1P84D

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
246
structure length
246
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
source organism Mus musculus
molecule tags Oxidoreductase
total genus 72
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1p84D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1p84D01
4FAVA 1B7VA 1RAPA 1SQPD 1GDVA 4RJTA 3CX5D 2IBZD 3CX5W 1YCCA 1W5CT 1GIWA 4Y5RA 3TGUD 3PXSA 1HZVA 2ZOOA 5B66V 1EB7A 2QG4A 3NWVA 3SJLA 2B11B 1BE3D 1ZZHA 1S6VB 3WC8A 2C1DB 2I8FA 3VYMA 3A0HV 3NBTA 1H33B 451CA 3PHLA 1CHHA 2PCCB 2C8SA 4O1QA 2EXVA 5B5EV 1CRGA 1YEBA 4EIEA 1C52A 1QKSA 1OCDA 1AKKA 1DIQC 1QL3A 1LS9A 4O1WA 4V2KA 1CO6A 1F1CA 1J3SA 1QL4A 1C2RA 1H9YA 4AALA 1BCCD 3L72D 1HZUA 1CIHA 3SWSA 3OA8B 2L91A 1HCMA 5KLIB 351CA 1CSXA 3ITKA 2GC7D 1GQ1A 5AURA 1MG2D 1HROA 3GG2A 1KX7A 1I6DA 2OZ1A 4L3HA 1HJ4A 3SVWA 1IQCA 2O3JA 1CYCA 1MZ4A 1I8OA 2C1DA 1DIIC 2C2CA 2LITA 2AIUA 5CIFB 1H33A 1KV9A 3L4OA 3ZOYA 4L1QA 1EZVD 1NU1D 1RZ5A 2ZBOA 1C75A 3RN0A 1CIEA 2N3YA 2MTAC 3CXHD 3CXHW 4MU8A 1CHJA 2FWLA 2Y0DA 3H1LD 1YICA 1I8PA 3NBSA 1U75B 5C0ZA 1IRVA 1SQQD 1AOQA 2RMZA 3TDKA 1CNOA 2N3BA 1E29A 3OA8A 4D6TD 2CE0A 1DW1A 1FCDC 1CORA 2BLFB 3ZIYA 1YIQA 3HQ7A 2ZXYA 1CCHA 1H32B 1NNOA 1F1FA 4K3IA 3A9FA 4LJIA 1A2SA 2QJKB 3PTZA 3CWBD 3KZIV 5CIHB 1LMSA 1CXCA 3FWLA 3C2CA 1FI9A 3VMAA 1C2NA 2YIUB 1JDLA 1L9JC 2C1VA 1VYDA 2N9YB 2OZ1B 3PLNA 1CRJA 1CSUA 3HQ8A 1YEAA 1BL9A 1I6EA 1N50A 1DW3A 1RZ6A 1H9XA 1KB9D 3ZCFA 1NMLA 1GU2A 1CRIA 4P4QB 4QAOA 2ZZS1 1KX2A 1K3HA 4WQ8A 4GEDB 2ORLA 3OCDB 5KKZB 1I55A 2L4DA 2BH4X 1CHIA 4FANA 1IRWA 2BCCD 1CRYA 2A06D 1ZRTD 1C6RA 4U3FD 4FB1A 1CTJA 1H32A 3HQ9A 1CTZA 1H31B 5B6QA 3ZOWA 3ORVA 4FA1A 4H0JA 1L9BC 1CYJA 1NTKD 3GW6A 2B4ZA 1E8EA 2PCBB 2QJYB 3M97X 3WUIA 1QYZA 2AXTV 3PXWA 1DW2A 4PD4D 1I54A 4WQ7A 1YNRA 4WQ9A 1PP9D 3O1YA 1FJ0A 4AAMA 1A56A 4AANA 3DMIA 4EIDA 3L73D 3H1KD 2FYUD 2BPBB 2ZONG 4FA4A 2CXBA 1SQXD 4J20A 1U74B 5E79V 4PWAA 3OCDA 3L70D 3WU2V 2FYNB 2RN0A 3L75D 3BCCD 2Y0EA 3DP5A 1R0QA 2B10B 2N9JA 2GB8B 4Q5PA 3VRDA 1FI3A 2JQRA 4EDFA 4L3GA 3CYTI 4UB6V 3O20A 1IZL0 1LC1A 3H1JD 3ZOXA 3MK7C 2Q3EA 4WQBA 3RLMA 1HJ3A 5KAIV 2B0ZB 1N15A 2FRCA 1H31A 4H0KA 1K3GA 3O5CA 3CU4A 1RAQA 1L0LD 1CIFA 3ZOOA 1C6SA 1KYOD 1KYOW 1HH7A 2C1UA 4WQEA 3WFEC 3HQ6A 2CA3B 1KIBA 4XYDB 1DVHA 2Y0CA 5C9MA 1GJQA 1P84D 2D0SA 4GYDA 1DVVA 1A8CA 1FI7A 1NTMD 1QN2A 4UB8V 3L4MA 3H1HD 5CIDB 2K9JB 3H1ID 3RN1A 1CXAA 5TISV 2PACA 3PXTA 4EICA 3TF5A 2LIRA 5CIEB 5CYTR 1LC2A 3A0BV 3RMZA 3L74D 1L0ND 4WQCA 3CP5A 2GIWA 4AAOA 4EIFA 1SQBD 2C9XB 1M6ZA 3JBTB 1YTCA 2B12B 1S5LV 4WQDA 4A7PA 3MK7B 1CSVA 2YQBA 1KB0A 5KLVD 5IY51 3ZBMA 1NTZD 3KHUA 4NFGB 1CYIA 5CICB 3SXTA 1M60A 1CC5A 1MG3D 2DGEA 2YK3A 2N18C 2JWAA 1NMIA 2YCCA 5DF5A 1H1OA 5EXQA 4DY9A 3DR0A 1ETPA 1HRCA 3SLEA 3WFBC 1CSWA 1C7MA 4PW9B 1DT1A 1M70A 2BCNB 5GTIV 1CTYA 1WVEC 3VNWA 3TYIA 1AOFA 1CEDA 1SQVD 2N9IA 4FA9A 2QJPB 4XXLA 5DJQC 1N9CA 4FA5A 2MHMA 3PRJA 1YFCA 1CRCA 5H2FV 1N90A 5GTHV 1CIGA 1CCRA 5TJHA 1OAEA 4KMGA 2D0WA 5CIBB 2CA4B 5CIGB 1HJ5A 1FHBA 1WEJF 1COTA 1DW0A 2BGVX 2VHDA 1I5TA 2CE1A 1W2LA 1GKSA 2DVHA 4RSZA 1FOCA 2N18B 3O0RC 4N0KA 2JTIB 3WFCC 3WFDC 1C6OA 3PH2B 2BH5X 2V07A 2KNCB 2V08A 1LFMA 2XTSB 2KS1A 3X39A 3L71D 1PPJD 4PJ0V 1IO3A 1NIRA 5DFSA 2HV4A 5KAFV 4JCGA 2AI5A 4IL6V 2GC4D 5DJQB 4AX3A 4YE1A 4WQAA 1AYGA 1CRHA 155CA 1E2RA 1BGYD
chains in the Genus database with same CATH superfamily
2WSSH 2K88A 1ZP0C 1B7VA 1PP9J 4LC1A 2IBZD 5KLIC 4U3FG 1KQGB 2D2CC 2KUBA 4Y5RA 1SQBE 1EXJA 1MZ9A 2IBZI 1M56D 5B66V 3T97B 3AE1C 3AE8C 2R5DA 2NPSA 3RK3D 3WC8A 3L75J 3OW2O 2H88C 2C1DB 5B5EE 1H33B 2I8DA 1Q82Q 1KTMA 3AECC 1S1CX 1LTJB 1CHHA 2WSEH 4N78E 3CC7P 4GOEA 2C8SA 2MKVA 1YEBA 1VQLP 1UIIA 4PJ0H 1AKKA 1L0LJ 3VP9A 1KYOH 1DD3A 1GK4A 1FZEA 4GOFA 1VQ5P 1W2BO 1FBMA 2E75C 1M1KQ 3CCUP 1H9YA 4AALA 1LP1B 1NTKK 4JQ0D 3E1IA 1R8EA 3OA8B 2L91A 4IL6X 4GT1A 3GHGB 351CA 4YTPC 1EDIA 3H1HJ 2AEJA 3I5CA 1VF5C 1Q90D 1GTWA 3CD6P 2JP3A 2QJKC 3SVWA 2XNXA 1CYCA 2O01N 1SQBJ 1IFNA 2FXOA 1KV9A 2Q5UA 2N9BA 1EZVE 3RL0g 2BEZF 3L71G 5B5EH 3SSUA 4MN4C 2M5AA 1NTMG 1HGZA 1YTZI 3CXHW 3CXHE 2NZ2A 2FWLA 2QE7H 3NBSA 5C0ZA 2E74B 1IRVA 5AVQB 5KKZC 1IFIA 4H44D 1L0NG 2RMZA 3WUVA 1E29A 2OGUA 1FCDC 1LGHB 1X79B 1NNOA 4K3IA 1BCCJ 3GMAA 1BGYE 4LJIA 1DIPA 4R4MA 1CXCA 3PH0A 2YIUB 4ASVA 2OZ1B 1HUCA 1YEAA 4Y99B 1I6EA 1N50A 1DW3A 4H44B 2PRRA 1FDIA 2J58A 2B9BA 1PGPA 4P4QB 2J5UA 1U7JA 2HPCB 3U59A 1X0TA 5EFWB 3AE6C 1UIXA 4BXLA 2R3SA 2BH4X 3CXHH 5KJ7D 3P32A 2BCCD 4K35A 3TNUA 1T2KC 1SFCD 1RH5B 4YXDC 5CJ0A 2LR2A 1JY2N 1PGJA 2FBWC 3HD7A 1NH4A 2AXTE 3HE4A 1LT1A 1GL2D 2WPQA 1CYJA 1NTKD 1SQVK 1BGYJ 2YO2A 2QJYB 3WUIA 4PD4D 3CMAP 2K9JA 1RQUA 1OX3A 4WQ9A 1KILB 3O1YA 4PD4I 4JF7A 1JNMA 1NU1E 3H1KD 2FYUD 1VQ4P 5CBNA 1MFTA 2CXBA 4OH8B 3OCDA 2C9LY 2IFMA 1MUUA 4UB6E 1SLQA 4Y28J 3BCCD 2Y0EA 5KAIE 2W6AA 2B10B 3HUSA 1USDA 1FI3A 3H1JD 1LC1A 2JJLA 2O01H 4I7ZB 4WQBA 2O01J 2FRCA 4H0KA 1SQQE 3TGUG 1EQ7A 5AVZB 4YPCA 4D6TE 4WQEA 3AEEC 3WFEC 2AXTH 1BE3G 2QVAA 1BSNA 2P67A 1N7SB 5C9MA 1SS1A 3ZDMA 4GYDA 1DVVA 1M7LA 1A8CA 3EWKA 4UB8V 1SQPK 4H13D 2KZIA 3SFDC 1E5WA 3AEFC 5TISV 1OWAA 3NTNA 3L74D 4NPDA 2QSIA 3B4SA 4W7YA 3L73J 5CCHA 3MUDA 1YI2P 1M6ZA 1BCCG 1S5LV 2FFDA 2OTKE 4UB6H 3D6YA 4WQDA 1JY2P 1OVRA 5APVA 3FXDA 2CK3H 1YQ4C 3II6A 3E7KA 1QL2A 5KAIH 1KB0A 1KQFB 5IY51 3ZBMA 1NTZD 2LKMA 4U3FE 4H13B 1XTGB 1R5SA 1IFPA 2NPSC 1MG3D 1RE3A 4GKGA 2DGEA 2N18C 1SQQJ 2YCCA 5DF5A 4KJMA 4IOIH 5EXQA 3SWYA 5GTIE 1C7MA 2IX7C 3A2AA 1LT9B 5APUA 5AW9B 1DT1A 3VOPA 1CEDA 4C7NB 1SQVD 2N9IA 1NJIQ 3VMZA 1CSBA 4FA9A 2QJPB 5DJQC 1CI6A 1M8OB 1VQOP 3G6EP 3H25A 1H0TB 5GTHV 1CIGA 4H0LD 3MTUE 2WPVB 5CIBB 5AW5B 3V6IA 1VPCA 4HYTB 3RK2D 1FHBA 3RL0C 2DVHA 1BSHA 4N0KA 3B5NA 4PV1D 5KLVJ 1C6OA 3LIDA 2BH5X 2V07A 4U3FJ 1ZR2A 2KNCB 2V08A 2OYHA 3VMYA 4IL6E 5GTIH 1LWUB 1IO3A 1NIRA 1ZXGA 2HV4A 5KAFV 2AI5A 5DJTB 1NTME 2DW3A 1CRHA 155CA 4HKZH 1E2RA 4HJGH 3S4RA 4FAVA 4ZKUA 1RAPA 1SQPD 1GDVA 4RJTA 3CX5D 2A06G 1YCCA 2G8YA 3VP8A 2WT7A 1L0NE 1GIWA 1T8ZA 1GW4A 3MZWB 3PXSA 2ZOOA 5CJ4A 3A0HE 2QG4A 1FZBA 2B11B 2ZYDA 3SWKA 1S6VB 2XDJA 3MGNA 2I8FA 1T3JA 451CA 3C1LA 1VQ6P 3PHLA 1FZFA 2PCCB 1YQ3C 1D7MA 2WPRA 1PIXA 4O1QA 3BATA 3A7OA 1CRGA 5DJUB 1EC5A 4OGQD 1Y47A 2PAJA 1C52A 2IPPA 1K9MQ 1OCDA 1QL3A 2OYOA 4O1WA 1KC8Q 4IL6H 1L4AD 4V2KA 1OVUA 3L73G 4BRYB 1JMBA 1PZQA 1FS0E 3L71J 3N4XA 4DZOA 3L72D 3B71A 1HZUA 5AVTB 5AVUB 1CIHA 3JSVC 3O6QA 2GUVA 5KLIB 2O1JA 2D2CB 2KLVA 2POHA 1WRGA 1M1JA 3VN0A 2LXBA 3HD7C 2OZ1A 2E75D 2JWDA 1IQCA 4WWIA 2WTYA 2HLOA 3GF3A 1FZCA 3A0HH 1I8OA 2QM8A 1SQXK 2AIUA 5CIFB 2P2UA 3ZOYA 3M0AA 5K5GB 4B86A 3HTKB 4I1LA 5CHXA 2MTAC 3VTPC 4DCKA 2SPZA 1HJBA 2OYIA 3ABVC 2E43A 1AFOA 2Y0DA 3H1LD 1YICA 3W67A 2E75B 1HBWA 3AEBC 1AOQA 3S9OA 3TDKA 1OW6A 2HR3A 2N3BA 2V4HA 1CORA 2BLFB 3ZIYA 3HQ7A 1HGVA 1H32B 3KZIE 1VF5B 1JEKA 2QJKB 3EFGA 5KLVG 3CWBD 2XNDH 1BDDA 5KJ7A 1LMSA 1C2NA 3TGUE 2FXMA 1JDLA 2E76C 5CCGA 2OARA 1NAYA 2N9YB 1Y8AA 3HQ8A 1SFCA 2ZVNB 1NGMB 2OQQA 3BRTB 1BL9A 1BE3E 2AEFA 1IFJA 1RZ6A 1KB9D 3ZCFA 1NMLA 2WQYC 4QAOA 2C9NY 1GL2A 2KSEA 1FJKA 1KB9I 1DEBA 2KYVA 2ORLA 1IK7A 5AVYB 5KKZB 1I55A 3P8CD 4C7RA 2L4DA 2FYNC 1IRWA 1QVFO 3MUDC 1ZRTD 2FFDC 4FB1A 4XA4A 2W83C 4IFDK 2E42A 1BCCE 1N86A 2A45G 1H31B 5B6QA 4W80A 1VQPP 4JBZA 3Q2YA 1K73Q 4DJGA 1OMIA 3KZIH 4H0JA 1OFCX 1L9BC 1RQVA 1RE4A 3D6ZA 1RE3C 2NRGA 1E8EA 3M97X 1QYZA 2E74D 4WQ7A 1YNRA 2FYUK 2UWJE 3TGUJ 1PP9D 4AAMA 5E79E 1YYCA 3DMIA 4NPFX 5L8RJ 3CMEP 3WU2E 1BE3J 1PPJG 4FA4A 1SQXD 4J20A 1G2CB 1AVOA 2RN0A 3L75D 3FX0A 3WMM0 3DP5A 1R0QA 4N3YB 4Q5PA 2WVRA 3VRDA 3L4FA 2JQRA 4EDFA 2MJZA 3CYTI 1AV1A 2E5TA 1IZL0 3ZOXA 2Q3EA 3LW5H 3MK7C 5AW6B 3RLMA 2IBZG 2B0ZB 3LW5J 1K3GA 1S72P 5APYA 2B87B 1L0LD 2R3CA 1KFNA 3OA7A 1VDFA 1CIFA 1USEA 1KYOD 2W6JH 4WBAA 1JTHA 3B5NC 3P7KA 2Y0CA 2K1AA 2OYHC 1SVFA 1NTKJ 3QH9A 3A0BE 3L4MA 3EQ2A 3H1HD 4CPGA 3RK3C 1CXAA 3PXTA 2LIRA 2IZ0A 5E79H 2ZYGA 4Z1MH 1KQSO 4L76A 1K05A 3WU2H 1JY3P 2Q3IA 4WQCA 2ZXXA 1LTGC 4EIFA 1URQC 1A02J 4O9BA 1SQBD 1YIJP 2Y9ZA 2Z5HA 1YTCA 4JYBA 1NTZK 2WZ7A 2KI7B 2YQBA 1GK6A 1KILD 2A06E 3KXDA 4N78D 2KNCA 3Q3DA 3NFQA 3SXTA 3H1JJ 4AQRD 2FYZA 1MFZA 2FY8A 2KP8A 2KOGA 4EOTA 1AA0A 2ZXEB 3D70A 3WFBC 1U7MA 3Q5RA 3TYIA 4WVZA 1NAFA 3A0BH 4XXLA 2R44A 3EFFK 2H7HA 3V5BA 3H32A 3PRJA 1LTTC 2YMKA 3GF7A 3L73E 1VQ7P 2CPBA 5H2FV 1MV8A 1N90A 1CCRA 1J1DC 1N7SD 1NU1K 2AXCA 2XV5A 1M1JC 1HJ5A 1DW0A 2VHDA 1S5LX 2P58A 1GKSA 2NPSB 4RSZA 5AW7B 2N18B 3IFMA 1FZCC 3WFDC 5APTA 3PH2B 4WY4C 1DEEG 4YXWH 1FOSE 2HODB 4QMAA 5AW0B 3U1AA 3FXEA 5BVZA 3AE7C 3RL0D 4PJ0V 2OYIC 5DFSA 1NOHA 1P84E 4HH2A 1YTZT 3MP7B 2KK7A 5DJQB 2Q6QA 2LXCB 4YE1A 1HJ0A 3V2QA 1FDMA 1BGYD 1GZLA 3R4YA 1RF1A 2Q9IA 1SQVJ 2BCCG 5B66E 3CX5W 1W5CT 1DX7A 3JC22 2OTJP 3CCMP 1ZN5A 1HZVA 1L4AA 1X9VA 3CCVP 3RL0B 1U57A 3NWVA 3SJLA 2R5BA 1VQ9P 1X8YA 2GM4A 1ZZHA 5KJ7C 2K37A 4JPZB 5KLVE 1HTLC 5CCGC 4ZNCA 1NTKG 1VQKP 1SFCC 1OXZA 1LNQA 1QLED 3E1RA 1M90Q 1N73A 5B5EV 4LGDE 1Q81Q 1OIPA 4EIEA 3M06A 1KMIZ 2WPSA 1GL2C 3H1KG 2FYUG 1FU1A 1CO6A 4BWNA 4IFFA 2KXPB 1J3SA 1S9KE 3D0WA 1P84H 2XZRA 3W68A 3BCCG 3Q5SA 1IZNB 4GIFA 2GC7D 3H1JG 3GG2A 1KX7A 2M3EA 5B66H 4L3HA 1HJ4A 3T97A 2HG5D 2VRSA 1AVYA 2O3JA 1LTBC 1JY2O 1MZ4A 1RE4C 3M9QA 2C1DA 5AW2B 1DIIC 2C2CA 1H33A 1H88A 1LTJA 1NU1D 1C75A 3OJAB 1CIEA 3HD7D 2QA4P 2RH0A 1NKNA 2AEMA 4U7JA 1CHJA 1A02F 3I55P 1PGQA 1NWQA 1U75B 4IFMA 3L71E 1PPJE 1VQ8P 1LP1A 3L74G 1SQQD 3MD0A 4W7ZA 3TNUB 1CNOA 1W2EA 3AE3C 3OA8A 4H13C 2Y9YA 4D6TD 2CE0A 1DD4A 3GHGA 1IO4A 2XKMA 1JB0J 2ZXYA 1CCHA 1IFDA 1F1FA 3L72J 3M0DA 4DT0A 3HD7B 1A2SA 1NTMK 3PTZA 3HE4B 2IBZE 1NTZG 4ZKPA 5CIHB 3VMAA 1L9JC 2C1VA 1VYDA 3CX5I 3PLNA 2A45H 1L0NK 4L75A 2N1TD 3RK3E 1KZUB 1LTAC 2P7JA 2PGDA 2QJPC 3NXSA 1CRIA 1G2CA 5AW8B 2CPSA 3R2PA 4I2LC 2D2CD 2YXRB 1K3HA 4WQ8A 2ZT9C 1FZGA 2V7QJ 3A5TA 3Q1MA 1SQVG 3OCDB 3P8MC 2H89C 1T3UA 3P8CE 1NVOA 3BRVB 3RGUA 4FANA 2KB7P 1YJ9P 1CRYA 1ZRTE 3H1LJ 4U3FD 1H89A 2GUSA 2N1TB 3HQ9A 4NPEA 3ORVA 2WSCH 4FA1A 3AE5C 2WSCJ 3Q5PA 1GU5A 1OW8A 2B4ZA 2PFXA 2E76B 3WUTA 2AXTV 4H0LC 3BVHA 5BU8B 1I54A 1Q2NA 3CWBJ 3F5HA 1CZQA 4ASWA 2E5YA 3RK2C 2IYPA 5APQA 1YBKA 1VF5D 2HPCA 2BPBB 4PV1C 1WT6A 1U74B 4L74A 3CC4P 3L70D 2FYNB 3IN6A 1YJNP 2N9JA 2FFDB 2GA1A 3AE2C 3CL3D 3GLMA 1L0LK 1W5CE 4UB6V 1RF0A 1SQPG 5KAIV 1N15A 3HUSC 1KQLA 3CU4A 4ZMDA 1L2PA 2I1JA 5AVXB 3ZOOA 1C6SA 1KYOW 2WMMA 3O8ZA 1KV4A 3HQ6A 1KIBA 4UB8E 4XYDB 2KZJA 5AW3B 5AVVB 1FOSF 1GJQA 4WB4A 2IZ1A 1Y9BA 5TISE 4EI2A 1KILA 1HF9A 1NTMD 1QN2A 2XU6A 5CIDB 2YNYA 2Q7CA 3H1ID 2PACA 4EICA 1SQBK 3B5ND 1LC2A 1S5LE 1CI6B 1L0ND 1J1EC 3UIAA 3CCSP 4AAOA 1RF1C 3JBTB 2C0XA 1SQXJ 3L72G 4OGQC 4DOJA 1EXIA 2QRXA 4LLHA 3MK7B 1CW5A 1CSVA 2JKVA 5CCHC 1JY3N 2BCCE 1L4AC 3CC2P 1KILE 2HODA 3CCRP 4NFGB 2W8ZA 5CICB 1URQD 2WSEJ 5CBOA 1M60A 2YK3A 3B5NB 2JWAA 2W27A 3IF4A 1YJWP 4I6MC 1H1OA 1OVVA 1N7SA 1WMKA 3DR0A 2OYHB 1CSWA 1NTKE 2K9YA 1N73C 1ZW0A 1T2KD 4UB8H 1KORA 3CPWO 3C9IA 5C39A 3CCEP 5GTIV 1CTYA 4PD4E 1K8AQ 1WVEC 3VNWA 2YKOA 1S4XA 3RK3B 5TISH 3B8EB 1Z56A 3L70G 5GTHE 4FA5A 3H1LG 2IFNA 4M3LA 1URQB 1YFCA 1CRCA 3H1KE 2FYUE 2KIKA 1S5LH 1ZOYC 2WITA 5TJHA 3IAOA 2WT7B 2Z5IA 3VYIA 1RHZB 3BCCE 1COTA 2P1JA 2JEEA 1I5TA 2CE1A 1KFMA 1GDTA 3M9HA 3CLQA 1QL1A 3CWBG 3H1JE 2ZFCA 1FOCA 3O0RC 3WFCC 2BCCJ 2BASA 1EDKA 5AVWB 1NHLA 1LTJC 2YO3A 1JCCA 4C46A 1AQ5A 5KAFE 3RBXA 5KTBA 1LT9A 3H1IG 2RKLA 3KQGA 1KYOI 4C7NA 3HE5B 1S2EA 5APWA 1QEXA 1EDLA 1HH0A 4IL6V 1N8RQ 4WY4D 4PD4H 4WQAA 1OZHA 4N6JA 4GODA 3L36A 1LJ2A 1KN7A 1JUNA 3M91A 5GTHH 3L35A 1H0TA 3O6QB 1J1DB 3GHGC 3L74E 3AEGC 5AW4B 3TGUD 2K3RA 3H1KJ 3PJSK 2FYUJ 1M1JB 3M0DC 2QM7A 2I1KA 2JDIH 1EB7A 1PFIA 1BE3D 1Q7YQ 1M57D 3BCCJ 1FZCB 1SP4A 3VYMA 3RBZA 3A0HV 3NBTA 1X22A 1NTZE 4WY4B 1YITP 3QWOC 4R4LA 1R5LA 3L37A 1TU3F 3IR9A 2EXVA 3BASA 1QKSA 1LWUA 2M8RA 1PP9G 4XE5B 1DIQC 2OYIB 5KAFH 1LS9A 2BEQD 2H43A 2HFED 2QIWA 1HVVA 5CCGD 2OTLP 2KS1B 1F1CA 3I56P 2E74C 1SQXG 1YHQP 1QL4A 1C2RA 2H8PD 2NPSD 1EDJA 1BCCD 4XFJA 1PL5A 1MKMA 1SQVE 3L75G 2QEXP 3SWSA 2YKQA 1HCMA 1CSXA 3ITKA 1JY3O 1JMMA 1GQ1A 1G1JA 1FDOA 1NO4A 5AURA 1MG2D 3AEDC 1HROA 1I6DA 3V4QA 1LTIC 3G4SP 1G1IA 3L74J 1L0LG 3FGAD 2YIUC 2LITA 2JO1A 3L4OA 1IC2A 4L1QA 1SFCB 1EZVD 1RZ5A 1ZLLA 4Y99C 2ZBOA 3WUUA 3MIWA 4H44C 4AUWA 3RN0A 1OW7A 2WWWA 2N3YA 1NTZJ 1EZVI 4RESB 1GL2B 3CXHD 4MU8A 3CI9A 3S1KA 3H1HG 1SQQK 3N7NA 4TT3H 4EIJA 1I8PA 4BRYA 3SFEC 2C0WA 3CXHI 4OWFA 3TYYA 2N1TA 4JYCA 1RY3A 3V2PA 1JM0A 4TLFA 1SQBG 1DW1A 3CCLP 1BDCA 1YIQA 1RF0C 3A9FA 1VQMP 2IYOA 1JCDA 1SQPE 3CX5E 1PGOA 3KZIV 1ZMEC 3FWLA 3C2CA 1FI9A 3KYQA 2JR8A 2J59M 2ZVOB 4KHXA 1GU4A 2QJYC 3HRNA 3G71P 1QVGO 1FC2C 1CRJA 1CSUA 4RKUJ 2YKPA 3HTKA 2Z4EA 1H9XA 1KILC 1GU2A 3A3YB 2ZZS1 1KX2A 1NU1J 3AEAC 4GDOA 4GEDB 2FXPA 5KLVK 2YXQB 2M5AB 3TSIA 1H8AA 3C8VA 3CCQP 1CHIA 1QGKB 1KD1Q 2A06D 1C6RA 3OAKA 1CTJA 1H32A 4I7ZC 5AVSB 2ZT9D 3L72E 1CTZA 2W6BA 3G3ZA 3ZOWA 3AE4C 1XTCC 4D6TJ 3GW6A 1EZVG 1JTHB 2PCBB 3V2NA 3PXWA 1DW2A 3CX5H 1PV3A 1SQPJ 2R32A 4K3AA 1N7SC 2ZAEB 3U1CA 4L73A 3JCUE 1HWTC 1E79H 1FJ0A 1A56A 4AANA 3CCJP 3V4WA 1ZR4A 5APSA 4EIDA 3L73D 2P10A 2ZONG 2ZT9B 1LTSC 2KLUA 2KSJA 5E79V 4PWAA 2IDBA 5AW1B 3WU2V 3L70E 1AQTA 1NYHA 2GB8B 3H1LE 1JOCA 3H6PA 1BGYG 2PP6A 2ZYAA 1IFMA 3TK1A 4L3GA 3O20A 1NKZB 3KDPB 3MHVA 1HJ3A 1H31A 3O5CA 3PP5A 1T6AA 1RAQA 1K04A 1QX8A 1HH7A 2C1UA 1S3JA 2CA3B 4H0LB 1DVHA 3CWBE 1P84D 2D0SA 3RK2B 1FI7A 1LT9C 3LIEA 3SWFA 1FZAA 2K9JB 3JCUH 1P84I 1URQA 3KPEA 3RN1A 3H1IE 3TF5A 4PV1B 2HYNA 3VMXA 1KB9E 2WSFH 5CIEB 5CYTR 3A0BV 3RMZA 1GD2E 2WSFJ 3H32B 3CP5A 2GIWA 2C9XB 2V7QH 1JO5A 2E76D 5AVRB 2B12B 4A7PA 5APXA 3L70J 1ZV8A 5KLVD 4AYCA 3HUSB 2B87A 3NMDA 3KHUA 2L5GB 4EYYQ 1CYIA 1GMJA 1CC5A 2B88A 4OVNF 1FJPA 1NMIA 4DY9A 1ETPA 1HRCA 1N7LA 1IJDB 3HE5A 5BU5A 5CCHD 3SLEA 1IK9A 1NU1G 1N2DC 4PW9B 1VQNP 3AE9C 1S9KD 1M70A 2BCNB 1LWUC 1AOFA 2FKWB 5H2FE 3USSA 5M1BA 5CMZA 1NTMJ 1N9CA 1PP9E 2MHMA 1J1EB 2B89A 2Q1KA 3H1IJ 1KB9H 1RF1B 1GW3A 2O1KA 4OGQB 1SQXE 2YMYA 1SQQG 1OAEA 4KMGA 2D0WA 1L0NJ 3L75E 4KT0J 4D6TG 3M9BA 3FWNA 2CA4B 1L4AB 5CIGB 4RO0A 1WEJF 2BGVX 3F89A 4WY4A 2A45I 1W2LA 2M0BA 2JTIB 2ITAA 1FAVA 1L0LE 1LFMA 4PJ0E 2XTSB 1Q86Q 3G9RA 1KYOE 1N73B 3D71A 2KS1A 3X39A 1DH3A 2G3AA 3L71D 1J2JB 1PPJD 4JCGA 1FE6A 2ZJSE 3K5BA 4HB1A 2GC4D 1AJYA 1VL2A 4AX3A 2W90A 3V2RA 1AYGA 3H1HE 2N1TC 2M3BA 5H2FH
chains in the Genus database with same CATH topology
4FAVA 1B7VA 1RAPA 1SQPD 1GDVA 4RJTA 3CX5D 2IBZD 3CX5W 1YCCA 1W5CT 1GIWA 4Y5RA 3TGUD 3PXSA 1HZVA 2ZOOA 5B66V 1EB7A 2QG4A 3NWVA 3SJLA 2B11B 1BE3D 1ZZHA 1S6VB 3WC8A 2C1DB 2I8FA 3VYMA 3A0HV 3NBTA 1H33B 451CA 3PHLA 1CHHA 2PCCB 2C8SA 4O1QA 2EXVA 5B5EV 1CRGA 1YEBA 4EIEA 1C52A 1QKSA 1OCDA 1AKKA 1DIQC 1QL3A 1LS9A 4O1WA 4V2KA 1CO6A 1F1CA 1J3SA 1QL4A 1C2RA 1H9YA 4AALA 1BCCD 3L72D 1HZUA 1CIHA 3SWSA 3OA8B 2L91A 1HCMA 5KLIB 351CA 1CSXA 3ITKA 2GC7D 1GQ1A 5AURA 1MG2D 1HROA 3GG2A 1KX7A 1I6DA 2OZ1A 4L3HA 1HJ4A 3SVWA 1IQCA 2O3JA 1CYCA 1MZ4A 1I8OA 2C1DA 1DIIC 2C2CA 2LITA 2AIUA 5CIFB 1H33A 1KV9A 3L4OA 3ZOYA 4L1QA 1EZVD 1NU1D 1RZ5A 2ZBOA 1C75A 3RN0A 1CIEA 2N3YA 2MTAC 3CXHD 3CXHW 4MU8A 1CHJA 2FWLA 2Y0DA 3H1LD 1YICA 1I8PA 3NBSA 1U75B 5C0ZA 1IRVA 1SQQD 1AOQA 2RMZA 3TDKA 1CNOA 2N3BA 1E29A 3OA8A 4D6TD 2CE0A 1DW1A 1FCDC 1CORA 2BLFB 3ZIYA 1YIQA 3HQ7A 2ZXYA 1CCHA 1H32B 1NNOA 1F1FA 4K3IA 3A9FA 4LJIA 1A2SA 2QJKB 3PTZA 3CWBD 3KZIV 5CIHB 1LMSA 1CXCA 3FWLA 3C2CA 1FI9A 3VMAA 1C2NA 2YIUB 1JDLA 1L9JC 2C1VA 1VYDA 2N9YB 2OZ1B 3PLNA 1CRJA 1CSUA 3HQ8A 1YEAA 1BL9A 1I6EA 1N50A 1DW3A 1RZ6A 1H9XA 1KB9D 3ZCFA 1NMLA 1GU2A 1CRIA 4P4QB 4QAOA 2ZZS1 1KX2A 1K3HA 4WQ8A 4GEDB 2ORLA 3OCDB 5KKZB 1I55A 2L4DA 2BH4X 1CHIA 4FANA 1IRWA 2BCCD 1CRYA 2A06D 1ZRTD 1C6RA 4U3FD 4FB1A 1CTJA 1H32A 3HQ9A 1CTZA 1H31B 5B6QA 3ZOWA 3ORVA 4FA1A 4H0JA 1L9BC 1CYJA 1NTKD 3GW6A 2B4ZA 1E8EA 2PCBB 2QJYB 3M97X 3WUIA 1QYZA 2AXTV 3PXWA 1DW2A 4PD4D 1I54A 4WQ7A 1YNRA 4WQ9A 1PP9D 3O1YA 1FJ0A 4AAMA 1A56A 4AANA 3DMIA 4EIDA 3L73D 3H1KD 2FYUD 2BPBB 2ZONG 4FA4A 2CXBA 1SQXD 4J20A 1U74B 5E79V 4PWAA 3OCDA 3L70D 3WU2V 2FYNB 2RN0A 3L75D 3BCCD 2Y0EA 3DP5A 1R0QA 2B10B 2N9JA 2GB8B 4Q5PA 3VRDA 1FI3A 2JQRA 4EDFA 4L3GA 3CYTI 4UB6V 3O20A 1IZL0 1LC1A 3H1JD 3ZOXA 3MK7C 2Q3EA 4WQBA 3RLMA 1HJ3A 5KAIV 2B0ZB 1N15A 2FRCA 1H31A 4H0KA 1K3GA 3O5CA 3CU4A 1RAQA 1L0LD 1CIFA 3ZOOA 1C6SA 1KYOD 1KYOW 1HH7A 2C1UA 4WQEA 3WFEC 3HQ6A 2CA3B 1KIBA 4XYDB 1DVHA 2Y0CA 5C9MA 1GJQA 1P84D 2D0SA 4GYDA 1DVVA 1A8CA 1FI7A 1NTMD 1QN2A 4UB8V 3L4MA 3H1HD 5CIDB 2K9JB 3H1ID 3RN1A 1CXAA 5TISV 2PACA 3PXTA 4EICA 3TF5A 2LIRA 5CIEB 5CYTR 1LC2A 3A0BV 3RMZA 3L74D 1L0ND 4WQCA 3CP5A 2GIWA 4AAOA 4EIFA 1SQBD 2C9XB 1M6ZA 3JBTB 1YTCA 2B12B 1S5LV 4WQDA 4A7PA 3MK7B 1CSVA 2YQBA 1KB0A 5KLVD 5IY51 3ZBMA 1NTZD 3KHUA 4NFGB 1CYIA 5CICB 3SXTA 1M60A 1CC5A 1MG3D 2DGEA 2YK3A 2N18C 2JWAA 1NMIA 2YCCA 5DF5A 1H1OA 5EXQA 4DY9A 3DR0A 1ETPA 1HRCA 3SLEA 3WFBC 1CSWA 1C7MA 4PW9B 1DT1A 1M70A 2BCNB 5GTIV 1CTYA 1WVEC 3VNWA 3TYIA 1AOFA 1CEDA 1SQVD 2N9IA 4FA9A 2QJPB 4XXLA 5DJQC 1N9CA 4FA5A 2MHMA 3PRJA 1YFCA 1CRCA 5H2FV 1N90A 5GTHV 1CIGA 1CCRA 5TJHA 1OAEA 4KMGA 2D0WA 5CIBB 2CA4B 5CIGB 1HJ5A 1FHBA 1WEJF 1COTA 1DW0A 2BGVX 2VHDA 1I5TA 2CE1A 1W2LA 1GKSA 2DVHA 4RSZA 1FOCA 2N18B 3O0RC 4N0KA 2JTIB 3WFCC 3WFDC 1C6OA 3PH2B 2BH5X 2V07A 2KNCB 2V08A 1LFMA 2XTSB 2KS1A 3X39A 3L71D 1PPJD 4PJ0V 1IO3A 1NIRA 5DFSA 2HV4A 5KAFV 4JCGA 2AI5A 4IL6V 2GC4D 5DJQB 4AX3A 4YE1A 4WQAA 1AYGA 1CRHA 155CA 1E2RA 1BGYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAV A;  1B7V A;  1RAP A;  1SQP D;  1GDV A;  4RJT A;  3CX5 D;  2IBZ D;  3CX5 W;  1YCC A;  1W5C T;  1GIW A;  4Y5R A;  3TGU D;  3PXS A;  1HZV A;  2ZOO A;  5B66 V;  1EB7 A;  2QG4 A;  3NWV A;  3SJL A;  2B11 B;  1BE3 D;  1ZZH A;  1S6V B;  3WC8 A;  2C1D B;  2I8F A;  3VYM A;  3A0H V;  3NBT A;  1H33 B;  451C A;  3PHL A;  1CHH A;  2PCC B;  2C8S A;  4O1Q A;  2EXV A;  5B5E V;  1CRG A;  1YEB A;  4EIE A;  1C52 A;  1QKS A;  1OCD A;  1AKK A;  1DIQ C;  1QL3 A;  1LS9 A;  4O1W A;  4V2K A;  1CO6 A;  1F1C A;  1J3S A;  1QL4 A;  1C2R A;  1H9Y A;  4AAL A;  1BCC D;  3L72 D;  1HZU A;  1CIH A;  3SWS A;  3OA8 B;  2L91 A;  1HCM A;  5KLI B;  351C A;  1CSX A;  3ITK A;  2GC7 D;  1GQ1 A;  5AUR A;  1MG2 D;  1HRO A;  3GG2 A;  1KX7 A;  1I6D A;  2OZ1 A;  4L3H A;  1HJ4 A;  3SVW A;  1IQC A;  2O3J A;  1CYC A;  1MZ4 A;  1I8O A;  2C1D A;  1DII C;  2C2C A;  2LIT A;  2AIU A;  5CIF B;  1H33 A;  1KV9 A;  3L4O A;  3ZOY A;  4L1Q A;  1EZV D;  1NU1 D;  1RZ5 A;  2ZBO A;  1C75 A;  3RN0 A;  1CIE A;  2N3Y A;  2MTA C;  3CXH D;  3CXH W;  4MU8 A;  1CHJ A;  2FWL A;  2Y0D A;  3H1L D;  1YIC A;  1I8P A;  3NBS A;  1U75 B;  5C0Z A;  1IRV A;  1SQQ D;  1AOQ A;  2RMZ A;  3TDK A;  1CNO A;  2N3B A;  1E29 A;  3OA8 A;  4D6T D;  2CE0 A;  1DW1 A;  1FCD C;  1COR A;  2BLF B;  3ZIY A;  1YIQ A;  3HQ7 A;  2ZXY A;  1CCH A;  1H32 B;  1NNO A;  1F1F A;  4K3I A;  3A9F A;  4LJI A;  1A2S A;  2QJK B;  3PTZ A;  3CWB D;  3KZI V;  5CIH B;  1LMS A;  1CXC A;  3FWL A;  3C2C A;  1FI9 A;  3VMA A;  1C2N A;  2YIU B;  1JDL A;  1L9J C;  2C1V A;  1VYD A;  2N9Y B;  2OZ1 B;  3PLN A;  1CRJ A;  1CSU A;  3HQ8 A;  1YEA A;  1BL9 A;  1I6E A;  1N50 A;  1DW3 A;  1RZ6 A;  1H9X A;  1KB9 D;  3ZCF A;  1NML A;  1GU2 A;  1CRI A;  4P4Q B;  4QAO A;  2ZZS 1;  1KX2 A;  1K3H A;  4WQ8 A;  4GED B;  2ORL A;  3OCD B;  5KKZ B;  1I55 A;  2L4D A;  2BH4 X;  1CHI A;  4FAN A;  1IRW A;  2BCC D;  1CRY A;  2A06 D;  1ZRT D;  1C6R A;  4U3F D;  4FB1 A;  1CTJ A;  1H32 A;  3HQ9 A;  1CTZ A;  1H31 B;  5B6Q A;  3ZOW A;  3ORV A;  4FA1 A;  4H0J A;  1L9B C;  1CYJ A;  1NTK D;  3GW6 A;  2B4Z A;  1E8E A;  2PCB B;  2QJY B;  3M97 X;  3WUI A;  1QYZ A;  2AXT V;  3PXW A;  1DW2 A;  4PD4 D;  1I54 A;  4WQ7 A;  1YNR A;  4WQ9 A;  1PP9 D;  3O1Y A;  1FJ0 A;  4AAM A;  1A56 A;  4AAN A;  3DMI A;  4EID A;  3L73 D;  3H1K D;  2FYU D;  2BPB B;  2ZON G;  4FA4 A;  2CXB A;  1SQX D;  4J20 A;  1U74 B;  5E79 V;  4PWA A;  3OCD A;  3L70 D;  3WU2 V;  2FYN B;  2RN0 A;  3L75 D;  3BCC D;  2Y0E A;  3DP5 A;  1R0Q A;  2B10 B;  2N9J A;  2GB8 B;  4Q5P A;  3VRD A;  1FI3 A;  2JQR A;  4EDF A;  4L3G A;  3CYT I;  4UB6 V;  3O20 A;  1IZL 0;  1LC1 A;  3H1J D;  3ZOX A;  3MK7 C;  2Q3E A;  4WQB A;  3RLM A;  1HJ3 A;  5KAI V;  2B0Z B;  1N15 A;  2FRC A;  1H31 A;  4H0K A;  1K3G A;  3O5C A;  3CU4 A;  1RAQ A;  1L0L D;  1CIF A;  3ZOO A;  1C6S A;  1KYO D;  1KYO W;  1HH7 A;  2C1U A;  4WQE A;  3WFE C;  3HQ6 A;  2CA3 B;  1KIB A;  4XYD B;  1DVH A;  2Y0C A;  5C9M A;  1GJQ A;  1P84 D;  2D0S A;  4GYD A;  1DVV A;  1A8C A;  1FI7 A;  1NTM D;  1QN2 A;  4UB8 V;  3L4M A;  3H1H D;  5CID B;  2K9J B;  3H1I D;  3RN1 A;  1CXA A;  5TIS V;  2PAC A;  3PXT A;  4EIC A;  3TF5 A;  2LIR A;  5CIE B;  5CYT R;  1LC2 A;  3A0B V;  3RMZ A;  3L74 D;  1L0N D;  4WQC A;  3CP5 A;  2GIW A;  4AAO A;  4EIF A;  1SQB D;  2C9X B;  1M6Z A;  3JBT B;  1YTC A;  2B12 B;  1S5L V;  4WQD A;  4A7P A;  3MK7 B;  1CSV A;  2YQB A;  1KB0 A;  5KLV D;  5IY5 1;  3ZBM A;  1NTZ D;  3KHU A;  4NFG B;  1CYI A;  5CIC B;  3SXT A;  1M60 A;  1CC5 A;  1MG3 D;  2DGE A;  2YK3 A;  2N18 C;  2JWA A;  1NMI A;  2YCC A;  5DF5 A;  1H1O A;  5EXQ A;  4DY9 A;  3DR0 A;  1ETP A;  1HRC A;  3SLE A;  3WFB C;  1CSW A;  1C7M A;  4PW9 B;  1DT1 A;  1M70 A;  2BCN B;  5GTI V;  1CTY A;  1WVE C;  3VNW A;  3TYI A;  1AOF A;  1CED A;  1SQV D;  2N9I A;  4FA9 A;  2QJP B;  4XXL A;  5DJQ C;  1N9C A;  4FA5 A;  2MHM A;  3PRJ A;  1YFC A;  1CRC A;  5H2F V;  1N90 A;  5GTH V;  1CIG A;  1CCR A;  5TJH A;  1OAE A;  4KMG A;  2D0W A;  5CIB B;  2CA4 B;  5CIG B;  1HJ5 A;  1FHB A;  1WEJ F;  1COT A;  1DW0 A;  2BGV X;  2VHD A;  1I5T A;  2CE1 A;  1W2L A;  1GKS A;  2DVH A;  4RSZ A;  1FOC A;  2N18 B;  3O0R C;  4N0K A;  2JTI B;  3WFC C;  3WFD C;  1C6O A;  3PH2 B;  2BH5 X;  2V07 A;  2KNC B;  2V08 A;  1LFM A;  2XTS B;  2KS1 A;  3X39 A;  3L71 D;  1PPJ D;  4PJ0 V;  1IO3 A;  1NIR A;  5DFS A;  2HV4 A;  5KAF V;  4JCG A;  2AI5 A;  4IL6 V;  2GC4 D;  5DJQ B;  4AX3 A;  4YE1 A;  4WQA A;  1AYG A;  1CRH A;  155C A;  1E2R A;  1BGY D; 
#chains in the Genus database with same CATH topology
 2WSS H;  2K88 A;  1ZP0 C;  1B7V A;  1PP9 J;  4LC1 A;  2IBZ D;  5KLI C;  4U3F G;  1KQG B;  2D2C C;  2KUB A;  4Y5R A;  1SQB E;  1EXJ A;  1MZ9 A;  2IBZ I;  1M56 D;  5B66 V;  3T97 B;  3AE1 C;  3AE8 C;  2R5D A;  2NPS A;  3RK3 D;  3WC8 A;  3L75 J;  3OW2 O;  2H88 C;  2C1D B;  5B5E E;  1H33 B;  2I8D A;  1Q82 Q;  1KTM A;  3AEC C;  1S1C X;  1LTJ B;  1CHH A;  2WSE H;  4N78 E;  3CC7 P;  4GOE A;  2C8S A;  2MKV A;  1YEB A;  1VQL P;  1UII A;  4PJ0 H;  1AKK A;  1L0L J;  3VP9 A;  1KYO H;  1DD3 A;  1GK4 A;  1FZE A;  4GOF A;  1VQ5 P;  1W2B O;  1FBM A;  2E75 C;  1M1K Q;  3CCU P;  1H9Y A;  4AAL A;  1LP1 B;  1NTK K;  4JQ0 D;  3E1I A;  1R8E A;  3OA8 B;  2L91 A;  4IL6 X;  4GT1 A;  3GHG B;  351C A;  4YTP C;  1EDI A;  3H1H J;  2AEJ A;  3I5C A;  1VF5 C;  1Q90 D;  1GTW A;  3CD6 P;  2JP3 A;  2QJK C;  3SVW A;  2XNX A;  1CYC A;  2O01 N;  1SQB J;  1IFN A;  2FXO A;  1KV9 A;  2Q5U A;  2N9B A;  1EZV E;  3RL0 g;  2BEZ F;  3L71 G;  5B5E H;  3SSU A;  4MN4 C;  2M5A A;  1NTM G;  1HGZ A;  1YTZ I;  3CXH W;  3CXH E;  2NZ2 A;  2FWL A;  2QE7 H;  3NBS A;  5C0Z A;  2E74 B;  1IRV A;  5AVQ B;  5KKZ C;  1IFI A;  4H44 D;  1L0N G;  2RMZ A;  3WUV A;  1E29 A;  2OGU A;  1FCD C;  1LGH B;  1X79 B;  1NNO A;  4K3I A;  1BCC J;  3GMA A;  1BGY E;  4LJI A;  1DIP A;  4R4M A;  1CXC A;  3PH0 A;  2YIU B;  4ASV A;  2OZ1 B;  1HUC A;  1YEA A;  4Y99 B;  1I6E A;  1N50 A;  1DW3 A;  4H44 B;  2PRR A;  1FDI A;  2J58 A;  2B9B A;  1PGP A;  4P4Q B;  2J5U A;  1U7J A;  2HPC B;  3U59 A;  1X0T A;  5EFW B;  3AE6 C;  1UIX A;  4BXL A;  2R3S A;  2BH4 X;  3CXH H;  5KJ7 D;  3P32 A;  2BCC D;  4K35 A;  3TNU A;  1T2K C;  1SFC D;  1RH5 B;  4YXD C;  5CJ0 A;  2LR2 A;  1JY2 N;  1PGJ A;  2FBW C;  3HD7 A;  1NH4 A;  2AXT E;  3HE4 A;  1LT1 A;  1GL2 D;  2WPQ A;  1CYJ A;  1NTK D;  1SQV K;  1BGY J;  2YO2 A;  2QJY B;  3WUI A;  4PD4 D;  3CMA P;  2K9J A;  1RQU A;  1OX3 A;  4WQ9 A;  1KIL B;  3O1Y A;  4PD4 I;  4JF7 A;  1JNM A;  1NU1 E;  3H1K D;  2FYU D;  1VQ4 P;  5CBN A;  1MFT A;  2CXB A;  4OH8 B;  3OCD A;  2C9L Y;  2IFM A;  1MUU A;  4UB6 E;  1SLQ A;  4Y28 J;  3BCC D;  2Y0E A;  5KAI E;  2W6A A;  2B10 B;  3HUS A;  1USD A;  1FI3 A;  3H1J D;  1LC1 A;  2JJL A;  2O01 H;  4I7Z B;  4WQB A;  2O01 J;  2FRC A;  4H0K A;  1SQQ E;  3TGU G;  1EQ7 A;  5AVZ B;  4YPC A;  4D6T E;  4WQE A;  3AEE C;  3WFE C;  2AXT H;  1BE3 G;  2QVA A;  1BSN A;  2P67 A;  1N7S B;  5C9M A;  1SS1 A;  3ZDM A;  4GYD A;  1DVV A;  1M7L A;  1A8C A;  3EWK A;  4UB8 V;  1SQP K;  4H13 D;  2KZI A;  3SFD C;  1E5W A;  3AEF C;  5TIS V;  1OWA A;  3NTN A;  3L74 D;  4NPD A;  2QSI A;  3B4S A;  4W7Y A;  3L73 J;  5CCH A;  3MUD A;  1YI2 P;  1M6Z A;  1BCC G;  1S5L V;  2FFD A;  2OTK E;  4UB6 H;  3D6Y A;  4WQD A;  1JY2 P;  1OVR A;  5APV A;  3FXD A;  2CK3 H;  1YQ4 C;  3II6 A;  3E7K A;  1QL2 A;  5KAI H;  1KB0 A;  1KQF B;  5IY5 1;  3ZBM A;  1NTZ D;  2LKM A;  4U3F E;  4H13 B;  1XTG B;  1R5S A;  1IFP A;  2NPS C;  1MG3 D;  1RE3 A;  4GKG A;  2DGE A;  2N18 C;  1SQQ J;  2YCC A;  5DF5 A;  4KJM A;  4IOI H;  5EXQ A;  3SWY A;  5GTI E;  1C7M A;  2IX7 C;  3A2A A;  1LT9 B;  5APU A;  5AW9 B;  1DT1 A;  3VOP A;  1CED A;  4C7N B;  1SQV D;  2N9I A;  1NJI Q;  3VMZ A;  1CSB A;  4FA9 A;  2QJP B;  5DJQ C;  1CI6 A;  1M8O B;  1VQO P;  3G6E P;  3H25 A;  1H0T B;  5GTH V;  1CIG A;  4H0L D;  3MTU E;  2WPV B;  5CIB B;  5AW5 B;  3V6I A;  1VPC A;  4HYT B;  3RK2 D;  1FHB A;  3RL0 C;  2DVH A;  1BSH A;  4N0K A;  3B5N A;  4PV1 D;  5KLV J;  1C6O A;  3LID A;  2BH5 X;  2V07 A;  4U3F J;  1ZR2 A;  2KNC B;  2V08 A;  2OYH A;  3VMY A;  4IL6 E;  5GTI H;  1LWU B;  1IO3 A;  1NIR A;  1ZXG A;  2HV4 A;  5KAF V;  2AI5 A;  5DJT B;  1NTM E;  2DW3 A;  1CRH A;  155C A;  4HKZ H;  1E2R A;  4HJG H;  3S4R A;  4FAV A;  4ZKU A;  1RAP A;  1SQP D;  1GDV A;  4RJT A;  3CX5 D;  2A06 G;  1YCC A;  2G8Y A;  3VP8 A;  2WT7 A;  1L0N E;  1GIW A;  1T8Z A;  1GW4 A;  3MZW B;  3PXS A;  2ZOO A;  5CJ4 A;  3A0H E;  2QG4 A;  1FZB A;  2B11 B;  2ZYD A;  3SWK A;  1S6V B;  2XDJ A;  3MGN A;  2I8F A;  1T3J A;  451C A;  3C1L A;  1VQ6 P;  3PHL A;  1FZF A;  2PCC B;  1YQ3 C;  1D7M A;  2WPR A;  1PIX A;  4O1Q A;  3BAT A;  3A7O A;  1CRG A;  5DJU B;  1EC5 A;  4OGQ D;  1Y47 A;  2PAJ A;  1C52 A;  2IPP A;  1K9M Q;  1OCD A;  1QL3 A;  2OYO A;  4O1W A;  1KC8 Q;  4IL6 H;  1L4A D;  4V2K A;  1OVU A;  3L73 G;  4BRY B;  1JMB A;  1PZQ A;  1FS0 E;  3L71 J;  3N4X A;  4DZO A;  3L72 D;  3B71 A;  1HZU A;  5AVT B;  5AVU B;  1CIH A;  3JSV C;  3O6Q A;  2GUV A;  5KLI B;  2O1J A;  2D2C B;  2KLV A;  2POH A;  1WRG A;  1M1J A;  3VN0 A;  2LXB A;  3HD7 C;  2OZ1 A;  2E75 D;  2JWD A;  1IQC A;  4WWI A;  2WTY A;  2HLO A;  3GF3 A;  1FZC A;  3A0H H;  1I8O A;  2QM8 A;  1SQX K;  2AIU A;  5CIF B;  2P2U A;  3ZOY A;  3M0A A;  5K5G B;  4B86 A;  3HTK B;  4I1L A;  5CHX A;  2MTA C;  3VTP C;  4DCK A;  2SPZ A;  1HJB A;  2OYI A;  3ABV C;  2E43 A;  1AFO A;  2Y0D A;  3H1L D;  1YIC A;  3W67 A;  2E75 B;  1HBW A;  3AEB C;  1AOQ A;  3S9O A;  3TDK A;  1OW6 A;  2HR3 A;  2N3B A;  2V4H A;  1COR A;  2BLF B;  3ZIY A;  3HQ7 A;  1HGV A;  1H32 B;  3KZI E;  1VF5 B;  1JEK A;  2QJK B;  3EFG A;  5KLV G;  3CWB D;  2XND H;  1BDD A;  5KJ7 A;  1LMS A;  1C2N A;  3TGU E;  2FXM A;  1JDL A;  2E76 C;  5CCG A;  2OAR A;  1NAY A;  2N9Y B;  1Y8A A;  3HQ8 A;  1SFC A;  2ZVN B;  1NGM B;  2OQQ A;  3BRT B;  1BL9 A;  1BE3 E;  2AEF A;  1IFJ A;  1RZ6 A;  1KB9 D;  3ZCF A;  1NML A;  2WQY C;  4QAO A;  2C9N Y;  1GL2 A;  2KSE A;  1FJK A;  1KB9 I;  1DEB A;  2KYV A;  2ORL A;  1IK7 A;  5AVY B;  5KKZ B;  1I55 A;  3P8C D;  4C7R A;  2L4D A;  2FYN C;  1IRW A;  1QVF O;  3MUD C;  1ZRT D;  2FFD C;  4FB1 A;  4XA4 A;  2W83 C;  4IFD K;  2E42 A;  1BCC E;  1N86 A;  2A45 G;  1H31 B;  5B6Q A;  4W80 A;  1VQP P;  4JBZ A;  3Q2Y A;  1K73 Q;  4DJG A;  1OMI A;  3KZI H;  4H0J A;  1OFC X;  1L9B C;  1RQV A;  1RE4 A;  3D6Z A;  1RE3 C;  2NRG A;  1E8E A;  3M97 X;  1QYZ A;  2E74 D;  4WQ7 A;  1YNR A;  2FYU K;  2UWJ E;  3TGU J;  1PP9 D;  4AAM A;  5E79 E;  1YYC A;  3DMI A;  4NPF X;  5L8R J;  3CME P;  3WU2 E;  1BE3 J;  1PPJ G;  4FA4 A;  1SQX D;  4J20 A;  1G2C B;  1AVO A;  2RN0 A;  3L75 D;  3FX0 A;  3WMM 0;  3DP5 A;  1R0Q A;  4N3Y B;  4Q5P A;  2WVR A;  3VRD A;  3L4F A;  2JQR A;  4EDF A;  2MJZ A;  3CYT I;  1AV1 A;  2E5T A;  1IZL 0;  3ZOX A;  2Q3E A;  3LW5 H;  3MK7 C;  5AW6 B;  3RLM A;  2IBZ G;  2B0Z B;  3LW5 J;  1K3G A;  1S72 P;  5APY A;  2B87 B;  1L0L D;  2R3C A;  1KFN A;  3OA7 A;  1VDF A;  1CIF A;  1USE A;  1KYO D;  2W6J H;  4WBA A;  1JTH A;  3B5N C;  3P7K A;  2Y0C A;  2K1A A;  2OYH C;  1SVF A;  1NTK J;  3QH9 A;  3A0B E;  3L4M A;  3EQ2 A;  3H1H D;  4CPG A;  3RK3 C;  1CXA A;  3PXT A;  2LIR A;  2IZ0 A;  5E79 H;  2ZYG A;  4Z1M H;  1KQS O;  4L76 A;  1K05 A;  3WU2 H;  1JY3 P;  2Q3I A;  4WQC A;  2ZXX A;  1LTG C;  4EIF A;  1URQ C;  1A02 J;  4O9B A;  1SQB D;  1YIJ P;  2Y9Z A;  2Z5H A;  1YTC A;  4JYB A;  1NTZ K;  2WZ7 A;  2KI7 B;  2YQB A;  1GK6 A;  1KIL D;  2A06 E;  3KXD A;  4N78 D;  2KNC A;  3Q3D A;  3NFQ A;  3SXT A;  3H1J J;  4AQR D;  2FYZ A;  1MFZ A;  2FY8 A;  2KP8 A;  2KOG A;  4EOT A;  1AA0 A;  2ZXE B;  3D70 A;  3WFB C;  1U7M A;  3Q5R A;  3TYI A;  4WVZ A;  1NAF A;  3A0B H;  4XXL A;  2R44 A;  3EFF K;  2H7H A;  3V5B A;  3H32 A;  3PRJ A;  1LTT C;  2YMK A;  3GF7 A;  3L73 E;  1VQ7 P;  2CPB A;  5H2F V;  1MV8 A;  1N90 A;  1CCR A;  1J1D C;  1N7S D;  1NU1 K;  2AXC A;  2XV5 A;  1M1J C;  1HJ5 A;  1DW0 A;  2VHD A;  1S5L X;  2P58 A;  1GKS A;  2NPS B;  4RSZ A;  5AW7 B;  2N18 B;  3IFM A;  1FZC C;  3WFD C;  5APT A;  3PH2 B;  4WY4 C;  1DEE G;  4YXW H;  1FOS E;  2HOD B;  4QMA A;  5AW0 B;  3U1A A;  3FXE A;  5BVZ A;  3AE7 C;  3RL0 D;  4PJ0 V;  2OYI C;  5DFS A;  1NOH A;  1P84 E;  4HH2 A;  1YTZ T;  3MP7 B;  2KK7 A;  5DJQ B;  2Q6Q A;  2LXC B;  4YE1 A;  1HJ0 A;  3V2Q A;  1FDM A;  1BGY D;  1GZL A;  3R4Y A;  1RF1 A;  2Q9I A;  1SQV J;  2BCC G;  5B66 E;  3CX5 W;  1W5C T;  1DX7 A;  3JC2 2;  2OTJ P;  3CCM P;  1ZN5 A;  1HZV A;  1L4A A;  1X9V A;  3CCV P;  3RL0 B;  1U57 A;  3NWV A;  3SJL A;  2R5B A;  1VQ9 P;  1X8Y A;  2GM4 A;  1ZZH A;  5KJ7 C;  2K37 A;  4JPZ B;  5KLV E;  1HTL C;  5CCG C;  4ZNC A;  1NTK G;  1VQK P;  1SFC C;  1OXZ A;  1LNQ A;  1QLE D;  3E1R A;  1M90 Q;  1N73 A;  5B5E V;  4LGD E;  1Q81 Q;  1OIP A;  4EIE A;  3M06 A;  1KMI Z;  2WPS A;  1GL2 C;  3H1K G;  2FYU G;  1FU1 A;  1CO6 A;  4BWN A;  4IFF A;  2KXP B;  1J3S A;  1S9K E;  3D0W A;  1P84 H;  2XZR A;  3W68 A;  3BCC G;  3Q5S A;  1IZN B;  4GIF A;  2GC7 D;  3H1J G;  3GG2 A;  1KX7 A;  2M3E A;  5B66 H;  4L3H A;  1HJ4 A;  3T97 A;  2HG5 D;  2VRS A;  1AVY A;  2O3J A;  1LTB C;  1JY2 O;  1MZ4 A;  1RE4 C;  3M9Q A;  2C1D A;  5AW2 B;  1DII C;  2C2C A;  1H33 A;  1H88 A;  1LTJ A;  1NU1 D;  1C75 A;  3OJA B;  1CIE A;  3HD7 D;  2QA4 P;  2RH0 A;  1NKN A;  2AEM A;  4U7J A;  1CHJ A;  1A02 F;  3I55 P;  1PGQ A;  1NWQ A;  1U75 B;  4IFM A;  3L71 E;  1PPJ E;  1VQ8 P;  1LP1 A;  3L74 G;  1SQQ D;  3MD0 A;  4W7Z A;  3TNU B;  1CNO A;  1W2E A;  3AE3 C;  3OA8 A;  4H13 C;  2Y9Y A;  4D6T D;  2CE0 A;  1DD4 A;  3GHG A;  1IO4 A;  2XKM A;  1JB0 J;  2ZXY A;  1CCH A;  1IFD A;  1F1F A;  3L72 J;  3M0D A;  4DT0 A;  3HD7 B;  1A2S A;  1NTM K;  3PTZ A;  3HE4 B;  2IBZ E;  1NTZ G;  4ZKP A;  5CIH B;  3VMA A;  1L9J C;  2C1V A;  1VYD A;  3CX5 I;  3PLN A;  2A45 H;  1L0N K;  4L75 A;  2N1T D;  3RK3 E;  1KZU B;  1LTA C;  2P7J A;  2PGD A;  2QJP C;  3NXS A;  1CRI A;  1G2C A;  5AW8 B;  2CPS A;  3R2P A;  4I2L C;  2D2C D;  2YXR B;  1K3H A;  4WQ8 A;  2ZT9 C;  1FZG A;  2V7Q J;  3A5T A;  3Q1M A;  1SQV G;  3OCD B;  3P8M C;  2H89 C;  1T3U A;  3P8C E;  1NVO A;  3BRV B;  3RGU A;  4FAN A;  2KB7 P;  1YJ9 P;  1CRY A;  1ZRT E;  3H1L J;  4U3F D;  1H89 A;  2GUS A;  2N1T B;  3HQ9 A;  4NPE A;  3ORV A;  2WSC H;  4FA1 A;  3AE5 C;  2WSC J;  3Q5P A;  1GU5 A;  1OW8 A;  2B4Z A;  2PFX A;  2E76 B;  3WUT A;  2AXT V;  4H0L C;  3BVH A;  5BU8 B;  1I54 A;  1Q2N A;  3CWB J;  3F5H A;  1CZQ A;  4ASW A;  2E5Y A;  3RK2 C;  2IYP A;  5APQ A;  1YBK A;  1VF5 D;  2HPC A;  2BPB B;  4PV1 C;  1WT6 A;  1U74 B;  4L74 A;  3CC4 P;  3L70 D;  2FYN B;  3IN6 A;  1YJN P;  2N9J A;  2FFD B;  2GA1 A;  3AE2 C;  3CL3 D;  3GLM A;  1L0L K;  1W5C E;  4UB6 V;  1RF0 A;  1SQP G;  5KAI V;  1N15 A;  3HUS C;  1KQL A;  3CU4 A;  4ZMD A;  1L2P A;  2I1J A;  5AVX B;  3ZOO A;  1C6S A;  1KYO W;  2WMM A;  3O8Z A;  1KV4 A;  3HQ6 A;  1KIB A;  4UB8 E;  4XYD B;  2KZJ A;  5AW3 B;  5AVV B;  1FOS F;  1GJQ A;  4WB4 A;  2IZ1 A;  1Y9B A;  5TIS E;  4EI2 A;  1KIL A;  1HF9 A;  1NTM D;  1QN2 A;  2XU6 A;  5CID B;  2YNY A;  2Q7C A;  3H1I D;  2PAC A;  4EIC A;  1SQB K;  3B5N D;  1LC2 A;  1S5L E;  1CI6 B;  1L0N D;  1J1E C;  3UIA A;  3CCS P;  4AAO A;  1RF1 C;  3JBT B;  2C0X A;  1SQX J;  3L72 G;  4OGQ C;  4DOJ A;  1EXI A;  2QRX A;  4LLH A;  3MK7 B;  1CW5 A;  1CSV A;  2JKV A;  5CCH C;  1JY3 N;  2BCC E;  1L4A C;  3CC2 P;  1KIL E;  2HOD A;  3CCR P;  4NFG B;  2W8Z A;  5CIC B;  1URQ D;  2WSE J;  5CBO A;  1M60 A;  2YK3 A;  3B5N B;  2JWA A;  2W27 A;  3IF4 A;  1YJW P;  4I6M C;  1H1O A;  1OVV A;  1N7S A;  1WMK A;  3DR0 A;  2OYH B;  1CSW A;  1NTK E;  2K9Y A;  1N73 C;  1ZW0 A;  1T2K D;  4UB8 H;  1KOR A;  3CPW O;  3C9I A;  5C39 A;  3CCE P;  5GTI V;  1CTY A;  4PD4 E;  1K8A Q;  1WVE C;  3VNW A;  2YKO A;  1S4X A;  3RK3 B;  5TIS H;  3B8E B;  1Z56 A;  3L70 G;  5GTH E;  4FA5 A;  3H1L G;  2IFN A;  4M3L A;  1URQ B;  1YFC A;  1CRC A;  3H1K E;  2FYU E;  2KIK A;  1S5L H;  1ZOY C;  2WIT A;  5TJH A;  3IAO A;  2WT7 B;  2Z5I A;  3VYI A;  1RHZ B;  3BCC E;  1COT A;  2P1J A;  2JEE A;  1I5T A;  2CE1 A;  1KFM A;  1GDT A;  3M9H A;  3CLQ A;  1QL1 A;  3CWB G;  3H1J E;  2ZFC A;  1FOC A;  3O0R C;  3WFC C;  2BCC J;  2BAS A;  1EDK A;  5AVW B;  1NHL A;  1LTJ C;  2YO3 A;  1JCC A;  4C46 A;  1AQ5 A;  5KAF E;  3RBX A;  5KTB A;  1LT9 A;  3H1I G;  2RKL A;  3KQG A;  1KYO I;  4C7N A;  3HE5 B;  1S2E A;  5APW A;  1QEX A;  1EDL A;  1HH0 A;  4IL6 V;  1N8R Q;  4WY4 D;  4PD4 H;  4WQA A;  1OZH A;  4N6J A;  4GOD A;  3L36 A;  1LJ2 A;  1KN7 A;  1JUN A;  3M91 A;  5GTH H;  3L35 A;  1H0T A;  3O6Q B;  1J1D B;  3GHG C;  3L74 E;  3AEG C;  5AW4 B;  3TGU D;  2K3R A;  3H1K J;  3PJS K;  2FYU J;  1M1J B;  3M0D C;  2QM7 A;  2I1K A;  2JDI H;  1EB7 A;  1PFI A;  1BE3 D;  1Q7Y Q;  1M57 D;  3BCC J;  1FZC B;  1SP4 A;  3VYM A;  3RBZ A;  3A0H V;  3NBT A;  1X22 A;  1NTZ E;  4WY4 B;  1YIT P;  3QWO C;  4R4L A;  1R5L A;  3L37 A;  1TU3 F;  3IR9 A;  2EXV A;  3BAS A;  1QKS A;  1LWU A;  2M8R A;  1PP9 G;  4XE5 B;  1DIQ C;  2OYI B;  5KAF H;  1LS9 A;  2BEQ D;  2H43 A;  2HFE D;  2QIW A;  1HVV A;  5CCG D;  2OTL P;  2KS1 B;  1F1C A;  3I56 P;  2E74 C;  1SQX G;  1YHQ P;  1QL4 A;  1C2R A;  2H8P D;  2NPS D;  1EDJ A;  1BCC D;  4XFJ A;  1PL5 A;  1MKM A;  1SQV E;  3L75 G;  2QEX P;  3SWS A;  2YKQ A;  1HCM A;  1CSX A;  3ITK A;  1JY3 O;  1JMM A;  1GQ1 A;  1G1J A;  1FDO A;  1NO4 A;  5AUR A;  1MG2 D;  3AED C;  1HRO A;  1I6D A;  3V4Q A;  1LTI C;  3G4S P;  1G1I A;  3L74 J;  1L0L G;  3FGA D;  2YIU C;  2LIT A;  2JO1 A;  3L4O A;  1IC2 A;  4L1Q A;  1SFC B;  1EZV D;  1RZ5 A;  1ZLL A;  4Y99 C;  2ZBO A;  3WUU A;  3MIW A;  4H44 C;  4AUW A;  3RN0 A;  1OW7 A;  2WWW A;  2N3Y A;  1NTZ J;  1EZV I;  4RES B;  1GL2 B;  3CXH D;  4MU8 A;  3CI9 A;  3S1K A;  3H1H G;  1SQQ K;  3N7N A;  4TT3 H;  4EIJ A;  1I8P A;  4BRY A;  3SFE C;  2C0W A;  3CXH I;  4OWF A;  3TYY A;  2N1T A;  4JYC A;  1RY3 A;  3V2P A;  1JM0 A;  4TLF A;  1SQB G;  1DW1 A;  3CCL P;  1BDC A;  1YIQ A;  1RF0 C;  3A9F A;  1VQM P;  2IYO A;  1JCD A;  1SQP E;  3CX5 E;  1PGO A;  3KZI V;  1ZME C;  3FWL A;  3C2C A;  1FI9 A;  3KYQ A;  2JR8 A;  2J59 M;  2ZVO B;  4KHX A;  1GU4 A;  2QJY C;  3HRN A;  3G71 P;  1QVG O;  1FC2 C;  1CRJ A;  1CSU A;  4RKU J;  2YKP A;  3HTK A;  2Z4E A;  1H9X A;  1KIL C;  1GU2 A;  3A3Y B;  2ZZS 1;  1KX2 A;  1NU1 J;  3AEA C;  4GDO A;  4GED B;  2FXP A;  5KLV K;  2YXQ B;  2M5A B;  3TSI A;  1H8A A;  3C8V A;  3CCQ P;  1CHI A;  1QGK B;  1KD1 Q;  2A06 D;  1C6R A;  3OAK A;  1CTJ A;  1H32 A;  4I7Z C;  5AVS B;  2ZT9 D;  3L72 E;  1CTZ A;  2W6B A;  3G3Z A;  3ZOW A;  3AE4 C;  1XTC C;  4D6T J;  3GW6 A;  1EZV G;  1JTH B;  2PCB B;  3V2N A;  3PXW A;  1DW2 A;  3CX5 H;  1PV3 A;  1SQP J;  2R32 A;  4K3A A;  1N7S C;  2ZAE B;  3U1C A;  4L73 A;  3JCU E;  1HWT C;  1E79 H;  1FJ0 A;  1A56 A;  4AAN A;  3CCJ P;  3V4W A;  1ZR4 A;  5APS A;  4EID A;  3L73 D;  2P10 A;  2ZON G;  2ZT9 B;  1LTS C;  2KLU A;  2KSJ A;  5E79 V;  4PWA A;  2IDB A;  5AW1 B;  3WU2 V;  3L70 E;  1AQT A;  1NYH A;  2GB8 B;  3H1L E;  1JOC A;  3H6P A;  1BGY G;  2PP6 A;  2ZYA A;  1IFM A;  3TK1 A;  4L3G A;  3O20 A;  1NKZ B;  3KDP B;  3MHV A;  1HJ3 A;  1H31 A;  3O5C A;  3PP5 A;  1T6A A;  1RAQ A;  1K04 A;  1QX8 A;  1HH7 A;  2C1U A;  1S3J A;  2CA3 B;  4H0L B;  1DVH A;  3CWB E;  1P84 D;  2D0S A;  3RK2 B;  1FI7 A;  1LT9 C;  3LIE A;  3SWF A;  1FZA A;  2K9J B;  3JCU H;  1P84 I;  1URQ A;  3KPE A;  3RN1 A;  3H1I E;  3TF5 A;  4PV1 B;  2HYN A;  3VMX A;  1KB9 E;  2WSF H;  5CIE B;  5CYT R;  3A0B V;  3RMZ A;  1GD2 E;  2WSF J;  3H32 B;  3CP5 A;  2GIW A;  2C9X B;  2V7Q H;  1JO5 A;  2E76 D;  5AVR B;  2B12 B;  4A7P A;  5APX A;  3L70 J;  1ZV8 A;  5KLV D;  4AYC A;  3HUS B;  2B87 A;  3NMD A;  3KHU A;  2L5G B;  4EYY Q;  1CYI A;  1GMJ A;  1CC5 A;  2B88 A;  4OVN F;  1FJP A;  1NMI A;  4DY9 A;  1ETP A;  1HRC A;  1N7L A;  1IJD B;  3HE5 A;  5BU5 A;  5CCH D;  3SLE A;  1IK9 A;  1NU1 G;  1N2D C;  4PW9 B;  1VQN P;  3AE9 C;  1S9K D;  1M70 A;  2BCN B;  1LWU C;  1AOF A;  2FKW B;  5H2F E;  3USS A;  5M1B A;  5CMZ A;  1NTM J;  1N9C A;  1PP9 E;  2MHM A;  1J1E B;  2B89 A;  2Q1K A;  3H1I J;  1KB9 H;  1RF1 B;  1GW3 A;  2O1K A;  4OGQ B;  1SQX E;  2YMY A;  1SQQ G;  1OAE A;  4KMG A;  2D0W A;  1L0N J;  3L75 E;  4KT0 J;  4D6T G;  3M9B A;  3FWN A;  2CA4 B;  1L4A B;  5CIG B;  4RO0 A;  1WEJ F;  2BGV X;  3F89 A;  4WY4 A;  2A45 I;  1W2L A;  2M0B A;  2JTI B;  2ITA A;  1FAV A;  1L0L E;  1LFM A;  4PJ0 E;  2XTS B;  1Q86 Q;  3G9R A;  1KYO E;  1N73 B;  3D71 A;  2KS1 A;  3X39 A;  1DH3 A;  2G3A A;  3L71 D;  1J2J B;  1PPJ D;  4JCG A;  1FE6 A;  2ZJS E;  3K5B A;  4HB1 A;  2GC4 D;  1AJY A;  1VL2 A;  4AX3 A;  2W90 A;  3V2R A;  1AYG A;  3H1H E;  2N1T C;  2M3B A;  5H2F H; 
#chains in the Genus database with same CATH homology
 4FAV A;  1B7V A;  1RAP A;  1SQP D;  1GDV A;  4RJT A;  3CX5 D;  2IBZ D;  3CX5 W;  1YCC A;  1W5C T;  1GIW A;  4Y5R A;  3TGU D;  3PXS A;  1HZV A;  2ZOO A;  5B66 V;  1EB7 A;  2QG4 A;  3NWV A;  3SJL A;  2B11 B;  1BE3 D;  1ZZH A;  1S6V B;  3WC8 A;  2C1D B;  2I8F A;  3VYM A;  3A0H V;  3NBT A;  1H33 B;  451C A;  3PHL A;  1CHH A;  2PCC B;  2C8S A;  4O1Q A;  2EXV A;  5B5E V;  1CRG A;  1YEB A;  4EIE A;  1C52 A;  1QKS A;  1OCD A;  1AKK A;  1DIQ C;  1QL3 A;  1LS9 A;  4O1W A;  4V2K A;  1CO6 A;  1F1C A;  1J3S A;  1QL4 A;  1C2R A;  1H9Y A;  4AAL A;  1BCC D;  3L72 D;  1HZU A;  1CIH A;  3SWS A;  3OA8 B;  2L91 A;  1HCM A;  5KLI B;  351C A;  1CSX A;  3ITK A;  2GC7 D;  1GQ1 A;  5AUR A;  1MG2 D;  1HRO A;  3GG2 A;  1KX7 A;  1I6D A;  2OZ1 A;  4L3H A;  1HJ4 A;  3SVW A;  1IQC A;  2O3J A;  1CYC A;  1MZ4 A;  1I8O A;  2C1D A;  1DII C;  2C2C A;  2LIT A;  2AIU A;  5CIF B;  1H33 A;  1KV9 A;  3L4O A;  3ZOY A;  4L1Q A;  1EZV D;  1NU1 D;  1RZ5 A;  2ZBO A;  1C75 A;  3RN0 A;  1CIE A;  2N3Y A;  2MTA C;  3CXH D;  3CXH W;  4MU8 A;  1CHJ A;  2FWL A;  2Y0D A;  3H1L D;  1YIC A;  1I8P A;  3NBS A;  1U75 B;  5C0Z A;  1IRV A;  1SQQ D;  1AOQ A;  2RMZ A;  3TDK A;  1CNO A;  2N3B A;  1E29 A;  3OA8 A;  4D6T D;  2CE0 A;  1DW1 A;  1FCD C;  1COR A;  2BLF B;  3ZIY A;  1YIQ A;  3HQ7 A;  2ZXY A;  1CCH A;  1H32 B;  1NNO A;  1F1F A;  4K3I A;  3A9F A;  4LJI A;  1A2S A;  2QJK B;  3PTZ A;  3CWB D;  3KZI V;  5CIH B;  1LMS A;  1CXC A;  3FWL A;  3C2C A;  1FI9 A;  3VMA A;  1C2N A;  2YIU B;  1JDL A;  1L9J C;  2C1V A;  1VYD A;  2N9Y B;  2OZ1 B;  3PLN A;  1CRJ A;  1CSU A;  3HQ8 A;  1YEA A;  1BL9 A;  1I6E A;  1N50 A;  1DW3 A;  1RZ6 A;  1H9X A;  1KB9 D;  3ZCF A;  1NML A;  1GU2 A;  1CRI A;  4P4Q B;  4QAO A;  2ZZS 1;  1KX2 A;  1K3H A;  4WQ8 A;  4GED B;  2ORL A;  3OCD B;  5KKZ B;  1I55 A;  2L4D A;  2BH4 X;  1CHI A;  4FAN A;  1IRW A;  2BCC D;  1CRY A;  2A06 D;  1ZRT D;  1C6R A;  4U3F D;  4FB1 A;  1CTJ A;  1H32 A;  3HQ9 A;  1CTZ A;  1H31 B;  5B6Q A;  3ZOW A;  3ORV A;  4FA1 A;  4H0J A;  1L9B C;  1CYJ A;  1NTK D;  3GW6 A;  2B4Z A;  1E8E A;  2PCB B;  2QJY B;  3M97 X;  3WUI A;  1QYZ A;  2AXT V;  3PXW A;  1DW2 A;  4PD4 D;  1I54 A;  4WQ7 A;  1YNR A;  4WQ9 A;  1PP9 D;  3O1Y A;  1FJ0 A;  4AAM A;  1A56 A;  4AAN A;  3DMI A;  4EID A;  3L73 D;  3H1K D;  2FYU D;  2BPB B;  2ZON G;  4FA4 A;  2CXB A;  1SQX D;  4J20 A;  1U74 B;  5E79 V;  4PWA A;  3OCD A;  3L70 D;  3WU2 V;  2FYN B;  2RN0 A;  3L75 D;  3BCC D;  2Y0E A;  3DP5 A;  1R0Q A;  2B10 B;  2N9J A;  2GB8 B;  4Q5P A;  3VRD A;  1FI3 A;  2JQR A;  4EDF A;  4L3G A;  3CYT I;  4UB6 V;  3O20 A;  1IZL 0;  1LC1 A;  3H1J D;  3ZOX A;  3MK7 C;  2Q3E A;  4WQB A;  3RLM A;  1HJ3 A;  5KAI V;  2B0Z B;  1N15 A;  2FRC A;  1H31 A;  4H0K A;  1K3G A;  3O5C A;  3CU4 A;  1RAQ A;  1L0L D;  1CIF A;  3ZOO A;  1C6S A;  1KYO D;  1KYO W;  1HH7 A;  2C1U A;  4WQE A;  3WFE C;  3HQ6 A;  2CA3 B;  1KIB A;  4XYD B;  1DVH A;  2Y0C A;  5C9M A;  1GJQ A;  1P84 D;  2D0S A;  4GYD A;  1DVV A;  1A8C A;  1FI7 A;  1NTM D;  1QN2 A;  4UB8 V;  3L4M A;  3H1H D;  5CID B;  2K9J B;  3H1I D;  3RN1 A;  1CXA A;  5TIS V;  2PAC A;  3PXT A;  4EIC A;  3TF5 A;  2LIR A;  5CIE B;  5CYT R;  1LC2 A;  3A0B V;  3RMZ A;  3L74 D;  1L0N D;  4WQC A;  3CP5 A;  2GIW A;  4AAO A;  4EIF A;  1SQB D;  2C9X B;  1M6Z A;  3JBT B;  1YTC A;  2B12 B;  1S5L V;  4WQD A;  4A7P A;  3MK7 B;  1CSV A;  2YQB A;  1KB0 A;  5KLV D;  5IY5 1;  3ZBM A;  1NTZ D;  3KHU A;  4NFG B;  1CYI A;  5CIC B;  3SXT A;  1M60 A;  1CC5 A;  1MG3 D;  2DGE A;  2YK3 A;  2N18 C;  2JWA A;  1NMI A;  2YCC A;  5DF5 A;  1H1O A;  5EXQ A;  4DY9 A;  3DR0 A;  1ETP A;  1HRC A;  3SLE A;  3WFB C;  1CSW A;  1C7M A;  4PW9 B;  1DT1 A;  1M70 A;  2BCN B;  5GTI V;  1CTY A;  1WVE C;  3VNW A;  3TYI A;  1AOF A;  1CED A;  1SQV D;  2N9I A;  4FA9 A;  2QJP B;  4XXL A;  5DJQ C;  1N9C A;  4FA5 A;  2MHM A;  3PRJ A;  1YFC A;  1CRC A;  5H2F V;  1N90 A;  5GTH V;  1CIG A;  1CCR A;  5TJH A;  1OAE A;  4KMG A;  2D0W A;  5CIB B;  2CA4 B;  5CIG B;  1HJ5 A;  1FHB A;  1WEJ F;  1COT A;  1DW0 A;  2BGV X;  2VHD A;  1I5T A;  2CE1 A;  1W2L A;  1GKS A;  2DVH A;  4RSZ A;  1FOC A;  2N18 B;  3O0R C;  4N0K A;  2JTI B;  3WFC C;  3WFD C;  1C6O A;  3PH2 B;  2BH5 X;  2V07 A;  2KNC B;  2V08 A;  1LFM A;  2XTS B;  2KS1 A;  3X39 A;  3L71 D;  1PPJ D;  4PJ0 V;  1IO3 A;  1NIR A;  5DFS A;  2HV4 A;  5KAF V;  4JCG A;  2AI5 A;  4IL6 V;  2GC4 D;  5DJQ B;  4AX3 A;  4YE1 A;  4WQA A;  1AYG A;  1CRH A;  155C A;  1E2R A;  1BGY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...