2PY5A 4TOIA 2X7RB 3TXSA 4PA3A 3THOA 4U3JB 2LP7A 4X1IB 3RYIB 1ZTEA 2RMKB 1K33A 5KHHA 2F23A 2YIAA 2HHHO 2P22C 3FB5C 1QLNA 5C93A 1JA8A 5ITZB 2HEPA 1F4MA 3FB6C 4D7TA 4FLXA 2XAHA 1M5IA 4JI0B 3T4ZA 2ZIOA 2CTQA 5CBHA 3HKDA 1MZFA 1R6TA 1NBMG 2B1GA 2QSAA 3UT5B 5B1AC 4X66B 2FKXA 5JCOA 5LHHA 3MHHC 3B8NA 3DXRB 4CS2A 4TQFA 2H3OA 4JAUA 2BE3A 2ZNJA 3CS5A 1WB7A 3FX7A 2GTSA 4UB6Z 1XUQA 4JAVA 2F66C 1VARA 1AVMA 5E1AC 4JI8O 3FD9A 4DR5O 2WLLA 4UV9A 4K35A 3E83A 3EVKA 1OCRB 5EC1C 2UXDB 4TV8A 3E8FA 2V7QG 2ZQMA 3K57A 4GZRB 4JI3O 1J5EB 2ODMA 1V55C 2WLNA 5IJ9A 1S0VA 2VQFB 4RWUA 4CS4A 5GTIZ 2AW9A 2YEVB 3JD0A 4WFEA 2XTAA 4DR6O 1VIBA 3R65A 1AI5A 1M57C 3IC9A 1GM8A 2GTAA 1VF5B 4YXWG 3T1YO 3JSLA 2YXLA 1PNLA 3SJCC 3F5TA 4TQDA 2QWQB 1QNMA 1G1XB 3CRAA 2EIMB 2WSSG 4IHJB 2IM9A 5LGUA 2H8PC 4X1IA 4DV7O 1YJ9V 3RYIA 1ZUQA 3BRCA 4DV2O 2R72A 4PI0A 4LF5B 2FB5A 4JI7O 2QWNB 1COWG 1MG1A 3UQ8A 4I5SA 4UCVA 3TCUA 3L71H 1MMMA 2P4KA 4I50B 4DRXB 2YI8A 3AG3B 3TXQA 2K9PA 3JCUZ 2EINB 3JD2A 1N34O 3ZRSA 5B66Z 4J7KA 4GUNA 3ZHQA 2HJFC 1Y74B 3ETEA 4LNUA 4FZ1A 1AI7A 3UT5A 3DGEA 4WFGA 4ZOLA 2IH3C 4EKWA 2EILC 3DXRA 3L73H 1VQNV 4H33A 4BIUA 4TV9B 1R3IC 1KQSU 4OX9B 4JI6B 3ZS8C 1SQBH 4PJ0Z 1W59A 1RM1B 1L0LH 3JAWB 2ZE7A 1I94O 2UUAO 1URFA 3RYHB 3ASOC 3W7XA 3RYFB 5LMNO 4FMTA 1SS3A 2WLJA 3STZC 1AB3A 4J80A 3CCRV 2P4VA 1WN7A 3SR2C 1PPJH 4YJ3B 3D36A 4XDJA 2HVKC 2JJ2G 1L1FA 4LF4B 5LGTA 2YEVA 4JI1O 5IY5C 2Q9LA 3OMIB 5DECA 5JH7B 1G8MA 4UVBA 3K5LA 4UXNA 4R6ZA 3Q4HB 1B04A 1XBLA 4FVMA 2HVJC 2ZDIA 3B77A 3VQVA 1WP7A 2YUAA 4O2BA 3KZIZ 4E4EA 1H2LA 1OCZB 3SYCA 4LCUC 4NYKA 4B7KA 1FOUA 2VQEB 1I0HA 2G38A 2JGUA 5LMUO 5L3DA 3LNNA 3ZRWA 2ETNA 4OPAA 3GVMA 2N05A 3BEHA 3S3XA 3CRQA 5JWPA 2HFEC 2IU3A 1Q7YW 3S3WA 2Q0AA 5C8YB 4DV0B 1RSOB 1F4NA 5JVDB 4QPKA 4LF6B 1OJHA 1ENVA 3H1JH 1P7BA 3KDRA 3JARB 2C2AA 4ZKIA 2XUMA 5H2FZ 2E5LO 1DLBA 3OTOB 4UB8Z 1QVGU 1VF6A 3K03A 4BW5A 4ZI7B 4JYYA 5EIBD 3WB0A 2LQTA 2YXYA 1US6A 1VQ9V 2WLKA 1NH2D 2RJZA 1JX9A 4N21A 3CC7V 4KHPB 3K5NA 2DJVA 2M7WA 3JAWA 1OCRC 4QGPA 4FLYA 4JGSA 2Q4PA 1QLEB 1RFYA 3WB2A 5KX5B 3RYHA 1JVMA 1QU7A 4I4TA 2BOCC 1Z2GA 2GHYA 2CAZC 1M56B 1VEWA 4RUFA 5DEDA 4ZHQA 1OZ0A 2R9AA 2LGQA 4BWAA 3W7WA 1TVKB 3W7UA 1S5JA 4LF8B 4FLVA 4PDLA 2W0FC 2NLJC 3QO7A 2OCCC 4OXSA 3OAAG 4DR3O 1EN6A 1RP3B 1NJIW 2A9HA 2QE7G 1KD1W 2EIMC 4MVOA 1N33B 3CCJV 2IJJA 2LO1A 1V54C 2Q73A 4I7ZB 3CCQV 4IYHA 2O57A 2OWOA 4B3RB 4NKGB 5LYJA 4IT5A 2ZNIA 2A7WA 3J81N 2FL4A 1U96A 3JALA 4KL1A 1YCIA 5IJ0A 4O4JB 3AG3C 5LP6B 5C8YA 1RSOA 3RYCA 5F2VO 2BTOA 4B08A 5JVDA 1TAEA 3VBBA 2ZM6O 4DV1O 5J9PC 5KHGA 2W6IG 4DV3B 1K5SA 3FAVA 3ASNB 2HJDA 1M1KW 1HNWB 1K9MW 1SC5B 1S3JA 4F6RB 1IBLO 1HNXB 4FZ0A 3M8AA 3K08A 3A0BZ 2OTLV 5EBLC 4H37A 4RQFA 4Z2WA 4X65O 4UVCA 1TUBA 4ZI7A 1S76D 4MVZA 4O4HA 5H5NA 4FLTA 3ABUA 1H2NA 5HFMA 1RM1C 2QR4A 2UUCB 1XL6A 4X64B 1CPYA 2EZOA 2ADPA 2DE0X 3FKSG 2IBZH 4DV4O 1MSDA 1K3EA 4G27B 4X20B 3JASB 1HNZB 2KB1A 2PF4E 2CTPA 2XASA 3E8GA 1O9HA 2A3QA 2IJKA 3LUTB 1IBMO 4WBNA 3IJ4A 2NNUA 2ZINA 3SPJA 2N04A 1Q3EA 5EZYA 3ABKC 5H6RA 1FFXA 2XT9A 3AG4B 4PDVA 5IYZB 5L3FA 1MSWD 3AG2B 3CCUV 1GM9A 3LDCA 4EEQA 2WLMA 4I0XA 2KG7A 1PL0A 5J2UB 2IJIA 3KCXA 1DF5A 3F7YC 5CMUA 4XDLA 5BY1A 3RFRA 4IIJB 2CGNA 3AK1A 3QG5A 3SYPA 3A0HZ 4GKJO 4CH3A 1WPBA 2QDOA 3BABA 4O2AA 4LF9O 3J7AU 1Y76A 1I5YA 1SZXA 3RVYA 1AJNA 1N32B 2XHBA 2E75B 4CC6A 5LL6Y 4HYOA 5A9GA 5BR8B 1K73W 3WB1A 1JOYA 1PL4A 4X88A 5LP6A 5EYPB 2Q69A 2GV9A 4J9ZB 5GW7A 3OGIB 1DTOA 2WA3A 4GLXA 2JEXA 1I08A 4X1YA 4X62B 2AGAA 4L87A 3HKDB 1NTZH 1M90W 3QTCA 2UU9O 4WFFA 3CRMA 4BR6A 2DYSB 1VMGA 1XMOB 1UPGA 4W4LA 3CD6V 1H8EG 1NU1H 1R3JC 2Q0OC 2X0LA 1QR9A 3DSQA 1NH2B 4GKKO 1QBZA 3OFNG 3EHBB 2QWOB 4B3MB 4RUEA 4X1KA 4ICGA 3RT3C 3SJBC 4DV6B 1BE3H 2UUBB 3JASA 1BQZA 3ZHRA 4CH4A 1JJ2U 3WG7B 3K59A 1HP8A 1M56C 5B3SB 4TV8B 3U0ZA 2D2CB 3A2FA 3HKBA 2HHHB 3LDEA 4WFHA 1H38A 1XREA 4R50A 1BSMA 2XOKG 4FLZA 3JD4A 5JQGB 3CX5F 3C3SA 3E8HA 1JR9A 1MZEA 1ZSPA 4DR4O 2HLDG 3X2QB 5J2UA 4JZGA 4CZZA 3WFVA 4IIJA 3QF7A 3AK3A 5IE9A 2ZCEA 1ZL8A 1Q86W 5J2TB 4LH7A 4P9OA 1AR1B 3E2EA 4LFAO 4WFAV 2B9ZA 2MK3A 4JI4O 5DN6G 5KAFZ 5EBMC 1OCOB 4JI8B 4DR5B 5EYPA 1CEZA 5IYDO 2GSMB 3ASNC 2PI5A 2DW4A 3OW2U 1JQ0A 5CN0A 1XHZA 3CSXA 5LHGA 4JI3B 4LNUB 2Q67A 5IT9N 1M9NA 3TK1A 1BGYH 4ZOLB 3DC5A 1FJGO 3EXAA 1KB9F 4LP8A 1NTKH 1SESA 1JFFB 1WA8A 1R73A 1CXZB 1HR0O 1VQ8V 3T1YB 2ZXWB 1XNQO 4AI8A 1ZAUA 4RQEA 2JRIA 3K0GA 5KMGA 3HKCB 4R7CA 1WNSA 4NXMO 4DXWA 3STLC 4E2LA 4Z1VA 2XNDG 5KUMA 4QJFB 2QM7A 3IFXA 2F4VO 1WB8A 1Q5OA 5IDJA 2HR3A 1P4RA 4I9QA 2ZIMA 3CRCA 3AG4C 5LA6B 2Y0IA 1XHXA 3N2GA 4D6TH 2Y69C 1DGSA 1L8DA 1K4DC 1ROPA 3ZRVA 5JQGA 3H1LH 1H8HG 1H2KA 3SDLA 4JI0O 1N34B 1NR1A 3ZCCA 1EZVH 2KKWA 3JYCA 4K0KB 2GDSA 2ZKOA 5AG2A 1XNRO 1AI6A 1HWYA 3H1IH 4ABMA 4JZ2A 4O2BB 1D5AA 5J2TA 2LJ2A 1KECA 4I9WA 2V4DA 2IH1C 3EFFK 4PHZA 2JGDA 1H2GA 3ZRWB 1GTOA 3N2KA 3IAYA 1FXHA 1BQ0A 4K8ZA 2OCHA 1LNQA 4AILC 1PV0A 4JTCB 4NXNO 5B1BC 1FPOA 4FK5C 2LFSA 5LMNB 4Z1MG 2UXDO 4AQYO 2FTKA 2A0LA 3TETA 5JCOC 4WFBV 1J5EO 3H01A 3I55V 2WAMA 2YIBD 3ZHTA 5EBWC 3FB8C 4PDRA 3AG1B 4DUZB 1WPXA 3QO5A 1JFFA 1SQVH 5CBFA 1P7GA 4RO2A 3FFQA 3G80A 1K92A 1FXKB 3WG7C 3SPGA 3HKCA 5D5PA 2Y0PA 3G6BA 2ZD9A 2Y48A 1BHBA 4YHHB 1Z5VA 3DC6A 3M7MX 2AZ0A 3RWRD 2UXNA 3CPWU 1T5EA 5LMUB 4FFKA 4I4TB 2ZE8A 4CS3A 3K5MA 4ZHQB 2LW7A 4LFCB 1UJWB 3DTUB 4JYCA 4PDMA 5LA6A 3X2QC 1AP6A 3J80N 4JAAA 4KFMA 4OGQB 1K5QA 3ZMUA 2E5LB 1YZBA 4MT8A 2QKAA 4NTXA 4MS2A 3E22B 1L0NH 5LYJB 2EIJB 3MD0A 1OCOC 3JALB 4NTYA 5IJ0B 2XAFA 4LF7O 2UXCB 4MTXA 3OE7G 3CYOA 3A0RA 4Q20A 4U3FH 4PA7A 5H9CA 4YIOA 3RYCB 3SYQA 2D3OW 4UCRA 2WLIA 4NVPA 2WLHA 5CB4A 3K04A 1BHAA 3FAVB 4DW0A 3OR7C 4PD4F 3E89A 4MTGA 1SERA 3UO3A 1XQ8A 5BMVB 3G4SV 4MW8A 1CP9A 2DQ3A 3AG7A 3CB2A 1TUBB 2RDCA 4O4HB 5KUKA 4LFBO 2QKSA 1BMFG 2NN4A 1VQ7V 1JCHA 4FPPA 2PI4A 3H1KH 1S5LZ 5JJJB 1FXKA 4DR1O 5TISZ 4DR2B 1OCCB 3JD3A 1IJGA 1AI4A 3PJSK 3KG2A 4WCEV 3CC2V 2VQEO 4WBNB 1Q8IA 5LXTA 2QJ1A 3OT7A 4YJ2A 1RPOA 3D36C 1SQPH 5EZYB 5IWAB 2AHYA 2DYRB 1FFXB 1NS1A 4J11A 1XILA 4DV0O 1WLEA 2ZM6B 1XMQO 4DV1B 5H6QA 1R6KA 4BW9A 3BFRA 1Q6UA 1SKVA 4LF6O 2EJ7A 3LNMB 3OEEG 4I0XB 2KG7B 4DUYO 2ZDIC 2UXXA 1G6UA 4HAMA 1IBLB 1GM7A 2BSKA 3OTOO 1GN6A 1MNGA 4BIOA 2RQ6A 4F4LA 2W0XA 4X65B 4FM2A 3RN4A 4O2AB 5GONA 3E22A 1Y76B 1XL4A 3OR6C 1KYOF 1N0JA 1JJOA 3T1HO 4B3TO 5KAIZ 4G28B 2P06A 3G67A 3CJHA 1M4UA 2F95B 2EINC 2V1DA 4JV5O 1X4TA 3LSUA 4X1YB 2JS3A 3L75H 1F51A 3ZHSA 4FLWA 1VF6C 5BMVA 3GB7C 2UXBB 4O4IA 3APQA 2QM4A 5CA0A 2W6JG 1HW7A 4DK0A 1MA1A 2Q7EA 2DQ0A 2JVDA 3JAMN 4X9QA 1W2BU 4X1KB 2Z5UA 1N33O 1K34A 1SQGA 2LGWA 2P67A 1EN4A 5BXZA 4LF9B 1WP8A 4TUYA 4TT3G 1VQ5V 3OMNB 4TWKA 5JJNB 4HZ3A 4O4LB 3HKBB 2ILMA 2GUZB 3T4DA 1QQCA 1XDCA 5FPOA 3B2EE 2ZR2A 2YC0A 4YY3O 4DV5O 3CCLV 4JI5O 3CRRA 4PA4A 3OUFA 3F5WC 1FFTB 2R9RB 1PM9A 3VQXA 3ZMVA 2JJ1G 3BY6A 4J7JA 4KXRA 4DV3O 1HDJA 3APOA 2L6LA 3HR0A 2VWJA 4PV1B 4F6EA 1OCZC 1N0NA 4FFBA 3LSQA 1KP2A 2JEUA 2Q5ZA 1ZL8B 2B5UA 2EIJC 4JYAO 1XEQA 4IYIA 1Q82W 3JD1A 4GKKB 3K79A 3B4SA 5L3BA 4X64O 1F7YA 4UCSA 4C7UA 3OD4A 4MVRA 1VQLV 4GX0A 1AR5A 1JMKC 5EC2C 2RN9A 1K97A 5KHIA 1N4CA 1GN3A 2BOBC 4K8XA 1YF2A 2PTMA 2YSUB 1KKCA 1YITV 3SPCA 3B8MA 5FL7G 2Q68A 1EN5A 1SA0A 2YIBA 1B3QA 4B3SB 2ITCC 1PNKA 3MHSC 2JIZG 3C3TA 1Y4MA 3ZX6A 4G2KA 4MTOA 3LDDA 1WA8B 4DR4B 4ZIBA 1E1RG 5FLXN 4EFBA 1VF7A 1AILA 1IBKO 2ZE5A 1D5NA 4CBCA 1QLEC 5KMGB 4X8AA 3CHXA 1RPRA 4MTFA 4DR7O 1H5WA 1B6QA 2Q7HA 2OT5A 1VQPV 5CA1A 4LFAB 1IVSA 1PNMA 1NR7A 1N32O 3VOUA 2DYRC 2EILB 4O4LA 1PKXA 2JS5A 2ZE6A 2GUZA 3ZBHA 2JDIG 3N2GB 4NB5A 4JI2O 2P6JA 4RAIA 4HNAA 4UFZA 1NKDA 4D7SA 2EIKB 4AHCA 1QVFU 5HFLA 5FNVA 1QR8A 3K9AA 1VP7A 3P3NA 1FJGB 3H9VA 1GRJA 2BTQA 4JASA 1Q81W 3SGIA 2JGDB 1FXVA 4UUJC 2CK3G 4MVSA 1HR0B 2ITDC 5GTHZ 3ZHVA 1GO3F 5LP6C 3N2KB 3N27A 2ADQB 5L3EA 1Q6IA 4DV6O 2UUBO 1E1QG 4NXMB 3ETQA 3ICXA 3CXCU 1SQFA 4JPRA 3JATB 4UCTA 3AK2A 1N36O 2F4VB 3H1HH 1GMGA 4LWSA 2AXTZ 5CA3A 1D2DA 1BCCH 4UV8A 2HKOA 1LR1A 5K1XA 1J95A 3ETGA 4TSFG 2PZSA 1KC8W 2X6AA 2BCCH 4DR6B 2XAJA 4R8CA 4J41A 1XNRB 2KQXA 1WJZA 1FAFA 4PA9A 2GBOA 3CCEV 1EFRG 1H2SB 4MVUA 3LSSA 3W7TA 3ZN0A 1B06A 4DV7B 3MAQA 3CCMV 2FYUH 3SJAC 3B09A 2YICA 1SQQH 4DV2B 4JTDB 4DK1A 3U11A 2P90A 2PGGA 4JI7B 3AG2C 3IGAC 3CE2A 4NXNB 3KKYA 1IX9A 4EFEA 3K58A 2A79B 2MW2B 4AQYB 5A2QN 3K06A 1GK9A 2YS8A 1P49A 1LUVA 4MVQA 1AJPA 1BL8A 3CEIA 3ETDA 3ZIAG 1VQ4V 2LW1A 2QWPB 2QGNA 3ABMB 4KUMA 2CE4A 4X66O 2K1EA 4W4KA 3CMEV 1QCEA 3BAAA 1AR4A 2QWRB 5KA6A 2E3CA 1QHTA 1TGOA 4P2ZA 1FYJA 2OCCB 1MOFA 4JTAB 3BHPA 5K1PA 2E74B 1R1BA 2F93B 1I94B 2UUAB 1YIJV 2WLIB 3JATA 5CB4B 1BS3A 1V54B 4U3JA 3BVOA 2DYSC 4LC1A 5EIBC 4PA6A 2OTJV 4U7NA 4GX5A 3FB7C 3AEIA 3L9DA 2VQFO 1XI1A 5ITZA 4H13B 1FS0G 4GX2A 3CC4V 3MDSA 2VWKA 4FM1A 4JI1B 2QM8A 1YTFD 3ZRXA 4K0KO 4JF3A 3ZMTA 1X59A 1K7DA 2OIGA 3L74H 3RBZA 3VQWA 3BCCH 4CC5A 5B3SC 1VQOV 1IDSA 1G4YB 4UCOA 4I55B 3JCZA 1O9GA 2VS0A 1PP9H 4QE7A 5LXTB 2P7TC 5BZBA 4FM0A 4YJ2B 1NZ6A 4LF7B 4U7OA 3CP1A
chains in the Genus database with same CATH topology
1GN6A 1MNGA 3KKYA 4GUNA 1IX9A 1PL4A 4F6EA 3KDRA 1N0NA 3RN4A 1LUWA 1N0JA 1I08A 1LUVA 3CEIA 1WB7A 2CE4A 4BR6A 4JYYA 4YIOA 1GN4A 1XUQA 4C7UA 1AR4A 1VARA 1AVMA 1AR5A 1AP5A 3DC5A 1GN3A 3EVKA 4YIPA 2ADQB 1ZLZA 3LSUA 3QVNA 2ADPA 2RCVA 1MSDA 3TJTA 1KKCA 3AK2A 1EN5A 1P7GA 1BS3A 1BT8A 1VEWA 1Y67A 2AW9A 1MA1A 2CDYA 3C3TA 1EM1A 3IC9A 4X9QA 1WB8A 3DC6A 1GN2A 1XREA 4FFKA 1QNMA 3MDSA 1IXBA 1EN6A 1BSMA 1D5NA 1EN4A 2QKCA 3C3SA 1ZTEA 4E4EA 1JR9A 1ZSPA 3OT7A 1ZUQA 1I0HA 4JZGA 3AK1A 3K9SA 1AP6A 1XILA 1JA8A 1IDSA 1XDCA 2GDSA 1B06A 3AK3A 1SZXA 3BFRA 5AG2A 1MMMA 2P4KA 1PM9A 4JZ2A 2QKAA 5A9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GN6 A;  1MNG A;  3KKY A;  4GUN A;  1IX9 A;  1PL4 A;  4F6E A;  1N0N A;  3RN4 A;  1LUW A;  1N0J A;  1I08 A;  1LUV A;  3CEI A;  1WB7 A;  2CE4 A;  4BR6 A;  4JYY A;  4YIO A;  1GN4 A;  1XUQ A;  4C7U A;  1AR4 A;  1VAR A;  1AVM A;  1AR5 A;  1AP5 A;  3DC5 A;  1GN3 A;  3EVK A;  4YIP A;  2ADQ B;  1ZLZ A;  3LSU A;  3QVN A;  2ADP A;  2RCV A;  1MSD A;  3TJT A;  1KKC A;  3AK2 A;  1EN5 A;  1P7G A;  1BS3 A;  1BT8 A;  1VEW A;  1Y67 A;  2AW9 A;  1MA1 A;  2CDY A;  3C3T A;  1EM1 A;  3IC9 A;  4X9Q A;  1WB8 A;  3DC6 A;  1GN2 A;  1XRE A;  4FFK A;  1QNM A;  3MDS A;  1IXB A;  1EN6 A;  1BSM A;  1D5N A;  1EN4 A;  2QKC A;  3C3S A;  1ZTE A;  4E4E A;  1JR9 A;  1ZSP A;  3OT7 A;  1ZUQ A;  1I0H A;  4JZG A;  3AK1 A;  3K9S A;  1AP6 A;  1XIL A;  1JA8 A;  1IDS A;  1XDC A;  2GDS A;  1B06 A;  3AK3 A;  1SZX A;  3BFR A;  5AG2 A;  1MMM A;  2P4K A;  1PM9 A;  4JZ2 A;  2QKA A;  5A9G A; 
#chains in the Genus database with same CATH topology
 5B1O A;  4LF5 O;  3KCY A;  1KU9 A;  3ZN1 A;  4MSW C;  2EIK C;  3BA8 A;  4J42 A;  2P5O A;  1Y6X A;  1IXM A;  4CH5 A;  3UM7 A;  1YJW V;  5B5E Z;  2NR5 A;  1JPX A;  4PI2 A;  2DOS A;  2CTW A;  2DWE C;  2Y4T A;  2BSK B;  3HKE B;  2DWD C;  3D3I A;  3G71 V;  3WU2 Z;  5EK0 A;  3CCV V;  2JK5 C;  3SPI A;  5GON B;  3ABK B;  4LFB B;  1AJQ A;  1ZLZ A;  2N74 A;  4DUZ O;  4JYB A;  3RW0 A;  4J7Z A;  4OX9 O;  4JI6 O;  3JAK B;  1THZ A;  4DR1 B;  4GCZ A;  3CJH B;  3ABL B;  1VQ6 V;  1KMI Z;  1YSC A;  2X6C A;  2DN9 A;  3TGU H;  1Y67 A;  3IC7 A;  3JSN A;  4IHJ A;  4YHH O;  1EM1 A;  3VQY A;  2PYL A;  3ZED A;  3ZHU A;  1NI8 A;  4LFC O;  2WPD G;  3QNE A;  2L35 A;  1NVP D;  2LFR A;  4A5U B;  1XMQ B;  4I50 A;  4O4I B;  3HPL C;  3T2M A;  4LF4 O;  4DRX A;  3O9O A;  1IUR A;  5CA0 B;  1S5H C;  3O65 A;  1YXB A;  1K4C C;  4BAY A;  2ZXW C;  4DUY B;  4DR3 B;  3FYI B;  1KBH A;  2WWW A;  3B40 A;  4NR1 A;  1Y74 A;  3R66 A;  1SQX H;  4BIZ A;  2EUL A;  4DW1 A;  2R9I A;  1Z5W A;  4TUY B;  4I55 A;  2CH7 B;  1ARO P;  3ZJZ A;  1XOU A;  3T1H B;  1Q43 A;  1E79 G;  4B3T B;  4TV9 A;  2F43 G;  4LR3 A;  4GX1 A;  2UXC O;  5LOV B;  2R70 A;  3A8T A;  1K8A W;  2OYQ A;  4JV5 B;  3CXH F;  4FJC C;  4J10 A;  2IW5 A;  1V9P A;  4KP4 A;  1KKD A;  3RYF A;  3OGC C;  2E76 B;  3OEH G;  3ABM C;  4MVM A;  5D5Q A;  1MAB G;  5JJE B;  4FFB B;  1FKA O;  3GWO A;  3HKE A;  4YJ3 A;  1VQK V;  4YIP A;  3L70 H;  4HBN A;  3K0D A;  4LH6 A;  1SZT A;  2YI9 A;  5JH7 A;  1DF4 A;  2H94 A;  3JAK A;  4DV4 B;  3Q4H A;  4GT1 A;  1OHH G;  2A06 H;  2Y4U A;  1BT8 A;  4KHP O;  4K3A A;  4DR2 O;  5IYB O;  1NQT A;  2EZP A;  1W0J G;  3ZMZ A;  2EJR A;  1NT2 B;  1ZWI C;  1IBM B;  3SJQ C;  5E79 Z;  1M93 A;  1SA0 B;  5LHI A;  2QKC A;  4DV5 B;  4YY3 B;  5IWA O;  4QNH B;  3AG1 C;  4JI5 B;  3CMA V;  1GAX A;  4LF8 O;  3QO8 A;  1EBO A;  1YTF B;  1SET A;  3ML0 A;  1FXK C;  3JAR A;  3UO2 A;  3M99 B;  2CUG A;  3K5O A;  1YJN V;  1YHQ V;  2WA4 A;  4GKJ B;  1YI2 V;  4JYA B;  5B1A B;  1SRY A;  1IXB A;  2CH7 A;  4B7E A;  1GH6 A;  1W0K G;  3C90 A;  5CA1 B;  3P32 A;  4B3R O;  3I5D A;  2ZR3 A;  4PEL A;  4ASU G;  3F7V C;  1LUW A;  2KSD A;  3NR7 A;  2HP8 A;  4H0L B;  1R6N A;  2Q8V A;  4XBF A;  5LOV A;  2YDE A;  3I56 V;  3D3Q A;  3G6E V;  5KHK A;  2F1M A;  4H44 B;  2QEX V;  5KX5 A;  1FD9 A;  1GN4 A;  3UKM A;  3CCS V;  4WF9 V;  2PUS A;  4HNA B;  1S77 D;  2UU9 B;  1AP5 A;  1HNW O;  2OIE A;  5FNV B;  1Q90 D;  2AZ2 A;  2ZT9 B;  5KHJ A;  2CGO A;  3QVN A;  1HNX O;  1TVK A;  1ORQ C;  4FLU A;  3OM3 B;  1TA8 A;  1YVW A;  1V55 B;  2BTQ B;  1KP3 A;  2VRZ A;  1N8R W;  2UXB O;  4EB6 B;  2Y69 B;  1NTM H;  3PN1 A;  3ABL C;  3U10 A;  2UUC O;  1WAZ A;  4OPH A;  1IBK B;  2FML A;  1M57 B;  3RVZ A;  4XDK A;  4ZBM A;  2ATK C;  3SYO A;  2CDY A;  5L3C A;  2IJH A;  2AHZ A;  4DR7 B;  4QIW F;  3P30 A;  1HNZ O;  2RNB A;  3SYA A;  1VQM V;  4DO2 A;  4L8J A;  2YXH A;  4MW3 A;  1GN2 A;  5LGN A;  2HG5 C;  1YDX A;  2XAG A;  4LWS B;  2XAQ A;  3E35 A;  3W7S A;  1NVP B;  1IZ3 A;  4O4J A;  3FYE B;  4CH6 A;  1SF9 A;  4JI2 B;  1TUE B;  5KA5 A;  3K9S A;  3P3P A;  1EZJ A;  4QPJ A;  2QTS A;  3OUS A;  4P9P A;  2Z3Y A;  4IL6 Z;  3K3W A;  1H2M A;  2Z0A A;  5B1B B;  4FIP C;  1I7F A;  1R3K C;  1OCC C;  2IU0 A;  1A32 A;  4UVA A;  4F6R A;  4P30 A;  1Y66 A;  1GKF A;  1DK1 A;  1KUQ A;  5L3G A;  4N23 A;  1R3L C;  4IGG A;  4QE9 A;  3RGB A;  2QTO A;  1ZX3 A;  1Q6H A;  2Q6A A;  4DYL A;  4JI4 B;  5BR8 O;  4X20 A;  2EBO A;  2YID A;  1PD3 A;  4GYC B;  4J9Y B;  3E86 A;  2WLL B;  4Q6G A;  3BA9 A;  1P84 F;  3HB3 B;  3GWK C;  5LBQ A;  1N36 B;  5IYC O;  1F23 A;  3CWB H;  4X62 O;  4LBE C;  3OMA B;  3SPH A;  2B1I A;  3T1C A;  3ASO B;  3NXS A;  2ARH A;  2CTR A;  2M6Y A;  5CBG A;  1I5X A;  2RCV A;  2QA4 V;  3UCS C;  5IJ9 B;  3TJT A;  3BPZ A;  3D8C A;  2X6B A;  4B3S O;  1XMO O;  3L72 H;  4UCU A;  4NTW A;  3E8B A;  2PYJ A;  1YEW A;  4EB6 A;  2Q7G A;  5IYZ A;  1OV9 A;  5FPR A;  5KLV H;  5B1N A;  4X89 A;  1UFI A;  3OTF A;  1U97 A;  1JNB A;  5DM6 V;  1BZK A;  5IY5 B;  1XNQ B;  4B3M O;  2DMX A;  3ABT A;  2EX3 A;  3ZMS A;  1S72 V;  2PY5 A;  4TOI A;  2X7R B;  3TXS A;  4PA3 A;  3THO A;  4U3J B;  2LP7 A;  4X1I B;  3RYI B;  1ZTE A;  2RMK B;  1K33 A;  5KHH A;  2F23 A;  2YIA A;  2HHH O;  2P22 C;  3FB5 C;  1QLN A;  5C93 A;  1JA8 A;  5ITZ B;  2HEP A;  1F4M A;  3FB6 C;  4D7T A;  4FLX A;  2XAH A;  1M5I A;  4JI0 B;  3T4Z A;  2ZIO A;  2CTQ A;  5CBH A;  3HKD A;  1MZF A;  1R6T A;  1NBM G;  2B1G A;  2QSA A;  3UT5 B;  5B1A C;  4X66 B;  2FKX A;  5JCO A;  5LHH A;  3MHH C;  3B8N A;  3DXR B;  4CS2 A;  4TQF A;  2H3O A;  4JAU A;  2BE3 A;  2ZNJ A;  3CS5 A;  1WB7 A;  3FX7 A;  2GTS A;  4UB6 Z;  1XUQ A;  4JAV A;  2F66 C;  1VAR A;  1AVM A;  5E1A C;  4JI8 O;  3FD9 A;  4DR5 O;  2WLL A;  4UV9 A;  4K35 A;  3E83 A;  3EVK A;  1OCR B;  5EC1 C;  2UXD B;  4TV8 A;  3E8F A;  2V7Q G;  2ZQM A;  3K57 A;  4GZR B;  4JI3 O;  1J5E B;  2ODM A;  1V55 C;  2WLN A;  5IJ9 A;  1S0V A;  2VQF B;  4RWU A;  4CS4 A;  5GTI Z;  2AW9 A;  2YEV B;  3JD0 A;  4WFE A;  2XTA A;  4DR6 O;  1VIB A;  3R65 A;  1AI5 A;  1M57 C;  3IC9 A;  1GM8 A;  2GTA A;  1VF5 B;  4YXW G;  3T1Y O;  3JSL A;  2YXL A;  1PNL A;  3SJC C;  3F5T A;  4TQD A;  2QWQ B;  1QNM A;  1G1X B;  3CRA A;  2EIM B;  2WSS G;  4IHJ B;  2IM9 A;  5LGU A;  2H8P C;  4X1I A;  4DV7 O;  1YJ9 V;  3RYI A;  1ZUQ A;  3BRC A;  4DV2 O;  2R72 A;  4PI0 A;  4LF5 B;  2FB5 A;  4JI7 O;  2QWN B;  1COW G;  1MG1 A;  3UQ8 A;  4I5S A;  4UCV A;  3TCU A;  3L71 H;  1MMM A;  2P4K A;  4I50 B;  4DRX B;  2YI8 A;  3AG3 B;  3TXQ A;  2K9P A;  3JCU Z;  2EIN B;  3JD2 A;  1N34 O;  3ZRS A;  5B66 Z;  4J7K A;  4GUN A;  3ZHQ A;  2HJF C;  1Y74 B;  3ETE A;  4LNU A;  4FZ1 A;  1AI7 A;  3UT5 A;  3DGE A;  4WFG A;  4ZOL A;  2IH3 C;  4EKW A;  2EIL C;  3DXR A;  3L73 H;  1VQN V;  4H33 A;  4BIU A;  4TV9 B;  1R3I C;  1KQS U;  4OX9 B;  4JI6 B;  3ZS8 C;  1SQB H;  4PJ0 Z;  1W59 A;  1RM1 B;  1L0L H;  3JAW B;  2ZE7 A;  1I94 O;  2UUA O;  1URF A;  3RYH B;  3ASO C;  3W7X A;  3RYF B;  5LMN O;  4FMT A;  1SS3 A;  2WLJ A;  3STZ C;  1AB3 A;  4J80 A;  3CCR V;  2P4V A;  1WN7 A;  3SR2 C;  1PPJ H;  4YJ3 B;  3D36 A;  4XDJ A;  2HVK C;  2JJ2 G;  1L1F A;  4LF4 B;  5LGT A;  2YEV A;  4JI1 O;  5IY5 C;  2Q9L A;  3OMI B;  5DEC A;  5JH7 B;  1G8M A;  4UVB A;  3K5L A;  4UXN A;  4R6Z A;  3Q4H B;  1B04 A;  1XBL A;  4FVM A;  2HVJ C;  2ZDI A;  3B77 A;  3VQV A;  1WP7 A;  2YUA A;  4O2B A;  3KZI Z;  4E4E A;  1H2L A;  1OCZ B;  3SYC A;  4LCU C;  4NYK A;  4B7K A;  1FOU A;  2VQE B;  1I0H A;  2G38 A;  2JGU A;  5LMU O;  5L3D A;  3LNN A;  3ZRW A;  2ETN A;  4OPA A;  3GVM A;  2N05 A;  3BEH A;  3S3X A;  3CRQ A;  5JWP A;  2HFE C;  2IU3 A;  1Q7Y W;  3S3W A;  2Q0A A;  5C8Y B;  4DV0 B;  1RSO B;  1F4N A;  5JVD B;  4QPK A;  4LF6 B;  1OJH A;  1ENV A;  3H1J H;  1P7B A;  3KDR A;  3JAR B;  2C2A A;  4ZKI A;  2XUM A;  5H2F Z;  2E5L O;  1DLB A;  3OTO B;  4UB8 Z;  1QVG U;  1VF6 A;  3K03 A;  4BW5 A;  4ZI7 B;  4JYY A;  5EIB D;  3WB0 A;  2LQT A;  2YXY A;  1US6 A;  1VQ9 V;  2WLK A;  1NH2 D;  2RJZ A;  1JX9 A;  4N21 A;  3CC7 V;  4KHP B;  3K5N A;  2DJV A;  2M7W A;  3JAW A;  1OCR C;  4QGP A;  4FLY A;  4JGS A;  2Q4P A;  1QLE B;  1RFY A;  3WB2 A;  5KX5 B;  3RYH A;  1JVM A;  1QU7 A;  4I4T A;  2BOC C;  1Z2G A;  2GHY A;  2CAZ C;  1M56 B;  1VEW A;  4RUF A;  5DED A;  4ZHQ A;  1OZ0 A;  2R9A A;  2LGQ A;  4BWA A;  3W7W A;  1TVK B;  3W7U A;  1S5J A;  4LF8 B;  4FLV A;  4PDL A;  2W0F C;  2NLJ C;  3QO7 A;  2OCC C;  4OXS A;  3OAA G;  4DR3 O;  1EN6 A;  1RP3 B;  1NJI W;  2A9H A;  2QE7 G;  1KD1 W;  2EIM C;  4MVO A;  1N33 B;  3CCJ V;  2IJJ A;  2LO1 A;  1V54 C;  2Q73 A;  4I7Z B;  3CCQ V;  4IYH A;  2O57 A;  2OWO A;  4B3R B;  4NKG B;  5LYJ A;  4IT5 A;  2ZNI A;  2A7W A;  3J81 N;  2FL4 A;  1U96 A;  3JAL A;  4KL1 A;  1YCI A;  5IJ0 A;  4O4J B;  3AG3 C;  5LP6 B;  5C8Y A;  1RSO A;  3RYC A;  5F2V O;  2BTO A;  4B08 A;  5JVD A;  1TAE A;  3VBB A;  2ZM6 O;  4DV1 O;  5J9P C;  5KHG A;  2W6I G;  4DV3 B;  1K5S A;  3FAV A;  3ASN B;  2HJD A;  1M1K W;  1HNW B;  1K9M W;  1SC5 B;  1S3J A;  4F6R B;  1IBL O;  1HNX B;  4FZ0 A;  3M8A A;  3K08 A;  3A0B Z;  2OTL V;  5EBL C;  4H37 A;  4RQF A;  4Z2W A;  4X65 O;  4UVC A;  1TUB A;  4ZI7 A;  1S76 D;  4MVZ A;  4O4H A;  5H5N A;  4FLT A;  3ABU A;  1H2N A;  5HFM A;  1RM1 C;  2QR4 A;  2UUC B;  1XL6 A;  4X64 B;  1CPY A;  2EZO A;  2ADP A;  2DE0 X;  3FKS G;  2IBZ H;  4DV4 O;  1MSD A;  1K3E A;  4G27 B;  4X20 B;  3JAS B;  1HNZ B;  2KB1 A;  2PF4 E;  2CTP A;  2XAS A;  3E8G A;  1O9H A;  2A3Q A;  2IJK A;  3LUT B;  1IBM O;  4WBN A;  3IJ4 A;  2NNU A;  2ZIN A;  3SPJ A;  2N04 A;  1Q3E A;  5EZY A;  3ABK C;  5H6R A;  1FFX A;  2XT9 A;  3AG4 B;  4PDV A;  5IYZ B;  5L3F A;  1MSW D;  3AG2 B;  3CCU V;  1GM9 A;  3LDC A;  4EEQ A;  2WLM A;  4I0X A;  2KG7 A;  1PL0 A;  5J2U B;  2IJI A;  3KCX A;  1DF5 A;  3F7Y C;  5CMU A;  4XDL A;  5BY1 A;  3RFR A;  4IIJ B;  2CGN A;  3AK1 A;  3QG5 A;  3SYP A;  3A0H Z;  4GKJ O;  4CH3 A;  1WPB A;  2QDO A;  3BAB A;  4O2A A;  4LF9 O;  3J7A U;  1Y76 A;  1I5Y A;  1SZX A;  3RVY A;  1AJN A;  1N32 B;  2XHB A;  2E75 B;  4CC6 A;  5LL6 Y;  4HYO A;  5A9G A;  5BR8 B;  1K73 W;  3WB1 A;  1JOY A;  1PL4 A;  4X88 A;  5LP6 A;  5EYP B;  2Q69 A;  2GV9 A;  4J9Z B;  5GW7 A;  3OGI B;  1DTO A;  2WA3 A;  4GLX A;  2JEX A;  1I08 A;  4X1Y A;  4X62 B;  2AGA A;  4L87 A;  3HKD B;  1NTZ H;  1M90 W;  3QTC A;  2UU9 O;  4WFF A;  3CRM A;  4BR6 A;  2DYS B;  1VMG A;  1XMO B;  1UPG A;  4W4L A;  3CD6 V;  1H8E G;  1NU1 H;  1R3J C;  2Q0O C;  2X0L A;  1QR9 A;  3DSQ A;  1NH2 B;  4GKK O;  1QBZ A;  3OFN G;  3EHB B;  2QWO B;  4B3M B;  4RUE A;  4X1K A;  4ICG A;  3RT3 C;  3SJB C;  4DV6 B;  1BE3 H;  2UUB B;  3JAS A;  1BQZ A;  3ZHR A;  4CH4 A;  1JJ2 U;  3WG7 B;  3K59 A;  1HP8 A;  1M56 C;  5B3S B;  4TV8 B;  3U0Z A;  2D2C B;  3A2F A;  3HKB A;  2HHH B;  3LDE A;  4WFH A;  1H38 A;  1XRE A;  4R50 A;  1BSM A;  2XOK G;  4FLZ A;  3JD4 A;  5JQG B;  3CX5 F;  3C3S A;  3E8H A;  1JR9 A;  1MZE A;  1ZSP A;  4DR4 O;  2HLD G;  3X2Q B;  5J2U A;  4JZG A;  4CZZ A;  3WFV A;  4IIJ A;  3QF7 A;  3AK3 A;  5IE9 A;  2ZCE A;  1ZL8 A;  1Q86 W;  5J2T B;  4LH7 A;  4P9O A;  1AR1 B;  3E2E A;  4LFA O;  4WFA V;  2B9Z A;  2MK3 A;  4JI4 O;  5DN6 G;  5KAF Z;  5EBM C;  1OCO B;  4JI8 B;  4DR5 B;  5EYP A;  1CEZ A;  5IYD O;  2GSM B;  3ASN C;  2PI5 A;  2DW4 A;  3OW2 U;  1JQ0 A;  5CN0 A;  1XHZ A;  3CSX A;  5LHG A;  4JI3 B;  4LNU B;  2Q67 A;  5IT9 N;  1M9N A;  3TK1 A;  1BGY H;  4ZOL B;  3DC5 A;  1FJG O;  3EXA A;  1KB9 F;  4LP8 A;  1NTK H;  1SES A;  1JFF B;  1WA8 A;  1R73 A;  1CXZ B;  1HR0 O;  1VQ8 V;  3T1Y B;  2ZXW B;  1XNQ O;  4AI8 A;  1ZAU A;  4RQE A;  2JRI A;  3K0G A;  5KMG A;  3HKC B;  4R7C A;  1WNS A;  4NXM O;  4DXW A;  3STL C;  4E2L A;  4Z1V A;  2XND G;  5KUM A;  4QJF B;  2QM7 A;  3IFX A;  2F4V O;  1WB8 A;  1Q5O A;  5IDJ A;  2HR3 A;  1P4R A;  4I9Q A;  2ZIM A;  3CRC A;  3AG4 C;  5LA6 B;  2Y0I A;  1XHX A;  3N2G A;  4D6T H;  2Y69 C;  1DGS A;  1L8D A;  1K4D C;  1ROP A;  3ZRV A;  5JQG A;  3H1L H;  1H8H G;  1H2K A;  3SDL A;  4JI0 O;  1N34 B;  1NR1 A;  3ZCC A;  1EZV H;  2KKW A;  3JYC A;  4K0K B;  2GDS A;  2ZKO A;  5AG2 A;  1XNR O;  1AI6 A;  1HWY A;  3H1I H;  4ABM A;  4JZ2 A;  4O2B B;  1D5A A;  5J2T A;  2LJ2 A;  1KEC A;  4I9W A;  2V4D A;  2IH1 C;  3EFF K;  4PHZ A;  2JGD A;  1H2G A;  3ZRW B;  1GTO A;  3N2K A;  3IAY A;  1FXH A;  1BQ0 A;  4K8Z A;  2OCH A;  1LNQ A;  4AIL C;  1PV0 A;  4JTC B;  4NXN O;  5B1B C;  1FPO A;  4FK5 C;  2LFS A;  5LMN B;  4Z1M G;  2UXD O;  4AQY O;  2FTK A;  2A0L A;  3TET A;  5JCO C;  4WFB V;  1J5E O;  3H01 A;  3I55 V;  2WAM A;  2YIB D;  3ZHT A;  5EBW C;  3FB8 C;  4PDR A;  3AG1 B;  4DUZ B;  1WPX A;  3QO5 A;  1JFF A;  1SQV H;  5CBF A;  1P7G A;  4RO2 A;  3FFQ A;  3G80 A;  1K92 A;  1FXK B;  3WG7 C;  3SPG A;  3HKC A;  5D5P A;  2Y0P A;  3G6B A;  2ZD9 A;  2Y48 A;  1BHB A;  4YHH B;  1Z5V A;  3DC6 A;  3M7M X;  2AZ0 A;  3RWR D;  2UXN A;  3CPW U;  1T5E A;  5LMU B;  4FFK A;  4I4T B;  2ZE8 A;  4CS3 A;  3K5M A;  4ZHQ B;  2LW7 A;  4LFC B;  1UJW B;  3DTU B;  4JYC A;  4PDM A;  5LA6 A;  3X2Q C;  1AP6 A;  3J80 N;  4JAA A;  4KFM A;  4OGQ B;  1K5Q A;  3ZMU A;  2E5L B;  1YZB A;  4MT8 A;  2QKA A;  4NTX A;  4MS2 A;  3E22 B;  1L0N H;  5LYJ B;  2EIJ B;  3MD0 A;  1OCO C;  3JAL B;  4NTY A;  5IJ0 B;  2XAF A;  4LF7 O;  2UXC B;  4MTX A;  3OE7 G;  3CYO A;  3A0R A;  4Q20 A;  4U3F H;  4PA7 A;  5H9C A;  4YIO A;  3RYC B;  3SYQ A;  2D3O W;  4UCR A;  2WLI A;  4NVP A;  2WLH A;  5CB4 A;  3K04 A;  1BHA A;  3FAV B;  4DW0 A;  3OR7 C;  4PD4 F;  3E89 A;  4MTG A;  1SER A;  3UO3 A;  1XQ8 A;  5BMV B;  3G4S V;  4MW8 A;  1CP9 A;  2DQ3 A;  3AG7 A;  3CB2 A;  1TUB B;  2RDC A;  4O4H B;  5KUK A;  4LFB O;  2QKS A;  1BMF G;  2NN4 A;  1VQ7 V;  1JCH A;  4FPP A;  2PI4 A;  3H1K H;  1S5L Z;  5JJJ B;  1FXK A;  4DR1 O;  5TIS Z;  4DR2 B;  1OCC B;  3JD3 A;  1IJG A;  1AI4 A;  3PJS K;  3KG2 A;  4WCE V;  3CC2 V;  2VQE O;  4WBN B;  1Q8I A;  5LXT A;  2QJ1 A;  3OT7 A;  4YJ2 A;  1RPO A;  3D36 C;  1SQP H;  5EZY B;  5IWA B;  2AHY A;  2DYR B;  1FFX B;  1NS1 A;  4J11 A;  1XIL A;  4DV0 O;  1WLE A;  2ZM6 B;  1XMQ O;  4DV1 B;  5H6Q A;  1R6K A;  4BW9 A;  3BFR A;  1Q6U A;  1SKV A;  4LF6 O;  2EJ7 A;  3LNM B;  3OEE G;  4I0X B;  2KG7 B;  4DUY O;  2ZDI C;  2UXX A;  1G6U A;  4HAM A;  1IBL B;  1GM7 A;  2BSK A;  3OTO O;  1GN6 A;  1MNG A;  4BIO A;  2RQ6 A;  4F4L A;  2W0X A;  4X65 B;  4FM2 A;  3RN4 A;  4O2A B;  5GON A;  3E22 A;  1Y76 B;  1XL4 A;  3OR6 C;  1KYO F;  1N0J A;  1JJO A;  3T1H O;  4B3T O;  5KAI Z;  4G28 B;  2P06 A;  3G67 A;  3CJH A;  1M4U A;  2F95 B;  2EIN C;  2V1D A;  4JV5 O;  1X4T A;  3LSU A;  4X1Y B;  2JS3 A;  3L75 H;  1F51 A;  3ZHS A;  4FLW A;  1VF6 C;  5BMV A;  3GB7 C;  2UXB B;  4O4I A;  3APQ A;  2QM4 A;  5CA0 A;  2W6J G;  1HW7 A;  4DK0 A;  1MA1 A;  2Q7E A;  2DQ0 A;  2JVD A;  3JAM N;  4X9Q A;  1W2B U;  4X1K B;  2Z5U A;  1N33 O;  1K34 A;  1SQG A;  2LGW A;  2P67 A;  1EN4 A;  5BXZ A;  4LF9 B;  1WP8 A;  4TUY A;  4TT3 G;  1VQ5 V;  3OMN B;  4TWK A;  5JJN B;  4HZ3 A;  4O4L B;  3HKB B;  2ILM A;  2GUZ B;  3T4D A;  1QQC A;  1XDC A;  5FPO A;  3B2E E;  2ZR2 A;  2YC0 A;  4YY3 O;  4DV5 O;  3CCL V;  4JI5 O;  3CRR A;  4PA4 A;  3OUF A;  3F5W C;  1FFT B;  2R9R B;  1PM9 A;  3VQX A;  3ZMV A;  2JJ1 G;  3BY6 A;  4J7J A;  4KXR A;  4DV3 O;  1HDJ A;  3APO A;  2L6L A;  3HR0 A;  2VWJ A;  4PV1 B;  4F6E A;  1OCZ C;  1N0N A;  4FFB A;  3LSQ A;  1KP2 A;  2JEU A;  2Q5Z A;  1ZL8 B;  2B5U A;  2EIJ C;  4JYA O;  1XEQ A;  4IYI A;  1Q82 W;  3JD1 A;  4GKK B;  3K79 A;  3B4S A;  5L3B A;  4X64 O;  1F7Y A;  4UCS A;  4C7U A;  3OD4 A;  4MVR A;  1VQL V;  4GX0 A;  1AR5 A;  1JMK C;  5EC2 C;  2RN9 A;  1K97 A;  5KHI A;  1N4C A;  1GN3 A;  2BOB C;  4K8X A;  1YF2 A;  2PTM A;  2YSU B;  1KKC A;  1YIT V;  3SPC A;  3B8M A;  5FL7 G;  2Q68 A;  1EN5 A;  1SA0 A;  2YIB A;  1B3Q A;  4B3S B;  2ITC C;  1PNK A;  3MHS C;  2JIZ G;  3C3T A;  1Y4M A;  3ZX6 A;  4G2K A;  4MTO A;  3LDD A;  1WA8 B;  4DR4 B;  4ZIB A;  1E1R G;  5FLX N;  4EFB A;  1VF7 A;  1AIL A;  1IBK O;  2ZE5 A;  1D5N A;  4CBC A;  1QLE C;  5KMG B;  4X8A A;  3CHX A;  1RPR A;  4MTF A;  4DR7 O;  1H5W A;  1B6Q A;  2Q7H A;  2OT5 A;  1VQP V;  5CA1 A;  4LFA B;  1IVS A;  1PNM A;  1NR7 A;  1N32 O;  3VOU A;  2DYR C;  2EIL B;  4O4L A;  1PKX A;  2JS5 A;  2ZE6 A;  2GUZ A;  3ZBH A;  2JDI G;  3N2G B;  4NB5 A;  4JI2 O;  2P6J A;  4RAI A;  4HNA A;  4UFZ A;  1NKD A;  4D7S A;  2EIK B;  4AHC A;  1QVF U;  5HFL A;  5FNV A;  1QR8 A;  3K9A A;  1VP7 A;  3P3N A;  1FJG B;  3H9V A;  1GRJ A;  2BTQ A;  4JAS A;  1Q81 W;  3SGI A;  2JGD B;  1FXV A;  4UUJ C;  2CK3 G;  4MVS A;  1HR0 B;  2ITD C;  5GTH Z;  3ZHV A;  1GO3 F;  5LP6 C;  3N2K B;  3N27 A;  2ADQ B;  5L3E A;  1Q6I A;  4DV6 O;  2UUB O;  1E1Q G;  4NXM B;  3ETQ A;  3ICX A;  3CXC U;  1SQF A;  4JPR A;  3JAT B;  4UCT A;  3AK2 A;  1N36 O;  2F4V B;  3H1H H;  1GMG A;  4LWS A;  2AXT Z;  5CA3 A;  1D2D A;  1BCC H;  4UV8 A;  2HKO A;  1LR1 A;  5K1X A;  1J95 A;  3ETG A;  4TSF G;  2PZS A;  1KC8 W;  2X6A A;  2BCC H;  4DR6 B;  2XAJ A;  4R8C A;  4J41 A;  1XNR B;  2KQX A;  1WJZ A;  1FAF A;  4PA9 A;  2GBO A;  3CCE V;  1EFR G;  1H2S B;  4MVU A;  3LSS A;  3W7T A;  3ZN0 A;  1B06 A;  4DV7 B;  3MAQ A;  3CCM V;  2FYU H;  3SJA C;  3B09 A;  2YIC A;  1SQQ H;  4DV2 B;  4JTD B;  4DK1 A;  3U11 A;  2P90 A;  2PGG A;  4JI7 B;  3AG2 C;  3IGA C;  3CE2 A;  4NXN B;  3KKY A;  1IX9 A;  4EFE A;  3K58 A;  2A79 B;  2MW2 B;  4AQY B;  5A2Q N;  3K06 A;  1GK9 A;  2YS8 A;  1P49 A;  1LUV A;  4MVQ A;  1AJP A;  1BL8 A;  3CEI A;  3ETD A;  3ZIA G;  1VQ4 V;  2LW1 A;  2QWP B;  2QGN A;  3ABM B;  4KUM A;  2CE4 A;  4X66 O;  2K1E A;  4W4K A;  3CME V;  1QCE A;  3BAA A;  1AR4 A;  2QWR B;  5KA6 A;  2E3C A;  1QHT A;  1TGO A;  4P2Z A;  1FYJ A;  2OCC B;  1MOF A;  4JTA B;  3BHP A;  5K1P A;  2E74 B;  1R1B A;  2F93 B;  1I94 B;  2UUA B;  1YIJ V;  2WLI B;  3JAT A;  5CB4 B;  1BS3 A;  1V54 B;  4U3J A;  3BVO A;  2DYS C;  4LC1 A;  5EIB C;  4PA6 A;  2OTJ V;  4U7N A;  4GX5 A;  3FB7 C;  3AEI A;  3L9D A;  2VQF O;  1XI1 A;  5ITZ A;  4H13 B;  1FS0 G;  4GX2 A;  3CC4 V;  3MDS A;  2VWK A;  4FM1 A;  4JI1 B;  2QM8 A;  1YTF D;  3ZRX A;  4K0K O;  4JF3 A;  3ZMT A;  1X59 A;  1K7D A;  2OIG A;  3L74 H;  3RBZ A;  3VQW A;  3BCC H;  4CC5 A;  5B3S C;  1VQO V;  1IDS A;  1G4Y B;  4UCO A;  4I55 B;  3JCZ A;  1O9G A;  2VS0 A;  1PP9 H;  4QE7 A;  5LXT B;  2P7T C;  5BZB A;  4FM0 A;  4YJ2 B;  1NZ6 A;  4LF7 B;  4U7O A;  3CP1 A; 
#chains in the Genus database with same CATH homology
 1GN6 A;  1MNG A;  3KKY A;  4GUN A;  1IX9 A;  1PL4 A;  4F6E A;  3KDR A;  1N0N A;  3RN4 A;  1LUW A;  1N0J A;  1I08 A;  1LUV A;  3CEI A;  1WB7 A;  2CE4 A;  4BR6 A;  4JYY A;  4YIO A;  1GN4 A;  1XUQ A;  4C7U A;  1AR4 A;  1VAR A;  1AVM A;  1AR5 A;  1AP5 A;  3DC5 A;  1GN3 A;  3EVK A;  4YIP A;  2ADQ B;  1ZLZ A;  3LSU A;  3QVN A;  2ADP A;  2RCV A;  1MSD A;  3TJT A;  1KKC A;  3AK2 A;  1EN5 A;  1P7G A;  1BS3 A;  1BT8 A;  1VEW A;  1Y67 A;  2AW9 A;  1MA1 A;  2CDY A;  3C3T A;  1EM1 A;  3IC9 A;  4X9Q A;  1WB8 A;  3DC6 A;  1GN2 A;  1XRE A;  4FFK A;  1QNM A;  3MDS A;  1IXB A;  1EN6 A;  1BSM A;  1D5N A;  1EN4 A;  2QKC A;  3C3S A;  1ZTE A;  4E4E A;  1JR9 A;  1ZSP A;  3OT7 A;  1ZUQ A;  1I0H A;  4JZG A;  3AK1 A;  3K9S A;  1AP6 A;  1XIL A;  1JA8 A;  1IDS A;  1XDC A;  2GDS A;  1B06 A;  3AK3 A;  1SZX A;  3BFR A;  5AG2 A;  1MMM A;  2P4K A;  1PM9 A;  4JZ2 A;  2QKA A;  5A9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...