1P84D

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
246
structure length
246
Chain Sequence
b'MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 72
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1p84D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1p84D01
2CA3B 1HJ3A 4P4QB 5KLIB 1CC5A 4H0JA 2FYUD 2MHMA 1FHBA 4LJIA 2L4DA 1CYJA 1NTZD 1NNOA 4IL6V 1K3HA 2N9IA 3PRJA 5KAIV 3H1LD 1DW2A 3MK7B 1MG2D 4WQBA 4RJTA 1MG3D 4FA1A 4FA4A 1C2RA 3PLNA 2DVHA 1L9JC 451CA 3O5CA 2ZXYA 4UB6V 1CIFA 4AAMA 3L74D 3L75D 1HRCA 1YNRA 1AOFA 1CRIA 2V08A 3PXTA 3WFDC 3L4MA 3WU2V 1LFMA 4AAOA 3A9FA 5B66V 2AIUA 3H1HD 4WQ8A 1FI7A 3WUIA 3KZIV 1W5CT 1HZVA 1PPJD 1HROA 3ZOXA 3CXHW 5KLVD 1YFCA 3CWBD 1E2RA 3WFBC 1DVHA 4AX3A 3O20A 3KHUA 1I6EA 2N3YA 3OCDA 3RMZA 1GKSA 1C2NA 1KX7A 1EZVD 4L3HA 1I55A 1CRHA 1C6OA 3VYMA 1AYGA 3HQ8A 1S6VB 2JQRA 2BPBB 1CHIA 1KB9D 1SQVD 3JBTB 5C0ZA 2C1UA 4QAOA 2BLFB 1HCMA 1FCDC 4UB8V 1N15A 1QN2A 1VYDA 1LC2A 3GG2A 2QJYB 2RMZA 1H32A 1CTJA 2CA4B 2OZ1B 1U74B 4V2KA 2Q3EA 1KV9A 1IRWA 1I5TA 4PD4D 1GQ1A 2QG4A 1I8OA 2C9XB 3PTZA 1CRGA 2YK3A 2JWAA 4FA9A 3L71D 4GYDA 5DJQC 1M60A 1N90A 4U3FD 1JDLA 1LS9A 4YE1A 3BCCD 1DIIC 2VHDA 1HJ5A 1F1CA 5CIFB 2IBZD 4J20A 1C52A 1L9BC 1M70A 2N3BA 2MTAC 3WC8A 1MZ4A 3A0HV 5B6QA 4K3IA 3FWLA 4AANA 2CXBA 1I6DA 1DIQC 1IZL0 1LC1A 4H0KA 1PP9D 3M97X 2RN0A 1BGYD 1I54A 1KB0A 1GU2A 3NBTA 4WQEA 1H31A 2BH4X 3HQ9A 3ZOWA 3O1YA 1CTZA 2KNCB 2D0SA 4KMGA 3ZCFA 2JTIB 1IQCA 2N9JA 1C6RA 4A7PA 2ZBOA 1DW0A 1L0LD 1U75B 5CIHB 1H9XA 1DVVA 1NU1D 2N18B 5DFSA 4Y5RA 2BH5X 2L91A 3TF5A 1SQQD 3ZOYA 1OCDA 2ZONG 1DW3A 1NTMD 2D0WA 3OA8B 1CHHA 1B7VA 2C1VA 3TDKA 2V07A 4PWAA 3MK7C 1EB7A 1AKKA 1YCCA 3PXSA 1H9YA 2ZOOA 1CTYA 3HQ6A 1FJ0A 1M6ZA 2BCNB 2DGEA 1FOCA 3CU4A 2Y0CA 2N18C 4EICA 3VMAA 3CX5D 5KKZB 1SQPD 1RAPA 3VNWA 3VRDA 2Y0EA 2PCBB 1IRVA 1QL3A 1YEBA 4O1QA 3H1JD 4XYDB 4FA5A 4EDFA 1CCRA 4EIEA 1HJ4A 1DW1A 4GEDB 3RN0A 1YEAA 1LMSA 1RZ6A 5CIGB 4WQ7A 4FANA 1P84D 2N9YB 2C1DA 1NMIA 1GJQA 1I8PA 3PXWA 2GIWA 1RAQA 1CXCA 4PW9B 1F1FA 4D6TD 1E8EA 1E29A 1CSXA 4RSZA 2B0ZB 3RLMA 1N50A 3PHLA 4L3GA 3ZIYA 3SJLA 5TJHA 5H2FV 1SQXD 4O1WA 1YTCA 1CSVA 3ITKA 1H32B 2C2CA 2LIRA 2BCCD 5IY51 2I8FA 1QKSA 1COTA 1A56A 1CIHA 2FRCA 2XTSB 2Y0DA 2C8SA 2EXVA 2YQBA 4DY9A 1RZ5A 3CP5A 3A0BV 1CEDA 3X39A 5CIEB 1ZZHA 3NBSA 2PCCB 3CX5W 1YIQA 3ZBMA 1KYOD 4WQDA 2B10B 2HV4A 2B4ZA 5CIBB 1CORA 1KIBA 1QL4A 2K9JB 1H33B 2GC4D 3NWVA 2QJPB 5CYTR 3L70D 155CA 3OA8A 2A06D 5CIDB 1GDVA 1CYIA 1CRCA 1C6SA 3SXTA 3HQ7A 1H31B 2B11B 4N0KA 5EXQA 3H1KD 1A8CA 1CHJA 4EIDA 4PJ0V 3DR0A 4WQ9A 3SVWA 1HH7A 5B5EV 3L4OA 5GTIV 2AI5A 5C9MA 3L72D 1KX2A 2YCCA 2ZZS1 4FAVA 2FYNB 3C2CA 5TISV 2ORLA 2B12B 1SQBD 3DMIA 1OAEA 4EIFA 3GW6A 1CYCA 3WFCC 1CCHA 3CYTI 1FI9A 2KS1A 1HZUA 4XXLA 1NTKD 1CNOA 1BCCD 2OZ1A 4AALA 1WEJF 3OCDB 2AXTV 1FI3A 1AOQA 3RN1A 2QJKB 2CE0A 1KYOW 1YICA 5E79V 1ZRTD 1K3GA 4NFGB 5AURA 5DJQB 3WFEC 1QYZA 3PH2B 1J3SA 1CIGA 1BE3D 2FWLA 1L0ND 1R0QA 2BGVX 4Q5PA 1IO3A 1ETPA 3SLEA 1BL9A 1W2LA 5GTHV 1GIWA 2PACA 1C7MA 3SWSA 1C75A 4FB1A 4L1QA 2C1DB 3CXHD 1CO6A 1NIRA 4WQAA 5CICB 3TGUD 1S5LV 3ORVA 1CIEA 1CSWA 1NMLA 2GC7D 3ZOOA 1CRYA 2CE1A 1CSUA 3H1ID 1H1OA 3DP5A 1DT1A 351CA 4MU8A 3TYIA 1H33A 2YIUB 2GB8B 5KAFV 5DF5A 1CRJA 1WVEC 4JCGA 1N9CA 2O3JA 3O0RC 1A2SA 4WQCA 3L73D 2LITA 1CXAA
chains in the Genus database with same CATH superfamily
1JNMA 5KLVE 3CWBE 2W6AA 1DH3A 3HTKA 3H1LD 2LXBA 1DW2A 5KLVK 1J1EC 1WMKA 4RJTA 1MG3D 1KMIZ 4FA4A 3SSUA 1VQKP 4JF7A 2HPCB 2E75C 3H6PA 2DVHA 3C9IA 1SFCD 4H0LB 3L71G 2O01J 1HF9A 1KFMA 1S5LH 3H1IG 1NH4A 1HRCA 3AEDC 1AOFA 1CRIA 3WFDC 3WU2V 1LFMA 4XE5B 3A9FA 3H1HD 4WQ8A 3WUIA 3KZIV 2YKQA 1PPJD 3H1LJ 1FDMA 3CXHW 3G3ZA 1DVHA 3O20A 5AW0B 2FY8A 2N3YA 3RK3C 3OCDA 3B5ND 1I55A 3V2RA 1C6OA 4PD4H 1U7JA 3BCCE 4ASVA 3CMAP 2BPBB 1SQVD 2GA1A 1HCMA 2E75D 3GF3A 1N15A 1RH5B 1SQQG 3U1CA 1DD4A 1FC2C 1PP9E 2QJYB 3WU2E 1J1DC 3KZIE 2Q3EA 4UB6H 3N4XA 3R4YA 3VTPC 1QEXA 1KV9A 1I5TA 4PD4D 5CCGD 4ASWA 3RK2D 5KLVG 2C9XB 1P84I 3PTZA 1CRGA 1SQVJ 4FA9A 2ZXEB 1K9MQ 5CCHA 1HJ0A 3RK3D 3D70A 2IBZD 4J20A 3CC4P 3Q3DA 2O1KA 3ZDMA 1OZHA 1KZUB 1JY3O 2HYNA 1LTJC 4AANA 1EDLA 3Q5RA 1LT9C 1KFNA 1IZL0 1LC1A 3SWYA 4Y99C 1Q86Q 4KHXA 3LW5H 4WQEA 1E79H 4D6TJ 3O1YA 3PJSK 3CD6P 1YQ3C 2QM8A 4KMGA 4N3YB 1IQCA 1C6RA 1Q81Q 1S9KE 4L75A 1M7LA 3V2QA 3VOPA 1DVVA 1QVGO 2KSEA 2N1TB 5APQA 3SFEC 3RL0C 1KYOI 3P8CD 3MP7B 4Y5RA 1XTGB 5AVXB 1OCDA 1HJBA 1EQ7A 2W90A 1IFDA 3HE5B 1KB9H 2C1VA 2ZT9C 2D2CB 4WY4B 3BASA 1NAYA 1LWUB 3MK7C 2BEQD 1EXJA 1H9YA 2ZOOA 1M6ZA 1PP9G 1JMBA 1FOCA 1EDKA 3CCVP 2K37A 1BE3E 3L37A 3I5CA 3WUVA 4AUWA 2OYIC 1MUUA 1SQPD 1PGPA 1LTSC 5CBNA 1NAFA 1FDIA 2PCBB 3H1JD 3LW5J 4XYDB 3HRNA 2PP6A 3EQ2A 1SQXK 4LC1A 4EDFA 4EIEA 3JCUH 1DW1A 1YI2P 1HGZA 1RZ6A 1EXIA 2N9YB 1NMIA 5AVRB 1RAQA 1CXCA 4PW9B 1F1FA 1Q7YQ 3S1KA 1KTMA 3VP8A 3RLMA 5TISE 2E5YA 3ZIYA 2NPSB 5TJHA 1OFCX 3FGAD 3D6ZA 1BCCJ 4GT1A 1L4AC 4WB4A 3G71P 2LIRA 3AE6C 4GIFA 5IY51 3KXDA 2B87B 1N2DC 2KZJA 1CIHA 4JPZB 4W7ZA 1YQ4C 4YTPC 2YQBA 3PH0A 2JWDA 4JQ0D 1RZ5A 3CXHI 1LTIC 1HGVA 5CIEB 4L74A 2PCCB 3CX5W 1MFTA 3ZBMA 4DCKA 4WQDA 2B4ZA 1G1IA 1FZFA 1URQC 3H1HE 1KIBA 4OVNF 1QL4A 3FXEA 3AE3C 1BDCA 3L70D 1VQ5P 1BE3G 3WMM0 5CIDB 2XV5A 4N78D 3TGUJ 4WY4A 1C6SA 1D7MA 5EXQA 1JUNA 1EDJA 3H1KD 3HE4B 2A45G 2XNDH 1SQVE 4AQRD 3L4OA 4GKGA 5GTIV 1JMMA 2V7QH 2ZXXA 3A0HH 5C9MA 1LT1A 1ZP0C 3N7NA 3L70J 4R4LA 2MJZA 1SQBD 3DMIA 1OAEA 4EIFA 2WT7B 1URQD 3VMYA 2K9YA 4PD4E 3CYTI 1OVRA 1M57D 1FI9A 2KS1A 1BSNA 3V5BA 1N8RQ 4XXLA 2ZYDA 1NTKD 1FOSE 1RF1A 2ZVNB 2WSFH 1WEJF 2G8YA 1VF5C 2AXTV 3RK3E 1KILB 5KKZC 1M90Q 1T2KC 2IBZE 5CCHD 2E5TA 1A02F 4NFGB 1SQBJ 1QYZA 1TU3F 4NPFX 3PH2B 3L35A 3NTNA 1L0ND 2IZ1A 1JCCA 1VQMP 5AVSB 1ETPA 2YKPA 2PACA 4GODA 5AW5B 5CBOA 3H1HG 1NTKJ 1LTJB 1ZN5A 2V7QJ 1C75A 1IZNB 1LT9B 4IL6X 4Y99B 3CC7P 2PRRA 5CICB 1CIEA 2KNCA 1CRYA 1N7LA 5CJ0A 4R4MA 2AXTE 3P8CE 1LP1A 2K3RA 3TSIA 2Y9YA 1H1OA 3M0DA 1KQSO 3II6A 2FYZA 351CA 1VF5D 3C1LA 4MU8A 1SQVG 2GB8B 4GOFA 2HODB 4JBZA 1CRJA 3RL0B 2E74C 1N73A 1Y9BA 4RO0A 2YO3A 4WQCA 3O6QA 1UIXA 2WSFJ 1AV1A 2FYUD 2MHMA 2ZT9B 4PV1C 1CYJA 1NTZD 1NNOA 3UIAA 2N9IA 1PL5A 3MK7B 4IFFA 1EZVE 4WQBA 2ZVOB 3V6IA 4EIJA 5H2FH 1SQPE 2E43A 3V4WA 5AW8B 1KB9E 2KZIA 1H8AA 1SQPK 2Z5IA 2ZXYA 3H1JE 3IN6A 2QJPC 3P32A 4AAMA 3L74D 4BRYB 2OTKE 2IBZG 1N7SA 4WVZA 1YNRA 2V08A 4H13D 1WT6A 2FYUJ 1HZVA 3A7OA 3KQGA 2OARA 2WPRA 2FFDC 2C0WA 2XDJA 5KAFH 1H0TB 3KHUA 1GKSA 3S9OA 1OVUA 4L3HA 2YO2A 3GHGC 1YYCA 3JCUE 2ZYGA 3RL0g 5EFWB 1YITP 3JBTB 1BSHA 1R8EA 3L74J 1DX7A 4QAOA 3CX5I 3AE5C 1ZR2A 4W7YA 2H8PD 1FCDC 2Y9ZA 4UB8V 1JY3P 1VQ7P 3KYQA 3USSA 5B5EH 1L4AB 3CCUP 1H32A 1HUCA 4V2KA 5AW9B 3JSVC 3OW2O 1G1JA 1LTBC 2QJKC 3CCRP 1OW6A 1M60A 1N90A 4YE1A 1JDLA 1G2CB 2XU6A 1DD3A 1EZVG 2VHDA 1F1CA 1SQPG 2QVAA 1SQQE 3IFMA 1L9BC 1M70A 2MTAC 3D71A 1FJPA 2K9JA 4LLHA 3A0HV 1FZCC 3H1JG 4YXWH 3H1KE 4UB8E 1SQQK 1I6DA 1HH0A 1DIQC 1R5SA 2E76C 4I7ZC 4H0KA 1FZBA 5KJ7C 3B5NC 1I54A 1FZAA 1VQPP 1H89A 3NBTA 3HQ9A 2JTIB 1RF0C 2ZAEB 1L0LD 1SQBE 5GTHH 1U75B 5CIHB 2YMKA 3F89A 3P8MC 1NU1D 4EOTA 1ZXGA 3SWKA 1KQLA 4EI2A 2BH5X 2LR2A 1JO5A 1NTMD 1Q2NA 1NTKE 5KLIC 4EYYQ 1B7VA 3A0HE 4DOJA 2PGDA 1FOSF 4OGQB 5CCGC 1H0TA 2HLOA 3RK2C 1EB7A 1YCCA 2Q7CA 4K3AA 1T3UA 2E76D 2DGEA 1L0LJ 1N86A 5KJ7D 1P84H 2N18C 2XZRA 4XFJA 5AVYB 3VMAA 1NU1J 1QX8A 1RQUA 5KKZB 1L0NE 1LGHB 1RE4C 3S4RA 1RAPA 1JOCA 3IF4A 3EWKA 1T3JA 3VNWA 1NTMJ 5KAIH 3BATA 1L0NK 1GTWA 4BXLA 2OQQA 3L70G 2P10A 3H32A 1CCRA 3AEAC 2JEEA 1JY2O 3B8EB 1YEAA 1ZV8A 1LMSA 1JB0J 5CIGB 1P84D 1S2EA 3RGUA 1Y8AA 1YTZI 3H1KG 3HD7A 5APTA 1GU5A 1AFOA 1M8OB 4C46A 3U59A 1YJWP 4D6TD 2B0ZB 1N50A 3AEBC 5H2FV 1KYOH 3AE8C 5C39A 1CSVA 1SQBG 4RKUJ 1FE6A 3ITKA 1NTZE 2E74B 2C2CA 2BCCD 2IPPA 4L73A 1QKSA 1COTA 5M1BA 1NTZK 2FRCA 3D0WA 2ITAA 2Y0DA 2H43A 4PV1B 1LTAC 4DY9A 1NTKG 1VQ9P 5AVZB 3CP5A 1CEDA 3MUDC 3NBSA 4CPGA 1KYOD 2HPCA 2M3BA 2GM4A 1CORA 1QL1A 2QJPB 1N7SD 5CYTR 5H2FE 2BCCJ 1L0NG 2OYHC 2A06D 1FJKA 5BU5A 1CYIA 4H44B 2KI7B 1H31B 1VPCA 4AYCA 2FFDB 3HUSC 3NMDA 3OAKA 1KV4A 1HH7A 5B5EV 4M3LA 1K73Q 3AEEC 3TK1A 3L72D 3GHGB 1KX2A 1GL2C 3E1IA 4FAVA 5TISV 5CMZA 3QWOC 2CPSA 2P2UA 4ZMDA 1USDA 5AW2B 1X22A 1M1JB 1CYCA 3WFCC 3MTUE 3M0AA 1DIPA 2FYUG 2Z5HA 1RE3A 5K5GB 1BCCD 1NTZG 4HH2A 2R5DA 3CXHH 3IAOA 3L72J 1FI3A 1AOQA 3RN1A 1H88A 1Z56A 2QJKB 4I1LA 1SFCB 3VMXA 5B5EE 1K3GA 1ZRTD 5AURA 2H7HA 1J3SA 1CIGA 2NRGA 2FWLA 2I8DA 1R0QA 2BGVX 4Q5PA 1GL2D 1OWAA 1IO3A 1IK7A 1W2LA 5GTHV 2IYOA 1GIWA 2VRSA 3I56P 1FZCB 1KORA 3SWSA 1W2EA 2B9BA 1ZLLA 3R2PA 3H1LE 2C1DB 3CXHD 3B71A 2HFED 3B5NB 1L0LE 3TGUD 1S5LV 2FXPA 1OXZA 3ZOOA 2QA4P 2CE1A 3H1ID 1J1EB 1GDTA 2IYPA 2E75B 2Z4EA 5DF5A 1WVEC 2N1TA 2O3JA 3T97B 3OA7A 3L73D 3Q2YA 2QIWA 4TLFA 1Q82Q 2LITA 1PPJE 2CA3B 5KLIB 4H0JA 5GTHE 3HE5A 4LJIA 2QM7A 2L4DA 1K3HA 5KAIV 3SWFA 1MG2D 3RK2B 1LWUA 2JO1A 5CCHC 3H1IJ 3CCJP 3PLNA 1PFIA 1S5LE 1LTGC 1L9JC 4L76A 451CA 3RK3B 1MKMA 4IFMA 2KYVA 4UB6V 2WQYC 3L73J 1SQVK 2P58A 1GD2E 4KJMA 3L75D 1M1JA 1YIJP 3A0BH 2AIUA 1VQ4P 4LGDE 1KQFB 3W67A 5KLVD 1RHZB 3CWBD 4Z1MH 1QLED 3HD7D 2FBWC 1J1DB 1ZW0A 5KAIE 4D6TE 1KX7A 2HG5D 1PGOA 3H1LG 1CRHA 3PP5A 1AYGA 3HQ8A 1CI6B 2QEXP 1S6VB 2JQRA 2QRXA 2FYNC 1CHIA 5C0ZA 1T8ZA 1L0LG 1W2BO 3L75J 1NU1G 2JDIH 4PJ0H 3VMZA 1JCDA 2NPSA 4UB6E 2I1JA 3V2NA 1S1CX 3GG2A 3GLMA 1LC2A 1NO4A 1NTMG 3CWBJ 5KLVJ 2W8ZA 2RMZA 1CTJA 2CA4B 2OZ1B 1U74B 2G3AA 2B87A 2K1AA 1IRWA 1GQ1A 1KYOE 1PPJG 3CPWO 1PGQA 1I8OA 2SPZA 2YK3A 2JWAA 4GYDA 4U3FD 1CW5A 3BCCD 1DIIC 4H0LD 2WSSH 1HJ5A 5CIFB 2AEJA 4H13C 2YKOA 3WC8A 2KOGA 1GK6A 5B6QA 3FXDA 2OYHB 2WPSA 1YJNP 1KN7A 2RH0A 1PP9D 3M97X 1BGYD 2M5AB 3TNUB 1AQTA 1CTZA 3CI9A 4JYCA 1YJ9P 3G9RA 4U3FJ 1YBKA 3HE4A 2KP8A 1VQ6P 1PV3A 1FZGA 3BCCJ 2ZBOA 1IC2A 1EC5A 1IFMA 3A3YB 1H9XA 3BVHA 1YHQP 4D6TG 1R5LA 3CX5H 4B86A 3TF5A 2R32A 1E5WA 3ZOYA 2OYIB 2ZONG 1DW3A 1FU1A 2Q9IA 2D0WA 3OA8B 1PP9J 4K35A 1BCCE 1JY2P 3TDKA 1BGYJ 3HTKB 2WT7A 2V07A 2BCCG 3C8VA 3PXSA 2JR8A 1OIPA 1ZRTE 2BEZF 2WMMA 1GU4A 4RESB 2WZ7A 2KK7A 4EICA 1CI6A 3CX5D 2YXRB 1U7MA 1KILA 4ZNCA 2MKVA 2HR3A 5AVVB 1OMIA 4IL6H 1CSBA 1GZLA 2CPBA 4HJGH 2D2CC 1IRVA 4WY4C 1M56D 3CXHE 4FA5A 2WITA 2POHA 1PGJA 4QMAA 4GEDB 1SS1A 2A06G 3TGUE 5BU8B 1LTJA 4U7JA 1M1KQ 4FANA 1LT9A 2QSIA 1NWQA 2LKMA 2PAJA 1GJQA 3KDPB 2OYOA 4C7RA 1I8PA 5B66H 4I2LC 1W5CE 3H25A 1E8EA 4OWFA 1E29A 4RSZA 3L72G 3PHLA 1NGMB 3SJLA 3L70E 2N1TD 1SQXD 4O1WA 1SVFA 1YTCA 2O01N 2J59M 1URQB 2HODA 2RKLA 4N78E 1HWTC 3AE2C 3CLQA 3CCEP 1RF1C 2D2CD 1A56A 4WY4D 1IFPA 2KSJA 4DZOA 5DJUB 3TNUA 1GK4A 3AEGC 1IFJA 1BCCG 1DEBA 3A0BV 1X79B 2A45I 5APUA 1NKZB 5AW7B 4HB1A 2B10B 2ZJSE 3L75E 1S72P 2R3SA 4MN4C 1SQXJ 5CIBB 1JM0A 1EDIA 3CCMP 1X8YA 5AW4B 1H33B 2GC4D 2OYIA 2FXMA 2Q1KA 2ZFCA 3OA8A 2KIKA 2K88A 4BRYA 1SQBK 3M9HA 1AQ5A 1S4XA 1CRCA 3ABVC 1HBWA 1IFNA 1A8CA 1AA0A 4EIDA 4PJ0V 1NTKK 3M0DC 3TGUG 4BWNA 3A0BE 2AI5A 2YCCA 3A5TA 1VF5B 4OH8B 1N73C 2ZZS1 3MIWA 2FYNB 2ORLA 2B12B 2AXCA 5APXA 1ZOYC 2NPSD 1JY3N 2J58A 2YNYA 2C9LY 1LJ2A 3CL3D 3L73G 1CCHA 3CCLP 1L4AA 1CNOA 1PIXA 3GF7A 4AALA 3VYIA 4U3FE 1LTTC 1OW7A 4PJ0E 5KTBA 5AVQB 2CE0A 1NKNA 2W6BA 3E7KA 3RBXA 2WPQA 5AVUB 1N7SC 3H1HJ 1RQVA 1G2CA 3AECC 2XKMA 3M9BA 3NXSA 2FXOA 3AE1C 2AEMA 3V4QA 2LXCB 4H13B 5GTIH 3MD0A 1NYHA 1URQA 3L75G 1BGYE 1BL9A 1U57A 2KXPB 2FYUE 3P7KA 4FB1A 4L1QA 2WTYA 1KILC 1CO6A 3CWBG 2FYUK 1NIRA 4WQAA 2IX7C 1FDOA 1DEEG 1USEA 1CSWA 1OX3A 1LNQA 2GC7D 4GOEA 1NHLA 2IFMA 4PD4I 4N6JA 2M3EA 1QVFO 3DP5A 1DT1A 1MV8A 2C0XA 3L74E 3TYIA 1H33A 1OVVA 5KAFV 1J2JB 2AXTH 4JCGA 1N9CA 2IBZI 2JJLA 1HJ3A 4P4QB 3M06A 1CC5A 1S3JA 1FHBA 2BASA 1FAVA 2W6JH 2B88A 4IL6V 3OJAB 2P1JA 3PRJA 1VQOP 1X9VA 4IFDK 3G4SP 2KB7P 3CX5E 1X0TA 2Q3IA 1JTHB 4DJGA 4FA1A 4DT0A 1C2RA 1KILD 3M9QA 3CCSP 3O5CA 4ZKPA 1NJIQ 4U3FG 4WBAA 3BCCG 1CIFA 4KT0J 3PXTA 2C9NY 3L4MA 4AAOA 5KAFE 3AE4C 5B66V 4C7NB 1FI7A 1VDFA 1W5CT 3O8ZA 5AW1B 1HROA 3ZOXA 2KUBA 1YFCA 2DW3A 1E2RA 3GMAA 3WFBC 4AX3A 1SLQA 1KD1Q 4IL6E 1K8AQ 1BGYG 1I6EA 5AVTB 3RMZA 1C2NA 1MZ9A 1EZVD 2M8RA 1HVVA 3VYMA 2KLUA 1SQXE 3D6YA 1KB9D 5APWA 2C1UA 1SP4A 1GW3A 2BLFB 1EZVI 2Q6QA 1K04A 3RL0D 1QN2A 2ZYAA 1VYDA 1KB9I 2KS1B 2L5GB 5B66E 3L74G 3Q1MA 3MZWB 2WPVB 1RF1B 2ZT9D 4W80A 1SQPJ 1VL2A 2E76B 4I7ZB 2QG4A 3QH9A 3L71D 5DJQC 3H1JJ 1LS9A 1NU1E 2NZ2A 3W68A 2OTJP 1L0LK 3U1AA 1C52A 4Y28J 2N3BA 1NTME 1NU1K 2H89C 3B4SA 1MZ4A 3CMEP 4K3IA 2KLVA 3FWLA 2CXBA 1NTMK 3HD7C 3FX0A 1UIIA 3VP9A 5E79H 2RN0A 1KB0A 1GU2A 1H31A 2BH4X 3ZOWA 4UB8H 1JTHA 2KNCB 3K5BA 2FFDA 3L71J 2D0SA 3ZCFA 1LP1B 2N9JA 4A7PA 1DW0A 1IO4A 2JKVA 2YIUC 4WWIA 3GHGA 2M0BA 2N18B 1N73B 5DFSA 3AE7C 5CJ4A 2W83C 3O6QB 2L91A 1SQQD 1RY3A 1FZEA 1SQXG 3MGNA 4I6MC 3F5HA 4C7NA 1CHHA 2IFNA 2WSCH 1L4AD 1T6AA 1P84E 4PWAA 1ZR4A 1AKKA 4TT3H 1CTYA 3HQ6A 1FJ0A 3NFQA 2XNXA 2OTLP 2BCNB 4JYBA 3E1RA 3CU4A 4O9BA 2Y0CA 4H0LC 2P7JA 5APSA 1VQLP 1SFCA 1FBMA 2UWJE 1SQQJ 1N7SB 3VRDA 5L8RJ 2Y0EA 4O1QA 1QL3A 1YEBA 4OGQC 3H1KJ 1Q90D 2R44A 1L2PA 2BCCE 1HJ4A 1NOHA 2W27A 3RN0A 2CK3H 1FZCA 4WQ7A 2C1DA 3L36A 1IFIA 5KJ7A 2AEFA 3B5NA 5GTIE 2OGUA 3PXWA 2GIWA 3WU2H 4IOIH 3AEFC 1GW4A 3KZIH 3G6EP 4HYTB 1CSXA 1MFZA 1RF0A 2WSCJ 4L3GA 2O1JA 3WUTA 2WSEH 2A06E 2GUSA 2QJYC 1H32B 2YXQB 3T97A 3Q5SA 1RE3C 2WVRA 3L4FA 5BVZA 2I8FA 2R5BA 2XTSB 4OGQD 1BDDA 2N9BA 2C8SA 2EXVA 2J5UA 1KILE 1IK9A 1JEKA 1NVOA 3I55P 5CCGA 3X39A 3CCQP 3VN0A 1HTLC 1QL2A 1ZZHA 3L72E 1YIQA 3HUSB 1L0NJ 2HV4A 3IR9A 1T2KD 1AVOA 2E42A 3KPEA 4HKZH 2K9JB 3NWVA 3CC2P 3EFGA 1RE4A 3M91A 2B89A 155CA 1GL2B 4YXDC 3Q5PA 3LIDA 1GDVA 3SXTA 3HQ7A 4XA4A 2B11B 4N0KA 1AVYA 2GUVA 1IJDB 1CHJA 1K05A 3DR0A 4WQ9A 3SVWA 2R3CA 2IDBA 2WSEJ 1ZMEC 2N1TC 3C2CA 3SFDC 1S9KD 5AVWB 3RBZA 4H44C 1A02J 1NTZJ 1AJYA 5APVA 3GW6A 1KQGB 3A2AA 1PZQA 2E74D 2V4HA 1LWUC 5AW6B 1HZUA 1GMJA 1QGKB 1WRGA 2OZ1A 3L71E 4PV1D 2WWWA 3OCDB 1S5LX 2A45H 3H1IE 1KYOW 2PFXA 1YICA 5E79V 3BRTB 3MUDA 3WUUA 2JP3A 2IZ0A 5DJQB 3WFEC 3MHVA 1KC8Q 1M1JC 4NPEA 4ZKUA 1CZQA 1BE3D 3H32B 3TYYA 3L73E 1FS0E 1VQNP 2YMYA 3SLEA 1OW8A 2FKWB 3JC22 2O01H 1C7MA 2Q5UA 4NPDA 4H44D 5TISH 2OYHA 3LIEA 1VQ8P 3HD7B 5APYA 2H88C 1SFCC 3V2PA 3BRVB 1YTZT 3ORVA 2M5AA 5CHXA 1NMLA 1XTCC 3HUSA 2QE7H 1CSUA 4YPCA 1BE3J 2NPSC 3EFFK 5E79E 3AE9C 5AW3B 2YIUB 1GL2A 3O0RC 3FWNA 1A2SA 2P67A 1JY2N 5DJTB 2I1KA 1Y47A 4GDOA 1CXAA
chains in the Genus database with same CATH topology
2CA3B 1HJ3A 4P4QB 5KLIB 1CC5A 4H0JA 2FYUD 2MHMA 1FHBA 4LJIA 2L4DA 1CYJA 1NTZD 1NNOA 4IL6V 1K3HA 2N9IA 3PRJA 5KAIV 3H1LD 1DW2A 3MK7B 1MG2D 4WQBA 4RJTA 1MG3D 4FA1A 4FA4A 1C2RA 3PLNA 2DVHA 1L9JC 451CA 3O5CA 2ZXYA 4UB6V 1CIFA 4AAMA 3L74D 3L75D 1HRCA 1YNRA 1AOFA 1CRIA 2V08A 3PXTA 3WFDC 3L4MA 3WU2V 1LFMA 4AAOA 3A9FA 5B66V 2AIUA 3H1HD 4WQ8A 1FI7A 3WUIA 3KZIV 1W5CT 1HZVA 1PPJD 1HROA 3ZOXA 3CXHW 5KLVD 1YFCA 3CWBD 1E2RA 3WFBC 1DVHA 4AX3A 3O20A 3KHUA 1I6EA 2N3YA 3OCDA 3RMZA 1GKSA 1C2NA 1KX7A 1EZVD 4L3HA 1I55A 1CRHA 1C6OA 3VYMA 1AYGA 3HQ8A 1S6VB 2JQRA 2BPBB 1CHIA 1KB9D 1SQVD 3JBTB 5C0ZA 2C1UA 4QAOA 2BLFB 1HCMA 1FCDC 4UB8V 1N15A 1QN2A 1VYDA 1LC2A 3GG2A 2QJYB 2RMZA 1H32A 1CTJA 2CA4B 2OZ1B 1U74B 4V2KA 2Q3EA 1KV9A 1IRWA 1I5TA 4PD4D 1GQ1A 2QG4A 1I8OA 2C9XB 3PTZA 1CRGA 2YK3A 2JWAA 4FA9A 3L71D 4GYDA 5DJQC 1M60A 1N90A 4U3FD 1JDLA 1LS9A 4YE1A 3BCCD 1DIIC 2VHDA 1HJ5A 1F1CA 5CIFB 2IBZD 4J20A 1C52A 1L9BC 1M70A 2N3BA 2MTAC 3WC8A 1MZ4A 3A0HV 5B6QA 4K3IA 3FWLA 4AANA 2CXBA 1I6DA 1DIQC 1IZL0 1LC1A 4H0KA 1PP9D 3M97X 2RN0A 1BGYD 1I54A 1KB0A 1GU2A 3NBTA 4WQEA 1H31A 2BH4X 3HQ9A 3ZOWA 3O1YA 1CTZA 2KNCB 2D0SA 4KMGA 3ZCFA 2JTIB 1IQCA 2N9JA 1C6RA 4A7PA 2ZBOA 1DW0A 1L0LD 1U75B 5CIHB 1H9XA 1DVVA 1NU1D 2N18B 5DFSA 4Y5RA 2BH5X 2L91A 3TF5A 1SQQD 3ZOYA 1OCDA 2ZONG 1DW3A 1NTMD 2D0WA 3OA8B 1CHHA 1B7VA 2C1VA 3TDKA 2V07A 4PWAA 3MK7C 1EB7A 1AKKA 1YCCA 3PXSA 1H9YA 2ZOOA 1CTYA 3HQ6A 1FJ0A 1M6ZA 2BCNB 2DGEA 1FOCA 3CU4A 2Y0CA 2N18C 4EICA 3VMAA 3CX5D 5KKZB 1SQPD 1RAPA 3VNWA 3VRDA 2Y0EA 2PCBB 1IRVA 1QL3A 1YEBA 4O1QA 3H1JD 4XYDB 4FA5A 4EDFA 1CCRA 4EIEA 1HJ4A 1DW1A 4GEDB 3RN0A 1YEAA 1LMSA 1RZ6A 5CIGB 4WQ7A 4FANA 1P84D 2N9YB 2C1DA 1NMIA 1GJQA 1I8PA 3PXWA 2GIWA 1RAQA 1CXCA 4PW9B 1F1FA 4D6TD 1E8EA 1E29A 1CSXA 4RSZA 2B0ZB 3RLMA 1N50A 3PHLA 4L3GA 3ZIYA 3SJLA 5TJHA 5H2FV 1SQXD 4O1WA 1YTCA 1CSVA 3ITKA 1H32B 2C2CA 2LIRA 2BCCD 5IY51 2I8FA 1QKSA 1COTA 1A56A 1CIHA 2FRCA 2XTSB 2Y0DA 2C8SA 2EXVA 2YQBA 4DY9A 1RZ5A 3CP5A 3A0BV 1CEDA 3X39A 5CIEB 1ZZHA 3NBSA 2PCCB 3CX5W 1YIQA 3ZBMA 1KYOD 4WQDA 2B10B 2HV4A 2B4ZA 5CIBB 1CORA 1KIBA 1QL4A 2K9JB 1H33B 2GC4D 3NWVA 2QJPB 5CYTR 3L70D 155CA 3OA8A 2A06D 5CIDB 1GDVA 1CYIA 1CRCA 1C6SA 3SXTA 3HQ7A 1H31B 2B11B 4N0KA 5EXQA 3H1KD 1A8CA 1CHJA 4EIDA 4PJ0V 3DR0A 4WQ9A 3SVWA 1HH7A 5B5EV 3L4OA 5GTIV 2AI5A 5C9MA 3L72D 1KX2A 2YCCA 2ZZS1 4FAVA 2FYNB 3C2CA 5TISV 2ORLA 2B12B 1SQBD 3DMIA 1OAEA 4EIFA 3GW6A 1CYCA 3WFCC 1CCHA 3CYTI 1FI9A 2KS1A 1HZUA 4XXLA 1NTKD 1CNOA 1BCCD 2OZ1A 4AALA 1WEJF 3OCDB 2AXTV 1FI3A 1AOQA 3RN1A 2QJKB 2CE0A 1KYOW 1YICA 5E79V 1ZRTD 1K3GA 4NFGB 5AURA 5DJQB 3WFEC 1QYZA 3PH2B 1J3SA 1CIGA 1BE3D 2FWLA 1L0ND 1R0QA 2BGVX 4Q5PA 1IO3A 1ETPA 3SLEA 1BL9A 1W2LA 5GTHV 1GIWA 2PACA 1C7MA 3SWSA 1C75A 4FB1A 4L1QA 2C1DB 3CXHD 1CO6A 1NIRA 4WQAA 5CICB 3TGUD 1S5LV 3ORVA 1CIEA 1CSWA 1NMLA 2GC7D 3ZOOA 1CRYA 2CE1A 1CSUA 3H1ID 1H1OA 3DP5A 1DT1A 351CA 4MU8A 3TYIA 1H33A 2YIUB 2GB8B 5KAFV 5DF5A 1CRJA 1WVEC 4JCGA 1N9CA 2O3JA 3O0RC 1A2SA 4WQCA 3L73D 2LITA 1CXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CA3 B;  1HJ3 A;  4P4Q B;  5KLI B;  1CC5 A;  4H0J A;  2FYU D;  2MHM A;  1FHB A;  4LJI A;  2L4D A;  1CYJ A;  1NTZ D;  1NNO A;  4IL6 V;  1K3H A;  2N9I A;  3PRJ A;  5KAI V;  3H1L D;  1DW2 A;  3MK7 B;  1MG2 D;  4WQB A;  4RJT A;  1MG3 D;  4FA1 A;  4FA4 A;  1C2R A;  3PLN A;  2DVH A;  1L9J C;  451C A;  3O5C A;  2ZXY A;  4UB6 V;  1CIF A;  4AAM A;  3L74 D;  3L75 D;  1HRC A;  1YNR A;  1AOF A;  1CRI A;  2V08 A;  3PXT A;  3WFD C;  3L4M A;  3WU2 V;  1LFM A;  4AAO A;  3A9F A;  5B66 V;  2AIU A;  3H1H D;  4WQ8 A;  1FI7 A;  3WUI A;  3KZI V;  1W5C T;  1HZV A;  1PPJ D;  1HRO A;  3ZOX A;  3CXH W;  5KLV D;  1YFC A;  3CWB D;  1E2R A;  3WFB C;  1DVH A;  4AX3 A;  3O20 A;  3KHU A;  1I6E A;  2N3Y A;  3OCD A;  3RMZ A;  1GKS A;  1C2N A;  1KX7 A;  1EZV D;  4L3H A;  1I55 A;  1CRH A;  1C6O A;  3VYM A;  1AYG A;  3HQ8 A;  1S6V B;  2JQR A;  2BPB B;  1CHI A;  1KB9 D;  1SQV D;  3JBT B;  5C0Z A;  2C1U A;  4QAO A;  2BLF B;  1HCM A;  1FCD C;  4UB8 V;  1N15 A;  1QN2 A;  1VYD A;  1LC2 A;  3GG2 A;  2QJY B;  2RMZ A;  1H32 A;  1CTJ A;  2CA4 B;  2OZ1 B;  1U74 B;  4V2K A;  2Q3E A;  1KV9 A;  1IRW A;  1I5T A;  4PD4 D;  1GQ1 A;  2QG4 A;  1I8O A;  2C9X B;  3PTZ A;  1CRG A;  2YK3 A;  2JWA A;  4FA9 A;  3L71 D;  4GYD A;  5DJQ C;  1M60 A;  1N90 A;  4U3F D;  1JDL A;  1LS9 A;  4YE1 A;  3BCC D;  1DII C;  2VHD A;  1HJ5 A;  1F1C A;  5CIF B;  2IBZ D;  4J20 A;  1C52 A;  1L9B C;  1M70 A;  2N3B A;  2MTA C;  3WC8 A;  1MZ4 A;  3A0H V;  5B6Q A;  4K3I A;  3FWL A;  4AAN A;  2CXB A;  1I6D A;  1DIQ C;  1IZL 0;  1LC1 A;  4H0K A;  1PP9 D;  3M97 X;  2RN0 A;  1BGY D;  1I54 A;  1KB0 A;  1GU2 A;  3NBT A;  4WQE A;  1H31 A;  2BH4 X;  3HQ9 A;  3ZOW A;  3O1Y A;  1CTZ A;  2KNC B;  2D0S A;  4KMG A;  3ZCF A;  2JTI B;  1IQC A;  2N9J A;  1C6R A;  4A7P A;  2ZBO A;  1DW0 A;  1L0L D;  1U75 B;  5CIH B;  1H9X A;  1DVV A;  1NU1 D;  2N18 B;  5DFS A;  4Y5R A;  2BH5 X;  2L91 A;  3TF5 A;  1SQQ D;  3ZOY A;  1OCD A;  2ZON G;  1DW3 A;  1NTM D;  2D0W A;  3OA8 B;  1CHH A;  1B7V A;  2C1V A;  3TDK A;  2V07 A;  4PWA A;  3MK7 C;  1EB7 A;  1AKK A;  1YCC A;  3PXS A;  1H9Y A;  2ZOO A;  1CTY A;  3HQ6 A;  1FJ0 A;  1M6Z A;  2BCN B;  2DGE A;  1FOC A;  3CU4 A;  2Y0C A;  2N18 C;  4EIC A;  3VMA A;  3CX5 D;  5KKZ B;  1SQP D;  1RAP A;  3VNW A;  3VRD A;  2Y0E A;  2PCB B;  1IRV A;  1QL3 A;  1YEB A;  4O1Q A;  3H1J D;  4XYD B;  4FA5 A;  4EDF A;  1CCR A;  4EIE A;  1HJ4 A;  1DW1 A;  4GED B;  3RN0 A;  1YEA A;  1LMS A;  1RZ6 A;  5CIG B;  4WQ7 A;  4FAN A;  1P84 D;  2N9Y B;  2C1D A;  1NMI A;  1GJQ A;  1I8P A;  3PXW A;  2GIW A;  1RAQ A;  1CXC A;  4PW9 B;  1F1F A;  4D6T D;  1E8E A;  1E29 A;  1CSX A;  4RSZ A;  2B0Z B;  3RLM A;  1N50 A;  3PHL A;  4L3G A;  3ZIY A;  3SJL A;  5TJH A;  5H2F V;  1SQX D;  4O1W A;  1YTC A;  1CSV A;  3ITK A;  1H32 B;  2C2C A;  2LIR A;  2BCC D;  5IY5 1;  2I8F A;  1QKS A;  1COT A;  1A56 A;  1CIH A;  2FRC A;  2XTS B;  2Y0D A;  2C8S A;  2EXV A;  2YQB A;  4DY9 A;  1RZ5 A;  3CP5 A;  3A0B V;  1CED A;  3X39 A;  5CIE B;  1ZZH A;  3NBS A;  2PCC B;  3CX5 W;  1YIQ A;  3ZBM A;  1KYO D;  4WQD A;  2B10 B;  2HV4 A;  2B4Z A;  5CIB B;  1COR A;  1KIB A;  1QL4 A;  2K9J B;  1H33 B;  2GC4 D;  3NWV A;  2QJP B;  5CYT R;  3L70 D;  155C A;  3OA8 A;  2A06 D;  5CID B;  1GDV A;  1CYI A;  1CRC A;  1C6S A;  3SXT A;  3HQ7 A;  1H31 B;  2B11 B;  4N0K A;  5EXQ A;  3H1K D;  1A8C A;  1CHJ A;  4EID A;  4PJ0 V;  3DR0 A;  4WQ9 A;  3SVW A;  1HH7 A;  5B5E V;  3L4O A;  5GTI V;  2AI5 A;  5C9M A;  3L72 D;  1KX2 A;  2YCC A;  2ZZS 1;  4FAV A;  2FYN B;  3C2C A;  5TIS V;  2ORL A;  2B12 B;  1SQB D;  3DMI A;  1OAE A;  4EIF A;  3GW6 A;  1CYC A;  3WFC C;  1CCH A;  3CYT I;  1FI9 A;  2KS1 A;  1HZU A;  4XXL A;  1NTK D;  1CNO A;  1BCC D;  2OZ1 A;  4AAL A;  1WEJ F;  3OCD B;  2AXT V;  1FI3 A;  1AOQ A;  3RN1 A;  2QJK B;  2CE0 A;  1KYO W;  1YIC A;  5E79 V;  1ZRT D;  1K3G A;  4NFG B;  5AUR A;  5DJQ B;  3WFE C;  1QYZ A;  3PH2 B;  1J3S A;  1CIG A;  1BE3 D;  2FWL A;  1L0N D;  1R0Q A;  2BGV X;  4Q5P A;  1IO3 A;  1ETP A;  3SLE A;  1BL9 A;  1W2L A;  5GTH V;  1GIW A;  2PAC A;  1C7M A;  3SWS A;  1C75 A;  4FB1 A;  4L1Q A;  2C1D B;  3CXH D;  1CO6 A;  1NIR A;  4WQA A;  5CIC B;  3TGU D;  1S5L V;  3ORV A;  1CIE A;  1CSW A;  1NML A;  2GC7 D;  3ZOO A;  1CRY A;  2CE1 A;  1CSU A;  3H1I D;  1H1O A;  3DP5 A;  1DT1 A;  351C A;  4MU8 A;  3TYI A;  1H33 A;  2YIU B;  2GB8 B;  5KAF V;  5DF5 A;  1CRJ A;  1WVE C;  4JCG A;  1N9C A;  2O3J A;  3O0R C;  1A2S A;  4WQC A;  3L73 D;  2LIT A;  1CXA A; 
#chains in the Genus database with same CATH topology
 1JNM A;  5KLV E;  3CWB E;  2W6A A;  1DH3 A;  3HTK A;  3H1L D;  2LXB A;  1DW2 A;  5KLV K;  1J1E C;  1WMK A;  4RJT A;  1MG3 D;  1KMI Z;  4FA4 A;  3SSU A;  1VQK P;  4JF7 A;  2HPC B;  2E75 C;  3H6P A;  2DVH A;  3C9I A;  1SFC D;  4H0L B;  3L71 G;  2O01 J;  1HF9 A;  1KFM A;  1S5L H;  3H1I G;  1NH4 A;  1HRC A;  3AED C;  1AOF A;  1CRI A;  3WFD C;  3WU2 V;  1LFM A;  4XE5 B;  3A9F A;  3H1H D;  4WQ8 A;  3WUI A;  3KZI V;  2YKQ A;  1PPJ D;  3H1L J;  1FDM A;  3CXH W;  3G3Z A;  1DVH A;  3O20 A;  5AW0 B;  2FY8 A;  2N3Y A;  3RK3 C;  3OCD A;  3B5N D;  1I55 A;  3V2R A;  1C6O A;  4PD4 H;  1U7J A;  3BCC E;  4ASV A;  3CMA P;  2BPB B;  1SQV D;  2GA1 A;  1HCM A;  2E75 D;  3GF3 A;  1N15 A;  1RH5 B;  1SQQ G;  3U1C A;  1DD4 A;  1FC2 C;  1PP9 E;  2QJY B;  3WU2 E;  1J1D C;  3KZI E;  2Q3E A;  4UB6 H;  3N4X A;  3R4Y A;  3VTP C;  1QEX A;  1KV9 A;  1I5T A;  4PD4 D;  5CCG D;  4ASW A;  3RK2 D;  5KLV G;  2C9X B;  1P84 I;  3PTZ A;  1CRG A;  1SQV J;  4FA9 A;  2ZXE B;  1K9M Q;  5CCH A;  1HJ0 A;  3RK3 D;  3D70 A;  2IBZ D;  4J20 A;  3CC4 P;  3Q3D A;  2O1K A;  3ZDM A;  1OZH A;  1KZU B;  1JY3 O;  2HYN A;  1LTJ C;  4AAN A;  1EDL A;  3Q5R A;  1LT9 C;  1KFN A;  1IZL 0;  1LC1 A;  3SWY A;  4Y99 C;  1Q86 Q;  4KHX A;  3LW5 H;  4WQE A;  1E79 H;  4D6T J;  3O1Y A;  3PJS K;  3CD6 P;  1YQ3 C;  2QM8 A;  4KMG A;  4N3Y B;  1IQC A;  1C6R A;  1Q81 Q;  1S9K E;  4L75 A;  1M7L A;  3V2Q A;  3VOP A;  1DVV A;  1QVG O;  2KSE A;  2N1T B;  5APQ A;  3SFE C;  3RL0 C;  1KYO I;  3P8C D;  3MP7 B;  4Y5R A;  1XTG B;  5AVX B;  1OCD A;  1HJB A;  1EQ7 A;  2W90 A;  1IFD A;  3HE5 B;  1KB9 H;  2C1V A;  2ZT9 C;  2D2C B;  4WY4 B;  3BAS A;  1NAY A;  1LWU B;  3MK7 C;  2BEQ D;  1EXJ A;  1H9Y A;  2ZOO A;  1M6Z A;  1PP9 G;  1JMB A;  1FOC A;  1EDK A;  3CCV P;  2K37 A;  1BE3 E;  3L37 A;  3I5C A;  3WUV A;  4AUW A;  2OYI C;  1MUU A;  1SQP D;  1PGP A;  1LTS C;  5CBN A;  1NAF A;  1FDI A;  2PCB B;  3H1J D;  3LW5 J;  4XYD B;  3HRN A;  2PP6 A;  3EQ2 A;  1SQX K;  4LC1 A;  4EDF A;  4EIE A;  3JCU H;  1DW1 A;  1YI2 P;  1HGZ A;  1RZ6 A;  1EXI A;  2N9Y B;  1NMI A;  5AVR B;  1RAQ A;  1CXC A;  4PW9 B;  1F1F A;  1Q7Y Q;  3S1K A;  1KTM A;  3VP8 A;  3RLM A;  5TIS E;  2E5Y A;  3ZIY A;  2NPS B;  5TJH A;  1OFC X;  3FGA D;  3D6Z A;  1BCC J;  4GT1 A;  1L4A C;  4WB4 A;  3G71 P;  2LIR A;  3AE6 C;  4GIF A;  5IY5 1;  3KXD A;  2B87 B;  1N2D C;  2KZJ A;  1CIH A;  4JPZ B;  4W7Z A;  1YQ4 C;  4YTP C;  2YQB A;  3PH0 A;  2JWD A;  4JQ0 D;  1RZ5 A;  3CXH I;  1LTI C;  1HGV A;  5CIE B;  4L74 A;  2PCC B;  3CX5 W;  1MFT A;  3ZBM A;  4DCK A;  4WQD A;  2B4Z A;  1G1I A;  1FZF A;  1URQ C;  3H1H E;  1KIB A;  4OVN F;  1QL4 A;  3FXE A;  3AE3 C;  1BDC A;  3L70 D;  1VQ5 P;  1BE3 G;  3WMM 0;  5CID B;  2XV5 A;  4N78 D;  3TGU J;  4WY4 A;  1C6S A;  1D7M A;  5EXQ A;  1JUN A;  1EDJ A;  3H1K D;  3HE4 B;  2A45 G;  2XND H;  1SQV E;  4AQR D;  3L4O A;  4GKG A;  5GTI V;  1JMM A;  2V7Q H;  2ZXX A;  3A0H H;  5C9M A;  1LT1 A;  1ZP0 C;  3N7N A;  3L70 J;  4R4L A;  2MJZ A;  1SQB D;  3DMI A;  1OAE A;  4EIF A;  2WT7 B;  1URQ D;  3VMY A;  2K9Y A;  4PD4 E;  3CYT I;  1OVR A;  1M57 D;  1FI9 A;  2KS1 A;  1BSN A;  3V5B A;  1N8R Q;  4XXL A;  2ZYD A;  1NTK D;  1FOS E;  1RF1 A;  2ZVN B;  2WSF H;  1WEJ F;  2G8Y A;  1VF5 C;  2AXT V;  3RK3 E;  1KIL B;  5KKZ C;  1M90 Q;  1T2K C;  2IBZ E;  5CCH D;  2E5T A;  1A02 F;  4NFG B;  1SQB J;  1QYZ A;  1TU3 F;  4NPF X;  3PH2 B;  3L35 A;  3NTN A;  1L0N D;  2IZ1 A;  1JCC A;  1VQM P;  5AVS B;  1ETP A;  2YKP A;  2PAC A;  4GOD A;  5AW5 B;  5CBO A;  3H1H G;  1NTK J;  1LTJ B;  1ZN5 A;  2V7Q J;  1C75 A;  1IZN B;  1LT9 B;  4IL6 X;  4Y99 B;  3CC7 P;  2PRR A;  5CIC B;  1CIE A;  2KNC A;  1CRY A;  1N7L A;  5CJ0 A;  4R4M A;  2AXT E;  3P8C E;  1LP1 A;  2K3R A;  3TSI A;  2Y9Y A;  1H1O A;  3M0D A;  1KQS O;  3II6 A;  2FYZ A;  351C A;  1VF5 D;  3C1L A;  4MU8 A;  1SQV G;  2GB8 B;  4GOF A;  2HOD B;  4JBZ A;  1CRJ A;  3RL0 B;  2E74 C;  1N73 A;  1Y9B A;  4RO0 A;  2YO3 A;  4WQC A;  3O6Q A;  1UIX A;  2WSF J;  1AV1 A;  2FYU D;  2MHM A;  2ZT9 B;  4PV1 C;  1CYJ A;  1NTZ D;  1NNO A;  3UIA A;  2N9I A;  1PL5 A;  3MK7 B;  4IFF A;  1EZV E;  4WQB A;  2ZVO B;  3V6I A;  4EIJ A;  5H2F H;  1SQP E;  2E43 A;  3V4W A;  5AW8 B;  1KB9 E;  2KZI A;  1H8A A;  1SQP K;  2Z5I A;  2ZXY A;  3H1J E;  3IN6 A;  2QJP C;  3P32 A;  4AAM A;  3L74 D;  4BRY B;  2OTK E;  2IBZ G;  1N7S A;  4WVZ A;  1YNR A;  2V08 A;  4H13 D;  1WT6 A;  2FYU J;  1HZV A;  3A7O A;  3KQG A;  2OAR A;  2WPR A;  2FFD C;  2C0W A;  2XDJ A;  5KAF H;  1H0T B;  3KHU A;  1GKS A;  3S9O A;  1OVU A;  4L3H A;  2YO2 A;  3GHG C;  1YYC A;  3JCU E;  2ZYG A;  3RL0 g;  5EFW B;  1YIT P;  3JBT B;  1BSH A;  1R8E A;  3L74 J;  1DX7 A;  4QAO A;  3CX5 I;  3AE5 C;  1ZR2 A;  4W7Y A;  2H8P D;  1FCD C;  2Y9Z A;  4UB8 V;  1JY3 P;  1VQ7 P;  3KYQ A;  3USS A;  5B5E H;  1L4A B;  3CCU P;  1H32 A;  1HUC A;  4V2K A;  5AW9 B;  3JSV C;  3OW2 O;  1G1J A;  1LTB C;  2QJK C;  3CCR P;  1OW6 A;  1M60 A;  1N90 A;  4YE1 A;  1JDL A;  1G2C B;  2XU6 A;  1DD3 A;  1EZV G;  2VHD A;  1F1C A;  1SQP G;  2QVA A;  1SQQ E;  3IFM A;  1L9B C;  1M70 A;  2MTA C;  3D71 A;  1FJP A;  2K9J A;  4LLH A;  3A0H V;  1FZC C;  3H1J G;  4YXW H;  3H1K E;  4UB8 E;  1SQQ K;  1I6D A;  1HH0 A;  1DIQ C;  1R5S A;  2E76 C;  4I7Z C;  4H0K A;  1FZB A;  5KJ7 C;  3B5N C;  1I54 A;  1FZA A;  1VQP P;  1H89 A;  3NBT A;  3HQ9 A;  2JTI B;  1RF0 C;  2ZAE B;  1L0L D;  1SQB E;  5GTH H;  1U75 B;  5CIH B;  2YMK A;  3F89 A;  3P8M C;  1NU1 D;  4EOT A;  1ZXG A;  3SWK A;  1KQL A;  4EI2 A;  2BH5 X;  2LR2 A;  1JO5 A;  1NTM D;  1Q2N A;  1NTK E;  5KLI C;  4EYY Q;  1B7V A;  3A0H E;  4DOJ A;  2PGD A;  1FOS F;  4OGQ B;  5CCG C;  1H0T A;  2HLO A;  3RK2 C;  1EB7 A;  1YCC A;  2Q7C A;  4K3A A;  1T3U A;  2E76 D;  2DGE A;  1L0L J;  1N86 A;  5KJ7 D;  1P84 H;  2N18 C;  2XZR A;  4XFJ A;  5AVY B;  3VMA A;  1NU1 J;  1QX8 A;  1RQU A;  5KKZ B;  1L0N E;  1LGH B;  1RE4 C;  3S4R A;  1RAP A;  1JOC A;  3IF4 A;  3EWK A;  1T3J A;  3VNW A;  1NTM J;  5KAI H;  3BAT A;  1L0N K;  1GTW A;  4BXL A;  2OQQ A;  3L70 G;  2P10 A;  3H32 A;  1CCR A;  3AEA C;  2JEE A;  1JY2 O;  3B8E B;  1YEA A;  1ZV8 A;  1LMS A;  1JB0 J;  5CIG B;  1P84 D;  1S2E A;  3RGU A;  1Y8A A;  1YTZ I;  3H1K G;  3HD7 A;  5APT A;  1GU5 A;  1AFO A;  1M8O B;  4C46 A;  3U59 A;  1YJW P;  4D6T D;  2B0Z B;  1N50 A;  3AEB C;  5H2F V;  1KYO H;  3AE8 C;  5C39 A;  1CSV A;  1SQB G;  4RKU J;  1FE6 A;  3ITK A;  1NTZ E;  2E74 B;  2C2C A;  2BCC D;  2IPP A;  4L73 A;  1QKS A;  1COT A;  5M1B A;  1NTZ K;  2FRC A;  3D0W A;  2ITA A;  2Y0D A;  2H43 A;  4PV1 B;  1LTA C;  4DY9 A;  1NTK G;  1VQ9 P;  5AVZ B;  3CP5 A;  1CED A;  3MUD C;  3NBS A;  4CPG A;  1KYO D;  2HPC A;  2M3B A;  2GM4 A;  1COR A;  1QL1 A;  2QJP B;  1N7S D;  5CYT R;  5H2F E;  2BCC J;  1L0N G;  2OYH C;  2A06 D;  1FJK A;  5BU5 A;  1CYI A;  4H44 B;  2KI7 B;  1H31 B;  1VPC A;  4AYC A;  2FFD B;  3HUS C;  3NMD A;  3OAK A;  1KV4 A;  1HH7 A;  5B5E V;  4M3L A;  1K73 Q;  3AEE C;  3TK1 A;  3L72 D;  3GHG B;  1KX2 A;  1GL2 C;  3E1I A;  4FAV A;  5TIS V;  5CMZ A;  3QWO C;  2CPS A;  2P2U A;  4ZMD A;  1USD A;  5AW2 B;  1X22 A;  1M1J B;  1CYC A;  3WFC C;  3MTU E;  3M0A A;  1DIP A;  2FYU G;  2Z5H A;  1RE3 A;  5K5G B;  1BCC D;  1NTZ G;  4HH2 A;  2R5D A;  3CXH H;  3IAO A;  3L72 J;  1FI3 A;  1AOQ A;  3RN1 A;  1H88 A;  1Z56 A;  2QJK B;  4I1L A;  1SFC B;  3VMX A;  5B5E E;  1K3G A;  1ZRT D;  5AUR A;  2H7H A;  1J3S A;  1CIG A;  2NRG A;  2FWL A;  2I8D A;  1R0Q A;  2BGV X;  4Q5P A;  1GL2 D;  1OWA A;  1IO3 A;  1IK7 A;  1W2L A;  5GTH V;  2IYO A;  1GIW A;  2VRS A;  3I56 P;  1FZC B;  1KOR A;  3SWS A;  1W2E A;  2B9B A;  1ZLL A;  3R2P A;  3H1L E;  2C1D B;  3CXH D;  3B71 A;  2HFE D;  3B5N B;  1L0L E;  3TGU D;  1S5L V;  2FXP A;  1OXZ A;  3ZOO A;  2QA4 P;  2CE1 A;  3H1I D;  1J1E B;  1GDT A;  2IYP A;  2E75 B;  2Z4E A;  5DF5 A;  1WVE C;  2N1T A;  2O3J A;  3T97 B;  3OA7 A;  3L73 D;  3Q2Y A;  2QIW A;  4TLF A;  1Q82 Q;  2LIT A;  1PPJ E;  2CA3 B;  5KLI B;  4H0J A;  5GTH E;  3HE5 A;  4LJI A;  2QM7 A;  2L4D A;  1K3H A;  5KAI V;  3SWF A;  1MG2 D;  3RK2 B;  1LWU A;  2JO1 A;  5CCH C;  3H1I J;  3CCJ P;  3PLN A;  1PFI A;  1S5L E;  1LTG C;  1L9J C;  4L76 A;  451C A;  3RK3 B;  1MKM A;  4IFM A;  2KYV A;  4UB6 V;  2WQY C;  3L73 J;  1SQV K;  2P58 A;  1GD2 E;  4KJM A;  3L75 D;  1M1J A;  1YIJ P;  3A0B H;  2AIU A;  1VQ4 P;  4LGD E;  1KQF B;  3W67 A;  5KLV D;  1RHZ B;  3CWB D;  4Z1M H;  1QLE D;  3HD7 D;  2FBW C;  1J1D B;  1ZW0 A;  5KAI E;  4D6T E;  1KX7 A;  2HG5 D;  1PGO A;  3H1L G;  1CRH A;  3PP5 A;  1AYG A;  3HQ8 A;  1CI6 B;  2QEX P;  1S6V B;  2JQR A;  2QRX A;  2FYN C;  1CHI A;  5C0Z A;  1T8Z A;  1L0L G;  1W2B O;  3L75 J;  1NU1 G;  2JDI H;  4PJ0 H;  3VMZ A;  1JCD A;  2NPS A;  4UB6 E;  2I1J A;  3V2N A;  1S1C X;  3GG2 A;  3GLM A;  1LC2 A;  1NO4 A;  1NTM G;  3CWB J;  5KLV J;  2W8Z A;  2RMZ A;  1CTJ A;  2CA4 B;  2OZ1 B;  1U74 B;  2G3A A;  2B87 A;  2K1A A;  1IRW A;  1GQ1 A;  1KYO E;  1PPJ G;  3CPW O;  1PGQ A;  1I8O A;  2SPZ A;  2YK3 A;  2JWA A;  4GYD A;  4U3F D;  1CW5 A;  3BCC D;  1DII C;  4H0L D;  2WSS H;  1HJ5 A;  5CIF B;  2AEJ A;  4H13 C;  2YKO A;  3WC8 A;  2KOG A;  1GK6 A;  5B6Q A;  3FXD A;  2OYH B;  2WPS A;  1YJN P;  1KN7 A;  2RH0 A;  1PP9 D;  3M97 X;  1BGY D;  2M5A B;  3TNU B;  1AQT A;  1CTZ A;  3CI9 A;  4JYC A;  1YJ9 P;  3G9R A;  4U3F J;  1YBK A;  3HE4 A;  2KP8 A;  1VQ6 P;  1PV3 A;  1FZG A;  3BCC J;  2ZBO A;  1IC2 A;  1EC5 A;  1IFM A;  3A3Y B;  1H9X A;  3BVH A;  1YHQ P;  4D6T G;  1R5L A;  3CX5 H;  4B86 A;  3TF5 A;  2R32 A;  1E5W A;  3ZOY A;  2OYI B;  2ZON G;  1DW3 A;  1FU1 A;  2Q9I A;  2D0W A;  3OA8 B;  1PP9 J;  4K35 A;  1BCC E;  1JY2 P;  3TDK A;  1BGY J;  3HTK B;  2WT7 A;  2V07 A;  2BCC G;  3C8V A;  3PXS A;  2JR8 A;  1OIP A;  1ZRT E;  2BEZ F;  2WMM A;  1GU4 A;  4RES B;  2WZ7 A;  2KK7 A;  4EIC A;  1CI6 A;  3CX5 D;  2YXR B;  1U7M A;  1KIL A;  4ZNC A;  2MKV A;  2HR3 A;  5AVV B;  1OMI A;  4IL6 H;  1CSB A;  1GZL A;  2CPB A;  4HJG H;  2D2C C;  1IRV A;  4WY4 C;  1M56 D;  3CXH E;  4FA5 A;  2WIT A;  2POH A;  1PGJ A;  4QMA A;  4GED B;  1SS1 A;  2A06 G;  3TGU E;  5BU8 B;  1LTJ A;  4U7J A;  1M1K Q;  4FAN A;  1LT9 A;  2QSI A;  1NWQ A;  2LKM A;  2PAJ A;  1GJQ A;  3KDP B;  2OYO A;  4C7R A;  1I8P A;  5B66 H;  4I2L C;  1W5C E;  3H25 A;  1E8E A;  4OWF A;  1E29 A;  4RSZ A;  3L72 G;  3PHL A;  1NGM B;  3SJL A;  3L70 E;  2N1T D;  1SQX D;  4O1W A;  1SVF A;  1YTC A;  2O01 N;  2J59 M;  1URQ B;  2HOD A;  2RKL A;  4N78 E;  1HWT C;  3AE2 C;  3CLQ A;  3CCE P;  1RF1 C;  2D2C D;  1A56 A;  4WY4 D;  1IFP A;  2KSJ A;  4DZO A;  5DJU B;  3TNU A;  1GK4 A;  3AEG C;  1IFJ A;  1BCC G;  1DEB A;  3A0B V;  1X79 B;  2A45 I;  5APU A;  1NKZ B;  5AW7 B;  4HB1 A;  2B10 B;  2ZJS E;  3L75 E;  1S72 P;  2R3S A;  4MN4 C;  1SQX J;  5CIB B;  1JM0 A;  1EDI A;  3CCM P;  1X8Y A;  5AW4 B;  1H33 B;  2GC4 D;  2OYI A;  2FXM A;  2Q1K A;  2ZFC A;  3OA8 A;  2KIK A;  2K88 A;  4BRY A;  1SQB K;  3M9H A;  1AQ5 A;  1S4X A;  1CRC A;  3ABV C;  1HBW A;  1IFN A;  1A8C A;  1AA0 A;  4EID A;  4PJ0 V;  1NTK K;  3M0D C;  3TGU G;  4BWN A;  3A0B E;  2AI5 A;  2YCC A;  3A5T A;  1VF5 B;  4OH8 B;  1N73 C;  2ZZS 1;  3MIW A;  2FYN B;  2ORL A;  2B12 B;  2AXC A;  5APX A;  1ZOY C;  2NPS D;  1JY3 N;  2J58 A;  2YNY A;  2C9L Y;  1LJ2 A;  3CL3 D;  3L73 G;  1CCH A;  3CCL P;  1L4A A;  1CNO A;  1PIX A;  3GF7 A;  4AAL A;  3VYI A;  4U3F E;  1LTT C;  1OW7 A;  4PJ0 E;  5KTB A;  5AVQ B;  2CE0 A;  1NKN A;  2W6B A;  3E7K A;  3RBX A;  2WPQ A;  5AVU B;  1N7S C;  3H1H J;  1RQV A;  1G2C A;  3AEC C;  2XKM A;  3M9B A;  3NXS A;  2FXO A;  3AE1 C;  2AEM A;  3V4Q A;  2LXC B;  4H13 B;  5GTI H;  3MD0 A;  1NYH A;  1URQ A;  3L75 G;  1BGY E;  1BL9 A;  1U57 A;  2KXP B;  2FYU E;  3P7K A;  4FB1 A;  4L1Q A;  2WTY A;  1KIL C;  1CO6 A;  3CWB G;  2FYU K;  1NIR A;  4WQA A;  2IX7 C;  1FDO A;  1DEE G;  1USE A;  1CSW A;  1OX3 A;  1LNQ A;  2GC7 D;  4GOE A;  1NHL A;  2IFM A;  4PD4 I;  4N6J A;  2M3E A;  1QVF O;  3DP5 A;  1DT1 A;  1MV8 A;  2C0X A;  3L74 E;  3TYI A;  1H33 A;  1OVV A;  5KAF V;  1J2J B;  2AXT H;  4JCG A;  1N9C A;  2IBZ I;  2JJL A;  1HJ3 A;  4P4Q B;  3M06 A;  1CC5 A;  1S3J A;  1FHB A;  2BAS A;  1FAV A;  2W6J H;  2B88 A;  4IL6 V;  3OJA B;  2P1J A;  3PRJ A;  1VQO P;  1X9V A;  4IFD K;  3G4S P;  2KB7 P;  3CX5 E;  1X0T A;  2Q3I A;  1JTH B;  4DJG A;  4FA1 A;  4DT0 A;  1C2R A;  1KIL D;  3M9Q A;  3CCS P;  3O5C A;  4ZKP A;  1NJI Q;  4U3F G;  4WBA A;  3BCC G;  1CIF A;  4KT0 J;  3PXT A;  2C9N Y;  3L4M A;  4AAO A;  5KAF E;  3AE4 C;  5B66 V;  4C7N B;  1FI7 A;  1VDF A;  1W5C T;  3O8Z A;  5AW1 B;  1HRO A;  3ZOX A;  2KUB A;  1YFC A;  2DW3 A;  1E2R A;  3GMA A;  3WFB C;  4AX3 A;  1SLQ A;  1KD1 Q;  4IL6 E;  1K8A Q;  1BGY G;  1I6E A;  5AVT B;  3RMZ A;  1C2N A;  1MZ9 A;  1EZV D;  2M8R A;  1HVV A;  3VYM A;  2KLU A;  1SQX E;  3D6Y A;  1KB9 D;  5APW A;  2C1U A;  1SP4 A;  1GW3 A;  2BLF B;  1EZV I;  2Q6Q A;  1K04 A;  3RL0 D;  1QN2 A;  2ZYA A;  1VYD A;  1KB9 I;  2KS1 B;  2L5G B;  5B66 E;  3L74 G;  3Q1M A;  3MZW B;  2WPV B;  1RF1 B;  2ZT9 D;  4W80 A;  1SQP J;  1VL2 A;  2E76 B;  4I7Z B;  2QG4 A;  3QH9 A;  3L71 D;  5DJQ C;  3H1J J;  1LS9 A;  1NU1 E;  2NZ2 A;  3W68 A;  2OTJ P;  1L0L K;  3U1A A;  1C52 A;  4Y28 J;  2N3B A;  1NTM E;  1NU1 K;  2H89 C;  3B4S A;  1MZ4 A;  3CME P;  4K3I A;  2KLV A;  3FWL A;  2CXB A;  1NTM K;  3HD7 C;  3FX0 A;  1UII A;  3VP9 A;  5E79 H;  2RN0 A;  1KB0 A;  1GU2 A;  1H31 A;  2BH4 X;  3ZOW A;  4UB8 H;  1JTH A;  2KNC B;  3K5B A;  2FFD A;  3L71 J;  2D0S A;  3ZCF A;  1LP1 B;  2N9J A;  4A7P A;  1DW0 A;  1IO4 A;  2JKV A;  2YIU C;  4WWI A;  3GHG A;  2M0B A;  2N18 B;  1N73 B;  5DFS A;  3AE7 C;  5CJ4 A;  2W83 C;  3O6Q B;  2L91 A;  1SQQ D;  1RY3 A;  1FZE A;  1SQX G;  3MGN A;  4I6M C;  3F5H A;  4C7N A;  1CHH A;  2IFN A;  2WSC H;  1L4A D;  1T6A A;  1P84 E;  4PWA A;  1ZR4 A;  1AKK A;  4TT3 H;  1CTY A;  3HQ6 A;  1FJ0 A;  3NFQ A;  2XNX A;  2OTL P;  2BCN B;  4JYB A;  3E1R A;  3CU4 A;  4O9B A;  2Y0C A;  4H0L C;  2P7J A;  5APS A;  1VQL P;  1SFC A;  1FBM A;  2UWJ E;  1SQQ J;  1N7S B;  3VRD A;  5L8R J;  2Y0E A;  4O1Q A;  1QL3 A;  1YEB A;  4OGQ C;  3H1K J;  1Q90 D;  2R44 A;  1L2P A;  2BCC E;  1HJ4 A;  1NOH A;  2W27 A;  3RN0 A;  2CK3 H;  1FZC A;  4WQ7 A;  2C1D A;  3L36 A;  1IFI A;  5KJ7 A;  2AEF A;  3B5N A;  5GTI E;  2OGU A;  3PXW A;  2GIW A;  3WU2 H;  4IOI H;  3AEF C;  1GW4 A;  3KZI H;  3G6E P;  4HYT B;  1CSX A;  1MFZ A;  1RF0 A;  2WSC J;  4L3G A;  2O1J A;  3WUT A;  2WSE H;  2A06 E;  2GUS A;  2QJY C;  1H32 B;  2YXQ B;  3T97 A;  3Q5S A;  1RE3 C;  2WVR A;  3L4F A;  5BVZ A;  2I8F A;  2R5B A;  2XTS B;  4OGQ D;  1BDD A;  2N9B A;  2C8S A;  2EXV A;  2J5U A;  1KIL E;  1IK9 A;  1JEK A;  1NVO A;  3I55 P;  5CCG A;  3X39 A;  3CCQ P;  3VN0 A;  1HTL C;  1QL2 A;  1ZZH A;  3L72 E;  1YIQ A;  3HUS B;  1L0N J;  2HV4 A;  3IR9 A;  1T2K D;  1AVO A;  2E42 A;  3KPE A;  4HKZ H;  2K9J B;  3NWV A;  3CC2 P;  3EFG A;  1RE4 A;  3M91 A;  2B89 A;  155C A;  1GL2 B;  4YXD C;  3Q5P A;  3LID A;  1GDV A;  3SXT A;  3HQ7 A;  4XA4 A;  2B11 B;  4N0K A;  1AVY A;  2GUV A;  1IJD B;  1CHJ A;  1K05 A;  3DR0 A;  4WQ9 A;  3SVW A;  2R3C A;  2IDB A;  2WSE J;  1ZME C;  2N1T C;  3C2C A;  3SFD C;  1S9K D;  5AVW B;  3RBZ A;  4H44 C;  1A02 J;  1NTZ J;  1AJY A;  5APV A;  3GW6 A;  1KQG B;  3A2A A;  1PZQ A;  2E74 D;  2V4H A;  1LWU C;  5AW6 B;  1HZU A;  1GMJ A;  1QGK B;  1WRG A;  2OZ1 A;  3L71 E;  4PV1 D;  2WWW A;  3OCD B;  1S5L X;  2A45 H;  3H1I E;  1KYO W;  2PFX A;  1YIC A;  5E79 V;  3BRT B;  3MUD A;  3WUU A;  2JP3 A;  2IZ0 A;  5DJQ B;  3WFE C;  3MHV A;  1KC8 Q;  1M1J C;  4NPE A;  4ZKU A;  1CZQ A;  1BE3 D;  3H32 B;  3TYY A;  3L73 E;  1FS0 E;  1VQN P;  2YMY A;  3SLE A;  1OW8 A;  2FKW B;  3JC2 2;  2O01 H;  1C7M A;  2Q5U A;  4NPD A;  4H44 D;  5TIS H;  2OYH A;  3LIE A;  1VQ8 P;  3HD7 B;  5APY A;  2H88 C;  1SFC C;  3V2P A;  3BRV B;  1YTZ T;  3ORV A;  2M5A A;  5CHX A;  1NML A;  1XTC C;  3HUS A;  2QE7 H;  1CSU A;  4YPC A;  1BE3 J;  2NPS C;  3EFF K;  5E79 E;  3AE9 C;  5AW3 B;  2YIU B;  1GL2 A;  3O0R C;  3FWN A;  1A2S A;  2P67 A;  1JY2 N;  5DJT B;  2I1K A;  1Y47 A;  4GDO A;  1CXA A; 
#chains in the Genus database with same CATH homology
 2CA3 B;  1HJ3 A;  4P4Q B;  5KLI B;  1CC5 A;  4H0J A;  2FYU D;  2MHM A;  1FHB A;  4LJI A;  2L4D A;  1CYJ A;  1NTZ D;  1NNO A;  4IL6 V;  1K3H A;  2N9I A;  3PRJ A;  5KAI V;  3H1L D;  1DW2 A;  3MK7 B;  1MG2 D;  4WQB A;  4RJT A;  1MG3 D;  4FA1 A;  4FA4 A;  1C2R A;  3PLN A;  2DVH A;  1L9J C;  451C A;  3O5C A;  2ZXY A;  4UB6 V;  1CIF A;  4AAM A;  3L74 D;  3L75 D;  1HRC A;  1YNR A;  1AOF A;  1CRI A;  2V08 A;  3PXT A;  3WFD C;  3L4M A;  3WU2 V;  1LFM A;  4AAO A;  3A9F A;  5B66 V;  2AIU A;  3H1H D;  4WQ8 A;  1FI7 A;  3WUI A;  3KZI V;  1W5C T;  1HZV A;  1PPJ D;  1HRO A;  3ZOX A;  3CXH W;  5KLV D;  1YFC A;  3CWB D;  1E2R A;  3WFB C;  1DVH A;  4AX3 A;  3O20 A;  3KHU A;  1I6E A;  2N3Y A;  3OCD A;  3RMZ A;  1GKS A;  1C2N A;  1KX7 A;  1EZV D;  4L3H A;  1I55 A;  1CRH A;  1C6O A;  3VYM A;  1AYG A;  3HQ8 A;  1S6V B;  2JQR A;  2BPB B;  1CHI A;  1KB9 D;  1SQV D;  3JBT B;  5C0Z A;  2C1U A;  4QAO A;  2BLF B;  1HCM A;  1FCD C;  4UB8 V;  1N15 A;  1QN2 A;  1VYD A;  1LC2 A;  3GG2 A;  2QJY B;  2RMZ A;  1H32 A;  1CTJ A;  2CA4 B;  2OZ1 B;  1U74 B;  4V2K A;  2Q3E A;  1KV9 A;  1IRW A;  1I5T A;  4PD4 D;  1GQ1 A;  2QG4 A;  1I8O A;  2C9X B;  3PTZ A;  1CRG A;  2YK3 A;  2JWA A;  4FA9 A;  3L71 D;  4GYD A;  5DJQ C;  1M60 A;  1N90 A;  4U3F D;  1JDL A;  1LS9 A;  4YE1 A;  3BCC D;  1DII C;  2VHD A;  1HJ5 A;  1F1C A;  5CIF B;  2IBZ D;  4J20 A;  1C52 A;  1L9B C;  1M70 A;  2N3B A;  2MTA C;  3WC8 A;  1MZ4 A;  3A0H V;  5B6Q A;  4K3I A;  3FWL A;  4AAN A;  2CXB A;  1I6D A;  1DIQ C;  1IZL 0;  1LC1 A;  4H0K A;  1PP9 D;  3M97 X;  2RN0 A;  1BGY D;  1I54 A;  1KB0 A;  1GU2 A;  3NBT A;  4WQE A;  1H31 A;  2BH4 X;  3HQ9 A;  3ZOW A;  3O1Y A;  1CTZ A;  2KNC B;  2D0S A;  4KMG A;  3ZCF A;  2JTI B;  1IQC A;  2N9J A;  1C6R A;  4A7P A;  2ZBO A;  1DW0 A;  1L0L D;  1U75 B;  5CIH B;  1H9X A;  1DVV A;  1NU1 D;  2N18 B;  5DFS A;  4Y5R A;  2BH5 X;  2L91 A;  3TF5 A;  1SQQ D;  3ZOY A;  1OCD A;  2ZON G;  1DW3 A;  1NTM D;  2D0W A;  3OA8 B;  1CHH A;  1B7V A;  2C1V A;  3TDK A;  2V07 A;  4PWA A;  3MK7 C;  1EB7 A;  1AKK A;  1YCC A;  3PXS A;  1H9Y A;  2ZOO A;  1CTY A;  3HQ6 A;  1FJ0 A;  1M6Z A;  2BCN B;  2DGE A;  1FOC A;  3CU4 A;  2Y0C A;  2N18 C;  4EIC A;  3VMA A;  3CX5 D;  5KKZ B;  1SQP D;  1RAP A;  3VNW A;  3VRD A;  2Y0E A;  2PCB B;  1IRV A;  1QL3 A;  1YEB A;  4O1Q A;  3H1J D;  4XYD B;  4FA5 A;  4EDF A;  1CCR A;  4EIE A;  1HJ4 A;  1DW1 A;  4GED B;  3RN0 A;  1YEA A;  1LMS A;  1RZ6 A;  5CIG B;  4WQ7 A;  4FAN A;  1P84 D;  2N9Y B;  2C1D A;  1NMI A;  1GJQ A;  1I8P A;  3PXW A;  2GIW A;  1RAQ A;  1CXC A;  4PW9 B;  1F1F A;  4D6T D;  1E8E A;  1E29 A;  1CSX A;  4RSZ A;  2B0Z B;  3RLM A;  1N50 A;  3PHL A;  4L3G A;  3ZIY A;  3SJL A;  5TJH A;  5H2F V;  1SQX D;  4O1W A;  1YTC A;  1CSV A;  3ITK A;  1H32 B;  2C2C A;  2LIR A;  2BCC D;  5IY5 1;  2I8F A;  1QKS A;  1COT A;  1A56 A;  1CIH A;  2FRC A;  2XTS B;  2Y0D A;  2C8S A;  2EXV A;  2YQB A;  4DY9 A;  1RZ5 A;  3CP5 A;  3A0B V;  1CED A;  3X39 A;  5CIE B;  1ZZH A;  3NBS A;  2PCC B;  3CX5 W;  1YIQ A;  3ZBM A;  1KYO D;  4WQD A;  2B10 B;  2HV4 A;  2B4Z A;  5CIB B;  1COR A;  1KIB A;  1QL4 A;  2K9J B;  1H33 B;  2GC4 D;  3NWV A;  2QJP B;  5CYT R;  3L70 D;  155C A;  3OA8 A;  2A06 D;  5CID B;  1GDV A;  1CYI A;  1CRC A;  1C6S A;  3SXT A;  3HQ7 A;  1H31 B;  2B11 B;  4N0K A;  5EXQ A;  3H1K D;  1A8C A;  1CHJ A;  4EID A;  4PJ0 V;  3DR0 A;  4WQ9 A;  3SVW A;  1HH7 A;  5B5E V;  3L4O A;  5GTI V;  2AI5 A;  5C9M A;  3L72 D;  1KX2 A;  2YCC A;  2ZZS 1;  4FAV A;  2FYN B;  3C2C A;  5TIS V;  2ORL A;  2B12 B;  1SQB D;  3DMI A;  1OAE A;  4EIF A;  3GW6 A;  1CYC A;  3WFC C;  1CCH A;  3CYT I;  1FI9 A;  2KS1 A;  1HZU A;  4XXL A;  1NTK D;  1CNO A;  1BCC D;  2OZ1 A;  4AAL A;  1WEJ F;  3OCD B;  2AXT V;  1FI3 A;  1AOQ A;  3RN1 A;  2QJK B;  2CE0 A;  1KYO W;  1YIC A;  5E79 V;  1ZRT D;  1K3G A;  4NFG B;  5AUR A;  5DJQ B;  3WFE C;  1QYZ A;  3PH2 B;  1J3S A;  1CIG A;  1BE3 D;  2FWL A;  1L0N D;  1R0Q A;  2BGV X;  4Q5P A;  1IO3 A;  1ETP A;  3SLE A;  1BL9 A;  1W2L A;  5GTH V;  1GIW A;  2PAC A;  1C7M A;  3SWS A;  1C75 A;  4FB1 A;  4L1Q A;  2C1D B;  3CXH D;  1CO6 A;  1NIR A;  4WQA A;  5CIC B;  3TGU D;  1S5L V;  3ORV A;  1CIE A;  1CSW A;  1NML A;  2GC7 D;  3ZOO A;  1CRY A;  2CE1 A;  1CSU A;  3H1I D;  1H1O A;  3DP5 A;  1DT1 A;  351C A;  4MU8 A;  3TYI A;  1H33 A;  2YIU B;  2GB8 B;  5KAF V;  5DF5 A;  1CRJ A;  1WVE C;  4JCG A;  1N9C A;  2O3J A;  3O0R C;  1A2S A;  4WQC A;  3L73 D;  2LIT A;  1CXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...