1P84D

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
246
structure length
246
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
total genus 72
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1p84D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1p84D01
3L70D 1C6RA 3CX5D 2V08A 2N18B 3MK7B 1SQQD 1C6OA 3CP5A 3ZOWA 3SLEA 5CIFB 2B11B 2BH4X 4EIDA 3L4MA 2DVHA 2ZBOA 1H31B 3ITKA 2RMZA 1I55A 4EDFA 1M70A 3SWSA 4AANA 3RLMA 2L4DA 3H1HD 1CIHA 1N9CA 1C2RA 1U74B 2PCBB 2CE0A 4RSZA 5H2FV 3RN1A 1MG3D 5B5EV 1CYIA 3O5CA 1K3GA 5AURA 1YCCA 5KAIV 1SQVD 3ZOOA 1KB0A 1KB9D 3H1KD 1H31A 1KIBA 1FI3A 2YIUB 5C9MA 2DGEA 2ZXYA 1CSUA 4K3IA 3ZOXA 3WFCC 1CTYA 4FB1A 1CHIA 2VHDA 3MK7C 5CIGB 3OA8A 3VRDA 3X39A 1CC5A 451CA 4D6TD 2IBZD 1L0LD 1CO6A 3PXWA 3O1YA 1CHHA 1IQCA 4O1QA 1ZZHA 1LFMA 3SJLA 1HZVA 4WQEA 3CU4A 1R0QA 1YEAA 1DIIC 2LITA 1RZ6A 1CYJA 2KNCB 2FRCA 3TYIA 4DY9A 4Y5RA 1C7MA 1CIGA 1NU1D 4FA1A 1LC2A 1CXAA 1CXCA 3PHLA 1FI7A 1H9XA 1HROA 1KYOD 3NBSA 5KLVD 3CYTI 4V2KA 2A06D 1I5TA 4AAMA 2AIUA 3VNWA 3A9FA 1COTA 1QKSA 2B4ZA 4KMGA 1K3HA 1EB7A 1WVEC 1A2SA 3TDKA 1GDVA 1OAEA 3L73D 3WFDC 4WQAA 3DMIA 4XXLA 2JTIB 1HH7A 2C1DB 1N90A 3OCDA 1NMLA 2FYNB 2N18C 2JQRA 4A7PA 4EIEA 1HJ4A 2N3YA 1WEJF 1ETPA 2PCCB 4GEDB 1QL4A 4PW9B 1FJ0A 2BGVX 3NWVA 1IO3A 4GYDA 1CNOA 1IZL0 5CYTR 2ZZS1 3A0HV 1I6EA 5DF5A 2B12B 2FYUD 1CTZA 155CA 1JDLA 1I8PA 4NFGB 4FANA 1CIEA 2Y0DA 1H33A 2Q3EA 1KV9A 4FA9A 1BE3D 1E2RA 4N0KA 2XTSB 1FI9A 2KS1A 2C1VA 2CXBA 2N3BA 1F1FA 3WU2V 1RZ5A 1CCHA 1VYDA 2QJKB 1YFCA 5E79V 2D0WA 4RJTA 1GU2A 3L72D 5CIDB 1SQBD 3A0BV 2C1DA 3OCDB 2N9YB 3CX5W 4XYDB 2D0SA 1FHBA 3ZIYA 3PXSA 4IL6V 3FWLA 2I8FA 2ZOOA 1B7VA 2MHMA 3WUIA 1CSXA 1KX7A 3NBTA 1YIQA 2CA4B 3DP5A 3WC8A 3H1LD 1CSVA 1M60A 2C9XB 3GW6A 1IRWA 3CXHD 3PH2B 1EZVD 2OZ1A 3SVWA 1KYOW 2K9JB 2YQBA 3ORVA 3M97X 5CICB 1I6DA 1CRIA 1J3SA 4J20A 1AKKA 2V07A 1CRJA 1BL9A 1F1CA 1HCMA 5C0ZA 1HJ3A 1CSWA 1NTZD 2CA3B 3L74D 1S5LV 1W2LA 1QYZA 2N9JA 3WFBC 1HJ5A 4P4QB 1YEBA 1CTJA 4LJIA 5GTHV 5KLIB 1H1OA 5IY51 3O20A 3KZIV 2MTAC 3PLNA 4WQ8A 4FA4A 1GIWA 1H32A 1CRHA 1S6VB 4FA5A 3BCCD 1C52A 1HZUA 1AYGA 1FOCA 3VYMA 3PTZA 1GQ1A 3WFEC 3DR0A 1N15A 1CORA 2BPBB 3CXHW 2GIWA 3ZOYA 1CEDA 4H0JA 1IRVA 3HQ6A 4EICA 2BCCD 1HRCA 2B10B 1MG2D 4PWAA 2ORLA 1LC1A 4AAOA 2YK3A 5KAFV 3HQ7A 3VMAA 3PXTA 1H9YA 3HQ8A 1PP9D 2QG4A 1DW3A 2BLFB 1E8EA 3L75D 3CWBD 4L1QA 2YCCA 4L3GA 1OCDA 1CYCA 3L4OA 3ZCFA 2CE1A 2C1UA 1I8OA 2AXTV 4FAVA 2AI5A 1AOFA 1DW0A 4L3HA 1DW2A 1FCDC 1N50A 1U75B 1GJQA 4EIFA 5TJHA 1KX2A 5CIBB 1CRCA 2EXVA 1SQPD 1A8CA 2BH5X 1I54A 1NNOA 1DIQC 1H33B 3H1JD 3RMZA 5B66V 4PJ0V 1CRGA 1DW1A 1YTCA 3PRJA 4PD4D 1L9JC 1A56A 3O0RC 4UB6V 4AALA 3HQ9A 1BCCD 1YICA 2ZONG 1NIRA 5EXQA 3ZBMA 1BGYD 1DVHA 1ZRTD 1CHJA 1NMIA 1C6SA 3L71D 3TGUD 2QJPB 1E29A 1C2NA 1DVVA 1MZ4A 2C8SA 2B0ZB 1QN2A 3OA8B 4AX3A 1PPJD 1L0ND 5TISV 1W5CT 2N9IA 1GKSA 1NTKD 1L9BC 1M6ZA 4WQ7A 1P84D 3KHUA 5GTIV 1H32B 4UB8V 4O1WA 1DT1A 4WQBA 1CIFA 1NTMD 1RAPA 4MU8A 2LIRA 2OZ1B 5CIEB 5DJQC 4QAOA 4YE1A 4WQCA 4H0KA 2HV4A 3RN0A 5B6QA 4Q5PA 2Y0CA 2Y0EA 2GC7D 3SXTA 2QJYB 3C2CA 1RAQA 1LS9A 1AOQA 3H1ID 1CCRA 1YNRA 4JCGA 1C75A 4WQDA 2PACA 1SQXD 2GB8B 3TF5A 5CIHB 4U3FD 5KKZB 5DFSA 2RN0A 2FWLA 1QL3A 2C2CA 3JBTB 351CA 2JWAA 2BCNB 5DJQB 3GG2A 2L91A 2GC4D 1LMSA 1CRYA 4WQ9A 2O3JA
chains in the Genus database with same CATH superfamily
1IO4A 3L4FA 3CX5D 4U3FJ 1PP9J 1C6OA 2B11B 1AFOA 3CL3D 3VTPC 1YYCA 3ITKA 1VQNP 4XE5B 1XTGB 4EDFA 1PGOA 3VP8A 2KSEA 1CIHA 5APQA 2HPCA 1OIPA 3CX5H 2PCBB 1SQVG 2I1KA 2JWDA 4I6MC 1VQPP 3O6QB 1HWTC 1GMJA 1K3GA 1SQXE 4JF7A 5AVVB 3M9BA 1FAVA 1KB9D 5CJ4A 1LNQA 2YIUB 4IL6X 2DGEA 3ZOXA 2OYIB 3OJAB 1FOSE 3MK7C 4NPEA 2IBZE 2FXMA 2IBZD 1L0LD 1J2JB 1URQC 3IF4A 1MFZA 2DW3A 2QJKC 1IQCA 2M3BA 1OZHA 2LXBA 3TGUJ 3SSUA 3CU4A 3LIDA 5GTHH 1K04A 3HE4A 1YEAA 1DIIC 2LITA 5AVYB 1M7LA 1VQ4P 3M0DC 2O01N 4Y5RA 3CCVP 3JC22 1CXAA 3CCMP 3CCLP 4I1LA 5KLVD 1UIIA 3CYTI 4V2KA 4AAMA 1I5TA 2FBWC 4YXDC 2Y9ZA 3L75J 1FZGA 4H44C 1IC2A 1FZEA 3E1RA 1WVEC 2AXTH 3NMDA 1ZRTE 1LT1A 3TDKA 1IK7A 3WFDC 1JUNA 1FJPA 2I1JA 4PJ0H 3M0AA 3OCDA 2BEQD 4EYYQ 1KORA 3H1KJ 2N18C 4A7PA 2IZ0A 1LWUC 1KILB 2E76C 2WSFH 1LTTC 3JCUE 4PW9B 1FJ0A 2AXTE 1NTKJ 1VF5C 4PD4E 5CYTR 3JSVC 2FYUJ 1I6EA 2OTKE 2XKMA 2O1KA 1MV8A 1NH4A 3N4XA 2YO2A 3WUUA 3M9HA 3Q5RA 5CCHD 3WUTA 2WSCJ 3TYYA 1GK6A 1ZXGA 3QWOC 4CPGA 3CCEP 2Q3EA 4FA9A 4YPCA 2KS1A 4UB8H 3L74E 4N6JA 1JY3P 5DJUB 1NGMB 5APYA 2FYNC 4UB6H 3GLMA 5AVSB 1CCHA 1VYDA 3CCRP 1RQVA 3EFFK 4WB4A 2W83C 1BCCJ 3USSA 1KZUB 2D0WA 2KSJA 4WVZA 4RJTA 1GK4A 3W67A 1SQBD 3HUSB 1S1CX 3K5BA 2BASA 4Y99B 3RL0g 4C7NB 2D0SA 2QSIA 3PXSA 1B7VA 5KAFH 1RE3C 3Q3DA 2FXPA 3V2NA 3TGUE 3NBTA 2IBZI 3MTUE 1N7SB 2QRXA 2NPSD 1DD3A 3GW6A 1IRWA 2R3CA 3PH2B 4IL6H 5AVZB 2K9JB 2YQBA 3LW5H 4JYBA 3MIWA 3D0WA 1SQXJ 2CA3B 2E43A 3L74D 2N9BA 2ZYAA 1S5LV 2GUSA 1HJ5A 1EDLA 4P4QB 4L73A 1SQPE 5GTHV 2WT7B 5KLIB 3HE4B 1M1KQ 2H43A 4H13D 2JJLA 1H32A 2P58A 3BCCD 1KILD 3VYMA 1W2BO 3PTZA 5AVQB 5C39A 3CC4P 1N15A 2BPBB 3CXHW 1EDIA 3KZIH 4DCKA 2BCCD 2B10B 1D7MA 4N78E 2L5GB 4AAOA 2YK3A 1S72P 3HD7C 2YKQA 3HQ7A 3VMAA 1DW3A 2NZ2A 4O9BA 4WY4D 3CWBD 1NTZG 2BCCG 4KT0J 2MKVA 1QGKB 1RF0A 2KUBA 1FZAA 2C1UA 3W68A 3V5BA 3C8VA 1DW2A 1FCDC 1N50A 1BE3E 3WUVA 3BATA 3VYIA 4EIFA 1KX2A 5CIBB 1CRCA 4BRYB 1L4AA 4GODA 1SQPD 2GM4A 2POHA 1I54A 1VQLP 4XFJA 1AA0A 1OVUA 1OVRA 1CRGA 3B8EB 1FC2C 1YBKA 3PRJA 4W80A 1X8YA 4GT1A 4AALA 1HJ0A 1EZVE 1IK9A 1NHLA 1YJNP 1YICA 2FKWB 4UB6E 1BSNA 4OGQC 1ZRTD 1N2DC 1RF1B 2QJYC 1GL2C 1LP1B 3AE4C 5BU5A 2ZT9B 1KB9E 3Q5PA 3VMYA 1H0TB 1MZ4A 4H0LC 1YHQP 5APSA 3Q5SA 1BDDA 1L0ND 3FX0A 2N9IA 1X0TA 1GKSA 1RE3A 3RK3C 2FYUK 4JQ0D 3MUDC 2KLVA 2W6BA 1AVOA 4KHXA 2IDBA 1DT1A 4WQBA 1CIFA 4PD4H 3V2RA 2LIRA 2OZ1B 5CIEB 5AVWB 4QAOA 4WQCA 4IFFA 2W27A 3R2PA 1P84H 5B6QA 1Q81Q 2A45H 1SQBK 2Y0EA 3CX5E 3C2CA 1RAQA 4LLHA 3A0HE 1AOQA 3V4WA 3H1ID 1N73C 1KV4A 1JY2O 5AW0B 1SQXD 2GB8B 3CMEP 1AQ5A 1QL1A 5KKZB 4DZOA 3VMZA 5DFSA 2RN0A 2K88A 3C9IA 2N1TB 4GKGA 2C2CA 1U7JA 351CA 2BCNB 1SQXG 2ZAEB 2XU6A 1VQ5P 4YTPC 2XV5A 2OQQA 5E79H 4HYTB 1C6RA 5H2FH 3FWNA 1NTMJ 1NKZB 2E5YA 2HYNA 1BE3J 1L0LJ 2WWWA 1CI6A 2XZRA 3ZOWA 3SLEA 5CIFB 1KB9I 2BH4X 4U7JA 2DVHA 1H31B 1L0NJ 1WMKA 3SWKA 1M90Q 1L0NE 3SWSA 3QH9A 3MUDA 1N9CA 4BWNA 4NPFX 2CE0A 2WITA 4H13C 2G8YA 3RN1A 3L71J 1FU1A 1PIXA 2M5AA 3O5CA 1PPJE 3BASA 5KAIV 2J58A 3ZOOA 1WRGA 3WU2H 2QE7H 2QA4P 2WPRA 1URQA 1KIBA 2KNCA 1FI3A 4I7ZC 2B88A 3WFCC 4FB1A 3X39A 3OA8A 1AJYA 1CC5A 3EFGA 4D6TD 1EC5A 1CO6A 1Q82Q 4PJ0E 3WMM0 3P8CD 3H1JE 1LT9B 2P1JA 2K3RA 1Z56A 1JTHA 2IFNA 2RH0A 1HBWA 3BVHA 4D6TE 1CYJA 3P7KA 3TYIA 1NU1D 3A2AA 1ZR4A 2WQYC 1NTKE 2WSFJ 1FI7A 1DX7A 1H9XA 1HROA 3G3ZA 1NO4A 2AIUA 1JTHB 1QLED 2OYIC 1K3HA 1EB7A 2E42A 5E79E 2K1AA 2M3EA 1GDVA 1OAEA 3NTNA 5AW3B 3AE1C 4H44D 2FY8A 3HUSA 1N90A 3N7NA 2OYHB 2C0XA 2AEFA 1VF5D 1BGYE 1HJ4A 2PCCB 2ZYGA 2BGVX 3V6IA 5APVA 4IOIH 2E75C 1CNOA 1S3JA 1IZL0 2ZZS1 5GTIH 1BCCE 4JBZA 2FYUG 5AW9B 1SQPG 5AVXB 2B12B 155CA 1JDLA 1KQSO 2A45I 4FANA 3RGUA 3P8CE 1H33A 4YXWH 1SFCC 4N0KA 1SQVJ 3WU2E 3SWFA 3MD0A 3D70A 1FI9A 1M57D 3CCUP 1J1DB 1X22A 3SFDC 1NWQA 2KK7A 2N3BA 1NTMK 2CPSA 1YJWP 1JB0J 2IPPA 3H1LJ 1URQD 4GDOA 1KFNA 3H1KG 3L72E 3A0BV 4HJGH 3AECC 3OCDB 3L73G 1L4AD 3GHGC 5KLVK 1G2CA 4QMAA 1IFNA 3L73J 1VQKP 4IL6V 1CW5A 3RK3D 4TLFA 3RK3E 1KYOI 2R3SA 2Q5UA 1YIQA 3DP5A 3I5CA 1IFDA 1DEEG 1SS1A 4ASVA 1N86A 2Z5IA 1FZCC 4EOTA 4PV1C 1G2CB 1J3SA 1CRJA 1F1CA 1RF1A 1VL2A 3IFMA 1M1JA 5C0ZA 1CSWA 2KS1B 3L37A 4LJIA 5B66E 3BCCE 3S1KA 4Y99C 1EDJA 1NTMG 1LTIC 1USDA 2H88C 4D6TJ 5KTBA 1HH0A 3ABVC 3KQGA 1EZVI 1MZ9A 2R5DA 2NPSC 4OH8B 1C52A 1YQ3C 1FOCA 3WFEC 5L8RJ 1CORA 3RBZA 3ZOYA 1CEDA 2BEZF 3M0DA 3Q2YA 3HQ6A 2FFDA 4XA4A 1RH5B 1HRCA 5KAFE 5AVRB 1N7SA 3M9QA 4PWAA 1LWUA 1PP9G 1SVFA 1VQ9P 1LTJA 3HQ8A 2BLFB 1CZQA 1E8EA 3AEEC 3L70E 1LTSC 2SPZA 2MJZA 3B5NA 3L75D 2OYHA 1KYOE 2A06E 3L4OA 4AQRD 5K5GB 2FFDB 5CBOA 1USEA 1NJIQ 3ZCFA 2AXTV 2HR3A 2V7QJ 1VQ6P 4FAVA 1FZBA 2AI5A 1IJDB 1NKNA 4L3HA 1SQPK 1KQLA 1U75B 1S9KD 4DT0A 1YI2P 3RK2B 1A8CA 3E7KA 1NNOA 1DIQC 1H33B 2R32A 2ZYDA 5B66V 1SQBG 1ZP0C 4K35A 2PAJA 1YTCA 3O0RC 1GW4A 2Q3IA 2B9BA 1K73Q 3HQ9A 1ZOYC 1NIRA 3ZBMA 1K9MQ 1J1EC 1DVHA 1DIPA 1CHJA 3F89A 5KJ7A 1X9VA 2QJPB 5KLVG 1P84I 1JM0A 2JR8A 1YTZI 2Q6QA 2XDJA 2C8SA 2QM8A 2W6JH 1H89A 3OA8B 3HRNA 4AX3A 3M06A 5M1BA 1PPJD 1RY3A 2O01J 4BXLA 2W8ZA 1VPCA 2HFED 2YIUC 1S5LX 2Q7CA 3PJSK 3KHUA 1H32B 3RL0C 1U7MA 5B5EE 3IN6A 3CXHI 2WSEJ 5DJQC 5AVUB 3P32A 3CLQA 3UIAA 1WT6A 3RN0A 4R4MA 5AW5B 4Q5PA 1GU4A 2GC7D 3KYQA 3SXTA 3HD7A 1IFIA 2QJYB 3G4SP 1LS9A 2C9NY 2ZT9C 1NAFA 1CCRA 1L4AC 4JCGA 1KN7A 3H1JG 1PPJG 3MP7B 2WZ7A 2PACA 3E1IA 3H1JJ 3TF5A 1OW8A 5CIHB 2E74D 1RE4C 2N1TD 3G71P 1Y8AA 3L72J 3T97A 1LTJC 2HODA 2IYOA 2KXPB 1GZLA 1QL3A 2YKOA 1T6AA 3H1IG 3GG2A 3RL0D 2HPCB 1LMSA 3AE3C 5AW4B 1YIJP 3MK7B 2V08A 2N18B 1LWUB 4HH2A 1JMBA 1S4XA 2JKVA 2PGDA 1T2KC 1NTZK 2ZBOA 2J59M 2E75B 2RMZA 1SQQK 1I55A 2IBZG 4RO0A 1FZCA 4AANA 3RLMA 3CC2P 3H1HD 2CK3H 3H6PA 1KFMA 1C2RA 1U74B 3CPWO 2VRSA 5H2FV 1MG3D 5B5EV 1CYIA 2CPBA 3BCCG 3B5NC 1LJ2A 5AURA 1HGZA 3VN0A 2OYOA 4Z1MH 1SQVD 1LP1A 2K37A 1KB0A 4C7RA 3H1KD 5BVZA 4H44B 4B86A 4WY4A 5C9MA 4K3IA 1CTYA 1JCCA 2VHDA 3VRDA 1H8AA 3H1HJ 451CA 3L74J 3PXWA 2IZ1A 3O1YA 1ZZHA 1RE4A 2WT7A 3HUSC 1R0QA 1GTWA 1Q7YQ 1W5CE 5BU8B 1C7MA 2YNYA 4ZKPA 4N3YB 3PHLA 3MHVA 2E5TA 3B71A 2FYZA 3B4SA 1KYOD 3NBSA 1NTKG 4C46A 2A06D 5AW2B 3VNWA 2GUVA 5AW6B 1COTA 4PV1B 4KMGA 3HE5A 5KJ7C 3CCJP 1FZFA 1Q86Q 3AEBC 4WQAA 2P7JA 1JO5A 1FDMA 1Q90D 2JTIB 3FGAD 1HH7A 5KAIE 1KTMA 2C1DB 1LTGC 1NMLA 2WPVB 1KQFB 1DD4A 2JQRA 1YTZT 1HUCA 1A02F 4GEDB 1QL4A 2D2CC 2P67A 2V7QH 3CWBJ 3NWVA 1GL2D 1EDKA 1SQVK 2WTYA 3A0HV 3AE6C 1A02J 1KD1Q 4DOJA 1JY2P 5DF5A 1JNMA 4ZMDA 4WBAA 2FYUD 1L0NG 2BCCJ 4I2LC 1I8PA 1CSBA 2Y0DA 2R5BA 5CJ0A 3CMAP 1E2RA 1YJ9P 2XTSB 3AEDC 1NTKK 2Z5HA 1PGQA 1JEKA 2NRGA 3HTKB 2QEXP 1F1FA 2OYHC 3WU2V 3F5HA 1RZ5A 3KZIE 1URQB 1VQOP 1HVVA 1QL2A 3TSIA 2QJKB 1OWAA 5E79V 1PGJA 3L75E 3L72D 2E76D 5CIDB 2N9YB 4XYDB 3ZIYA 3II6A 3CCQP 3FWLA 5CCGC 2ZOOA 3HTKA 2OTJP 2MHMA 4KJMA 3WUIA 1FJKA 1KX7A 5AW1B 4U3FG 1KB9H 1DEBA 5GTIE 2NPSA 3H1LD 4UB8E 1CSVA 3TK1A 1M60A 3SFEC 2H7HA 1N73A 1EZVD 2OZ1A 3SVWA 2A45G 5CCHA 1KYOH 2PP6A 5CICB 1I6DA 1CRIA 4J20A 1IFMA 1AKKA 2UWJE 2OYIA 3V4QA 1HJ3A 1NTZD 1PGPA 3CWBG 3L75G 1W2LA 1QYZA 2N9JA 4PD4I 1RHZB 3A0BH 4JPZB 3H1IJ 1RF1C 1GL2B 1FS0E 2JDIH 4W7ZA 1H1OA 5IY51 5CHXA 1E79H 5GTHE 3CC7P 3CWBE 3BRVB 3PLNA 4WQ8A 1S6VB 4FA5A 3I56P 1VF5B 1OW7A 1IZNB 3CXHE 1AYGA 3FXDA 3DR0A 1L2PA 2GIWA 1GL2A 4EICA 3GHGA 1LC1A 1GD2E 5KAFV 3PXTA 1PP9D 2QG4A 4TT3H 1P84E 1X79B 5CMZA 3L71E 4L1QA 2O1JA 2YCCA 1SQBE 2LR2A 1L4AB 4L3GA 1OCDA 1QVFO 4RESB 5APWA 1AQTA 2WPSA 2CE1A 5KKZC 3D71A 1I8OA 1NU1J 1SP4A 2AEMA 1K8AQ 1AOFA 1DW0A 4W7YA 1S9KE 1IFJA 4IFDK 1NAYA 4H0LB 3EQ2A 5APXA 2WPQA 2WSEH 1N7SC 2KZIA 4HB1A 1QX8A 2BH5X 3LW5J 3H1JD 1PV3A 3AE2C 3RMZA 5KLVJ 4PJ0V 3HD7B 1XTCC 2ZVNB 4MN4C 1LT9A 2JP3A 3L71G 2LXCB 1HTLC 3P8MC 1ZLLA 1FOSF 4D6TG 4L76A 1BGYD 4OVNF 1SQVE 1SQQG 3PP5A 3V2PA 2E75D 4H13B 1RF0C 3L71D 3AEAC 3TGUD 1E29A 1L0NK 2HG5D 3H1KE 4C7NA 3B5NB 3CXHH 2OTLP 4WY4B 2B87A 3OAKA 5TISV 1M1JC 3A5TA 4NPDA 4I7ZB 2E74C 1GDTA 1NTKD 1L9BC 3IAOA 3TGUG 2N1TC 1P84D 3AE9C 2G3AA 1ZW0A 3A0HH 2ZXXA 1NTMD 1RAPA 4MU8A 1KILE 2K9JA 1YQ4C 2HV4A 1FZCB 1BGYG 2C0WA 1M8OB 3AEGC 3H25A 3G6EP 2KZJA 3L72G 1HGVA 3A7OA 3O6QA 1YITP 1S5LE 4EI2A 1L0LK 2QJPC 4M3LA 4WQDA 2FYUE 4K3AA 1JCDA 3GF7A 1VQ7P 3GF3A 1ZV8A 4U3FD 4H0LD 3H1LG 2A06G 3JCUH 4L75A 2M8RA 3PH0A 3S4RA 3AE8C 2ZXEB 2KIKA 3MGNA 4OGQD 5DJQB 2L91A 2GC4D 3L70D 2V4HA 3RBXA 5TISH 1OX3A 2H89C 4HKZH 1SQQD 2KP8A 4AUWA 3CP5A 4N78D 2IYPA 3MZWB 4EIDA 1LT9C 3L4MA 2KOGA 4L74A 1SQBJ 4IL6E 3AE5C 1M70A 3H1HE 1LGHB 3U1CA 2L4DA 4OGQB 4RSZA 1G1JA 1U57A 1T8ZA 1QEXA 1YCCA 1PL5A 1OXZA 1SFCB 3NXSA 1BSHA 3CCSP 1H31A 1JY3O 3D6ZA 3B5ND 4BRYA 2ZXYA 1CSUA 1CHIA 3T97B 5CIGB 1KILA 5APTA 3U59A 5KAIH 1CHHA 3TNUA 4O1QA 1FDOA 1LFMA 3SJLA 1HZVA 4WQEA 2OARA 5CCGD 1RZ6A 1EZVG 1OMIA 2KNCB 3SWYA 2Y9YA 2E76B 2FRCA 2YO3A 1SFCD 4DY9A 1CIGA 4FA1A 1N73B 1LC2A 1CXCA 3L73E 3G9RA 3EWKA 3VP9A 4AYCA 1H0TA 3FXEA 2B87B 1SQQE 2YMKA 1KQGB 1NU1G 1NVOA 3A9FA 1EXJA 4GOFA 1QKSA 2B4ZA 1T3UA 1PP9E 1A2SA 1BCCG 2PFXA 5AW7B 3L73D 2PRRA 3AEFC 3DMIA 4XXLA 1JMMA 1J1DC 3I55P 2YKPA 2BCCE 3L35A 2FYNB 3A3YB 4EIEA 2H8PD 3VMXA 2N3YA 2IX7C 1WEJF 1ETPA 1ZN5A 4GOEA 1N8RQ 3BCCJ 4PV1D 1IO3A 1RQUA 4GYDA 1G1IA 1T2KD 2NPSB 5B5EH 3KDPB 1E5WA 1BE3G 1NOHA 2QIWA 3GHGB 1CTZA 1UIXA 2C9LY 4NFGB 1FE6A 1CIEA 1VQMP 1FDIA 1KV9A 1NTZJ 1BE3D 1HJBA 1NTZE 2C1VA 2CXBA 2QM7A 2JEEA 1L0LG 1H88A 1M56D 2D2CB 1YFCA 1CI6B 1GU2A 2ZT9D 3Q1MA 2XNXA 2I8DA 3L70G 2C1DA 1DH3A 1S5LH 1ZR2A 5KLIC 3CX5I 3CX5W 4RKUJ 5B66H 4R4LA 1HF9A 1FHBA 1Y9BA 3KXDA 5CCHC 2I8FA 3D6YA 1Y47A 5CBNA 1CSXA 2AEJA 2LKMA 2CA4B 2P10A 3GMAA 2WMMA 3WC8A 5CCGA 2ZVOB 2C9XB 1VDFA 2ZFCA 2IFMA 3CXHD 1SFCA 1PZQA 1KYOW 1NU1E 2AXCA 3ORVA 3M97X 1MKMA 2WSCH 2V07A 1BL9A 2WVRA 1HCMA 2FXOA 3O8ZA 1GW3A 2W90A 3WFBC 2KI7B 2KLUA 1OW6A 1YEBA 1CTJA 4LGDE 1JY3N 1LTAC 4OWFA 3O20A 1KILC 1MUUA 1OFCX 1QVGO 3KZIV 2Q9IA 3BRTB 1IFPA 2MTAC 4FA4A 5DJTB 2FFDC 1GIWA 1CRHA 1M1JB 2HODB 1HZUA 5EFWB 1GQ1A 3R4YA 3RL0B 4H0JA 1SQXK 2W6AA 1IRVA 1KMIZ 1K05A 1NTME 1MG2D 3RK2C 3M91A 1N7SD 3C1LA 2ORLA 4LC1A 2M0BA 1H9YA 1SQPJ 3IR9A 4ZNCA 5KJ7D 4ASWA 5KLVE 1FBMA 1CYCA 1S2EA 2Q1KA 2K9YA 5H2FE 2XNDH 5AW8B 3OW2O 2KYVA 1SLQA 2D2CD 3CI9A 3OA7A 1LTJB 1KC8Q 1MFTA 1GJQA 1W2EA 3L36A 5TJHA 3U1AA 2EXVA 2Z4EA 1Q2NA 3RK3B 1AVYA 3S9OA 1DW1A 4PD4D 1L9JC 1A56A 4IFMA 4UB6V 2P2UA 4Y28J 1BCCD 2ZONG 5AVTB 5EXQA 1R5LA 2M5AB 2R44A 1AV1A 2OGUA 3VOPA 1NMIA 3KPEA 1BDCA 1GU5A 1C6SA 1R5SA 2N1TA 3CD6P 1N7LA 3A0BE 1LTBC 1C2NA 1PFIA 3RK2D 1DVVA 2B0ZB 2J5UA 5APUA 1QN2A 3LIEA 2WSSH 1EXIA 1W5CT 1VQ8P 1OVVA 3TNUB 1M6ZA 4WQ7A 3HE5B 2KB7P 5GTIV 5TISE 2B89A 4UB8V 4O1WA 1T3JA 3H32A 3AE7C 4YE1A 1ZMEC 3V2QA 2ITAA 4H0KA 2YXRB 1NYHA 4DJGA 3NFQA 3L74G 2Y0CA 1BGYJ 1J1EB 2O01H 2QVAA 1TU3F 2ZJSE 3HD7D 2HLOA 2YMYA 1YNRA 1C75A 3ZDMA 4WY4C 2RKLA 1L0LE 4WWIA 3H32B 1SQQJ 4U3FE 1EQ7A 2YXQB 3L70J 2E74B 1JOCA 2JO1A 3H1IE 2FWLA 3H1HG 4EIJA 4GIFA 1NU1K 3H1LE 4ZKUA 2GA1A 3JBTB 2JWAA 1CRYA 1JY2N 4WQ9A 2O3JA 4JYCA 1R8EA
chains in the Genus database with same CATH topology
3L70D 1C6RA 3CX5D 2V08A 2N18B 3MK7B 1SQQD 1C6OA 3CP5A 3ZOWA 3SLEA 5CIFB 2B11B 2BH4X 4EIDA 3L4MA 2DVHA 2ZBOA 1H31B 3ITKA 2RMZA 1I55A 4EDFA 1M70A 3SWSA 4AANA 3RLMA 2L4DA 3H1HD 1CIHA 1N9CA 1C2RA 1U74B 2PCBB 2CE0A 4RSZA 5H2FV 3RN1A 1MG3D 5B5EV 1CYIA 3O5CA 1K3GA 5AURA 1YCCA 5KAIV 1SQVD 3ZOOA 1KB0A 1KB9D 3H1KD 1H31A 1KIBA 1FI3A 2YIUB 5C9MA 2DGEA 2ZXYA 1CSUA 4K3IA 3ZOXA 3WFCC 1CTYA 4FB1A 1CHIA 2VHDA 3MK7C 5CIGB 3OA8A 3VRDA 3X39A 1CC5A 451CA 4D6TD 2IBZD 1L0LD 1CO6A 3PXWA 3O1YA 1CHHA 1IQCA 4O1QA 1ZZHA 1LFMA 3SJLA 1HZVA 4WQEA 3CU4A 1R0QA 1YEAA 1DIIC 2LITA 1RZ6A 1CYJA 2KNCB 2FRCA 3TYIA 4DY9A 4Y5RA 1C7MA 1CIGA 1NU1D 4FA1A 1LC2A 1CXAA 1CXCA 3PHLA 1FI7A 1H9XA 1HROA 1KYOD 3NBSA 5KLVD 3CYTI 4V2KA 2A06D 1I5TA 4AAMA 2AIUA 3VNWA 3A9FA 1COTA 1QKSA 2B4ZA 4KMGA 1K3HA 1EB7A 1WVEC 1A2SA 3TDKA 1GDVA 1OAEA 3L73D 3WFDC 4WQAA 3DMIA 4XXLA 2JTIB 1HH7A 2C1DB 1N90A 3OCDA 1NMLA 2FYNB 2N18C 2JQRA 4A7PA 4EIEA 1HJ4A 2N3YA 1WEJF 1ETPA 2PCCB 4GEDB 1QL4A 4PW9B 1FJ0A 2BGVX 3NWVA 1IO3A 4GYDA 1CNOA 1IZL0 5CYTR 2ZZS1 3A0HV 1I6EA 5DF5A 2B12B 2FYUD 1CTZA 155CA 1JDLA 1I8PA 4NFGB 4FANA 1CIEA 2Y0DA 1H33A 2Q3EA 1KV9A 4FA9A 1BE3D 1E2RA 4N0KA 2XTSB 1FI9A 2KS1A 2C1VA 2CXBA 2N3BA 1F1FA 3WU2V 1RZ5A 1CCHA 1VYDA 2QJKB 1YFCA 5E79V 2D0WA 4RJTA 1GU2A 3L72D 5CIDB 1SQBD 3A0BV 2C1DA 3OCDB 2N9YB 3CX5W 4XYDB 2D0SA 1FHBA 3ZIYA 3PXSA 4IL6V 3FWLA 2I8FA 2ZOOA 1B7VA 2MHMA 3WUIA 1CSXA 1KX7A 3NBTA 1YIQA 2CA4B 3DP5A 3WC8A 3H1LD 1CSVA 1M60A 2C9XB 3GW6A 1IRWA 3CXHD 3PH2B 1EZVD 2OZ1A 3SVWA 1KYOW 2K9JB 2YQBA 3ORVA 3M97X 5CICB 1I6DA 1CRIA 1J3SA 4J20A 1AKKA 2V07A 1CRJA 1BL9A 1F1CA 1HCMA 5C0ZA 1HJ3A 1CSWA 1NTZD 2CA3B 3L74D 1S5LV 1W2LA 1QYZA 2N9JA 3WFBC 1HJ5A 4P4QB 1YEBA 1CTJA 4LJIA 5GTHV 5KLIB 1H1OA 5IY51 3O20A 3KZIV 2MTAC 3PLNA 4WQ8A 4FA4A 1GIWA 1H32A 1CRHA 1S6VB 4FA5A 3BCCD 1C52A 1HZUA 1AYGA 1FOCA 3VYMA 3PTZA 1GQ1A 3WFEC 3DR0A 1N15A 1CORA 2BPBB 3CXHW 2GIWA 3ZOYA 1CEDA 4H0JA 1IRVA 3HQ6A 4EICA 2BCCD 1HRCA 2B10B 1MG2D 4PWAA 2ORLA 1LC1A 4AAOA 2YK3A 5KAFV 3HQ7A 3VMAA 3PXTA 1H9YA 3HQ8A 1PP9D 2QG4A 1DW3A 2BLFB 1E8EA 3L75D 3CWBD 4L1QA 2YCCA 4L3GA 1OCDA 1CYCA 3L4OA 3ZCFA 2CE1A 2C1UA 1I8OA 2AXTV 4FAVA 2AI5A 1AOFA 1DW0A 4L3HA 1DW2A 1FCDC 1N50A 1U75B 1GJQA 4EIFA 5TJHA 1KX2A 5CIBB 1CRCA 2EXVA 1SQPD 1A8CA 2BH5X 1I54A 1NNOA 1DIQC 1H33B 3H1JD 3RMZA 5B66V 4PJ0V 1CRGA 1DW1A 1YTCA 3PRJA 4PD4D 1L9JC 1A56A 3O0RC 4UB6V 4AALA 3HQ9A 1BCCD 1YICA 2ZONG 1NIRA 5EXQA 3ZBMA 1BGYD 1DVHA 1ZRTD 1CHJA 1NMIA 1C6SA 3L71D 3TGUD 2QJPB 1E29A 1C2NA 1DVVA 1MZ4A 2C8SA 2B0ZB 1QN2A 3OA8B 4AX3A 1PPJD 1L0ND 5TISV 1W5CT 2N9IA 1GKSA 1NTKD 1L9BC 1M6ZA 4WQ7A 1P84D 3KHUA 5GTIV 1H32B 4UB8V 4O1WA 1DT1A 4WQBA 1CIFA 1NTMD 1RAPA 4MU8A 2LIRA 2OZ1B 5CIEB 5DJQC 4QAOA 4YE1A 4WQCA 4H0KA 2HV4A 3RN0A 5B6QA 4Q5PA 2Y0CA 2Y0EA 2GC7D 3SXTA 2QJYB 3C2CA 1RAQA 1LS9A 1AOQA 3H1ID 1CCRA 1YNRA 4JCGA 1C75A 4WQDA 2PACA 1SQXD 2GB8B 3TF5A 5CIHB 4U3FD 5KKZB 5DFSA 2RN0A 2FWLA 1QL3A 2C2CA 3JBTB 351CA 2JWAA 2BCNB 5DJQB 3GG2A 2L91A 2GC4D 1LMSA 1CRYA 4WQ9A 2O3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L70 D;  1C6R A;  3CX5 D;  2V08 A;  2N18 B;  3MK7 B;  1SQQ D;  1C6O A;  3CP5 A;  3ZOW A;  3SLE A;  5CIF B;  2B11 B;  2BH4 X;  4EID A;  3L4M A;  2DVH A;  2ZBO A;  1H31 B;  3ITK A;  2RMZ A;  1I55 A;  4EDF A;  1M70 A;  3SWS A;  4AAN A;  3RLM A;  2L4D A;  3H1H D;  1CIH A;  1N9C A;  1C2R A;  1U74 B;  2PCB B;  2CE0 A;  4RSZ A;  5H2F V;  3RN1 A;  1MG3 D;  5B5E V;  1CYI A;  3O5C A;  1K3G A;  5AUR A;  1YCC A;  5KAI V;  1SQV D;  3ZOO A;  1KB0 A;  1KB9 D;  3H1K D;  1H31 A;  1KIB A;  1FI3 A;  2YIU B;  5C9M A;  2DGE A;  2ZXY A;  1CSU A;  4K3I A;  3ZOX A;  3WFC C;  1CTY A;  4FB1 A;  1CHI A;  2VHD A;  3MK7 C;  5CIG B;  3OA8 A;  3VRD A;  3X39 A;  1CC5 A;  451C A;  4D6T D;  2IBZ D;  1L0L D;  1CO6 A;  3PXW A;  3O1Y A;  1CHH A;  1IQC A;  4O1Q A;  1ZZH A;  1LFM A;  3SJL A;  1HZV A;  4WQE A;  3CU4 A;  1R0Q A;  1YEA A;  1DII C;  2LIT A;  1RZ6 A;  1CYJ A;  2KNC B;  2FRC A;  3TYI A;  4DY9 A;  4Y5R A;  1C7M A;  1CIG A;  1NU1 D;  4FA1 A;  1LC2 A;  1CXA A;  1CXC A;  3PHL A;  1FI7 A;  1H9X A;  1HRO A;  1KYO D;  3NBS A;  5KLV D;  3CYT I;  4V2K A;  2A06 D;  1I5T A;  4AAM A;  2AIU A;  3VNW A;  3A9F A;  1COT A;  1QKS A;  2B4Z A;  4KMG A;  1K3H A;  1EB7 A;  1WVE C;  1A2S A;  3TDK A;  1GDV A;  1OAE A;  3L73 D;  3WFD C;  4WQA A;  3DMI A;  4XXL A;  2JTI B;  1HH7 A;  2C1D B;  1N90 A;  3OCD A;  1NML A;  2FYN B;  2N18 C;  2JQR A;  4A7P A;  4EIE A;  1HJ4 A;  2N3Y A;  1WEJ F;  1ETP A;  2PCC B;  4GED B;  1QL4 A;  4PW9 B;  1FJ0 A;  2BGV X;  3NWV A;  1IO3 A;  4GYD A;  1CNO A;  1IZL 0;  5CYT R;  2ZZS 1;  3A0H V;  1I6E A;  5DF5 A;  2B12 B;  2FYU D;  1CTZ A;  155C A;  1JDL A;  1I8P A;  4NFG B;  4FAN A;  1CIE A;  2Y0D A;  1H33 A;  2Q3E A;  1KV9 A;  4FA9 A;  1BE3 D;  1E2R A;  4N0K A;  2XTS B;  1FI9 A;  2KS1 A;  2C1V A;  2CXB A;  2N3B A;  1F1F A;  3WU2 V;  1RZ5 A;  1CCH A;  1VYD A;  2QJK B;  1YFC A;  5E79 V;  2D0W A;  4RJT A;  1GU2 A;  3L72 D;  5CID B;  1SQB D;  3A0B V;  2C1D A;  3OCD B;  2N9Y B;  3CX5 W;  4XYD B;  2D0S A;  1FHB A;  3ZIY A;  3PXS A;  4IL6 V;  3FWL A;  2I8F A;  2ZOO A;  1B7V A;  2MHM A;  3WUI A;  1CSX A;  1KX7 A;  3NBT A;  1YIQ A;  2CA4 B;  3DP5 A;  3WC8 A;  3H1L D;  1CSV A;  1M60 A;  2C9X B;  3GW6 A;  1IRW A;  3CXH D;  3PH2 B;  1EZV D;  2OZ1 A;  3SVW A;  1KYO W;  2K9J B;  2YQB A;  3ORV A;  3M97 X;  5CIC B;  1I6D A;  1CRI A;  1J3S A;  4J20 A;  1AKK A;  2V07 A;  1CRJ A;  1BL9 A;  1F1C A;  1HCM A;  5C0Z A;  1HJ3 A;  1CSW A;  1NTZ D;  2CA3 B;  3L74 D;  1S5L V;  1W2L A;  1QYZ A;  2N9J A;  3WFB C;  1HJ5 A;  4P4Q B;  1YEB A;  1CTJ A;  4LJI A;  5GTH V;  5KLI B;  1H1O A;  5IY5 1;  3O20 A;  3KZI V;  2MTA C;  3PLN A;  4WQ8 A;  4FA4 A;  1GIW A;  1H32 A;  1CRH A;  1S6V B;  4FA5 A;  3BCC D;  1C52 A;  1HZU A;  1AYG A;  1FOC A;  3VYM A;  3PTZ A;  1GQ1 A;  3WFE C;  3DR0 A;  1N15 A;  1COR A;  2BPB B;  3CXH W;  2GIW A;  3ZOY A;  1CED A;  4H0J A;  1IRV A;  3HQ6 A;  4EIC A;  2BCC D;  1HRC A;  2B10 B;  1MG2 D;  4PWA A;  2ORL A;  1LC1 A;  4AAO A;  2YK3 A;  5KAF V;  3HQ7 A;  3VMA A;  3PXT A;  1H9Y A;  3HQ8 A;  1PP9 D;  2QG4 A;  1DW3 A;  2BLF B;  1E8E A;  3L75 D;  3CWB D;  4L1Q A;  2YCC A;  4L3G A;  1OCD A;  1CYC A;  3L4O A;  3ZCF A;  2CE1 A;  2C1U A;  1I8O A;  2AXT V;  4FAV A;  2AI5 A;  1AOF A;  1DW0 A;  4L3H A;  1DW2 A;  1FCD C;  1N50 A;  1U75 B;  1GJQ A;  4EIF A;  5TJH A;  1KX2 A;  5CIB B;  1CRC A;  2EXV A;  1SQP D;  1A8C A;  2BH5 X;  1I54 A;  1NNO A;  1DIQ C;  1H33 B;  3H1J D;  3RMZ A;  5B66 V;  4PJ0 V;  1CRG A;  1DW1 A;  1YTC A;  3PRJ A;  4PD4 D;  1L9J C;  1A56 A;  3O0R C;  4UB6 V;  4AAL A;  3HQ9 A;  1BCC D;  1YIC A;  2ZON G;  1NIR A;  5EXQ A;  3ZBM A;  1BGY D;  1DVH A;  1ZRT D;  1CHJ A;  1NMI A;  1C6S A;  3L71 D;  3TGU D;  2QJP B;  1E29 A;  1C2N A;  1DVV A;  1MZ4 A;  2C8S A;  2B0Z B;  1QN2 A;  3OA8 B;  4AX3 A;  1PPJ D;  1L0N D;  5TIS V;  1W5C T;  2N9I A;  1GKS A;  1NTK D;  1L9B C;  1M6Z A;  4WQ7 A;  1P84 D;  3KHU A;  5GTI V;  1H32 B;  4UB8 V;  4O1W A;  1DT1 A;  4WQB A;  1CIF A;  1NTM D;  1RAP A;  4MU8 A;  2LIR A;  2OZ1 B;  5CIE B;  5DJQ C;  4QAO A;  4YE1 A;  4WQC A;  4H0K A;  2HV4 A;  3RN0 A;  5B6Q A;  4Q5P A;  2Y0C A;  2Y0E A;  2GC7 D;  3SXT A;  2QJY B;  3C2C A;  1RAQ A;  1LS9 A;  1AOQ A;  3H1I D;  1CCR A;  1YNR A;  4JCG A;  1C75 A;  4WQD A;  2PAC A;  1SQX D;  2GB8 B;  3TF5 A;  5CIH B;  4U3F D;  5KKZ B;  5DFS A;  2RN0 A;  2FWL A;  1QL3 A;  2C2C A;  3JBT B;  351C A;  2JWA A;  2BCN B;  5DJQ B;  3GG2 A;  2L91 A;  2GC4 D;  1LMS A;  1CRY A;  4WQ9 A;  2O3J A; 
#chains in the Genus database with same CATH topology
 1IO4 A;  3L4F A;  3CX5 D;  4U3F J;  1PP9 J;  1C6O A;  2B11 B;  1AFO A;  3CL3 D;  3VTP C;  1YYC A;  3ITK A;  1VQN P;  4XE5 B;  1XTG B;  4EDF A;  1PGO A;  3VP8 A;  2KSE A;  1CIH A;  5APQ A;  2HPC A;  1OIP A;  3CX5 H;  2PCB B;  1SQV G;  2I1K A;  2JWD A;  4I6M C;  1VQP P;  3O6Q B;  1HWT C;  1GMJ A;  1K3G A;  1SQX E;  4JF7 A;  5AVV B;  3M9B A;  1FAV A;  1KB9 D;  5CJ4 A;  1LNQ A;  2YIU B;  4IL6 X;  2DGE A;  3ZOX A;  2OYI B;  3OJA B;  1FOS E;  3MK7 C;  4NPE A;  2IBZ E;  2FXM A;  2IBZ D;  1L0L D;  1J2J B;  1URQ C;  3IF4 A;  1MFZ A;  2DW3 A;  2QJK C;  1IQC A;  2M3B A;  1OZH A;  2LXB A;  3TGU J;  3SSU A;  3CU4 A;  3LID A;  5GTH H;  1K04 A;  3HE4 A;  1YEA A;  1DII C;  2LIT A;  5AVY B;  1M7L A;  1VQ4 P;  3M0D C;  2O01 N;  4Y5R A;  3CCV P;  3JC2 2;  1CXA A;  3CCM P;  3CCL P;  4I1L A;  5KLV D;  1UII A;  3CYT I;  4V2K A;  4AAM A;  1I5T A;  2FBW C;  4YXD C;  2Y9Z A;  3L75 J;  1FZG A;  4H44 C;  1IC2 A;  1FZE A;  3E1R A;  1WVE C;  2AXT H;  3NMD A;  1ZRT E;  1LT1 A;  3TDK A;  1IK7 A;  3WFD C;  1JUN A;  1FJP A;  2I1J A;  4PJ0 H;  3M0A A;  3OCD A;  2BEQ D;  4EYY Q;  1KOR A;  3H1K J;  2N18 C;  4A7P A;  2IZ0 A;  1LWU C;  1KIL B;  2E76 C;  2WSF H;  1LTT C;  3JCU E;  4PW9 B;  1FJ0 A;  2AXT E;  1NTK J;  1VF5 C;  4PD4 E;  5CYT R;  3JSV C;  2FYU J;  1I6E A;  2OTK E;  2XKM A;  2O1K A;  1MV8 A;  1NH4 A;  3N4X A;  2YO2 A;  3WUU A;  3M9H A;  3Q5R A;  5CCH D;  3WUT A;  2WSC J;  3TYY A;  1GK6 A;  1ZXG A;  3QWO C;  4CPG A;  3CCE P;  2Q3E A;  4FA9 A;  4YPC A;  2KS1 A;  4UB8 H;  3L74 E;  4N6J A;  1JY3 P;  5DJU B;  1NGM B;  5APY A;  2FYN C;  4UB6 H;  3GLM A;  5AVS B;  1CCH A;  1VYD A;  3CCR P;  1RQV A;  3EFF K;  4WB4 A;  2W83 C;  1BCC J;  3USS A;  1KZU B;  2D0W A;  2KSJ A;  4WVZ A;  4RJT A;  1GK4 A;  3W67 A;  1SQB D;  3HUS B;  1S1C X;  3K5B A;  2BAS A;  4Y99 B;  3RL0 g;  4C7N B;  2D0S A;  2QSI A;  3PXS A;  1B7V A;  5KAF H;  1RE3 C;  3Q3D A;  2FXP A;  3V2N A;  3TGU E;  3NBT A;  2IBZ I;  3MTU E;  1N7S B;  2QRX A;  2NPS D;  1DD3 A;  3GW6 A;  1IRW A;  2R3C A;  3PH2 B;  4IL6 H;  5AVZ B;  2K9J B;  2YQB A;  3LW5 H;  4JYB A;  3MIW A;  3D0W A;  1SQX J;  2CA3 B;  2E43 A;  3L74 D;  2N9B A;  2ZYA A;  1S5L V;  2GUS A;  1HJ5 A;  1EDL A;  4P4Q B;  4L73 A;  1SQP E;  5GTH V;  2WT7 B;  5KLI B;  3HE4 B;  1M1K Q;  2H43 A;  4H13 D;  2JJL A;  1H32 A;  2P58 A;  3BCC D;  1KIL D;  3VYM A;  1W2B O;  3PTZ A;  5AVQ B;  5C39 A;  3CC4 P;  1N15 A;  2BPB B;  3CXH W;  1EDI A;  3KZI H;  4DCK A;  2BCC D;  2B10 B;  1D7M A;  4N78 E;  2L5G B;  4AAO A;  2YK3 A;  1S72 P;  3HD7 C;  2YKQ A;  3HQ7 A;  3VMA A;  1DW3 A;  2NZ2 A;  4O9B A;  4WY4 D;  3CWB D;  1NTZ G;  2BCC G;  4KT0 J;  2MKV A;  1QGK B;  1RF0 A;  2KUB A;  1FZA A;  2C1U A;  3W68 A;  3V5B A;  3C8V A;  1DW2 A;  1FCD C;  1N50 A;  1BE3 E;  3WUV A;  3BAT A;  3VYI A;  4EIF A;  1KX2 A;  5CIB B;  1CRC A;  4BRY B;  1L4A A;  4GOD A;  1SQP D;  2GM4 A;  2POH A;  1I54 A;  1VQL P;  4XFJ A;  1AA0 A;  1OVU A;  1OVR A;  1CRG A;  3B8E B;  1FC2 C;  1YBK A;  3PRJ A;  4W80 A;  1X8Y A;  4GT1 A;  4AAL A;  1HJ0 A;  1EZV E;  1IK9 A;  1NHL A;  1YJN P;  1YIC A;  2FKW B;  4UB6 E;  1BSN A;  4OGQ C;  1ZRT D;  1N2D C;  1RF1 B;  2QJY C;  1GL2 C;  1LP1 B;  3AE4 C;  5BU5 A;  2ZT9 B;  1KB9 E;  3Q5P A;  3VMY A;  1H0T B;  1MZ4 A;  4H0L C;  1YHQ P;  5APS A;  3Q5S A;  1BDD A;  1L0N D;  3FX0 A;  2N9I A;  1X0T A;  1GKS A;  1RE3 A;  3RK3 C;  2FYU K;  4JQ0 D;  3MUD C;  2KLV A;  2W6B A;  1AVO A;  4KHX A;  2IDB A;  1DT1 A;  4WQB A;  1CIF A;  4PD4 H;  3V2R A;  2LIR A;  2OZ1 B;  5CIE B;  5AVW B;  4QAO A;  4WQC A;  4IFF A;  2W27 A;  3R2P A;  1P84 H;  5B6Q A;  1Q81 Q;  2A45 H;  1SQB K;  2Y0E A;  3CX5 E;  3C2C A;  1RAQ A;  4LLH A;  3A0H E;  1AOQ A;  3V4W A;  3H1I D;  1N73 C;  1KV4 A;  1JY2 O;  5AW0 B;  1SQX D;  2GB8 B;  3CME P;  1AQ5 A;  1QL1 A;  5KKZ B;  4DZO A;  3VMZ A;  5DFS A;  2RN0 A;  2K88 A;  3C9I A;  2N1T B;  4GKG A;  2C2C A;  1U7J A;  351C A;  2BCN B;  1SQX G;  2ZAE B;  2XU6 A;  1VQ5 P;  4YTP C;  2XV5 A;  2OQQ A;  5E79 H;  4HYT B;  1C6R A;  5H2F H;  3FWN A;  1NTM J;  1NKZ B;  2E5Y A;  2HYN A;  1BE3 J;  1L0L J;  2WWW A;  1CI6 A;  2XZR A;  3ZOW A;  3SLE A;  5CIF B;  1KB9 I;  2BH4 X;  4U7J A;  2DVH A;  1H31 B;  1L0N J;  1WMK A;  3SWK A;  1M90 Q;  1L0N E;  3SWS A;  3QH9 A;  3MUD A;  1N9C A;  4BWN A;  4NPF X;  2CE0 A;  2WIT A;  4H13 C;  2G8Y A;  3RN1 A;  3L71 J;  1FU1 A;  1PIX A;  2M5A A;  3O5C A;  1PPJ E;  3BAS A;  5KAI V;  2J58 A;  3ZOO A;  1WRG A;  3WU2 H;  2QE7 H;  2QA4 P;  2WPR A;  1URQ A;  1KIB A;  2KNC A;  1FI3 A;  4I7Z C;  2B88 A;  3WFC C;  4FB1 A;  3X39 A;  3OA8 A;  1AJY A;  1CC5 A;  3EFG A;  4D6T D;  1EC5 A;  1CO6 A;  1Q82 Q;  4PJ0 E;  3WMM 0;  3P8C D;  3H1J E;  1LT9 B;  2P1J A;  2K3R A;  1Z56 A;  1JTH A;  2IFN A;  2RH0 A;  1HBW A;  3BVH A;  4D6T E;  1CYJ A;  3P7K A;  3TYI A;  1NU1 D;  3A2A A;  1ZR4 A;  2WQY C;  1NTK E;  2WSF J;  1FI7 A;  1DX7 A;  1H9X A;  1HRO A;  3G3Z A;  1NO4 A;  2AIU A;  1JTH B;  1QLE D;  2OYI C;  1K3H A;  1EB7 A;  2E42 A;  5E79 E;  2K1A A;  2M3E A;  1GDV A;  1OAE A;  3NTN A;  5AW3 B;  3AE1 C;  4H44 D;  2FY8 A;  3HUS A;  1N90 A;  3N7N A;  2OYH B;  2C0X A;  2AEF A;  1VF5 D;  1BGY E;  1HJ4 A;  2PCC B;  2ZYG A;  2BGV X;  3V6I A;  5APV A;  4IOI H;  2E75 C;  1CNO A;  1S3J A;  1IZL 0;  2ZZS 1;  5GTI H;  1BCC E;  4JBZ A;  2FYU G;  5AW9 B;  1SQP G;  5AVX B;  2B12 B;  155C A;  1JDL A;  1KQS O;  2A45 I;  4FAN A;  3RGU A;  3P8C E;  1H33 A;  4YXW H;  1SFC C;  4N0K A;  1SQV J;  3WU2 E;  3SWF A;  3MD0 A;  3D70 A;  1FI9 A;  1M57 D;  3CCU P;  1J1D B;  1X22 A;  3SFD C;  1NWQ A;  2KK7 A;  2N3B A;  1NTM K;  2CPS A;  1YJW P;  1JB0 J;  2IPP A;  3H1L J;  1URQ D;  4GDO A;  1KFN A;  3H1K G;  3L72 E;  3A0B V;  4HJG H;  3AEC C;  3OCD B;  3L73 G;  1L4A D;  3GHG C;  5KLV K;  1G2C A;  4QMA A;  1IFN A;  3L73 J;  1VQK P;  4IL6 V;  1CW5 A;  3RK3 D;  4TLF A;  3RK3 E;  1KYO I;  2R3S A;  2Q5U A;  1YIQ A;  3DP5 A;  3I5C A;  1IFD A;  1DEE G;  1SS1 A;  4ASV A;  1N86 A;  2Z5I A;  1FZC C;  4EOT A;  4PV1 C;  1G2C B;  1J3S A;  1CRJ A;  1F1C A;  1RF1 A;  1VL2 A;  3IFM A;  1M1J A;  5C0Z A;  1CSW A;  2KS1 B;  3L37 A;  4LJI A;  5B66 E;  3BCC E;  3S1K A;  4Y99 C;  1EDJ A;  1NTM G;  1LTI C;  1USD A;  2H88 C;  4D6T J;  5KTB A;  1HH0 A;  3ABV C;  3KQG A;  1EZV I;  1MZ9 A;  2R5D A;  2NPS C;  4OH8 B;  1C52 A;  1YQ3 C;  1FOC A;  3WFE C;  5L8R J;  1COR A;  3RBZ A;  3ZOY A;  1CED A;  2BEZ F;  3M0D A;  3Q2Y A;  3HQ6 A;  2FFD A;  4XA4 A;  1RH5 B;  1HRC A;  5KAF E;  5AVR B;  1N7S A;  3M9Q A;  4PWA A;  1LWU A;  1PP9 G;  1SVF A;  1VQ9 P;  1LTJ A;  3HQ8 A;  2BLF B;  1CZQ A;  1E8E A;  3AEE C;  3L70 E;  1LTS C;  2SPZ A;  2MJZ A;  3B5N A;  3L75 D;  2OYH A;  1KYO E;  2A06 E;  3L4O A;  4AQR D;  5K5G B;  2FFD B;  5CBO A;  1USE A;  1NJI Q;  3ZCF A;  2AXT V;  2HR3 A;  2V7Q J;  1VQ6 P;  4FAV A;  1FZB A;  2AI5 A;  1IJD B;  1NKN A;  4L3H A;  1SQP K;  1KQL A;  1U75 B;  1S9K D;  4DT0 A;  1YI2 P;  3RK2 B;  1A8C A;  3E7K A;  1NNO A;  1DIQ C;  1H33 B;  2R32 A;  2ZYD A;  5B66 V;  1SQB G;  1ZP0 C;  4K35 A;  2PAJ A;  1YTC A;  3O0R C;  1GW4 A;  2Q3I A;  2B9B A;  1K73 Q;  3HQ9 A;  1ZOY C;  1NIR A;  3ZBM A;  1K9M Q;  1J1E C;  1DVH A;  1DIP A;  1CHJ A;  3F89 A;  5KJ7 A;  1X9V A;  2QJP B;  5KLV G;  1P84 I;  1JM0 A;  2JR8 A;  1YTZ I;  2Q6Q A;  2XDJ A;  2C8S A;  2QM8 A;  2W6J H;  1H89 A;  3OA8 B;  3HRN A;  4AX3 A;  3M06 A;  5M1B A;  1PPJ D;  1RY3 A;  2O01 J;  4BXL A;  2W8Z A;  1VPC A;  2HFE D;  2YIU C;  1S5L X;  2Q7C A;  3PJS K;  3KHU A;  1H32 B;  3RL0 C;  1U7M A;  5B5E E;  3IN6 A;  3CXH I;  2WSE J;  5DJQ C;  5AVU B;  3P32 A;  3CLQ A;  3UIA A;  1WT6 A;  3RN0 A;  4R4M A;  5AW5 B;  4Q5P A;  1GU4 A;  2GC7 D;  3KYQ A;  3SXT A;  3HD7 A;  1IFI A;  2QJY B;  3G4S P;  1LS9 A;  2C9N Y;  2ZT9 C;  1NAF A;  1CCR A;  1L4A C;  4JCG A;  1KN7 A;  3H1J G;  1PPJ G;  3MP7 B;  2WZ7 A;  2PAC A;  3E1I A;  3H1J J;  3TF5 A;  1OW8 A;  5CIH B;  2E74 D;  1RE4 C;  2N1T D;  3G71 P;  1Y8A A;  3L72 J;  3T97 A;  1LTJ C;  2HOD A;  2IYO A;  2KXP B;  1GZL A;  1QL3 A;  2YKO A;  1T6A A;  3H1I G;  3GG2 A;  3RL0 D;  2HPC B;  1LMS A;  3AE3 C;  5AW4 B;  1YIJ P;  3MK7 B;  2V08 A;  2N18 B;  1LWU B;  4HH2 A;  1JMB A;  1S4X A;  2JKV A;  2PGD A;  1T2K C;  1NTZ K;  2ZBO A;  2J59 M;  2E75 B;  2RMZ A;  1SQQ K;  1I55 A;  2IBZ G;  4RO0 A;  1FZC A;  4AAN A;  3RLM A;  3CC2 P;  3H1H D;  2CK3 H;  3H6P A;  1KFM A;  1C2R A;  1U74 B;  3CPW O;  2VRS A;  5H2F V;  1MG3 D;  5B5E V;  1CYI A;  2CPB A;  3BCC G;  3B5N C;  1LJ2 A;  5AUR A;  1HGZ A;  3VN0 A;  2OYO A;  4Z1M H;  1SQV D;  1LP1 A;  2K37 A;  1KB0 A;  4C7R A;  3H1K D;  5BVZ A;  4H44 B;  4B86 A;  4WY4 A;  5C9M A;  4K3I A;  1CTY A;  1JCC A;  2VHD A;  3VRD A;  1H8A A;  3H1H J;  451C A;  3L74 J;  3PXW A;  2IZ1 A;  3O1Y A;  1ZZH A;  1RE4 A;  2WT7 A;  3HUS C;  1R0Q A;  1GTW A;  1Q7Y Q;  1W5C E;  5BU8 B;  1C7M A;  2YNY A;  4ZKP A;  4N3Y B;  3PHL A;  3MHV A;  2E5T A;  3B71 A;  2FYZ A;  3B4S A;  1KYO D;  3NBS A;  1NTK G;  4C46 A;  2A06 D;  5AW2 B;  3VNW A;  2GUV A;  5AW6 B;  1COT A;  4PV1 B;  4KMG A;  3HE5 A;  5KJ7 C;  3CCJ P;  1FZF A;  1Q86 Q;  3AEB C;  4WQA A;  2P7J A;  1JO5 A;  1FDM A;  1Q90 D;  2JTI B;  3FGA D;  1HH7 A;  5KAI E;  1KTM A;  2C1D B;  1LTG C;  1NML A;  2WPV B;  1KQF B;  1DD4 A;  2JQR A;  1YTZ T;  1HUC A;  1A02 F;  4GED B;  1QL4 A;  2D2C C;  2P67 A;  2V7Q H;  3CWB J;  3NWV A;  1GL2 D;  1EDK A;  1SQV K;  2WTY A;  3A0H V;  3AE6 C;  1A02 J;  1KD1 Q;  4DOJ A;  1JY2 P;  5DF5 A;  1JNM A;  4ZMD A;  4WBA A;  2FYU D;  1L0N G;  2BCC J;  4I2L C;  1I8P A;  1CSB A;  2Y0D A;  2R5B A;  5CJ0 A;  3CMA P;  1E2R A;  1YJ9 P;  2XTS B;  3AED C;  1NTK K;  2Z5H A;  1PGQ A;  1JEK A;  2NRG A;  3HTK B;  2QEX P;  1F1F A;  2OYH C;  3WU2 V;  3F5H A;  1RZ5 A;  3KZI E;  1URQ B;  1VQO P;  1HVV A;  1QL2 A;  3TSI A;  2QJK B;  1OWA A;  5E79 V;  1PGJ A;  3L75 E;  3L72 D;  2E76 D;  5CID B;  2N9Y B;  4XYD B;  3ZIY A;  3II6 A;  3CCQ P;  3FWL A;  5CCG C;  2ZOO A;  3HTK A;  2OTJ P;  2MHM A;  4KJM A;  3WUI A;  1FJK A;  1KX7 A;  5AW1 B;  4U3F G;  1KB9 H;  1DEB A;  5GTI E;  2NPS A;  3H1L D;  4UB8 E;  1CSV A;  3TK1 A;  1M60 A;  3SFE C;  2H7H A;  1N73 A;  1EZV D;  2OZ1 A;  3SVW A;  2A45 G;  5CCH A;  1KYO H;  2PP6 A;  5CIC B;  1I6D A;  1CRI A;  4J20 A;  1IFM A;  1AKK A;  2UWJ E;  2OYI A;  3V4Q A;  1HJ3 A;  1NTZ D;  1PGP A;  3CWB G;  3L75 G;  1W2L A;  1QYZ A;  2N9J A;  4PD4 I;  1RHZ B;  3A0B H;  4JPZ B;  3H1I J;  1RF1 C;  1GL2 B;  1FS0 E;  2JDI H;  4W7Z A;  1H1O A;  5IY5 1;  5CHX A;  1E79 H;  5GTH E;  3CC7 P;  3CWB E;  3BRV B;  3PLN A;  4WQ8 A;  1S6V B;  4FA5 A;  3I56 P;  1VF5 B;  1OW7 A;  1IZN B;  3CXH E;  1AYG A;  3FXD A;  3DR0 A;  1L2P A;  2GIW A;  1GL2 A;  4EIC A;  3GHG A;  1LC1 A;  1GD2 E;  5KAF V;  3PXT A;  1PP9 D;  2QG4 A;  4TT3 H;  1P84 E;  1X79 B;  5CMZ A;  3L71 E;  4L1Q A;  2O1J A;  2YCC A;  1SQB E;  2LR2 A;  1L4A B;  4L3G A;  1OCD A;  1QVF O;  4RES B;  5APW A;  1AQT A;  2WPS A;  2CE1 A;  5KKZ C;  3D71 A;  1I8O A;  1NU1 J;  1SP4 A;  2AEM A;  1K8A Q;  1AOF A;  1DW0 A;  4W7Y A;  1S9K E;  1IFJ A;  4IFD K;  1NAY A;  4H0L B;  3EQ2 A;  5APX A;  2WPQ A;  2WSE H;  1N7S C;  2KZI A;  4HB1 A;  1QX8 A;  2BH5 X;  3LW5 J;  3H1J D;  1PV3 A;  3AE2 C;  3RMZ A;  5KLV J;  4PJ0 V;  3HD7 B;  1XTC C;  2ZVN B;  4MN4 C;  1LT9 A;  2JP3 A;  3L71 G;  2LXC B;  1HTL C;  3P8M C;  1ZLL A;  1FOS F;  4D6T G;  4L76 A;  1BGY D;  4OVN F;  1SQV E;  1SQQ G;  3PP5 A;  3V2P A;  2E75 D;  4H13 B;  1RF0 C;  3L71 D;  3AEA C;  3TGU D;  1E29 A;  1L0N K;  2HG5 D;  3H1K E;  4C7N A;  3B5N B;  3CXH H;  2OTL P;  4WY4 B;  2B87 A;  3OAK A;  5TIS V;  1M1J C;  3A5T A;  4NPD A;  4I7Z B;  2E74 C;  1GDT A;  1NTK D;  1L9B C;  3IAO A;  3TGU G;  2N1T C;  1P84 D;  3AE9 C;  2G3A A;  1ZW0 A;  3A0H H;  2ZXX A;  1NTM D;  1RAP A;  4MU8 A;  1KIL E;  2K9J A;  1YQ4 C;  2HV4 A;  1FZC B;  1BGY G;  2C0W A;  1M8O B;  3AEG C;  3H25 A;  3G6E P;  2KZJ A;  3L72 G;  1HGV A;  3A7O A;  3O6Q A;  1YIT P;  1S5L E;  4EI2 A;  1L0L K;  2QJP C;  4M3L A;  4WQD A;  2FYU E;  4K3A A;  1JCD A;  3GF7 A;  1VQ7 P;  3GF3 A;  1ZV8 A;  4U3F D;  4H0L D;  3H1L G;  2A06 G;  3JCU H;  4L75 A;  2M8R A;  3PH0 A;  3S4R A;  3AE8 C;  2ZXE B;  2KIK A;  3MGN A;  4OGQ D;  5DJQ B;  2L91 A;  2GC4 D;  3L70 D;  2V4H A;  3RBX A;  5TIS H;  1OX3 A;  2H89 C;  4HKZ H;  1SQQ D;  2KP8 A;  4AUW A;  3CP5 A;  4N78 D;  2IYP A;  3MZW B;  4EID A;  1LT9 C;  3L4M A;  2KOG A;  4L74 A;  1SQB J;  4IL6 E;  3AE5 C;  1M70 A;  3H1H E;  1LGH B;  3U1C A;  2L4D A;  4OGQ B;  4RSZ A;  1G1J A;  1U57 A;  1T8Z A;  1QEX A;  1YCC A;  1PL5 A;  1OXZ A;  1SFC B;  3NXS A;  1BSH A;  3CCS P;  1H31 A;  1JY3 O;  3D6Z A;  3B5N D;  4BRY A;  2ZXY A;  1CSU A;  1CHI A;  3T97 B;  5CIG B;  1KIL A;  5APT A;  3U59 A;  5KAI H;  1CHH A;  3TNU A;  4O1Q A;  1FDO A;  1LFM A;  3SJL A;  1HZV A;  4WQE A;  2OAR A;  5CCG D;  1RZ6 A;  1EZV G;  1OMI A;  2KNC B;  3SWY A;  2Y9Y A;  2E76 B;  2FRC A;  2YO3 A;  1SFC D;  4DY9 A;  1CIG A;  4FA1 A;  1N73 B;  1LC2 A;  1CXC A;  3L73 E;  3G9R A;  3EWK A;  3VP9 A;  4AYC A;  1H0T A;  3FXE A;  2B87 B;  1SQQ E;  2YMK A;  1KQG B;  1NU1 G;  1NVO A;  3A9F A;  1EXJ A;  4GOF A;  1QKS A;  2B4Z A;  1T3U A;  1PP9 E;  1A2S A;  1BCC G;  2PFX A;  5AW7 B;  3L73 D;  2PRR A;  3AEF C;  3DMI A;  4XXL A;  1JMM A;  1J1D C;  3I55 P;  2YKP A;  2BCC E;  3L35 A;  2FYN B;  3A3Y B;  4EIE A;  2H8P D;  3VMX A;  2N3Y A;  2IX7 C;  1WEJ F;  1ETP A;  1ZN5 A;  4GOE A;  1N8R Q;  3BCC J;  4PV1 D;  1IO3 A;  1RQU A;  4GYD A;  1G1I A;  1T2K D;  2NPS B;  5B5E H;  3KDP B;  1E5W A;  1BE3 G;  1NOH A;  2QIW A;  3GHG B;  1CTZ A;  1UIX A;  2C9L Y;  4NFG B;  1FE6 A;  1CIE A;  1VQM P;  1FDI A;  1KV9 A;  1NTZ J;  1BE3 D;  1HJB A;  1NTZ E;  2C1V A;  2CXB A;  2QM7 A;  2JEE A;  1L0L G;  1H88 A;  1M56 D;  2D2C B;  1YFC A;  1CI6 B;  1GU2 A;  2ZT9 D;  3Q1M A;  2XNX A;  2I8D A;  3L70 G;  2C1D A;  1DH3 A;  1S5L H;  1ZR2 A;  5KLI C;  3CX5 I;  3CX5 W;  4RKU J;  5B66 H;  4R4L A;  1HF9 A;  1FHB A;  1Y9B A;  3KXD A;  5CCH C;  2I8F A;  3D6Y A;  1Y47 A;  5CBN A;  1CSX A;  2AEJ A;  2LKM A;  2CA4 B;  2P10 A;  3GMA A;  2WMM A;  3WC8 A;  5CCG A;  2ZVO B;  2C9X B;  1VDF A;  2ZFC A;  2IFM A;  3CXH D;  1SFC A;  1PZQ A;  1KYO W;  1NU1 E;  2AXC A;  3ORV A;  3M97 X;  1MKM A;  2WSC H;  2V07 A;  1BL9 A;  2WVR A;  1HCM A;  2FXO A;  3O8Z A;  1GW3 A;  2W90 A;  3WFB C;  2KI7 B;  2KLU A;  1OW6 A;  1YEB A;  1CTJ A;  4LGD E;  1JY3 N;  1LTA C;  4OWF A;  3O20 A;  1KIL C;  1MUU A;  1OFC X;  1QVG O;  3KZI V;  2Q9I A;  3BRT B;  1IFP A;  2MTA C;  4FA4 A;  5DJT B;  2FFD C;  1GIW A;  1CRH A;  1M1J B;  2HOD B;  1HZU A;  5EFW B;  1GQ1 A;  3R4Y A;  3RL0 B;  4H0J A;  1SQX K;  2W6A A;  1IRV A;  1KMI Z;  1K05 A;  1NTM E;  1MG2 D;  3RK2 C;  3M91 A;  1N7S D;  3C1L A;  2ORL A;  4LC1 A;  2M0B A;  1H9Y A;  1SQP J;  3IR9 A;  4ZNC A;  5KJ7 D;  4ASW A;  5KLV E;  1FBM A;  1CYC A;  1S2E A;  2Q1K A;  2K9Y A;  5H2F E;  2XND H;  5AW8 B;  3OW2 O;  2KYV A;  1SLQ A;  2D2C D;  3CI9 A;  3OA7 A;  1LTJ B;  1KC8 Q;  1MFT A;  1GJQ A;  1W2E A;  3L36 A;  5TJH A;  3U1A A;  2EXV A;  2Z4E A;  1Q2N A;  3RK3 B;  1AVY A;  3S9O A;  1DW1 A;  4PD4 D;  1L9J C;  1A56 A;  4IFM A;  4UB6 V;  2P2U A;  4Y28 J;  1BCC D;  2ZON G;  5AVT B;  5EXQ A;  1R5L A;  2M5A B;  2R44 A;  1AV1 A;  2OGU A;  3VOP A;  1NMI A;  3KPE A;  1BDC A;  1GU5 A;  1C6S A;  1R5S A;  2N1T A;  3CD6 P;  1N7L A;  3A0B E;  1LTB C;  1C2N A;  1PFI A;  3RK2 D;  1DVV A;  2B0Z B;  2J5U A;  5APU A;  1QN2 A;  3LIE A;  2WSS H;  1EXI A;  1W5C T;  1VQ8 P;  1OVV A;  3TNU B;  1M6Z A;  4WQ7 A;  3HE5 B;  2KB7 P;  5GTI V;  5TIS E;  2B89 A;  4UB8 V;  4O1W A;  1T3J A;  3H32 A;  3AE7 C;  4YE1 A;  1ZME C;  3V2Q A;  2ITA A;  4H0K A;  2YXR B;  1NYH A;  4DJG A;  3NFQ A;  3L74 G;  2Y0C A;  1BGY J;  1J1E B;  2O01 H;  2QVA A;  1TU3 F;  2ZJS E;  3HD7 D;  2HLO A;  2YMY A;  1YNR A;  1C75 A;  3ZDM A;  4WY4 C;  2RKL A;  1L0L E;  4WWI A;  3H32 B;  1SQQ J;  4U3F E;  1EQ7 A;  2YXQ B;  3L70 J;  2E74 B;  1JOC A;  2JO1 A;  3H1I E;  2FWL A;  3H1H G;  4EIJ A;  4GIF A;  1NU1 K;  3H1L E;  4ZKU A;  2GA1 A;  3JBT B;  2JWA A;  1CRY A;  1JY2 N;  4WQ9 A;  2O3J A;  4JYC A;  1R8E A; 
#chains in the Genus database with same CATH homology
 3L70 D;  1C6R A;  3CX5 D;  2V08 A;  2N18 B;  3MK7 B;  1SQQ D;  1C6O A;  3CP5 A;  3ZOW A;  3SLE A;  5CIF B;  2B11 B;  2BH4 X;  4EID A;  3L4M A;  2DVH A;  2ZBO A;  1H31 B;  3ITK A;  2RMZ A;  1I55 A;  4EDF A;  1M70 A;  3SWS A;  4AAN A;  3RLM A;  2L4D A;  3H1H D;  1CIH A;  1N9C A;  1C2R A;  1U74 B;  2PCB B;  2CE0 A;  4RSZ A;  5H2F V;  3RN1 A;  1MG3 D;  5B5E V;  1CYI A;  3O5C A;  1K3G A;  5AUR A;  1YCC A;  5KAI V;  1SQV D;  3ZOO A;  1KB0 A;  1KB9 D;  3H1K D;  1H31 A;  1KIB A;  1FI3 A;  2YIU B;  5C9M A;  2DGE A;  2ZXY A;  1CSU A;  4K3I A;  3ZOX A;  3WFC C;  1CTY A;  4FB1 A;  1CHI A;  2VHD A;  3MK7 C;  5CIG B;  3OA8 A;  3VRD A;  3X39 A;  1CC5 A;  451C A;  4D6T D;  2IBZ D;  1L0L D;  1CO6 A;  3PXW A;  3O1Y A;  1CHH A;  1IQC A;  4O1Q A;  1ZZH A;  1LFM A;  3SJL A;  1HZV A;  4WQE A;  3CU4 A;  1R0Q A;  1YEA A;  1DII C;  2LIT A;  1RZ6 A;  1CYJ A;  2KNC B;  2FRC A;  3TYI A;  4DY9 A;  4Y5R A;  1C7M A;  1CIG A;  1NU1 D;  4FA1 A;  1LC2 A;  1CXA A;  1CXC A;  3PHL A;  1FI7 A;  1H9X A;  1HRO A;  1KYO D;  3NBS A;  5KLV D;  3CYT I;  4V2K A;  2A06 D;  1I5T A;  4AAM A;  2AIU A;  3VNW A;  3A9F A;  1COT A;  1QKS A;  2B4Z A;  4KMG A;  1K3H A;  1EB7 A;  1WVE C;  1A2S A;  3TDK A;  1GDV A;  1OAE A;  3L73 D;  3WFD C;  4WQA A;  3DMI A;  4XXL A;  2JTI B;  1HH7 A;  2C1D B;  1N90 A;  3OCD A;  1NML A;  2FYN B;  2N18 C;  2JQR A;  4A7P A;  4EIE A;  1HJ4 A;  2N3Y A;  1WEJ F;  1ETP A;  2PCC B;  4GED B;  1QL4 A;  4PW9 B;  1FJ0 A;  2BGV X;  3NWV A;  1IO3 A;  4GYD A;  1CNO A;  1IZL 0;  5CYT R;  2ZZS 1;  3A0H V;  1I6E A;  5DF5 A;  2B12 B;  2FYU D;  1CTZ A;  155C A;  1JDL A;  1I8P A;  4NFG B;  4FAN A;  1CIE A;  2Y0D A;  1H33 A;  2Q3E A;  1KV9 A;  4FA9 A;  1BE3 D;  1E2R A;  4N0K A;  2XTS B;  1FI9 A;  2KS1 A;  2C1V A;  2CXB A;  2N3B A;  1F1F A;  3WU2 V;  1RZ5 A;  1CCH A;  1VYD A;  2QJK B;  1YFC A;  5E79 V;  2D0W A;  4RJT A;  1GU2 A;  3L72 D;  5CID B;  1SQB D;  3A0B V;  2C1D A;  3OCD B;  2N9Y B;  3CX5 W;  4XYD B;  2D0S A;  1FHB A;  3ZIY A;  3PXS A;  4IL6 V;  3FWL A;  2I8F A;  2ZOO A;  1B7V A;  2MHM A;  3WUI A;  1CSX A;  1KX7 A;  3NBT A;  1YIQ A;  2CA4 B;  3DP5 A;  3WC8 A;  3H1L D;  1CSV A;  1M60 A;  2C9X B;  3GW6 A;  1IRW A;  3CXH D;  3PH2 B;  1EZV D;  2OZ1 A;  3SVW A;  1KYO W;  2K9J B;  2YQB A;  3ORV A;  3M97 X;  5CIC B;  1I6D A;  1CRI A;  1J3S A;  4J20 A;  1AKK A;  2V07 A;  1CRJ A;  1BL9 A;  1F1C A;  1HCM A;  5C0Z A;  1HJ3 A;  1CSW A;  1NTZ D;  2CA3 B;  3L74 D;  1S5L V;  1W2L A;  1QYZ A;  2N9J A;  3WFB C;  1HJ5 A;  4P4Q B;  1YEB A;  1CTJ A;  4LJI A;  5GTH V;  5KLI B;  1H1O A;  5IY5 1;  3O20 A;  3KZI V;  2MTA C;  3PLN A;  4WQ8 A;  4FA4 A;  1GIW A;  1H32 A;  1CRH A;  1S6V B;  4FA5 A;  3BCC D;  1C52 A;  1HZU A;  1AYG A;  1FOC A;  3VYM A;  3PTZ A;  1GQ1 A;  3WFE C;  3DR0 A;  1N15 A;  1COR A;  2BPB B;  3CXH W;  2GIW A;  3ZOY A;  1CED A;  4H0J A;  1IRV A;  3HQ6 A;  4EIC A;  2BCC D;  1HRC A;  2B10 B;  1MG2 D;  4PWA A;  2ORL A;  1LC1 A;  4AAO A;  2YK3 A;  5KAF V;  3HQ7 A;  3VMA A;  3PXT A;  1H9Y A;  3HQ8 A;  1PP9 D;  2QG4 A;  1DW3 A;  2BLF B;  1E8E A;  3L75 D;  3CWB D;  4L1Q A;  2YCC A;  4L3G A;  1OCD A;  1CYC A;  3L4O A;  3ZCF A;  2CE1 A;  2C1U A;  1I8O A;  2AXT V;  4FAV A;  2AI5 A;  1AOF A;  1DW0 A;  4L3H A;  1DW2 A;  1FCD C;  1N50 A;  1U75 B;  1GJQ A;  4EIF A;  5TJH A;  1KX2 A;  5CIB B;  1CRC A;  2EXV A;  1SQP D;  1A8C A;  2BH5 X;  1I54 A;  1NNO A;  1DIQ C;  1H33 B;  3H1J D;  3RMZ A;  5B66 V;  4PJ0 V;  1CRG A;  1DW1 A;  1YTC A;  3PRJ A;  4PD4 D;  1L9J C;  1A56 A;  3O0R C;  4UB6 V;  4AAL A;  3HQ9 A;  1BCC D;  1YIC A;  2ZON G;  1NIR A;  5EXQ A;  3ZBM A;  1BGY D;  1DVH A;  1ZRT D;  1CHJ A;  1NMI A;  1C6S A;  3L71 D;  3TGU D;  2QJP B;  1E29 A;  1C2N A;  1DVV A;  1MZ4 A;  2C8S A;  2B0Z B;  1QN2 A;  3OA8 B;  4AX3 A;  1PPJ D;  1L0N D;  5TIS V;  1W5C T;  2N9I A;  1GKS A;  1NTK D;  1L9B C;  1M6Z A;  4WQ7 A;  1P84 D;  3KHU A;  5GTI V;  1H32 B;  4UB8 V;  4O1W A;  1DT1 A;  4WQB A;  1CIF A;  1NTM D;  1RAP A;  4MU8 A;  2LIR A;  2OZ1 B;  5CIE B;  5DJQ C;  4QAO A;  4YE1 A;  4WQC A;  4H0K A;  2HV4 A;  3RN0 A;  5B6Q A;  4Q5P A;  2Y0C A;  2Y0E A;  2GC7 D;  3SXT A;  2QJY B;  3C2C A;  1RAQ A;  1LS9 A;  1AOQ A;  3H1I D;  1CCR A;  1YNR A;  4JCG A;  1C75 A;  4WQD A;  2PAC A;  1SQX D;  2GB8 B;  3TF5 A;  5CIH B;  4U3F D;  5KKZ B;  5DFS A;  2RN0 A;  2FWL A;  1QL3 A;  2C2C A;  3JBT B;  351C A;  2JWA A;  2BCN B;  5DJQ B;  3GG2 A;  2L91 A;  2GC4 D;  1LMS A;  1CRY A;  4WQ9 A;  2O3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...