1P84D

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
246
structure length
246
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 72
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1p84D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1p84D01
1SQBD 4P4QB 4EIFA 1CSUA 1QN2A 1HJ4A 1QL4A 1C2RA 1WVEC 4WQ9A 1S5LV 1DT1A 4K3IA 4GEDB 3L4OA 2C1DA 1CIEA 1NMIA 3L70D 1IRVA 1DW2A 1CC5A 2CA3B 3SWSA 5B5EV 3ZOYA 3DR0A 4AALA 1KX7A 1KYOD 1GKSA 3KHUA 5KAIV 2MTAC 2GB8B 3WUIA 1CHIA 4FA5A 3ZOWA 1H1OA 3O0RC 2PCBB 1HH7A 4XXLA 3WC8A 2FYUD 3HQ8A 4AAOA 1E29A 3GW6A 2DVHA 3DP5A 1DW3A 3L4MA 5H2FV 1MG2D 3H1LD 1COTA 3L73D 1LMSA 1H31A 1CTYA 1LC2A 2RN0A 3ZCFA 4PW9B 4AAMA 3WFEC 1C75A 1RAQA 4FA9A 3MK7C 1IRWA 1HJ3A 3L72D 1B7VA 1N15A 1IQCA 1F1CA 1BL9A 4UB6V 3RMZA 4Q5PA 1FOCA 2PCCB 1HROA 2V08A 4A7PA 2JWAA 4D6TD 3OA8B 1W2LA 4DY9A 3HQ9A 5CIEB 1IZL0 3PHLA 1YICA 3BCCD 1L9BC 1YEAA 1K3GA 2YCCA 1KYOW 1I5TA 1MG3D 1I6DA 1AOFA 2OZ1A 2BCCD 2PACA 2FRCA 5CYTR 3NBTA 3ITKA 4RJTA 2C1UA 1QL3A 2QJYB 1C2NA 1H33B 1MZ4A 4O1WA 2XTSB 2B4ZA 5GTHV 1N9CA 3ZIYA 5CICB 4FB1A 1NU1D 1SQQD 1H9XA 2B11B 2YQBA 2L91A 3JBTB 2L4DA 4XYDB 2B0ZB 2N9JA 3TDKA 1OAEA 3TGUD 2GIWA 451CA 3CU4A 3HQ6A 1DVVA 1CRIA 1FCDC 1PP9D 1ETPA 2BCNB 2KNCB 1CRHA 3C2CA 3A0BV 1KV9A 1DIQC 2MHMA 4FANA 1C7MA 4V2KA 3PXSA 1FI3A 1CRYA 1PPJD 1CXCA 1E2RA 2AI5A 3KZIV 4YE1A 1GU2A 1C6RA 1F1FA 3PH2B 2BH5X 2ZZS1 5IY51 3SLEA 1CNOA 3NWVA 1RZ5A 5EXQA 1I54A 3L74D 2QJKB 3VRDA 2Q3EA 1CIFA 1AOQA 3SJLA 1L0ND 1CO6A 2GC4D 2LIRA 1A56A 1QYZA 1SQPD 3PXWA 2DGEA 2QG4A 5C9MA 2O3JA 3VNWA 3FWLA 3ZBMA 1A2SA 2QJPB 1L0LD 2ZOOA 4PWAA 5GTIV 3SVWA 1CSXA 3H1JD 3MK7B 1SQXD 1LFMA 3RLMA 3O1YA 2AIUA 1CRGA 1K3HA 1P84D 1CHHA 1L9JC 5B66V 3CP5A 1CRCA 1CTZA 3WU2V 2N18C 2YIUB 2ORLA 3OCDB 1LC1A 5KAFV 3WFCC 1OCDA 1BGYD 2Y0EA 3NBSA 1EZVD 1AKKA 1H33A 4H0KA 1NIRA 1CHJA 1GDVA 1CRJA 2ZONG 1E8EA 1H32B 4FAVA 2B12B 2BGVX 3VYMA 2C9XB 155CA 1I55A 2CE1A 1YCCA 3TYIA 1W5CT 1GQ1A 5TISV 3L71D 5DF5A 4WQDA 2CA4B 4WQEA 1RZ6A 1CEDA 3ORVA 5CIFB 3RN1A 2Y0CA 3H1ID 1I8PA 1RAPA 4WQ7A 1CYJA 2ZBOA 3CXHW 1WEJF 1I6EA 1CORA 1CIGA 1A8CA 3PRJA 1EB7A 1YEBA 1ZRTD 4O1QA 4PJ0V 5DJQC 2IBZD 1AYGA 4RSZA 2C8SA 1SQVD 4WQAA 3ZOOA 4JCGA 1DVHA 2D0WA 2EXVA 4LJIA 4U3FD 2BH4X 1GJQA 1NTZD 1BCCD 1CYIA 2KS1A 2BLFB 1FI7A 1LS9A 2VHDA 5CIHB 3SXTA 4AX3A 5KKZB 2D0SA 3A0HV 5KLVD 5TJHA 3CWBD 3PLNA 4EIEA 1CSWA 3PTZA 5CIGB 1HZUA 2ZXYA 4GYDA 1VYDA 3CX5D 1FHBA 4QAOA 1U75B 4WQ8A 1U74B 1C52A 5KLIB 4L3GA 4L1QA 4KMGA 1R0QA 1NNOA 2C1DB 2CE0A 5C0ZA 2GC7D 1M6ZA 1CXAA 4H0JA 3L75D 4EDFA 1H9YA 3CXHD 1N50A 1HCMA 5DFSA 2K9JB 1M70A 1KX2A 1S6VB 2A06D 4FA4A 1DW0A 1C6SA 5CIDB 1HJ5A 4UB8V 1C6OA 3OA8A 3HQ7A 4IL6V 5CIBB 4WQBA 2C1VA 2B10B 3CYTI 1HRCA 1CIHA 3OCDA 4PD4D 2V07A 4L3HA 1DIIC 1H31B 2BPBB 3TF5A 1QKSA 1H32A 1IO3A 5B6QA 2N18B 3H1KD 2N9YB 1CCRA 1NTKD 4Y5RA 3CX5W 3PXTA 1CCHA 1YIQA 4J20A 3O5CA 2JTIB 351CA 1YTCA 3H1HD 3ZOXA 1CYCA 3WFBC 2N3BA 3GG2A 4NFGB 1HZVA 3RN0A 3X39A 2AXTV 3A9FA 1BE3D 1YNRA 3VMAA 1I8OA 1ZZHA 4MU8A 2LITA 2FYNB 2OZ1B 3O20A 1NTMD 3WFDC 4EIDA 4FA1A 5E79V 2I8FA 4AANA 2C2CA 1KB0A 4WQCA 1M60A 4N0KA 1CTJA 5AURA 5DJQB 2CXBA 1FJ0A 2RMZA 1DW1A 1FI9A 1KIBA 2N9IA 3M97X 2HV4A 1KB9D 3DMIA 2Y0DA 1JDLA 1NMLA 2YK3A 1J3SA 2FWLA 2JQRA 1CSVA 1GIWA 4EICA 1N90A 2N3YA 1YFCA
chains in the Genus database with same CATH superfamily
3RGUA 1M57D 3JSVC 1CSUA 1QN2A 3C9IA 3CCMP 1IFPA 1C2RA 4ASWA 1NTMK 1KC8Q 1DT1A 3BRTB 2C1DA 2W27A 1CIEA 1CC5A 1NTZJ 2HLOA 2W83C 3DR0A 3OA7A 4WWIA 3E7KA 3USSA 3KHUA 4AYCA 5KAIV 4FA5A 3O0RC 1HBWA 3VN0A 3CXHH 1LWUC 3WC8A 3EWKA 1L4AD 2KI7B 2DVHA 3DP5A 2E76B 1YTZT 1MG2D 2CPBA 1LMSA 1H31A 5KLVK 3CXHE 5AVUB 3RK3D 1FOSF 4AQRD 1P84H 1RAQA 3GHGA 3L70G 4IL6H 3S9OA 5CBNA 1HJ3A 3L72D 1LT1A 2ZXEB 1LT9B 3RMZA 1HVVA 4IOIH 4W80A 1P84E 1FOCA 1NVOA 4IL6E 3D71A 1HROA 4D6TD 1CZQA 4DY9A 5AVRB 3HQ9A 1L9BC 1YEAA 2OARA 1EZVE 1IK7A 1VQ6P 1MG3D 1CSBA 2GM4A 1AOFA 4WVZA 4O1WA 2FXOA 2ZT9C 3ZIYA 3GLMA 1N7SA 1H9XA 3H1IE 1EC5A 1JY2O 1RE3A 4JF7A 3OJAB 1ZOYC 2GIWA 5CCHC 3CU4A 1FJPA 1JY3P 4KHXA 2QRXA 1FCDC 3CMAP 2BCNB 5GTHE 1KFNA 5AVWB 2O01N 3C2CA 2WSEJ 4FANA 1X8YA 3PXSA 1CRYA 3M9BA 3RK2C 4WY4B 1NTMJ 1J1DB 4YE1A 2NZ2A 4NPFX 3KQGA 2BH5X 1XTGB 3B71A 2ZZS1 5IY51 1EDLA 3SLEA 2KS1B 1RZ5A 3CLQA 4B86A 1ZP0C 1E5WA 2XU6A 1Q81Q 1N7SD 2YNYA 3MHVA 1YHQP 1CIFA 5DJTB 1AOQA 1W2EA 2E75B 2I1KA 3MZWB 1VQ8P 1L0ND 2KLUA 1CO6A 1GDTA 3C8VA 3L70E 1SQPD 2WSFH 4Y28J 3TNUA 1A02F 5KLVJ 1NO4A 2IX7C 3CWBJ 1MKMA 1RE4C 1KYOE 2O3JA 3VNWA 1UIIA 2XNXA 1G2CB 4PWAA 4H13D 1YYCA 3SFEC 3RLMA 4H44C 1GL2B 2GA1A 2Q5UA 1FS0E 1KORA 1OW7A 4UB6H 2KUBA 5B66V 1CRCA 2N18C 1YTZI 2YIUB 3OCDB 3S1KA 2K1AA 2Y0EA 1LTJC 3KYQA 5CMZA 1GDVA 4UB6E 4I2LC 1W5CT 2KXPB 4WQDA 4WQEA 1EXJA 1RZ6A 3L72G 1OFCX 1WRGA 3ORVA 1SQXG 3MUDC 3RN1A 4JYBA 3AEFC 2ZBOA 4ASVA 4D6TG 3W68A 1CORA 1CIGA 2A45G 2HODB 4R4MA 2NPSA 1KB9H 3BCCJ 1EB7A 1YEBA 1K05A 4XE5B 4GOEA 1BGYG 4PJ0V 1EDIA 2IBZD 1SQVD 2ITAA 4ZMDA 3N4XA 2EXVA 3HD7B 2BH4X 1GJQA 1NYHA 1MZ9A 4YPCA 2XZRA 1CYIA 3BVHA 1LTIC 2VHDA 2C0XA 3H32B 1LTAC 2BEQD 1VQ5P 3TGUJ 1L4AB 2O1KA 4N78E 5KLVD 3NFQA 3AE6C 2OYOA 1S5LH 3CWBD 1H0TB 1PP9J 3AEGC 3H6PA 3RK3B 1NH4A 2QVAA 1R5LA 1FZCB 5APVA 2NPSD 2WQYC 1U75B 3CCRP 1YITP 3E1IA 1FDOA 1YJWP 1NTZG 1OZHA 3CX5I 2C1DB 1FZAA 2AEFA 3VYIA 1HTLC 1XTCC 2O01H 4ZKUA 4KT0J 3CXHD 2IFMA 2Q7CA 2ZFCA 1LT9A 3B4SA 1A02J 3A3YB 2A06D 2JJLA 1C6SA 1DW0A 1OVRA 3R2PA 1KQSO 4MN4C 1JY2P 1H89A 1NOHA 1T3UA 3EFGA 4UB8V 1C6OA 5C39A 3HQ7A 2ZAEB 5CIBB 3V4QA 4WQBA 1L0NG 3CYTI 4PD4D 1SQPG 2POHA 1DIIC 1H31B 2Q6QA 5BU5A 2XNDH 1FBMA 1SQXE 2A45H 1H32A 2FYZA 3GHGB 2H8PD 5AVXB 3WU2H 1YIQA 4D6TE 3D70A 1GTWA 5KAFH 1IFJA 2IPPA 1LGHB 3CI9A 1CYCA 4U7JA 3WFBC 2N3BA 1J1EB 3HUSC 1BGYE 3RN0A 2HPCA 3WU2E 5TISH 2QJYC 1OW6A 1I8OA 4PV1B 1PGJA 2LITA 1JUNA 2JDIH 2FYNB 5CCHA 1KTMA 3LIEA 1FZFA 4CPGA 3CCUP 4FA1A 3L4FA 5E79V 5TISE 1X22A 2C2CA 2XDJA 1VQNP 2BCCJ 2Q9IA 4N3YB 1DD4A 3S4RA 1N7SB 3M97X 1M90Q 3L71J 3DMIA 1KQFB 2Y0DA 4TLFA 3KZIH 3F5HA 2N3YA 1RQVA 3CCEP 1NTZE 1N86A 1NTMG 2SPZA 3U59A 4P4QB 4C7NB 3AE8C 5CCHD 2VRSA 4WQ9A 1SQVG 1S5LV 4U3FJ 3L70D 1DW2A 2E74B 1BSHA 3SWSA 5B5EV 2P10A 2W90A 4LLHA 1BCCJ 1DH3A 3D0WA 2CK3H 2FY8A 1KYOD 1L0NE 3RK2D 4DZOA 5K5GB 3CCQP 1GKSA 4KJMA 2E43A 1N73C 3ZOWA 2PCBB 2KB7P 4XXLA 5KLVG 1T2KC 3CWBG 1DW3A 3FXDA 5H2FV 2OYHC 3H1LD 1FJKA 1CTYA 1LC2A 2RN0A 1MFZA 3E1RA 4PW9B 4YXWH 1HGZA 3A5TA 3QH9A 3WFEC 5APTA 3MK7C 1PV3A 1ZN5A 1VQLP 1B7VA 2OYIC 2NRGA 4Q5PA 1TU3F 2KZIA 3IR9A 2V08A 2E5YA 2R44A 3IFMA 2A06G 4AUWA 3GMAA 3PHLA 1IZL0 1YICA 3MUDA 1PGQA 1KMIZ 3FGAD 3MTUE 1K3GA 1KYOW 1R5SA 1R8EA 2PACA 2BCCD 2FYUK 2HODA 5CYTR 2WSEH 1VL2A 2C1UA 2AXTH 4DOJA 1JCDA 1M1JC 3A7OA 1PZQA 1YJNP 1K9MQ 3HD7A 2YQBA 3O8ZA 3H1KJ 2YKPA 4XYDB 3WMM0 4TT3H 2N9JA 2R5DA 3TDKA 1OAEA 3O6QB 1NTME 3H1HJ 451CA 1OW8A 2WMMA 4H0LC 4N6JA 1SQVE 1CRHA 3A0BV 1DIQC 2NPSB 1C7MA 1FI3A 3OW2O 1CXCA 1E2RA 3KZIV 5KJ7C 4N78D 1Q90D 1FZCA 1AQ5A 3Q1MA 3FXEA 2YO3A 2V7QH 2KYVA 5KKZC 1IFDA 5DJUB 5EXQA 5KLVE 3AEBC 1FZGA 1NU1K 2WSCJ 3AE3C 3NXSA 3TGUG 3L74D 3CWBE 3HD7D 4Y99C 1QEXA 2Y9ZA 1EDJA 2UWJE 3VRDA 3B5NC 2R5BA 1YI2P 1PP9G 2CPSA 1Y47A 2V4HA 2GC4D 2LIRA 1A56A 1U7JA 1OVVA 3PXWA 1IFMA 1NHLA 3OAKA 1LWUB 3A2AA 1QL1A 3FWLA 1VF5C 1VQ7P 3ZDMA 3ZBMA 1VQOP 2K88A 5GTIV 3SVWA 2A06E 1S9KE 1SQBK 4PD4H 3GF7A 1J2JB 3C1LA 1YJ9P 3H1JD 1SS1A 1SQXD 1LFMA 3I5CA 3M9QA 1KD1Q 3G4SP 2AIUA 4PD4E 1K3HA 3V6IA 2FYUJ 1ZW0A 2M3EA 1LC1A 2I1JA 1OCDA 1BGYD 3H1LG 3NBSA 1HJ0A 1DEBA 3P8MC 1H33A 4H0KA 1NIRA 3RBXA 5CBOA 3VMYA 2WPQA 1H32B 1YQ3C 1GQ1A 3MP7B 2W6JH 3PP5A 2BASA 2P67A 3G6EP 1L0LK 2W8ZA 2ZT9B 1DX7A 3SWFA 2Y0CA 5GTHH 2C9LY 2HPCB 1I8PA 4OGQC 1CYJA 1G1IA 2KNCA 1I6EA 3F89A 1IJDB 3PRJA 2D2CC 4M3LA 2Q3IA 4W7YA 1AYGA 1BE3J 2BCCG 4L76A 2C8SA 1GK6A 4WQAA 2WPRA 2HR3A 3TGUE 4PV1D 2WZ7A 1DVHA 1JY2N 2D0WA 1EXIA 4C7NA 3L71G 1NTZD 1GMJA 3HRNA 1PP9E 4OVNF 2PFXA 3RK2B 1NU1J 2BLFB 3RL0C 1LS9A 5AVQB 3AE7C 1KB9I 2YMKA 4DJGA 2BEZF 1SQQK 1PPJE 2Q1KA 1SFCC 2D0SA 2W6AA 3PLNA 3QWOC 4EIEA 5CIGB 2J5UA 1KYOH 1N73A 1VYDA 3CX5D 2WPSA 1D7MA 1U74B 1C52A 4L3GA 2OYHA 1KZUB 1LP1B 4L1QA 4KMGA 4IFMA 2CE0A 1SQBJ 1VPCA 1JEKA 1Q86Q 2YO2A 4EDFA 2Z4EA 1N50A 3VP8A 1FAVA 1M70A 2IYOA 4BWNA 3L74G 3W67A 2E74D 2J58A 3H1LE 4O9BA 2O1JA 1USEA 1HF9A 5CHXA 4IL6V 1PFIA 1HRCA 1JMBA 4L3HA 2WTYA 3EFFK 3M91A 2BPBB 5CCGC 3TF5A 5B6QA 2N18B 1T2KD 1CCRA 1GK4A 3CX5W 2PP6A 1LTJB 3BATA 1L0LJ 1YTCA 2JP3A 1M1JA 2C9NY 3GG2A 2XV5A 3H1JG 4EYYQ 4NFGB 1HZVA 4DCKA 1DIPA 2BCCE 3O6QA 3X39A 2N1TC 3A9FA 1BE3D 5AW3B 1ZZHA 1JNMA 3LW5H 3L71E 2FFDC 5APQA 1Q82Q 1NTMD 3WFDC 1WMKA 4EIDA 5AVSB 4JBZA 1Z56A 1JMMA 3ABVC 1PGPA 3H1KG 1GD2E 3Q5RA 2P2UA 1FJ0A 3V2PA 2FKWB 1DW1A 5KJ7A 2YMYA 1MUUA 3Q2YA 1NWQA 1NTKK 1IZNB 1ZRTE 1JDLA 1SQQJ 1NMLA 2LKMA 2FWLA 2JKVA 3D6ZA 5AVZB 3SWKA 1CSVA 3H1IJ 5AW4B 4U3FE 3IAOA 1OX3A 1YFCA 3CCVP 2JEEA 1BCCE 3B5NA 1EDKA 1SQBD 2QSIA 4EIFA 3A0HH 4H0LD 1WVEC 1LWUA 3G71P 3L74E 4GEDB 1NMIA 1FE6A 2QJKC 1IRVA 2CA3B 3B8EB 3A0HE 3KDPB 2K9JA 5KJ7D 1GU4A 4R4LA 1KFMA 3MGNA 2MTAC 2GB8B 3WUIA 1CHIA 1S3JA 1ZR2A 3JC22 1WT6A 1S9KD 1VQMP 1QVFO 2YXQB 4I7ZC 1BSNA 3L36A 4IFDK 2KSJA 2QJPC 5AW8B 1LJ2A 2P7JA 4BRYB 3HE4A 3B5ND 3ZCFA 4GIFA 1URQC 4WBAA 2ZYDA 3H1JE 4FA9A 1RF1C 4LGDE 2H7HA 1ZMEC 1N15A 1IQCA 1H8AA 1F1CA 2B88A 4UB6V 1CW5A 5AW2B 3L75J 1N2DC 2WSFJ 3R4YA 3OA8B 1VF5D 3M0AA 2FYUG 4GODA 5CIEB 3BCCD 1OVUA 4K3AA 3H1KE 3SFDC 3HUSB 1I5TA 3JCUE 2YKQA 2FRCA 2B87A 1QL3A 2WT7A 2QJYB 2AEJA 1H33B 3VOPA 2XTSB 1N9CA 2I8DA 5CICB 1E79H 4FB1A 1SQQD 2L91A 3JBTB 2L4DA 3CC4P 1NTKJ 2B0ZB 1PL5A 5APSA 3KPEA 3TGUD 1CRIA 1PP9D 2KNCB 2ZT9D 1BE3G 4EIJA 1RQUA 1KV9A 4HKZH 2N9BA 4V2KA 1YBKA 1PPJD 2AI5A 4HB1A 4OGQD 2IBZI 5EFWB 1GU2A 1C6RA 3PH2B 4YTPC 2B89A 5BVZA 4JQ0D 1LP1A 4GT1A 3CX5H 1CNOA 1RE4A 4L73A 2RKLA 2E42A 4GKGA 2Q3EA 1T3JA 2IZ0A 3CX5E 4H13C 1RY3A 5KLIC 3RL0D 1M8OB 1N73B 3RL0g 1QX8A 5KAIH 2DGEA 5C9MA 3CCJP 1SQBG 5APWA 3V5BA 1AVOA 3TYYA 1Q7YQ 2OYHB 4GDOA 1JY3N 1LTGC 2R32A 2FYUE 5KAIE 5CCGA 2OTJP 2Y9YA 2G3AA 4OH8B 1MFTA 1LTJA 3MK7B 1ZV8A 3Q5PA 2IZ1A 3O1YA 2GUSA 3CXHI 2OYIB 2B9BA 4W7ZA 1OIPA 3V4WA 2OQQA 1L2PA 1KV4A 1L9JC 1CTZA 1KILC 3WU2V 2ORLA 1L0NK 2P58A 2N1TA 5KAFV 3WFCC 1JTHA 1NAYA 2K3RA 1P84I 2PAJA 1SQPK 1AKKA 1CHJA 2O01J 4H44D 2ZONG 3AE4C 4GOFA 1L0LG 2B12B 2BGVX 2AEMA 2C9XB 1I55A 3P32A 2IDBA 5TISV 3L71D 1EZVI 1YQ4C 2YXRB 1CEDA 3L72J 5CIFB 1BE3E 1M1JB 5CCGD 1BDCA 2H88C 2QIWA 5AVVB 1RAPA 2WVRA 1WEJF 1W5CE 2HFED 3G3ZA 1NU1E 1A8CA 3BCCG 1ZRTD 4O1QA 2KZJA 2ZVNB 3KXDA 4H0LB 5DJQC 3M06A 4RSZA 5CJ4A 4C7RA 4JCGA 2N1TD 4LJIA 4U3FD 5L8RJ 3EQ2A 1NKNA 2FBWC 1QL2A 1BCCD 1SQQG 2IYPA 2OTKE 5CIHB 3SXTA 1HJBA 4AX3A 2R3SA 1FDMA 4XA4A 4HYTB 2M5AB 5KKZB 5TJHA 4WB4A 3CCSP 1SQBE 4Y99B 1CSWA 1S2EA 1DEEG 3PTZA 4GYDA 3B5NB 3WUVA 3HTKA 1FHBA 3P8CD 4QMAA 1LTTC 1T8ZA 4WQ8A 1KQGB 1PPJG 4BRYA 5APXA 2ZVOB 1SQVK 3VMXA 1R0QA 1OMIA 2H43A 2GC7D 1FOSE 4BXLA 1CXAA 1URQA 1NJIQ 1H9YA 1VF5B 1HCMA 3U1AA 2K9JB 1S6VB 1RF1A 2E76C 1KYOI 1Q2NA 3CC2P 3AE9C 5CIDB 3OA8A 1JB0J 1L0LE 1L0NJ 2C1VA 2KIKA 2B10B 1FDIA 2KK7A 2QE7H 1CIHA 4EI2A 3U1CA 1SQPJ 3HUSA 2R3CA 3HE4B 1LT9C 1IO3A 3L73J 3H1KD 5B66H 3PXTA 3O5CA 3L75G 3H1HD 1U7MA 3BCCE 5B66E 1URQD 5AW9B 3M9HA 2YKOA 1PIXA 2AXTV 2LXBA 4RKUJ 3VMAA 4MU8A 1NGMB 3H25A 4OGQB 2QM8A 4C46A 2B87B 1SQQE 2I8FA 4L75A 5AW1B 2WT7B 1RH5B 3CMEP 3V2RA 1KB0A 3AE1C 2WPVB 4N0KA 2D2CB 1CTJA 5AVTB 5AURA 1NTKG 2N9IA 1G1JA 2ZXXA 4PJ0H 2FXPA 1RHZB 1JM0A 2YK3A 2JQRA 1U57A 5M1BA 1AVYA 4PJ0E 3CL3D 3RL0B 4EICA 4WY4C 1J1DC 3CPWO 1QGKB 1SFCB 3P7KA 4NPEA 1X79B 1N8RQ 1S4XA 1HJ4A 1QL4A 1IFIA 3MIWA 1SQVJ 2M3BA 3IN6A 3VP9A 4K3IA 3L4OA 4U3FG 5AVYB 3SWYA 4YXDC 3ZOYA 2E75C 1BCCG 4AALA 1KX7A 1KQLA 3T97A 1AJYA 1H1OA 3NTNA 1HH7A 3WUUA 2FYUD 3HQ8A 2H89C 4AAOA 1MV8A 5AW5B 2OYIA 1E29A 3GW6A 3UIAA 3L4MA 3CCLP 2V7QJ 1COTA 1N7LA 3L73D 3V2NA 3L75E 4H44B 1OXZA 4AAMA 1C75A 1KILA 1RF0C 1S1CX 4UB8H 3I55P 1GL2C 1IRWA 1AFOA 4I6MC 2KOGA 2E5TA 4ZNCA 1BL9A 4UB8E 5AW6B 2PCCB 2WWWA 4A7PA 2JWAA 2YIUC 3Q3DA 1W2LA 3VMZA 2PRRA 3FWNA 2YCCA 4NPDA 1NTKE 1I6DA 2OZ1A 2N1TB 4IL6X 3NBTA 2A45I 3ITKA 4RJTA 1JTHB 1ZLLA 1C2NA 1GZLA 3CC7P 2MJZA 1MZ4A 2B4ZA 5GTHV 2FFDB 1GW3A 1VDFA 2OTLP 1NU1D 2WSSH 4LC1A 1K04A 3TSIA 3HE5A 2RH0A 2B11B 1KILD 2MKVA 5E79H 3TK1A 3M0DC 3H1HG 1VQPP 1CI6A 4HJGH 3HQ6A 1DVVA 1ETPA 5E79E 2M5AA 1ZXGA 2MHMA 3HD7C 1PGOA 4JPZB 1IC2A 4L74A 1KB9E 1EQ7A 1GU5A 1FU1A 4EOTA 2IFNA 3CD6P 1F1FA 1OWAA 1UIXA 2WITA 1X9VA 2KP8A 1L4AC 2JO1A 3NWVA 5APUA 1I54A 3AE5C 2C0WA 3AEDC 2QJKB 2Z5HA 1GW4A 3RK3C 3MD0A 1FZCC 3BASA 3P8CE 3SJLA 5B5EH 1DD3A 3Q5SA 1QYZA 1S5LE 3HTKB 2AXCA 1H88A 2QG4A 2Z5IA 4I7ZB 5B5EE 1JCCA 5AW0B 1K8AQ 1A2SA 2QJPB 1W2BO 1L0LD 2ZOOA 4HH2A 1T6AA 5H2FH 3SSUA 1HWTC 1CSXA 4IFFA 1AV1A 3L70J 1URQB 2LXCB 1YIJP 2K37A 1RF1B 5H2FE 1LNQA 4DT0A 3RK3E 1VQ4P 1CRGA 1P84D 3JCUH 1CHHA 1USDA 3CP5A 1Y8AA 3WUTA 3L72E 3GHGC 5CJ0A 3GF3A 1LTBC 1FZEA 3RBZA 2LR2A 3H1LJ 2E76D 1EZVD 3L73G 3H1HE 1CRJA 1E8EA 4FAVA 3II6A 3VYMA 1J1EC 155CA 2CE1A 1YCCA 3TYIA 1BDDA 5DF5A 2L5GB 3V2QA 2CA4B 2OGUA 4PV1C 5KTBA 5KAFE 3H1ID 2FYNC 3L37A 1JOCA 4WQ7A 1JO5A 1FC2C 3CXHW 1SQXK 2WSCH 3IF4A 3I56P 1ZR4A 2JR8A 1N7SC 4WY4A 3ZOOA 1SFCA 1RE3C 5APYA 3N7NA 5BU8B 3A0BH 3AE2C 1AA0A 1HGVA 1NU1G 2KS1A 1FI7A 2DW3A 3L35A 3AEEC 2D2CD 3LW5J 3BRVB 3A0BE 2JWDA 3A0HV 3KZIE 1QVGO 1HZUA 2ZXYA 1SVFA 2IBZG 2KSEA 2G8YA 4QAOA 2E74C 4H13B 5KLIB 1SP4A 1HH0A 4WY4D 1NNOA 1G2CA 1SFCD 1QLED 3NMDA 5C0ZA 4JYCA 2P1JA 2J59M 1M6ZA 2M8RA 4H0JA 2PGDA 1HUCA 1JY3O 3L75D 1M7LA 2XKMA 4I1LA 1NTZK 1SQPE 1RF0A 1IO4A 1S5LX 2KLVA 5DFSA 1GL2A 1KX2A 3T97B 3L74J 4FA4A 2QM7A 3L73E 5GTIH 3PH0A 1HJ5A 3TNUB 3VTPC 1FZBA 1M1KQ 2ZYAA 4Z1MH 2E75D 3OCDA 2V07A 2QA4P 5GTIE 1KN7A 1M56D 1QKSA 1KILB 1Y9BA 4PD4I 2ZJSE 2HG5D 2N9YB 1NTKD 4Y5RA 5AW7B 2FFDA 1CCHA 4J20A 3LIDA 2JTIB 1AQTA 351CA 3D6YA 3ZOXA 1LTSC 2M0BA 3H1JJ 2FXMA 1SQXJ 1S72P 2K9YA 2W6BA 1GL2D 1YNRA 3M0DA 1NAFA 3AEAC 4D6TJ 2OZ1B 3O20A 4OWFA 4AANA 1KILE 3K5BA 4RESB 1BGYJ 4WQCA 4RO0A 4ZKPA 1M60A 1EZVG 4XFJA 1X0TA 3G9RA 5DJQB 2AXTE 2CXBA 1NKZB 2RMZA 3HE5B 1FI9A 2ZYGA 1KIBA 3AECC 2HV4A 1KB9D 1K73Q 1IK9A 1SLQA 2IBZE 2NPSC 3H32A 1J3SA 1IFNA 1L4AA 2QEXP 1VQKP 1CI6B 2GUVA 3H1IG 4K35A 1GIWA 1VQ9P 1N90A 1H0TA 2HYNA 3PJSK 3FX0A
chains in the Genus database with same CATH topology
1SQBD 4P4QB 4EIFA 1CSUA 1QN2A 1HJ4A 1QL4A 1C2RA 1WVEC 4WQ9A 1S5LV 1DT1A 4K3IA 4GEDB 3L4OA 2C1DA 1CIEA 1NMIA 3L70D 1IRVA 1DW2A 1CC5A 2CA3B 3SWSA 5B5EV 3ZOYA 3DR0A 4AALA 1KX7A 1KYOD 1GKSA 3KHUA 5KAIV 2MTAC 2GB8B 3WUIA 1CHIA 4FA5A 3ZOWA 1H1OA 3O0RC 2PCBB 1HH7A 4XXLA 3WC8A 2FYUD 3HQ8A 4AAOA 1E29A 3GW6A 2DVHA 3DP5A 1DW3A 3L4MA 5H2FV 1MG2D 3H1LD 1COTA 3L73D 1LMSA 1H31A 1CTYA 1LC2A 2RN0A 3ZCFA 4PW9B 4AAMA 3WFEC 1C75A 1RAQA 4FA9A 3MK7C 1IRWA 1HJ3A 3L72D 1B7VA 1N15A 1IQCA 1F1CA 1BL9A 4UB6V 3RMZA 4Q5PA 1FOCA 2PCCB 1HROA 2V08A 4A7PA 2JWAA 4D6TD 3OA8B 1W2LA 4DY9A 3HQ9A 5CIEB 1IZL0 3PHLA 1YICA 3BCCD 1L9BC 1YEAA 1K3GA 2YCCA 1KYOW 1I5TA 1MG3D 1I6DA 1AOFA 2OZ1A 2BCCD 2PACA 2FRCA 5CYTR 3NBTA 3ITKA 4RJTA 2C1UA 1QL3A 2QJYB 1C2NA 1H33B 1MZ4A 4O1WA 2XTSB 2B4ZA 5GTHV 1N9CA 3ZIYA 5CICB 4FB1A 1NU1D 1SQQD 1H9XA 2B11B 2YQBA 2L91A 3JBTB 2L4DA 4XYDB 2B0ZB 2N9JA 3TDKA 1OAEA 3TGUD 2GIWA 451CA 3CU4A 3HQ6A 1DVVA 1CRIA 1FCDC 1PP9D 1ETPA 2BCNB 2KNCB 1CRHA 3C2CA 3A0BV 1KV9A 1DIQC 2MHMA 4FANA 1C7MA 4V2KA 3PXSA 1FI3A 1CRYA 1PPJD 1CXCA 1E2RA 2AI5A 3KZIV 4YE1A 1GU2A 1C6RA 1F1FA 3PH2B 2BH5X 2ZZS1 5IY51 3SLEA 1CNOA 3NWVA 1RZ5A 5EXQA 1I54A 3L74D 2QJKB 3VRDA 2Q3EA 1CIFA 1AOQA 3SJLA 1L0ND 1CO6A 2GC4D 2LIRA 1A56A 1QYZA 1SQPD 3PXWA 2DGEA 2QG4A 5C9MA 2O3JA 3VNWA 3FWLA 3ZBMA 1A2SA 2QJPB 1L0LD 2ZOOA 4PWAA 5GTIV 3SVWA 1CSXA 3H1JD 3MK7B 1SQXD 1LFMA 3RLMA 3O1YA 2AIUA 1CRGA 1K3HA 1P84D 1CHHA 1L9JC 5B66V 3CP5A 1CRCA 1CTZA 3WU2V 2N18C 2YIUB 2ORLA 3OCDB 1LC1A 5KAFV 3WFCC 1OCDA 1BGYD 2Y0EA 3NBSA 1EZVD 1AKKA 1H33A 4H0KA 1NIRA 1CHJA 1GDVA 1CRJA 2ZONG 1E8EA 1H32B 4FAVA 2B12B 2BGVX 3VYMA 2C9XB 155CA 1I55A 2CE1A 1YCCA 3TYIA 1W5CT 1GQ1A 5TISV 3L71D 5DF5A 4WQDA 2CA4B 4WQEA 1RZ6A 1CEDA 3ORVA 5CIFB 3RN1A 2Y0CA 3H1ID 1I8PA 1RAPA 4WQ7A 1CYJA 2ZBOA 3CXHW 1WEJF 1I6EA 1CORA 1CIGA 1A8CA 3PRJA 1EB7A 1YEBA 1ZRTD 4O1QA 4PJ0V 5DJQC 2IBZD 1AYGA 4RSZA 2C8SA 1SQVD 4WQAA 3ZOOA 4JCGA 1DVHA 2D0WA 2EXVA 4LJIA 4U3FD 2BH4X 1GJQA 1NTZD 1BCCD 1CYIA 2KS1A 2BLFB 1FI7A 1LS9A 2VHDA 5CIHB 3SXTA 4AX3A 5KKZB 2D0SA 3A0HV 5KLVD 5TJHA 3CWBD 3PLNA 4EIEA 1CSWA 3PTZA 5CIGB 1HZUA 2ZXYA 4GYDA 1VYDA 3CX5D 1FHBA 4QAOA 1U75B 4WQ8A 1U74B 1C52A 5KLIB 4L3GA 4L1QA 4KMGA 1R0QA 1NNOA 2C1DB 2CE0A 5C0ZA 2GC7D 1M6ZA 1CXAA 4H0JA 3L75D 4EDFA 1H9YA 3CXHD 1N50A 1HCMA 5DFSA 2K9JB 1M70A 1KX2A 1S6VB 2A06D 4FA4A 1DW0A 1C6SA 5CIDB 1HJ5A 4UB8V 1C6OA 3OA8A 3HQ7A 4IL6V 5CIBB 4WQBA 2C1VA 2B10B 3CYTI 1HRCA 1CIHA 3OCDA 4PD4D 2V07A 4L3HA 1DIIC 1H31B 2BPBB 3TF5A 1QKSA 1H32A 1IO3A 5B6QA 2N18B 3H1KD 2N9YB 1CCRA 1NTKD 4Y5RA 3CX5W 3PXTA 1CCHA 1YIQA 4J20A 3O5CA 2JTIB 351CA 1YTCA 3H1HD 3ZOXA 1CYCA 3WFBC 2N3BA 3GG2A 4NFGB 1HZVA 3RN0A 3X39A 2AXTV 3A9FA 1BE3D 1YNRA 3VMAA 1I8OA 1ZZHA 4MU8A 2LITA 2FYNB 2OZ1B 3O20A 1NTMD 3WFDC 4EIDA 4FA1A 5E79V 2I8FA 4AANA 2C2CA 1KB0A 4WQCA 1M60A 4N0KA 1CTJA 5AURA 5DJQB 2CXBA 1FJ0A 2RMZA 1DW1A 1FI9A 1KIBA 2N9IA 3M97X 2HV4A 1KB9D 3DMIA 2Y0DA 1JDLA 1NMLA 2YK3A 1J3SA 2FWLA 2JQRA 1CSVA 1GIWA 4EICA 1N90A 2N3YA 1YFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQB D;  4P4Q B;  4EIF A;  1CSU A;  1QN2 A;  1HJ4 A;  1QL4 A;  1C2R A;  1WVE C;  4WQ9 A;  1S5L V;  1DT1 A;  4K3I A;  4GED B;  3L4O A;  2C1D A;  1CIE A;  1NMI A;  3L70 D;  1IRV A;  1DW2 A;  1CC5 A;  2CA3 B;  3SWS A;  5B5E V;  3ZOY A;  3DR0 A;  4AAL A;  1KX7 A;  1KYO D;  1GKS A;  3KHU A;  5KAI V;  2MTA C;  2GB8 B;  3WUI A;  1CHI A;  4FA5 A;  3ZOW A;  1H1O A;  3O0R C;  2PCB B;  1HH7 A;  4XXL A;  3WC8 A;  2FYU D;  3HQ8 A;  4AAO A;  1E29 A;  3GW6 A;  2DVH A;  3DP5 A;  1DW3 A;  3L4M A;  5H2F V;  1MG2 D;  3H1L D;  1COT A;  3L73 D;  1LMS A;  1H31 A;  1CTY A;  1LC2 A;  2RN0 A;  3ZCF A;  4PW9 B;  4AAM A;  3WFE C;  1C75 A;  1RAQ A;  4FA9 A;  3MK7 C;  1IRW A;  1HJ3 A;  3L72 D;  1B7V A;  1N15 A;  1IQC A;  1F1C A;  1BL9 A;  4UB6 V;  3RMZ A;  4Q5P A;  1FOC A;  2PCC B;  1HRO A;  2V08 A;  4A7P A;  2JWA A;  4D6T D;  3OA8 B;  1W2L A;  4DY9 A;  3HQ9 A;  5CIE B;  1IZL 0;  3PHL A;  1YIC A;  3BCC D;  1L9B C;  1YEA A;  1K3G A;  2YCC A;  1KYO W;  1I5T A;  1MG3 D;  1I6D A;  1AOF A;  2OZ1 A;  2BCC D;  2PAC A;  2FRC A;  5CYT R;  3NBT A;  3ITK A;  4RJT A;  2C1U A;  1QL3 A;  2QJY B;  1C2N A;  1H33 B;  1MZ4 A;  4O1W A;  2XTS B;  2B4Z A;  5GTH V;  1N9C A;  3ZIY A;  5CIC B;  4FB1 A;  1NU1 D;  1SQQ D;  1H9X A;  2B11 B;  2YQB A;  2L91 A;  3JBT B;  2L4D A;  4XYD B;  2B0Z B;  2N9J A;  3TDK A;  1OAE A;  3TGU D;  2GIW A;  451C A;  3CU4 A;  3HQ6 A;  1DVV A;  1CRI A;  1FCD C;  1PP9 D;  1ETP A;  2BCN B;  2KNC B;  1CRH A;  3C2C A;  3A0B V;  1KV9 A;  1DIQ C;  2MHM A;  4FAN A;  1C7M A;  4V2K A;  3PXS A;  1FI3 A;  1CRY A;  1PPJ D;  1CXC A;  1E2R A;  2AI5 A;  3KZI V;  4YE1 A;  1GU2 A;  1C6R A;  1F1F A;  3PH2 B;  2BH5 X;  2ZZS 1;  5IY5 1;  3SLE A;  1CNO A;  3NWV A;  1RZ5 A;  5EXQ A;  1I54 A;  3L74 D;  2QJK B;  3VRD A;  2Q3E A;  1CIF A;  1AOQ A;  3SJL A;  1L0N D;  1CO6 A;  2GC4 D;  2LIR A;  1A56 A;  1QYZ A;  1SQP D;  3PXW A;  2DGE A;  2QG4 A;  5C9M A;  2O3J A;  3VNW A;  3FWL A;  3ZBM A;  1A2S A;  2QJP B;  1L0L D;  2ZOO A;  4PWA A;  5GTI V;  3SVW A;  1CSX A;  3H1J D;  3MK7 B;  1SQX D;  1LFM A;  3RLM A;  3O1Y A;  2AIU A;  1CRG A;  1K3H A;  1P84 D;  1CHH A;  1L9J C;  5B66 V;  3CP5 A;  1CRC A;  1CTZ A;  3WU2 V;  2N18 C;  2YIU B;  2ORL A;  3OCD B;  1LC1 A;  5KAF V;  3WFC C;  1OCD A;  1BGY D;  2Y0E A;  3NBS A;  1EZV D;  1AKK A;  1H33 A;  4H0K A;  1NIR A;  1CHJ A;  1GDV A;  1CRJ A;  2ZON G;  1E8E A;  1H32 B;  4FAV A;  2B12 B;  2BGV X;  3VYM A;  2C9X B;  155C A;  1I55 A;  2CE1 A;  1YCC A;  3TYI A;  1W5C T;  1GQ1 A;  5TIS V;  3L71 D;  5DF5 A;  4WQD A;  2CA4 B;  4WQE A;  1RZ6 A;  1CED A;  3ORV A;  5CIF B;  3RN1 A;  2Y0C A;  3H1I D;  1I8P A;  1RAP A;  4WQ7 A;  1CYJ A;  2ZBO A;  3CXH W;  1WEJ F;  1I6E A;  1COR A;  1CIG A;  1A8C A;  3PRJ A;  1EB7 A;  1YEB A;  1ZRT D;  4O1Q A;  4PJ0 V;  5DJQ C;  2IBZ D;  1AYG A;  4RSZ A;  2C8S A;  1SQV D;  4WQA A;  3ZOO A;  4JCG A;  1DVH A;  2D0W A;  2EXV A;  4LJI A;  4U3F D;  2BH4 X;  1GJQ A;  1NTZ D;  1BCC D;  1CYI A;  2KS1 A;  2BLF B;  1FI7 A;  1LS9 A;  2VHD A;  5CIH B;  3SXT A;  4AX3 A;  5KKZ B;  2D0S A;  3A0H V;  5KLV D;  5TJH A;  3CWB D;  3PLN A;  4EIE A;  1CSW A;  3PTZ A;  5CIG B;  1HZU A;  2ZXY A;  4GYD A;  1VYD A;  3CX5 D;  1FHB A;  4QAO A;  1U75 B;  4WQ8 A;  1U74 B;  1C52 A;  5KLI B;  4L3G A;  4L1Q A;  4KMG A;  1R0Q A;  1NNO A;  2C1D B;  2CE0 A;  5C0Z A;  2GC7 D;  1M6Z A;  1CXA A;  4H0J A;  3L75 D;  4EDF A;  1H9Y A;  3CXH D;  1N50 A;  1HCM A;  5DFS A;  2K9J B;  1M70 A;  1KX2 A;  1S6V B;  2A06 D;  4FA4 A;  1DW0 A;  1C6S A;  5CID B;  1HJ5 A;  4UB8 V;  1C6O A;  3OA8 A;  3HQ7 A;  4IL6 V;  5CIB B;  4WQB A;  2C1V A;  2B10 B;  3CYT I;  1HRC A;  1CIH A;  3OCD A;  4PD4 D;  2V07 A;  4L3H A;  1DII C;  1H31 B;  2BPB B;  3TF5 A;  1QKS A;  1H32 A;  1IO3 A;  5B6Q A;  2N18 B;  3H1K D;  2N9Y B;  1CCR A;  1NTK D;  4Y5R A;  3CX5 W;  3PXT A;  1CCH A;  1YIQ A;  4J20 A;  3O5C A;  2JTI B;  351C A;  1YTC A;  3H1H D;  3ZOX A;  1CYC A;  3WFB C;  2N3B A;  3GG2 A;  4NFG B;  1HZV A;  3RN0 A;  3X39 A;  2AXT V;  3A9F A;  1BE3 D;  1YNR A;  3VMA A;  1I8O A;  1ZZH A;  4MU8 A;  2LIT A;  2FYN B;  2OZ1 B;  3O20 A;  1NTM D;  3WFD C;  4EID A;  4FA1 A;  5E79 V;  2I8F A;  4AAN A;  2C2C A;  1KB0 A;  4WQC A;  1M60 A;  4N0K A;  1CTJ A;  5AUR A;  5DJQ B;  2CXB A;  1FJ0 A;  2RMZ A;  1DW1 A;  1FI9 A;  1KIB A;  2N9I A;  3M97 X;  2HV4 A;  1KB9 D;  3DMI A;  2Y0D A;  1JDL A;  1NML A;  2YK3 A;  1J3S A;  2FWL A;  2JQR A;  1CSV A;  1GIW A;  4EIC A;  1N90 A;  2N3Y A;  1YFC A; 
#chains in the Genus database with same CATH topology
 3RGU A;  1M57 D;  3JSV C;  1CSU A;  1QN2 A;  3C9I A;  3CCM P;  1IFP A;  1C2R A;  4ASW A;  1NTM K;  1KC8 Q;  1DT1 A;  3BRT B;  2C1D A;  2W27 A;  1CIE A;  1CC5 A;  1NTZ J;  2HLO A;  2W83 C;  3DR0 A;  3OA7 A;  4WWI A;  3E7K A;  3USS A;  3KHU A;  4AYC A;  5KAI V;  4FA5 A;  3O0R C;  1HBW A;  3VN0 A;  3CXH H;  1LWU C;  3WC8 A;  3EWK A;  1L4A D;  2KI7 B;  2DVH A;  3DP5 A;  2E76 B;  1YTZ T;  1MG2 D;  2CPB A;  1LMS A;  1H31 A;  5KLV K;  3CXH E;  5AVU B;  3RK3 D;  1FOS F;  4AQR D;  1P84 H;  1RAQ A;  3GHG A;  3L70 G;  4IL6 H;  3S9O A;  5CBN A;  1HJ3 A;  3L72 D;  1LT1 A;  2ZXE B;  1LT9 B;  3RMZ A;  1HVV A;  4IOI H;  4W80 A;  1P84 E;  1FOC A;  1NVO A;  4IL6 E;  3D71 A;  1HRO A;  4D6T D;  1CZQ A;  4DY9 A;  5AVR B;  3HQ9 A;  1L9B C;  1YEA A;  2OAR A;  1EZV E;  1IK7 A;  1VQ6 P;  1MG3 D;  1CSB A;  2GM4 A;  1AOF A;  4WVZ A;  4O1W A;  2FXO A;  2ZT9 C;  3ZIY A;  3GLM A;  1N7S A;  1H9X A;  3H1I E;  1EC5 A;  1JY2 O;  1RE3 A;  4JF7 A;  3OJA B;  1ZOY C;  2GIW A;  5CCH C;  3CU4 A;  1FJP A;  1JY3 P;  4KHX A;  2QRX A;  1FCD C;  3CMA P;  2BCN B;  5GTH E;  1KFN A;  5AVW B;  2O01 N;  3C2C A;  2WSE J;  4FAN A;  1X8Y A;  3PXS A;  1CRY A;  3M9B A;  3RK2 C;  4WY4 B;  1NTM J;  1J1D B;  4YE1 A;  2NZ2 A;  4NPF X;  3KQG A;  2BH5 X;  1XTG B;  3B71 A;  2ZZS 1;  5IY5 1;  1EDL A;  3SLE A;  2KS1 B;  1RZ5 A;  3CLQ A;  4B86 A;  1ZP0 C;  1E5W A;  2XU6 A;  1Q81 Q;  1N7S D;  2YNY A;  3MHV A;  1YHQ P;  1CIF A;  5DJT B;  1AOQ A;  1W2E A;  2E75 B;  2I1K A;  3MZW B;  1VQ8 P;  1L0N D;  2KLU A;  1CO6 A;  1GDT A;  3C8V A;  3L70 E;  1SQP D;  2WSF H;  4Y28 J;  3TNU A;  1A02 F;  5KLV J;  1NO4 A;  2IX7 C;  3CWB J;  1MKM A;  1RE4 C;  1KYO E;  2O3J A;  3VNW A;  1UII A;  2XNX A;  1G2C B;  4PWA A;  4H13 D;  1YYC A;  3SFE C;  3RLM A;  4H44 C;  1GL2 B;  2GA1 A;  2Q5U A;  1FS0 E;  1KOR A;  1OW7 A;  4UB6 H;  2KUB A;  5B66 V;  1CRC A;  2N18 C;  1YTZ I;  2YIU B;  3OCD B;  3S1K A;  2K1A A;  2Y0E A;  1LTJ C;  3KYQ A;  5CMZ A;  1GDV A;  4UB6 E;  4I2L C;  1W5C T;  2KXP B;  4WQD A;  4WQE A;  1EXJ A;  1RZ6 A;  3L72 G;  1OFC X;  1WRG A;  3ORV A;  1SQX G;  3MUD C;  3RN1 A;  4JYB A;  3AEF C;  2ZBO A;  4ASV A;  4D6T G;  3W68 A;  1COR A;  1CIG A;  2A45 G;  2HOD B;  4R4M A;  2NPS A;  1KB9 H;  3BCC J;  1EB7 A;  1YEB A;  1K05 A;  4XE5 B;  4GOE A;  1BGY G;  4PJ0 V;  1EDI A;  2IBZ D;  1SQV D;  2ITA A;  4ZMD A;  3N4X A;  2EXV A;  3HD7 B;  2BH4 X;  1GJQ A;  1NYH A;  1MZ9 A;  4YPC A;  2XZR A;  1CYI A;  3BVH A;  1LTI C;  2VHD A;  2C0X A;  3H32 B;  1LTA C;  2BEQ D;  1VQ5 P;  3TGU J;  1L4A B;  2O1K A;  4N78 E;  5KLV D;  3NFQ A;  3AE6 C;  2OYO A;  1S5L H;  3CWB D;  1H0T B;  1PP9 J;  3AEG C;  3H6P A;  3RK3 B;  1NH4 A;  2QVA A;  1R5L A;  1FZC B;  5APV A;  2NPS D;  2WQY C;  1U75 B;  3CCR P;  1YIT P;  3E1I A;  1FDO A;  1YJW P;  1NTZ G;  1OZH A;  3CX5 I;  2C1D B;  1FZA A;  2AEF A;  3VYI A;  1HTL C;  1XTC C;  2O01 H;  4ZKU A;  4KT0 J;  3CXH D;  2IFM A;  2Q7C A;  2ZFC A;  1LT9 A;  3B4S A;  1A02 J;  3A3Y B;  2A06 D;  2JJL A;  1C6S A;  1DW0 A;  1OVR A;  3R2P A;  1KQS O;  4MN4 C;  1JY2 P;  1H89 A;  1NOH A;  1T3U A;  3EFG A;  4UB8 V;  1C6O A;  5C39 A;  3HQ7 A;  2ZAE B;  5CIB B;  3V4Q A;  4WQB A;  1L0N G;  3CYT I;  4PD4 D;  1SQP G;  2POH A;  1DII C;  1H31 B;  2Q6Q A;  5BU5 A;  2XND H;  1FBM A;  1SQX E;  2A45 H;  1H32 A;  2FYZ A;  3GHG B;  2H8P D;  5AVX B;  3WU2 H;  1YIQ A;  4D6T E;  3D70 A;  1GTW A;  5KAF H;  1IFJ A;  2IPP A;  1LGH B;  3CI9 A;  1CYC A;  4U7J A;  3WFB C;  2N3B A;  1J1E B;  3HUS C;  1BGY E;  3RN0 A;  2HPC A;  3WU2 E;  5TIS H;  2QJY C;  1OW6 A;  1I8O A;  4PV1 B;  1PGJ A;  2LIT A;  1JUN A;  2JDI H;  2FYN B;  5CCH A;  1KTM A;  3LIE A;  1FZF A;  4CPG A;  3CCU P;  4FA1 A;  3L4F A;  5E79 V;  5TIS E;  1X22 A;  2C2C A;  2XDJ A;  1VQN P;  2BCC J;  2Q9I A;  4N3Y B;  1DD4 A;  3S4R A;  1N7S B;  3M97 X;  1M90 Q;  3L71 J;  3DMI A;  1KQF B;  2Y0D A;  4TLF A;  3KZI H;  3F5H A;  2N3Y A;  1RQV A;  3CCE P;  1NTZ E;  1N86 A;  1NTM G;  2SPZ A;  3U59 A;  4P4Q B;  4C7N B;  3AE8 C;  5CCH D;  2VRS A;  4WQ9 A;  1SQV G;  1S5L V;  4U3F J;  3L70 D;  1DW2 A;  2E74 B;  1BSH A;  3SWS A;  5B5E V;  2P10 A;  2W90 A;  4LLH A;  1BCC J;  1DH3 A;  3D0W A;  2CK3 H;  2FY8 A;  1KYO D;  1L0N E;  3RK2 D;  4DZO A;  5K5G B;  3CCQ P;  1GKS A;  4KJM A;  2E43 A;  1N73 C;  3ZOW A;  2PCB B;  2KB7 P;  4XXL A;  5KLV G;  1T2K C;  3CWB G;  1DW3 A;  3FXD A;  5H2F V;  2OYH C;  3H1L D;  1FJK A;  1CTY A;  1LC2 A;  2RN0 A;  1MFZ A;  3E1R A;  4PW9 B;  4YXW H;  1HGZ A;  3A5T A;  3QH9 A;  3WFE C;  5APT A;  3MK7 C;  1PV3 A;  1ZN5 A;  1VQL P;  1B7V A;  2OYI C;  2NRG A;  4Q5P A;  1TU3 F;  2KZI A;  3IR9 A;  2V08 A;  2E5Y A;  2R44 A;  3IFM A;  2A06 G;  4AUW A;  3GMA A;  3PHL A;  1IZL 0;  1YIC A;  3MUD A;  1PGQ A;  1KMI Z;  3FGA D;  3MTU E;  1K3G A;  1KYO W;  1R5S A;  1R8E A;  2PAC A;  2BCC D;  2FYU K;  2HOD A;  5CYT R;  2WSE H;  1VL2 A;  2C1U A;  2AXT H;  4DOJ A;  1JCD A;  1M1J C;  3A7O A;  1PZQ A;  1YJN P;  1K9M Q;  3HD7 A;  2YQB A;  3O8Z A;  3H1K J;  2YKP A;  4XYD B;  3WMM 0;  4TT3 H;  2N9J A;  2R5D A;  3TDK A;  1OAE A;  3O6Q B;  1NTM E;  3H1H J;  451C A;  1OW8 A;  2WMM A;  4H0L C;  4N6J A;  1SQV E;  1CRH A;  3A0B V;  1DIQ C;  2NPS B;  1C7M A;  1FI3 A;  3OW2 O;  1CXC A;  1E2R A;  3KZI V;  5KJ7 C;  4N78 D;  1Q90 D;  1FZC A;  1AQ5 A;  3Q1M A;  3FXE A;  2YO3 A;  2V7Q H;  2KYV A;  5KKZ C;  1IFD A;  5DJU B;  5EXQ A;  5KLV E;  3AEB C;  1FZG A;  1NU1 K;  2WSC J;  3AE3 C;  3NXS A;  3TGU G;  3L74 D;  3CWB E;  3HD7 D;  4Y99 C;  1QEX A;  2Y9Z A;  1EDJ A;  2UWJ E;  3VRD A;  3B5N C;  2R5B A;  1YI2 P;  1PP9 G;  2CPS A;  1Y47 A;  2V4H A;  2GC4 D;  2LIR A;  1A56 A;  1U7J A;  1OVV A;  3PXW A;  1IFM A;  1NHL A;  3OAK A;  1LWU B;  3A2A A;  1QL1 A;  3FWL A;  1VF5 C;  1VQ7 P;  3ZDM A;  3ZBM A;  1VQO P;  2K88 A;  5GTI V;  3SVW A;  2A06 E;  1S9K E;  1SQB K;  4PD4 H;  3GF7 A;  1J2J B;  3C1L A;  1YJ9 P;  3H1J D;  1SS1 A;  1SQX D;  1LFM A;  3I5C A;  3M9Q A;  1KD1 Q;  3G4S P;  2AIU A;  4PD4 E;  1K3H A;  3V6I A;  2FYU J;  1ZW0 A;  2M3E A;  1LC1 A;  2I1J A;  1OCD A;  1BGY D;  3H1L G;  3NBS A;  1HJ0 A;  1DEB A;  3P8M C;  1H33 A;  4H0K A;  1NIR A;  3RBX A;  5CBO A;  3VMY A;  2WPQ A;  1H32 B;  1YQ3 C;  1GQ1 A;  3MP7 B;  2W6J H;  3PP5 A;  2BAS A;  2P67 A;  3G6E P;  1L0L K;  2W8Z A;  2ZT9 B;  1DX7 A;  3SWF A;  2Y0C A;  5GTH H;  2C9L Y;  2HPC B;  1I8P A;  4OGQ C;  1CYJ A;  1G1I A;  2KNC A;  1I6E A;  3F89 A;  1IJD B;  3PRJ A;  2D2C C;  4M3L A;  2Q3I A;  4W7Y A;  1AYG A;  1BE3 J;  2BCC G;  4L76 A;  2C8S A;  1GK6 A;  4WQA A;  2WPR A;  2HR3 A;  3TGU E;  4PV1 D;  2WZ7 A;  1DVH A;  1JY2 N;  2D0W A;  1EXI A;  4C7N A;  3L71 G;  1NTZ D;  1GMJ A;  3HRN A;  1PP9 E;  4OVN F;  2PFX A;  3RK2 B;  1NU1 J;  2BLF B;  3RL0 C;  1LS9 A;  5AVQ B;  3AE7 C;  1KB9 I;  2YMK A;  4DJG A;  2BEZ F;  1SQQ K;  1PPJ E;  2Q1K A;  1SFC C;  2D0S A;  2W6A A;  3PLN A;  3QWO C;  4EIE A;  5CIG B;  2J5U A;  1KYO H;  1N73 A;  1VYD A;  3CX5 D;  2WPS A;  1D7M A;  1U74 B;  1C52 A;  4L3G A;  2OYH A;  1KZU B;  1LP1 B;  4L1Q A;  4KMG A;  4IFM A;  2CE0 A;  1SQB J;  1VPC A;  1JEK A;  1Q86 Q;  2YO2 A;  4EDF A;  2Z4E A;  1N50 A;  3VP8 A;  1FAV A;  1M70 A;  2IYO A;  4BWN A;  3L74 G;  3W67 A;  2E74 D;  2J58 A;  3H1L E;  4O9B A;  2O1J A;  1USE A;  1HF9 A;  5CHX A;  4IL6 V;  1PFI A;  1HRC A;  1JMB A;  4L3H A;  2WTY A;  3EFF K;  3M91 A;  2BPB B;  5CCG C;  3TF5 A;  5B6Q A;  2N18 B;  1T2K D;  1CCR A;  1GK4 A;  3CX5 W;  2PP6 A;  1LTJ B;  3BAT A;  1L0L J;  1YTC A;  2JP3 A;  1M1J A;  2C9N Y;  3GG2 A;  2XV5 A;  3H1J G;  4EYY Q;  4NFG B;  1HZV A;  4DCK A;  1DIP A;  2BCC E;  3O6Q A;  3X39 A;  2N1T C;  3A9F A;  1BE3 D;  5AW3 B;  1ZZH A;  1JNM A;  3LW5 H;  3L71 E;  2FFD C;  5APQ A;  1Q82 Q;  1NTM D;  3WFD C;  1WMK A;  4EID A;  5AVS B;  4JBZ A;  1Z56 A;  1JMM A;  3ABV C;  1PGP A;  3H1K G;  1GD2 E;  3Q5R A;  2P2U A;  1FJ0 A;  3V2P A;  2FKW B;  1DW1 A;  5KJ7 A;  2YMY A;  1MUU A;  3Q2Y A;  1NWQ A;  1NTK K;  1IZN B;  1ZRT E;  1JDL A;  1SQQ J;  1NML A;  2LKM A;  2FWL A;  2JKV A;  3D6Z A;  5AVZ B;  3SWK A;  1CSV A;  3H1I J;  5AW4 B;  4U3F E;  3IAO A;  1OX3 A;  1YFC A;  3CCV P;  2JEE A;  1BCC E;  3B5N A;  1EDK A;  1SQB D;  2QSI A;  4EIF A;  3A0H H;  4H0L D;  1WVE C;  1LWU A;  3G71 P;  3L74 E;  4GED B;  1NMI A;  1FE6 A;  2QJK C;  1IRV A;  2CA3 B;  3B8E B;  3A0H E;  3KDP B;  2K9J A;  5KJ7 D;  1GU4 A;  4R4L A;  1KFM A;  3MGN A;  2MTA C;  2GB8 B;  3WUI A;  1CHI A;  1S3J A;  1ZR2 A;  3JC2 2;  1WT6 A;  1S9K D;  1VQM P;  1QVF O;  2YXQ B;  4I7Z C;  1BSN A;  3L36 A;  4IFD K;  2KSJ A;  2QJP C;  5AW8 B;  1LJ2 A;  2P7J A;  4BRY B;  3HE4 A;  3B5N D;  3ZCF A;  4GIF A;  1URQ C;  4WBA A;  2ZYD A;  3H1J E;  4FA9 A;  1RF1 C;  4LGD E;  2H7H A;  1ZME C;  1N15 A;  1IQC A;  1H8A A;  1F1C A;  2B88 A;  4UB6 V;  1CW5 A;  5AW2 B;  3L75 J;  1N2D C;  2WSF J;  3R4Y A;  3OA8 B;  1VF5 D;  3M0A A;  2FYU G;  4GOD A;  5CIE B;  3BCC D;  1OVU A;  4K3A A;  3H1K E;  3SFD C;  3HUS B;  1I5T A;  3JCU E;  2YKQ A;  2FRC A;  2B87 A;  1QL3 A;  2WT7 A;  2QJY B;  2AEJ A;  1H33 B;  3VOP A;  2XTS B;  1N9C A;  2I8D A;  5CIC B;  1E79 H;  4FB1 A;  1SQQ D;  2L91 A;  3JBT B;  2L4D A;  3CC4 P;  1NTK J;  2B0Z B;  1PL5 A;  5APS A;  3KPE A;  3TGU D;  1CRI A;  1PP9 D;  2KNC B;  2ZT9 D;  1BE3 G;  4EIJ A;  1RQU A;  1KV9 A;  4HKZ H;  2N9B A;  4V2K A;  1YBK A;  1PPJ D;  2AI5 A;  4HB1 A;  4OGQ D;  2IBZ I;  5EFW B;  1GU2 A;  1C6R A;  3PH2 B;  4YTP C;  2B89 A;  5BVZ A;  4JQ0 D;  1LP1 A;  4GT1 A;  3CX5 H;  1CNO A;  1RE4 A;  4L73 A;  2RKL A;  2E42 A;  4GKG A;  2Q3E A;  1T3J A;  2IZ0 A;  3CX5 E;  4H13 C;  1RY3 A;  5KLI C;  3RL0 D;  1M8O B;  1N73 B;  3RL0 g;  1QX8 A;  5KAI H;  2DGE A;  5C9M A;  3CCJ P;  1SQB G;  5APW A;  3V5B A;  1AVO A;  3TYY A;  1Q7Y Q;  2OYH B;  4GDO A;  1JY3 N;  1LTG C;  2R32 A;  2FYU E;  5KAI E;  5CCG A;  2OTJ P;  2Y9Y A;  2G3A A;  4OH8 B;  1MFT A;  1LTJ A;  3MK7 B;  1ZV8 A;  3Q5P A;  2IZ1 A;  3O1Y A;  2GUS A;  3CXH I;  2OYI B;  2B9B A;  4W7Z A;  1OIP A;  3V4W A;  2OQQ A;  1L2P A;  1KV4 A;  1L9J C;  1CTZ A;  1KIL C;  3WU2 V;  2ORL A;  1L0N K;  2P58 A;  2N1T A;  5KAF V;  3WFC C;  1JTH A;  1NAY A;  2K3R A;  1P84 I;  2PAJ A;  1SQP K;  1AKK A;  1CHJ A;  2O01 J;  4H44 D;  2ZON G;  3AE4 C;  4GOF A;  1L0L G;  2B12 B;  2BGV X;  2AEM A;  2C9X B;  1I55 A;  3P32 A;  2IDB A;  5TIS V;  3L71 D;  1EZV I;  1YQ4 C;  2YXR B;  1CED A;  3L72 J;  5CIF B;  1BE3 E;  1M1J B;  5CCG D;  1BDC A;  2H88 C;  2QIW A;  5AVV B;  1RAP A;  2WVR A;  1WEJ F;  1W5C E;  2HFE D;  3G3Z A;  1NU1 E;  1A8C A;  3BCC G;  1ZRT D;  4O1Q A;  2KZJ A;  2ZVN B;  3KXD A;  4H0L B;  5DJQ C;  3M06 A;  4RSZ A;  5CJ4 A;  4C7R A;  4JCG A;  2N1T D;  4LJI A;  4U3F D;  5L8R J;  3EQ2 A;  1NKN A;  2FBW C;  1QL2 A;  1BCC D;  1SQQ G;  2IYP A;  2OTK E;  5CIH B;  3SXT A;  1HJB A;  4AX3 A;  2R3S A;  1FDM A;  4XA4 A;  4HYT B;  2M5A B;  5KKZ B;  5TJH A;  4WB4 A;  3CCS P;  1SQB E;  4Y99 B;  1CSW A;  1S2E A;  1DEE G;  3PTZ A;  4GYD A;  3B5N B;  3WUV A;  3HTK A;  1FHB A;  3P8C D;  4QMA A;  1LTT C;  1T8Z A;  4WQ8 A;  1KQG B;  1PPJ G;  4BRY A;  5APX A;  2ZVO B;  1SQV K;  3VMX A;  1R0Q A;  1OMI A;  2H43 A;  2GC7 D;  1FOS E;  4BXL A;  1CXA A;  1URQ A;  1NJI Q;  1H9Y A;  1VF5 B;  1HCM A;  3U1A A;  2K9J B;  1S6V B;  1RF1 A;  2E76 C;  1KYO I;  1Q2N A;  3CC2 P;  3AE9 C;  5CID B;  3OA8 A;  1JB0 J;  1L0L E;  1L0N J;  2C1V A;  2KIK A;  2B10 B;  1FDI A;  2KK7 A;  2QE7 H;  1CIH A;  4EI2 A;  3U1C A;  1SQP J;  3HUS A;  2R3C A;  3HE4 B;  1LT9 C;  1IO3 A;  3L73 J;  3H1K D;  5B66 H;  3PXT A;  3O5C A;  3L75 G;  3H1H D;  1U7M A;  3BCC E;  5B66 E;  1URQ D;  5AW9 B;  3M9H A;  2YKO A;  1PIX A;  2AXT V;  2LXB A;  4RKU J;  3VMA A;  4MU8 A;  1NGM B;  3H25 A;  4OGQ B;  2QM8 A;  4C46 A;  2B87 B;  1SQQ E;  2I8F A;  4L75 A;  5AW1 B;  2WT7 B;  1RH5 B;  3CME P;  3V2R A;  1KB0 A;  3AE1 C;  2WPV B;  4N0K A;  2D2C B;  1CTJ A;  5AVT B;  5AUR A;  1NTK G;  2N9I A;  1G1J A;  2ZXX A;  4PJ0 H;  2FXP A;  1RHZ B;  1JM0 A;  2YK3 A;  2JQR A;  1U57 A;  5M1B A;  1AVY A;  4PJ0 E;  3CL3 D;  3RL0 B;  4EIC A;  4WY4 C;  1J1D C;  3CPW O;  1QGK B;  1SFC B;  3P7K A;  4NPE A;  1X79 B;  1N8R Q;  1S4X A;  1HJ4 A;  1QL4 A;  1IFI A;  3MIW A;  1SQV J;  2M3B A;  3IN6 A;  3VP9 A;  4K3I A;  3L4O A;  4U3F G;  5AVY B;  3SWY A;  4YXD C;  3ZOY A;  2E75 C;  1BCC G;  4AAL A;  1KX7 A;  1KQL A;  3T97 A;  1AJY A;  1H1O A;  3NTN A;  1HH7 A;  3WUU A;  2FYU D;  3HQ8 A;  2H89 C;  4AAO A;  1MV8 A;  5AW5 B;  2OYI A;  1E29 A;  3GW6 A;  3UIA A;  3L4M A;  3CCL P;  2V7Q J;  1COT A;  1N7L A;  3L73 D;  3V2N A;  3L75 E;  4H44 B;  1OXZ A;  4AAM A;  1C75 A;  1KIL A;  1RF0 C;  1S1C X;  4UB8 H;  3I55 P;  1GL2 C;  1IRW A;  1AFO A;  4I6M C;  2KOG A;  2E5T A;  4ZNC A;  1BL9 A;  4UB8 E;  5AW6 B;  2PCC B;  2WWW A;  4A7P A;  2JWA A;  2YIU C;  3Q3D A;  1W2L A;  3VMZ A;  2PRR A;  3FWN A;  2YCC A;  4NPD A;  1NTK E;  1I6D A;  2OZ1 A;  2N1T B;  4IL6 X;  3NBT A;  2A45 I;  3ITK A;  4RJT A;  1JTH B;  1ZLL A;  1C2N A;  1GZL A;  3CC7 P;  2MJZ A;  1MZ4 A;  2B4Z A;  5GTH V;  2FFD B;  1GW3 A;  1VDF A;  2OTL P;  1NU1 D;  2WSS H;  4LC1 A;  1K04 A;  3TSI A;  3HE5 A;  2RH0 A;  2B11 B;  1KIL D;  2MKV A;  5E79 H;  3TK1 A;  3M0D C;  3H1H G;  1VQP P;  1CI6 A;  4HJG H;  3HQ6 A;  1DVV A;  1ETP A;  5E79 E;  2M5A A;  1ZXG A;  2MHM A;  3HD7 C;  1PGO A;  4JPZ B;  1IC2 A;  4L74 A;  1KB9 E;  1EQ7 A;  1GU5 A;  1FU1 A;  4EOT A;  2IFN A;  3CD6 P;  1F1F A;  1OWA A;  1UIX A;  2WIT A;  1X9V A;  2KP8 A;  1L4A C;  2JO1 A;  3NWV A;  5APU A;  1I54 A;  3AE5 C;  2C0W A;  3AED C;  2QJK B;  2Z5H A;  1GW4 A;  3RK3 C;  3MD0 A;  1FZC C;  3BAS A;  3P8C E;  3SJL A;  5B5E H;  1DD3 A;  3Q5S A;  1QYZ A;  1S5L E;  3HTK B;  2AXC A;  1H88 A;  2QG4 A;  2Z5I A;  4I7Z B;  5B5E E;  1JCC A;  5AW0 B;  1K8A Q;  1A2S A;  2QJP B;  1W2B O;  1L0L D;  2ZOO A;  4HH2 A;  1T6A A;  5H2F H;  3SSU A;  1HWT C;  1CSX A;  4IFF A;  1AV1 A;  3L70 J;  1URQ B;  2LXC B;  1YIJ P;  2K37 A;  1RF1 B;  5H2F E;  1LNQ A;  4DT0 A;  3RK3 E;  1VQ4 P;  1CRG A;  1P84 D;  3JCU H;  1CHH A;  1USD A;  3CP5 A;  1Y8A A;  3WUT A;  3L72 E;  3GHG C;  5CJ0 A;  3GF3 A;  1LTB C;  1FZE A;  3RBZ A;  2LR2 A;  3H1L J;  2E76 D;  1EZV D;  3L73 G;  3H1H E;  1CRJ A;  1E8E A;  4FAV A;  3II6 A;  3VYM A;  1J1E C;  155C A;  2CE1 A;  1YCC A;  3TYI A;  1BDD A;  5DF5 A;  2L5G B;  3V2Q A;  2CA4 B;  2OGU A;  4PV1 C;  5KTB A;  5KAF E;  3H1I D;  2FYN C;  3L37 A;  1JOC A;  4WQ7 A;  1JO5 A;  1FC2 C;  3CXH W;  1SQX K;  2WSC H;  3IF4 A;  3I56 P;  1ZR4 A;  2JR8 A;  1N7S C;  4WY4 A;  3ZOO A;  1SFC A;  1RE3 C;  5APY A;  3N7N A;  5BU8 B;  3A0B H;  3AE2 C;  1AA0 A;  1HGV A;  1NU1 G;  2KS1 A;  1FI7 A;  2DW3 A;  3L35 A;  3AEE C;  2D2C D;  3LW5 J;  3BRV B;  3A0B E;  2JWD A;  3A0H V;  3KZI E;  1QVG O;  1HZU A;  2ZXY A;  1SVF A;  2IBZ G;  2KSE A;  2G8Y A;  4QAO A;  2E74 C;  4H13 B;  5KLI B;  1SP4 A;  1HH0 A;  4WY4 D;  1NNO A;  1G2C A;  1SFC D;  1QLE D;  3NMD A;  5C0Z A;  4JYC A;  2P1J A;  2J59 M;  1M6Z A;  2M8R A;  4H0J A;  2PGD A;  1HUC A;  1JY3 O;  3L75 D;  1M7L A;  2XKM A;  4I1L A;  1NTZ K;  1SQP E;  1RF0 A;  1IO4 A;  1S5L X;  2KLV A;  5DFS A;  1GL2 A;  1KX2 A;  3T97 B;  3L74 J;  4FA4 A;  2QM7 A;  3L73 E;  5GTI H;  3PH0 A;  1HJ5 A;  3TNU B;  3VTP C;  1FZB A;  1M1K Q;  2ZYA A;  4Z1M H;  2E75 D;  3OCD A;  2V07 A;  2QA4 P;  5GTI E;  1KN7 A;  1M56 D;  1QKS A;  1KIL B;  1Y9B A;  4PD4 I;  2ZJS E;  2HG5 D;  2N9Y B;  1NTK D;  4Y5R A;  5AW7 B;  2FFD A;  1CCH A;  4J20 A;  3LID A;  2JTI B;  1AQT A;  351C A;  3D6Y A;  3ZOX A;  1LTS C;  2M0B A;  3H1J J;  2FXM A;  1SQX J;  1S72 P;  2K9Y A;  2W6B A;  1GL2 D;  1YNR A;  3M0D A;  1NAF A;  3AEA C;  4D6T J;  2OZ1 B;  3O20 A;  4OWF A;  4AAN A;  1KIL E;  3K5B A;  4RES B;  1BGY J;  4WQC A;  4RO0 A;  4ZKP A;  1M60 A;  1EZV G;  4XFJ A;  1X0T A;  3G9R A;  5DJQ B;  2AXT E;  2CXB A;  1NKZ B;  2RMZ A;  3HE5 B;  1FI9 A;  2ZYG A;  1KIB A;  3AEC C;  2HV4 A;  1KB9 D;  1K73 Q;  1IK9 A;  1SLQ A;  2IBZ E;  2NPS C;  3H32 A;  1J3S A;  1IFN A;  1L4A A;  2QEX P;  1VQK P;  1CI6 B;  2GUV A;  3H1I G;  4K35 A;  1GIW A;  1VQ9 P;  1N90 A;  1H0T A;  2HYN A;  3PJS K;  3FX0 A; 
#chains in the Genus database with same CATH homology
 1SQB D;  4P4Q B;  4EIF A;  1CSU A;  1QN2 A;  1HJ4 A;  1QL4 A;  1C2R A;  1WVE C;  4WQ9 A;  1S5L V;  1DT1 A;  4K3I A;  4GED B;  3L4O A;  2C1D A;  1CIE A;  1NMI A;  3L70 D;  1IRV A;  1DW2 A;  1CC5 A;  2CA3 B;  3SWS A;  5B5E V;  3ZOY A;  3DR0 A;  4AAL A;  1KX7 A;  1KYO D;  1GKS A;  3KHU A;  5KAI V;  2MTA C;  2GB8 B;  3WUI A;  1CHI A;  4FA5 A;  3ZOW A;  1H1O A;  3O0R C;  2PCB B;  1HH7 A;  4XXL A;  3WC8 A;  2FYU D;  3HQ8 A;  4AAO A;  1E29 A;  3GW6 A;  2DVH A;  3DP5 A;  1DW3 A;  3L4M A;  5H2F V;  1MG2 D;  3H1L D;  1COT A;  3L73 D;  1LMS A;  1H31 A;  1CTY A;  1LC2 A;  2RN0 A;  3ZCF A;  4PW9 B;  4AAM A;  3WFE C;  1C75 A;  1RAQ A;  4FA9 A;  3MK7 C;  1IRW A;  1HJ3 A;  3L72 D;  1B7V A;  1N15 A;  1IQC A;  1F1C A;  1BL9 A;  4UB6 V;  3RMZ A;  4Q5P A;  1FOC A;  2PCC B;  1HRO A;  2V08 A;  4A7P A;  2JWA A;  4D6T D;  3OA8 B;  1W2L A;  4DY9 A;  3HQ9 A;  5CIE B;  1IZL 0;  3PHL A;  1YIC A;  3BCC D;  1L9B C;  1YEA A;  1K3G A;  2YCC A;  1KYO W;  1I5T A;  1MG3 D;  1I6D A;  1AOF A;  2OZ1 A;  2BCC D;  2PAC A;  2FRC A;  5CYT R;  3NBT A;  3ITK A;  4RJT A;  2C1U A;  1QL3 A;  2QJY B;  1C2N A;  1H33 B;  1MZ4 A;  4O1W A;  2XTS B;  2B4Z A;  5GTH V;  1N9C A;  3ZIY A;  5CIC B;  4FB1 A;  1NU1 D;  1SQQ D;  1H9X A;  2B11 B;  2YQB A;  2L91 A;  3JBT B;  2L4D A;  4XYD B;  2B0Z B;  2N9J A;  3TDK A;  1OAE A;  3TGU D;  2GIW A;  451C A;  3CU4 A;  3HQ6 A;  1DVV A;  1CRI A;  1FCD C;  1PP9 D;  1ETP A;  2BCN B;  2KNC B;  1CRH A;  3C2C A;  3A0B V;  1KV9 A;  1DIQ C;  2MHM A;  4FAN A;  1C7M A;  4V2K A;  3PXS A;  1FI3 A;  1CRY A;  1PPJ D;  1CXC A;  1E2R A;  2AI5 A;  3KZI V;  4YE1 A;  1GU2 A;  1C6R A;  1F1F A;  3PH2 B;  2BH5 X;  2ZZS 1;  5IY5 1;  3SLE A;  1CNO A;  3NWV A;  1RZ5 A;  5EXQ A;  1I54 A;  3L74 D;  2QJK B;  3VRD A;  2Q3E A;  1CIF A;  1AOQ A;  3SJL A;  1L0N D;  1CO6 A;  2GC4 D;  2LIR A;  1A56 A;  1QYZ A;  1SQP D;  3PXW A;  2DGE A;  2QG4 A;  5C9M A;  2O3J A;  3VNW A;  3FWL A;  3ZBM A;  1A2S A;  2QJP B;  1L0L D;  2ZOO A;  4PWA A;  5GTI V;  3SVW A;  1CSX A;  3H1J D;  3MK7 B;  1SQX D;  1LFM A;  3RLM A;  3O1Y A;  2AIU A;  1CRG A;  1K3H A;  1P84 D;  1CHH A;  1L9J C;  5B66 V;  3CP5 A;  1CRC A;  1CTZ A;  3WU2 V;  2N18 C;  2YIU B;  2ORL A;  3OCD B;  1LC1 A;  5KAF V;  3WFC C;  1OCD A;  1BGY D;  2Y0E A;  3NBS A;  1EZV D;  1AKK A;  1H33 A;  4H0K A;  1NIR A;  1CHJ A;  1GDV A;  1CRJ A;  2ZON G;  1E8E A;  1H32 B;  4FAV A;  2B12 B;  2BGV X;  3VYM A;  2C9X B;  155C A;  1I55 A;  2CE1 A;  1YCC A;  3TYI A;  1W5C T;  1GQ1 A;  5TIS V;  3L71 D;  5DF5 A;  4WQD A;  2CA4 B;  4WQE A;  1RZ6 A;  1CED A;  3ORV A;  5CIF B;  3RN1 A;  2Y0C A;  3H1I D;  1I8P A;  1RAP A;  4WQ7 A;  1CYJ A;  2ZBO A;  3CXH W;  1WEJ F;  1I6E A;  1COR A;  1CIG A;  1A8C A;  3PRJ A;  1EB7 A;  1YEB A;  1ZRT D;  4O1Q A;  4PJ0 V;  5DJQ C;  2IBZ D;  1AYG A;  4RSZ A;  2C8S A;  1SQV D;  4WQA A;  3ZOO A;  4JCG A;  1DVH A;  2D0W A;  2EXV A;  4LJI A;  4U3F D;  2BH4 X;  1GJQ A;  1NTZ D;  1BCC D;  1CYI A;  2KS1 A;  2BLF B;  1FI7 A;  1LS9 A;  2VHD A;  5CIH B;  3SXT A;  4AX3 A;  5KKZ B;  2D0S A;  3A0H V;  5KLV D;  5TJH A;  3CWB D;  3PLN A;  4EIE A;  1CSW A;  3PTZ A;  5CIG B;  1HZU A;  2ZXY A;  4GYD A;  1VYD A;  3CX5 D;  1FHB A;  4QAO A;  1U75 B;  4WQ8 A;  1U74 B;  1C52 A;  5KLI B;  4L3G A;  4L1Q A;  4KMG A;  1R0Q A;  1NNO A;  2C1D B;  2CE0 A;  5C0Z A;  2GC7 D;  1M6Z A;  1CXA A;  4H0J A;  3L75 D;  4EDF A;  1H9Y A;  3CXH D;  1N50 A;  1HCM A;  5DFS A;  2K9J B;  1M70 A;  1KX2 A;  1S6V B;  2A06 D;  4FA4 A;  1DW0 A;  1C6S A;  5CID B;  1HJ5 A;  4UB8 V;  1C6O A;  3OA8 A;  3HQ7 A;  4IL6 V;  5CIB B;  4WQB A;  2C1V A;  2B10 B;  3CYT I;  1HRC A;  1CIH A;  3OCD A;  4PD4 D;  2V07 A;  4L3H A;  1DII C;  1H31 B;  2BPB B;  3TF5 A;  1QKS A;  1H32 A;  1IO3 A;  5B6Q A;  2N18 B;  3H1K D;  2N9Y B;  1CCR A;  1NTK D;  4Y5R A;  3CX5 W;  3PXT A;  1CCH A;  1YIQ A;  4J20 A;  3O5C A;  2JTI B;  351C A;  1YTC A;  3H1H D;  3ZOX A;  1CYC A;  3WFB C;  2N3B A;  3GG2 A;  4NFG B;  1HZV A;  3RN0 A;  3X39 A;  2AXT V;  3A9F A;  1BE3 D;  1YNR A;  3VMA A;  1I8O A;  1ZZH A;  4MU8 A;  2LIT A;  2FYN B;  2OZ1 B;  3O20 A;  1NTM D;  3WFD C;  4EID A;  4FA1 A;  5E79 V;  2I8F A;  4AAN A;  2C2C A;  1KB0 A;  4WQC A;  1M60 A;  4N0K A;  1CTJ A;  5AUR A;  5DJQ B;  2CXB A;  1FJ0 A;  2RMZ A;  1DW1 A;  1FI9 A;  1KIB A;  2N9I A;  3M97 X;  2HV4 A;  1KB9 D;  3DMI A;  2Y0D A;  1JDL A;  1NML A;  2YK3 A;  1J3S A;  2FWL A;  2JQR A;  1CSV A;  1GIW A;  4EIC A;  1N90 A;  2N3Y A;  1YFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...