1P84D

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
246
structure length
246
Chain Sequence
MTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREVCAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGKLSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPDEPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKFVFNPPKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 72
structure length 246
sequence length 246
ec nomenclature
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1p84D02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 1p84D01
2YCCA 1IO3A 1EZVD 4L3HA 1YICA 5IY51 3ZBMA 5B5EV 5C9MA 1NTMD 1CTZA 1LS9A 2LITA 1FJ0A 1QL3A 1SQVD 3CX5D 1L9BC 1KB9D 1NNOA 4N0KA 1DIQC 3ZOWA 5AURA 1U74B 2A06D 4K3IA 1A56A 4GYDA 1FOCA 1YCCA 1C6SA 1NU1D 5TJHA 1CEDA 4WQ7A 2N3YA 1W5CT 2DVHA 1MG2D 1AOQA 2YQBA 1DT1A 2RMZA 1C2RA 1I6DA 1OAEA 5KLVD 4FA1A 2CE0A 1CYIA 1RZ6A 1CIHA 3TDKA 4J20A 3ZCFA 3CU4A 3CYTI 1C7MA 1H33A 2QJPB 1DW3A 3L70D 1CRJA 3O20A 5EXQA 3RLMA 3ZOYA 3RN1A 2FRCA 1CRCA 2B12B 3OA8B 1KYOD 1GJQA 3A0BV 1E2RA 1PPJD 2K9JB 2B10B 3SJLA 3JBTB 3RMZA 2LIRA 1CYJA 5CIDB 4NFGB 5DJQC 1CSWA 4V2KA 4GEDB 1JDLA 4Q5PA 1S5LV 1FI9A 3ORVA 2Y0DA 2C1DB 3WUIA 1L9JC 1C6OA 1CRHA 4EIFA 4DY9A 2FYUD 1IZL0 1YEAA 4PJ0V 1IQCA 2B4ZA 3DP5A 5CIFB 1ZZHA 2GC4D 1ETPA 2L4DA 2V07A 2D0SA 1HJ3A 2BCNB 2BPBB 1NTZD 3KHUA 2N18C 1E8EA 1B7VA 2JQRA 1FHBA 2BLFB 1GU2A 1N15A 5KAFV 2CE1A 3A9FA 2L91A 5GTIV 1EB7A 3WFBC 3O1YA 5DJQB 5GTHV 2ZXYA 3CWBD 3PXWA 1S6VB 4H0KA 2BGVX 3OA8A 1I6EA 2EXVA 1C75A 1HZUA 1RZ5A 1CXAA 1K3GA 1YNRA 3CX5W 1R0QA 3OCDB 1DIIC 1I5TA 1GKSA 3VRDA 2N18B 1CSVA 4RSZA 4AANA 5DF5A 4AAOA 4WQAA 1W2LA 1KX7A 2PCBB 2C1DA 1KB0A 3PTZA 3NWVA 1YFCA 5B66V 1CHIA 2N9IA 3WFDC 3MK7C 1FI3A 3L4MA 4L3GA 3PLNA 4FANA 4IL6V 3L73D 4RJTA 4FAVA 1J3SA 1H9XA 4P4QB 2ZBOA 1CC5A 2B11B 2BH4X 2MHMA 2Y0CA 1K3HA 4AAMA 3ZOXA 5CIBB 1DW0A 3HQ8A 3PH2B 1M6ZA 4O1QA 1N90A 1HCMA 4EDFA 1HJ4A 1I55A 4D6TD 3H1JD 4FA9A 1KX2A 1SQPD 4WQ9A 4YE1A 351CA 1SQBD 1YIQA 3A0HV 3RN0A 1CSXA 1HH7A 155CA 1P84D 1BGYD 4XXLA 4U3FD 1KV9A 3HQ9A 3MK7B 4XYDB 3ITKA 1H9YA 2GB8B 4EICA 1YEBA 2I8FA 3PRJA 1MZ4A 1M70A 3OCDA 1CTJA 1CSUA 1CIEA 1A2SA 1QKSA 3ZOOA 1NMIA 2ZONG 2C9XB 1WEJF 1KIBA 5CIGB 2C2CA 3WFEC 2QG4A 4WQ8A 2Q3EA 3HQ7A 5B6QA 2CA4B 3CXHW 2BH5X 2PCCB 5C0ZA 4EIEA 2C1VA 3SLEA 2AIUA 1FCDC 2KNCB 1CHJA 1LFMA 3KZIV 2CA3B 3GG2A 2XTSB 5KLIB 1FI7A 5E79V 2BCCD 3TGUD 1H31B 1PP9D 1A8CA 1I8PA 2QJKB 3L71D 4WQDA 1E29A 2O3JA 1RAQA 3NBTA 1HZVA 1C52A 3L74D 2FYNB 1M60A 2D0WA 2GIWA 3L72D 1C6RA 4Y5RA 2AI5A 2AXTV 4FB1A 2OZ1B 1CHHA 4AX3A 1OCDA 1CCHA 1RAPA 3DMIA 4LJIA 1QL4A 1LC1A 1I54A 4FA5A 1DW2A 1CRIA 1F1CA 3VNWA 5CIEB 2CXBA 2N9JA 3WC8A 451CA 1N9CA 1QYZA 1QN2A 3HQ6A 3M97X 4A7PA 2JTIB 2FWLA 1LC2A 5TISV 1DW1A 4WQCA 3GW6A 5DFSA 3O5CA 1H31A 1CRYA 4PD4D 3X39A 1DVVA 4WQBA 2GC7D 5CICB 5KAIV 1KYOW 2PACA 1CO6A 3BCCD 3VMAA 2V08A 3SXTA 3H1HD 1SQXD 3TYIA 1BCCD 2ORLA 1GDVA 4PWAA 4H0JA 1LMSA 1NTKD 1GQ1A 2OZ1A 2ZZS1 1HRCA 4JCGA 2QJYB 1CNOA 4PW9B 1CYCA 1CXCA 1NMLA 1SQQD 3FWLA 1AYGA 1NIRA 5H2FV 2IBZD 1YTCA 1I8OA 4WQEA 3VYMA 1AOFA 1BL9A 3ZIYA 1HROA 3L4OA 2JWAA 1CORA 1H32B 4MU8A 3SVWA 1CRGA 2C1UA 4KMGA 1COTA 3NBSA 1N50A 3SWSA 3WU2V 2KS1A 1WVEC 3O0RC 3PXTA 2ZOOA 1L0ND 2B0ZB 1MG3D 2C8SA 1DVHA 4AALA 1CTYA 4FA4A 4UB8V 4L1QA 2N9YB 2Y0EA 3DR0A 1H1OA 2N3BA 2DGEA 2HV4A 3PXSA 1GIWA 1IRVA 1CIGA 1CIFA 3H1KD 5CIHB 3CXHD 2YK3A 3H1ID 3C2CA 2RN0A 1BE3D 3CP5A 3L75D 5CYTR 2MTAC 1F1FA 2VHDA 1C2NA 4EIDA 3H1LD 4UB6V 1HJ5A 1H33B 3WFCC 1IRWA 1U75B 4O1WA 2YIUB 1AKKA 1L0LD 3PHLA 1H32A 1VYDA 1CCRA 1ZRTD 5KKZB 4QAOA 3TF5A
chains in the Genus database with same CATH superfamily
2ZFCA 1EZVD 4L3HA 3U1AA 2NPSB 2QJPC 5B5EV 4YXDC 3SFEC 3IFMA 1LS9A 1S4XA 3CX5D 1SQQG 1KB9D 4N0KA 2Z4EA 1YCCA 1C6SA 3AE7C 1NTME 1DD4A 2J58A 2ZAEB 2OYIC 3IN6A 2P58A 4PV1C 1I6DA 1IFDA 1IFJA 2KSJA 2E74C 2A06E 1QX8A 3TDKA 5E79H 3O6QB 1GK4A 3TGUG 1C7MA 1SQVJ 1H33A 3Q3DA 1J1DB 3L70D 2V7QJ 2IDBA 5APUA 3O20A 4H0LD 5CCGA 3RLMA 2IYPA 3ZOYA 2HODB 1H89A 4Y99C 5AVUB 3TNUA 1BCCJ 1L2PA 3HD7B 1AFOA 5BU5A 1RF0A 2OTLP 4WY4C 1E2RA 1PPJD 2B10B 3SWFA 3A7OA 2V4HA 3RMZA 1HF9A 1YJNP 2LIRA 3A0BE 3CCRP 4GEDB 1JDLA 4Q5PA 3H1LG 4GDOA 2Y0DA 2C1DB 3CL3D 1CRHA 2D2CB 3P8CE 1FDIA 2GC4D 3FXEA 2V07A 3VP9A 2BPBB 3LIEA 1OFCX 2JQRA 3NMDA 3F89A 5CJ4A 4JBZA 3R2PA 1EB7A 2WSCH 3O1YA 3PXWA 1M1JC 5CCHC 1S6VB 3TSIA 1NO4A 3H1KJ 1NGMB 1KV4A 3AEEC 3OA8A 1I6EA 1FE6A 2YO2A 1YNRA 1Q2NA 1H0TB 4GKGA 2K9JA 1BE3J 1DIIC 1EQ7A 1GKSA 2Q1KA 4RSZA 2OYIA 5KLVG 1IFNA 3BASA 3OA7A 3V2PA 1KB0A 1FZCC 2A45I 2IFMA 3VOPA 2I1KA 4C7RA 1N7LA 2YXRB 2JEEA 4L3GA 3PLNA 4FANA 3L73D 1J3SA 3II6A 1G1IA 1EC5A 2O01J 1IC2A 2K1AA 4LGDE 3M91A 1IK9A 1K3HA 4WY4A 2JR8A 3ZOXA 1KYOH 1NTMJ 1CI6B 1N90A 1HJ4A 1I55A 4FA9A 4N78D 1URQB 1AQ5A 1KQLA 3RN0A 1VF5D 2E43A 3W68A 1HH7A 3ITKA 4XYDB 2IBZI 3JCUE 1MZ9A 3PRJA 1NTZG 3OCDA 1KILD 2CPSA 3H1JE 1QKSA 3B5ND 3H1HE 4L73A 1SQQK 5CIGB 2C2CA 2Q3IA 2E75B 4WQ8A 1VQ6P 2PCCB 2KP8A 2E42A 3CCEP 3SLEA 1M1JA 3IF4A 1W2EA 2KNCB 1CHJA 3KZIV 2H88C 2XTSB 5KLIB 5E79V 3M9HA 1H31B 2IX7C 1IFIA 1JCDA 3MGNA 3VP8A 4IFMA 1N2DC 1FZCA 3KYQA 1HZVA 1OW6A 3Q2YA 5AW1B 3RK3D 2FYNB 3CC7P 2QIWA 3V2QA 1FC2C 4IL6H 4IFDK 1N7SD 3AEBC 4ZNCA 1GU5A 2HFED 2AI5A 2JWDA 2Z5HA 1FAVA 3L71E 4FB1A 2OZ1B 2JJLA 4W7ZA 4AX3A 2PRRA 3H32B 2PAJA 3DMIA 1M57D 4OVNF 3USSA 1QVFO 1DW2A 3G6EP 2WWWA 2N9JA 4D6TG 5AW4B 1GL2B 3CLQA 3RK2C 3NFQA 3L70G 3M97X 1S1CX 1JY3P 1JY2N 2HPCA 2JTIB 1RQUA 1DEEG 1LC2A 3H6PA 5C39A 3BVHA 1LTBC 4WQCA 4TLFA 3B8EB 3OJAB 3AEGC 3A0BH 3OAKA 1JM0A 1P84H 5CBNA 1PPJG 1L0LE 3X39A 4YXWH 3CPWO 3KPEA 1DD3A 1PV3A 3JSVC 5DJTB 2WVRA 2GC7D 4N6JA 2W27A 1ZW0A 3BCCD 3VMAA 4QMAA 3SXTA 1T3UA 1OW8A 2FYZA 1SQXD 2JP3A 2ORLA 2FXOA 3CMAP 1M90Q 1S72P 2ZYGA 1AJYA 3CX5E 4OGQB 1VQ4P 1LMSA 1NH4A 4ZMDA 1NTKK 5KLVK 2BCCG 1HRCA 1CYCA 1SQQD 3L37A 4NPDA 3FWLA 3H1JJ 1AYGA 1SQPJ 2VRSA 5CCHD 3VYMA 1AOFA 4JYCA 3CCQP 1G2CB 3Q5PA 5APVA 3E1RA 3CCJP 1H32B 3L72G 4KMGA 1COTA 1N50A 3SWSA 4GIFA 3C1LA 1WVEC 1LP1A 3PXTA 2B0ZB 1MG3D 4K35A 4AALA 2QSIA 1CTYA 4H13B 4Z1MH 2XZRA 2K3RA 2O01N 2HV4A 1IRVA 1OZHA 1SP4A 4H0LC 1KQFB 3TYYA 2I1JA 2IFNA 1PIXA 5CIHB 2K37A 1NTZK 3CXHD 2YK3A 1MUUA 2Q5UA 1NOHA 2O1KA 5CYTR 4KHXA 1WT6A 2A45G 2IPPA 3H1LD 4HB1A 4R4MA 4AQRD 1HUCA 1BDDA 1PP9J 1HJ5A 2SPZA 3S1KA 3L71J 1U75B 3H1IE 1EDLA 5AW6B 5CMZA 4HYTB 2YIUB 3L75E 5AVQB 1GMJA 3L74J 1AV1A 3JCUH 1ZR2A 2Y9ZA 1IO3A 5IY51 1YQ3C 3EFFK 3D70A 2ZT9B 2C0WA 1QL3A 4WVZA 1TU3F 1ZRTE 1L9BC 1DIQC 1SFCB 2IBZG 1JOCA 1Q82Q 3M06A 4GYDA 1FOCA 5TJHA 1YTZT 2WT7B 2WSEJ 1W5CT 4C7NA 2BEQD 1AOQA 3FWNA 1DT1A 1C2RA 5AVSB 5KLVD 1S3JA 3AE1C 2Q9IA 1LNQA 5AW7B 1RZ6A 1CIHA 3L73E 4J20A 3LW5H 2QA4P 3CYTI 3A5TA 3LIDA 3RBXA 3GHGC 2C9NY 1DW3A 1K8AQ 2N1TD 1LTJC 2M5AB 3H1KG 2NPSD 1GJQA 2B9BA 3AEFC 4IFFA 3A0BV 2M0BA 1NKZB 4H44B 3JBTB 3M9BA 1BE3G 4NFGB 5DJQC 1PL5A 4V2KA 1YJWP 5AW5B 2KYVA 4I1LA 4GT1A 1KYOE 1RF1C 1T8ZA 1KILE 2FYUD 1S5LE 1YEAA 5M1BA 1ZZHA 1VF5C 1OW7A 2L4DA 5AVVB 5CHXA 1HVVA 2D0SA 4PJ0E 1HJ3A 1NTZD 2Z5IA 2ZVOB 2K88A 2XDJA 4DCKA 2OYHC 1FHBA 1KILC 3IR9A 1USEA 1BSNA 1SVFA 2M8RA 1L0NJ 5KJ7D 3IAOA 3WFBC 3CWBD 4L74A 1USDA 2JDIH 4H0KA 2EXVA 4B86A 1YITP 1J1EB 2WPSA 1K3GA 3PH0A 3CX5H 1FZBA 3H1IJ 3AECC 1SQXG 1KB9H 3L75J 3VRDA 2N18B 1HJ0A 3L35A 1N73B 4AAOA 2MKVA 2D2CD 3NTNA 2J59M 3EFGA 4AUWA 2H43A 4EYYQ 1QGKB 4YTPC 3GHGA 2R5DA 3MK7C 1FI3A 1K04A 3CI9A 1MV8A 3RK3C 4RJTA 5B66E 1LTJA 2XNXA 4P4QB 2WSCJ 4I7ZC 1N7SC 4IL6E 1CC5A 2B11B 2Y0CA 4BRYB 1KTMA 1FDMA 3HQ8A 3C9IA 1M6ZA 1E79H 2HYNA 4D6TD 1SQBD 1RF1A 3O8ZA 3HTKA 155CA 3HUSB 1BGYD 4XXLA 2KI7B 1NU1J 1SLQA 4EICA 1MZ4A 2PGDA 1CTJA 1CIEA 3BCCE 4BWNA 2KLUA 3RL0g 5BU8B 3ZOOA 2QJKC 2ZONG 2OYHA 1WEJF 1A02F 1KILA 5CBOA 1P84E 1EDJA 3AE8C 4U3FE 1HTLC 3B5NA 5GTIH 3CXHW 1Z56A 5C0ZA 3MTUE 4EIEA 2I8DA 4DT0A 3GLMA 1FZAA 1CZQA 1SQQE 3V5BA 3E7KA 2BCCD 1VQ8P 1FDOA 1XTCC 2YIUC 1I8PA 4O9BA 4AYCA 2CK3H 3FX0A 3TK1A 4WQDA 3ZDMA 1C52A 1SS1A 3MZWB 2KB7P 3TGUE 1VQMP 2B87A 3L72D 1W5CE 2E5TA 5AVTB 3P8MC 1N7SA 4XE5B 2LR2A 1OCDA 4LJIA 4ZKUA 1FOSF 1LT9C 3CXHE 3G3ZA 4FA5A 3H1JG 2BASA 1SQPG 4PD4H 1QYZA 1LWUC 3OW2O 4BXLA 4A7PA 2FWLA 1OVVA 4JF7A 5L8RJ 3H1LE 1L4AB 3N4XA 3JC22 1AQTA 2C9LY 1Y8AA 2YO3A 3EQ2A 2NZ2A 1KORA 2KZJA 3CCUP 1ZMEC 5DFSA 1FS0E 2QJYC 4WB4A 2KS1B 2LKMA 4PD4D 1YHQP 1JTHB 4WQBA 2KXPB 3PP5A 3CCMP 2YMYA 5CICB 2PACA 1CO6A 1S5LH 2V08A 1BDCA 2E76B 4H44C 1KQSO 5KAIE 2FYUG 1HJBA 1BCCD 1SQXK 4PJ0H 3KXDA 1VQKP 1GDVA 4RO0A 4H0JA 1GQ1A 1HBWA 1KYOI 4GOEA 3AE2C 4JCGA 3T97B 1GL2D 5APTA 1VPCA 1PP9G 3FXDA 2IBZD 1YTCA 1R8EA 1T2KC 1NTKE 3BATA 3MHVA 3CWBG 1PGPA 5KLVE 3L74G 3L4OA 1CORA 4U3FJ 4MU8A 4DJGA 2FFDC 2PFXA 4EIJA 5CCHA 1JY3N 3NBSA 2ZOOA 1OVUA 1KMIZ 3DR0A 2KSEA 1H1OA 1LT9A 1VQPP 3PJSK 3H1KD 4OGQD 3RL0C 1OX3A 2N1TC 1LWUA 5B66H 2NPSC 2JKVA 1IZNB 3M9QA 1BE3D 3CP5A 3AE6C 3G71P 5AW3B 3TGUJ 3L36A 1H33B 3I56P 1IRWA 1NTZE 1GZLA 2KK7A 4UB6E 3CC4P 3S4RA 1SQBG 4GOFA 3TNUB 3HE4A 5KKZB 1BGYG 1ZR4A 2YCCA 2C0XA 4RKUJ 4JQ0D 2P10A 4H13D 3HE5A 3QH9A 1DEBA 1YICA 3H1LJ 1J1DC 1QL1A 5C9MA 1NTMD 2Q7CA 3HUSC 5KJ7C 2KIKA 3QWOC 1UIXA 5AURA 1U74B 2A06D 3HD7C 1PZQA 3UIAA 1MFZA 4WWIA 2IZ0A 2B89A 1EZVE 2N3YA 3Q1MA 2DVHA 1JNMA 5AW2B 2WPRA 2FFDA 1P84I 4HKZH 4LLHA 1OAEA 1KB9E 2UWJE 1CYIA 3WU2H 1L0NG 2YMKA 3CU4A 1NHLA 1LTSC 2D2CC 1SQPK 2QJPB 5AW8B 5AVXB 1CRJA 4UB8H 1S9KD 2FRCA 1CW5A 3H1HJ 3AE3C 3WUVA 3OA8B 3N7NA 2KLVA 4D6TE 2ZT9D 2N1TA 1GW3A 2K9JB 3SJLA 1YQ4C 3L70E 1NTKJ 2NPSA 1CYJA 5CIDB 2GA1A 2L5GB 5APWA 2OYIB 1CSWA 1SFCD 1JY2P 4PV1B 2YKPA 1S5LV 3CXHH 1FI9A 3U1CA 4ZKPA 3ORVA 2E74B 3WUIA 1AA0A 1L9JC 1C6OA 4DY9A 3BRVB 2FYUK 4PJ0V 3B71A 1IQCA 2M3BA 1PPJE 5CIFB 3A3YB 4C46A 5BVZA 2QRXA 2Y9YA 3LW5J 3KHUA 1EXJA 4KT0J 1VL2A 1PGJA 5TISH 1EDKA 1NKNA 4WY4B 2L91A 3L4FA 3O6QA 5B5EH 3BRTB 2ZXYA 2FKWB 2G8YA 1SQVG 2FY8A 2HODA 5KJ7A 2BCCE 5GTIE 5KAIH 4H44D 1NJIQ 5GTHE 2BGVX 1JY3O 1C75A 3HD7A 1NU1G 1RZ5A 4GODA 1BCCG 1R0QA 3OCDB 3AE4C 1CSVA 4WQAA 1KX7A 2PCBB 1URQC 2C1DA 3PTZA 2N9BA 3NWVA 3NXSA 1YJ9P 3VN0A 1KD1Q 3EWKA 5B66V 1CHIA 2N9IA 1T2KD 3L4MA 4IL6V 1M1JB 1JEKA 1L0LJ 3P7KA 2R3SA 3CCLP 1Q7YQ 3M0AA 1LTTC 2MHMA 2W6JH 2E75C 2E5YA 5CIBB 1DW0A 3PH2B 1AVOA 4O1QA 3H1JD 1YIJP 1KX2A 1SQPD 4WQ9A 1M7LA 2P1JA 3M0DC 1SQBK 1LTIC 1FZCB 1YIQA 3SFDC 1IO4A 4PD4E 3RL0D 1KV9A 5KLIC 3HQ9A 3A0HE 4IL6X 2QM8A 2QEXP 1M70A 1H0TA 1CSUA 4N78E 1G1JA 3CMEP 2M3EA 1YI2P 3VMZA 1EDIA 1BSHA 4I6MC 1GDTA 3L70J 2FYNC 2BH5X 4UB6H 1X9VA 1Y47A 1X8YA 2HPCB 1NYHA 3I5CA 1JMBA 1UIIA 4HJGH 2H7HA 2QVAA 3GG2A 2IBZE 1L0NK 3KDPB 1PP9D 2LXCB 1CI6A 1GL2C 3WUTA 2ZXXA 4K3AA 3L71D 2WSFH 1NTMG 1M1KQ 4TT3H 1URQA 1DH3A 1E29A 1RAQA 3NBTA 5AW0B 1NVOA 3HD7D 3L74D 3U59A 1M60A 2D0WA 2A06G 4ASVA 2FXMA 2PP6A 4Y5RA 1WMKA 2FXPA 1LTGC 1LGHB 2YKQA 4HH2A 1CSBA 3H1KE 1CHHA 3D6ZA 5APSA 1CCHA 2AXTE 3RK3E 1QL4A 1LC1A 1EZVI 1F1CA 3S9OA 4EI2A 3KQGA 3MUDC 2CXBA 3WC8A 1BE3E 1VQ9P 1N9CA 1QN2A 5EFWB 4LC1A 3CX5I 4XFJA 4OGQC 1KB9I 2KNCA 5TISV 3Q5SA 3GW6A 1JCCA 1K9MQ 3FGAD 1H31A 1NWQA 1U7JA 1LP1B 3CD6P 5DJUB 2DW3A 2WPVB 1SQVK 5KAIV 1MKMA 3VYIA 1GU4A 1RHZB 2G3AA 1NU1K 2ZJSE 3RK2B 3VMYA 5AW9B 3B4SA 3L73J 3GMAA 4JYBA 5APYA 4PWAA 4JPZB 1RE4C 3V6IA 1VQNP 3KZIH 3V4QA 1VDFA 2XV5A 1HGVA 3CCVP 2OZ1A 1H88A 2ZZS1 4H13C 4KJMA 3H32A 1Y9BA 3H25A 4RESB 4EOTA 4PW9B 2J5UA 1NMLA 1SQXE 5KAFH 2RH0A 1L4AD 1GL2A 3G9RA 1I8OA 1IFPA 1OIPA 4ASWA 4W7YA 5GTHH 1BL9A 3ZIYA 5H2FE 1FZEA 1MFTA 2QM7A 3SVWA 1ZN5A 1CRGA 1QLED 4I2LC 2AXCA 2H8PD 2RKLA 5AVWB 1S9KE 1L0ND 1FOSE 1M8OB 2P67A 2E76D 3WU2E 4FA4A 1URQD 4L1QA 2N3BA 1T6AA 3PXSA 4IOIH 1CIFA 3MUDA 4UB8E 1RE3C 3H1ID 3C2CA 4C7NB 3L75D 1PGQA 1N86A 2ZT9C 3ABVC 2LXBA 2VHDA 3Q5RA 4EIDA 2E75D 2YNYA 4UB6V 4DZOA 1SFCC 2ITAA 3WMM0 3I55P 2MJZA 4O1WA 2A45H 5K5GB 2XU6A 1G2CA 2OTJP 2P7JA 1IJDB 1IFMA 3H1HG 3PHLA 1H32A 1KQGB 1VYDA 4H0LB 1CCRA 1ZRTD 3A0HH 4QAOA 2V7QH 1YBKA 1NTKG 1RE4A 1DX7A 3VTPC 3ZBMA 3VMXA 5TISE 1NTMK 1CTZA 3WUUA 4PD4I 2LITA 1FJ0A 1SQVD 1KN7A 5B5EE 1NNOA 3ZOWA 1A02J 4NPEA 4K3IA 1A56A 1NU1D 2OGUA 1CEDA 4WQ7A 3SWKA 1MG2D 1FZGA 2YQBA 2RMZA 1OWAA 2AEFA 4FA1A 1ZOYC 2CE0A 5CCGD 3ZCFA 1DIPA 3E1IA 5EXQA 3BCCJ 1J2JB 3RN1A 3L71G 1CRCA 1RQVA 1EXIA 2IZ1A 2B12B 1NAYA 3GF3A 1IK7A 1SQXJ 1KYOD 1RE3A 1LTAC 1X22A 1SQPE 4MN4C 1FU1A 3P32A 2WZ7A 2AXTH 2FBWC 1Q86Q 2GM4A 2YXQB 1SQQJ 3CCSP 4EIFA 3W67A 4DOJA 1SFCA 5KTBA 1IZL0 1J1EC 2AEJA 3GHGB 2OYOA 2B4ZA 1VQ7P 3DP5A 1ETPA 2WT7A 1L0LG 1Q81Q 1X0TA 2BCNB 3V4WA 5APQA 2GUSA 3AEAC 1LTJB 3F5HA 2N18C 1E8EA 1N73C 2Q6QA 3SWYA 1JB0J 1B7VA 2BLFB 1GU2A 1FJKA 1N15A 2KOGA 5KAFV 1EZVG 2FYUE 2CE1A 3A9FA 3V2NA 5GTIV 2ZYDA 1ZXGA 2O01H 5DJQB 5GTHV 1D7MA 3K5BA 1GD2E 1RF1B 2M5AA 3HTKB 2ZXEB 1PP9E 2R32A 1HZUA 1CXAA 3RBZA 1X79B 1VF5B 3CX5W 3HRNA 1E5WA 1RH5B 4PV1D 1VQ5P 2E74D 1I5TA 1ZLLA 2NRGA 3CWBE 1K05A 5AVYB 3L74E 4AANA 5DF5A 1U57A 2OYHB 1N8RQ 1U7MA 2P2UA 1W2LA 1KILB 2R44A 3B5NB 1YFCA 5CJ0A 2GUVA 3WFDC 5APXA 5H2FH 2W6BA 4FAVA 1H9XA 4WY4D 2WITA 2ZBOA 1JO5A 4U7JA 2IYOA 2BH4X 3AE9C 2BEZF 4AAMA 1WRGA 4W80A 3G4SP 1HGZA 1HCMA 4EDFA 1JMMA 1QL2A 1Q90D 4YE1A 351CA 2QE7H 3A0HV 1CSXA 1P84D 3CC2P 4OWFA 4U3FD 3MK7B 2XKMA 1H9YA 2GB8B 2B87B 2HR3A 1YEBA 1GK6A 2I8FA 3RK3B 1JUNA 3P8CD 3H1IG 1A2SA 4I7ZB 1N73A 1NMIA 1N7SB 2OQQA 1SQBE 2C9XB 3L75G 5KLVJ 1H8AA 1GTWA 1ZV8A 1KIBA 3R4YA 1BGYE 3WFEC 2QG4A 2Q3EA 3HQ7A 5B6QA 2CA4B 1FJPA 2W6AA 3V2RA 2C1VA 3RGUA 4R4LA 1YTZI 4M3LA 2AIUA 1FCDC 2HLOA 1HWTC 1LFMA 2CA3B 1AVYA 4Y99B 1FI7A 3MP7B 3TGUD 4BRYA 3CXHI 3KZIE 3D71A 1A8CA 5E79E 2QJKB 2KZIA 2WMMA 5KAFE 1L4AC 2O3JA 2FYUJ 1S5LX 1QEXA 3HUSA 1L0NE 2R3CA 1KC8Q 2GIWA 1PGOA 4Y28J 3L73G 1C6RA 2OTKE 2HG5D 3A2AA 2XNDH 1NTZJ 4CPGA 2AXTV 4L76A 1NAFA 2O1JA 1T3JA 1RAPA 1KFNA 5AVRB 1ZP0C 3GF7A 1I54A 1CRIA 3VNWA 5CIEB 2WTYA 1OVRA 2E76C 2CPBA 3L72E 451CA 3CWBJ 3HQ6A 1L0LK 2POHA 2OARA 1KZUB 1FBMA 3D6YA 1R5SA 1DW1A 2WSFJ 3O5CA 1CRYA 1KFMA 1DVVA 1KYOW 2W83C 3SSUA 1FZFA 1LT9B 1VQOP 2WPQA 3H1HD 1XTGB 2WSSH 2ZYAA 3TYIA 2R5BA 3C8VA 1LWUB 1W2BO 2WQYC 1SQVE 1NTKD 3MIWA 4OH8B 1YYCA 1PFIA 2JO1A 1NU1E 2QJYB 1CNOA 2KUBA 1CXCA 1BCCE 2YKOA 3D0WA 1JY2O 2W8ZA 3AE5C 4D6TJ 1NIRA 5H2FV 4WQEA 1SQBJ 4N3YB 1L4AA 1BGYJ 1HROA 1S2EA 2JWAA 3HE4B 2C1UA 2KS1A 3WU2V 3HE5B 4YPCA 3O0RC 2H89C 2C8SA 1DVHA 1JTHA 1VQLP 5CCGC 1OXZA 3MD0A 4UB8V 2N9YB 3RK2D 2Y0EA 2AEMA 2DGEA 4WBAA 1GIWA 1CIGA 1OMIA 5KKZC 1QVGO 1RF0C 1HH0A 4L75A 4NPFX 2RN0A 1LT1A 2FFDB 2MTAC 1F1FA 2BCCJ 1C2NA 3B5NC 3T97A 1M56D 1K73Q 1R5LA 1GW4A 2WSEH 1RY3A 3WFCC 2K9YA 4XA4A 1LJ2A 2B88A 3BCCG 1AKKA 1L0LD 3AEDC 3M0DA 2W90A 2ZVNB 3L72J 5AVZB 3RL0B 4U3FG 3TF5A 2N1TB
chains in the Genus database with same CATH topology
2YCCA 1IO3A 1EZVD 4L3HA 1YICA 5IY51 3ZBMA 5B5EV 5C9MA 1NTMD 1CTZA 1LS9A 2LITA 1FJ0A 1QL3A 1SQVD 3CX5D 1L9BC 1KB9D 1NNOA 4N0KA 1DIQC 3ZOWA 5AURA 1U74B 2A06D 4K3IA 1A56A 4GYDA 1FOCA 1YCCA 1C6SA 1NU1D 5TJHA 1CEDA 4WQ7A 2N3YA 1W5CT 2DVHA 1MG2D 1AOQA 2YQBA 1DT1A 2RMZA 1C2RA 1I6DA 1OAEA 5KLVD 4FA1A 2CE0A 1CYIA 1RZ6A 1CIHA 3TDKA 4J20A 3ZCFA 3CU4A 3CYTI 1C7MA 1H33A 2QJPB 1DW3A 3L70D 1CRJA 3O20A 5EXQA 3RLMA 3ZOYA 3RN1A 2FRCA 1CRCA 2B12B 3OA8B 1KYOD 1GJQA 3A0BV 1E2RA 1PPJD 2K9JB 2B10B 3SJLA 3JBTB 3RMZA 2LIRA 1CYJA 5CIDB 4NFGB 5DJQC 1CSWA 4V2KA 4GEDB 1JDLA 4Q5PA 1S5LV 1FI9A 3ORVA 2Y0DA 2C1DB 3WUIA 1L9JC 1C6OA 1CRHA 4EIFA 4DY9A 2FYUD 1IZL0 1YEAA 4PJ0V 1IQCA 2B4ZA 3DP5A 5CIFB 1ZZHA 2GC4D 1ETPA 2L4DA 2V07A 2D0SA 1HJ3A 2BCNB 2BPBB 1NTZD 3KHUA 2N18C 1E8EA 1B7VA 2JQRA 1FHBA 2BLFB 1GU2A 1N15A 5KAFV 2CE1A 3A9FA 2L91A 5GTIV 1EB7A 3WFBC 3O1YA 5DJQB 5GTHV 2ZXYA 3CWBD 3PXWA 1S6VB 4H0KA 2BGVX 3OA8A 1I6EA 2EXVA 1C75A 1HZUA 1RZ5A 1CXAA 1K3GA 1YNRA 3CX5W 1R0QA 3OCDB 1DIIC 1I5TA 1GKSA 3VRDA 2N18B 1CSVA 4RSZA 4AANA 5DF5A 4AAOA 4WQAA 1W2LA 1KX7A 2PCBB 2C1DA 1KB0A 3PTZA 3NWVA 1YFCA 5B66V 1CHIA 2N9IA 3WFDC 3MK7C 1FI3A 3L4MA 4L3GA 3PLNA 4FANA 4IL6V 3L73D 4RJTA 4FAVA 1J3SA 1H9XA 4P4QB 2ZBOA 1CC5A 2B11B 2BH4X 2MHMA 2Y0CA 1K3HA 4AAMA 3ZOXA 5CIBB 1DW0A 3HQ8A 3PH2B 1M6ZA 4O1QA 1N90A 1HCMA 4EDFA 1HJ4A 1I55A 4D6TD 3H1JD 4FA9A 1KX2A 1SQPD 4WQ9A 4YE1A 351CA 1SQBD 1YIQA 3A0HV 3RN0A 1CSXA 1HH7A 155CA 1P84D 1BGYD 4XXLA 4U3FD 1KV9A 3HQ9A 3MK7B 4XYDB 3ITKA 1H9YA 2GB8B 4EICA 1YEBA 2I8FA 3PRJA 1MZ4A 1M70A 3OCDA 1CTJA 1CSUA 1CIEA 1A2SA 1QKSA 3ZOOA 1NMIA 2ZONG 2C9XB 1WEJF 1KIBA 5CIGB 2C2CA 3WFEC 2QG4A 4WQ8A 2Q3EA 3HQ7A 5B6QA 2CA4B 3CXHW 2BH5X 2PCCB 5C0ZA 4EIEA 2C1VA 3SLEA 2AIUA 1FCDC 2KNCB 1CHJA 1LFMA 3KZIV 2CA3B 3GG2A 2XTSB 5KLIB 1FI7A 5E79V 2BCCD 3TGUD 1H31B 1PP9D 1A8CA 1I8PA 2QJKB 3L71D 4WQDA 1E29A 2O3JA 1RAQA 3NBTA 1HZVA 1C52A 3L74D 2FYNB 1M60A 2D0WA 2GIWA 3L72D 1C6RA 4Y5RA 2AI5A 2AXTV 4FB1A 2OZ1B 1CHHA 4AX3A 1OCDA 1CCHA 1RAPA 3DMIA 4LJIA 1QL4A 1LC1A 1I54A 4FA5A 1DW2A 1CRIA 1F1CA 3VNWA 5CIEB 2CXBA 2N9JA 3WC8A 451CA 1N9CA 1QYZA 1QN2A 3HQ6A 3M97X 4A7PA 2JTIB 2FWLA 1LC2A 5TISV 1DW1A 4WQCA 3GW6A 5DFSA 3O5CA 1H31A 1CRYA 4PD4D 3X39A 1DVVA 4WQBA 2GC7D 5CICB 5KAIV 1KYOW 2PACA 1CO6A 3BCCD 3VMAA 2V08A 3SXTA 3H1HD 1SQXD 3TYIA 1BCCD 2ORLA 1GDVA 4PWAA 4H0JA 1LMSA 1NTKD 1GQ1A 2OZ1A 2ZZS1 1HRCA 4JCGA 2QJYB 1CNOA 4PW9B 1CYCA 1CXCA 1NMLA 1SQQD 3FWLA 1AYGA 1NIRA 5H2FV 2IBZD 1YTCA 1I8OA 4WQEA 3VYMA 1AOFA 1BL9A 3ZIYA 1HROA 3L4OA 2JWAA 1CORA 1H32B 4MU8A 3SVWA 1CRGA 2C1UA 4KMGA 1COTA 3NBSA 1N50A 3SWSA 3WU2V 2KS1A 1WVEC 3O0RC 3PXTA 2ZOOA 1L0ND 2B0ZB 1MG3D 2C8SA 1DVHA 4AALA 1CTYA 4FA4A 4UB8V 4L1QA 2N9YB 2Y0EA 3DR0A 1H1OA 2N3BA 2DGEA 2HV4A 3PXSA 1GIWA 1IRVA 1CIGA 1CIFA 3H1KD 5CIHB 3CXHD 2YK3A 3H1ID 3C2CA 2RN0A 1BE3D 3CP5A 3L75D 5CYTR 2MTAC 1F1FA 2VHDA 1C2NA 4EIDA 3H1LD 4UB6V 1HJ5A 1H33B 3WFCC 1IRWA 1U75B 4O1WA 2YIUB 1AKKA 1L0LD 3PHLA 1H32A 1VYDA 1CCRA 1ZRTD 5KKZB 4QAOA 3TF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YCC A;  1IO3 A;  1EZV D;  4L3H A;  1YIC A;  5IY5 1;  3ZBM A;  5B5E V;  5C9M A;  1NTM D;  1CTZ A;  1LS9 A;  2LIT A;  1FJ0 A;  1QL3 A;  1SQV D;  3CX5 D;  1L9B C;  1KB9 D;  1NNO A;  4N0K A;  1DIQ C;  3ZOW A;  5AUR A;  1U74 B;  2A06 D;  4K3I A;  1A56 A;  4GYD A;  1FOC A;  1YCC A;  1C6S A;  1NU1 D;  5TJH A;  1CED A;  4WQ7 A;  2N3Y A;  1W5C T;  2DVH A;  1MG2 D;  1AOQ A;  2YQB A;  1DT1 A;  2RMZ A;  1C2R A;  1I6D A;  1OAE A;  5KLV D;  4FA1 A;  2CE0 A;  1CYI A;  1RZ6 A;  1CIH A;  3TDK A;  4J20 A;  3ZCF A;  3CU4 A;  3CYT I;  1C7M A;  1H33 A;  2QJP B;  1DW3 A;  3L70 D;  1CRJ A;  3O20 A;  5EXQ A;  3RLM A;  3ZOY A;  3RN1 A;  2FRC A;  1CRC A;  2B12 B;  3OA8 B;  1KYO D;  1GJQ A;  3A0B V;  1E2R A;  1PPJ D;  2K9J B;  2B10 B;  3SJL A;  3JBT B;  3RMZ A;  2LIR A;  1CYJ A;  5CID B;  4NFG B;  5DJQ C;  1CSW A;  4V2K A;  4GED B;  1JDL A;  4Q5P A;  1S5L V;  1FI9 A;  3ORV A;  2Y0D A;  2C1D B;  3WUI A;  1L9J C;  1C6O A;  1CRH A;  4EIF A;  4DY9 A;  2FYU D;  1IZL 0;  1YEA A;  4PJ0 V;  1IQC A;  2B4Z A;  3DP5 A;  5CIF B;  1ZZH A;  2GC4 D;  1ETP A;  2L4D A;  2V07 A;  2D0S A;  1HJ3 A;  2BCN B;  2BPB B;  1NTZ D;  3KHU A;  2N18 C;  1E8E A;  1B7V A;  2JQR A;  1FHB A;  2BLF B;  1GU2 A;  1N15 A;  5KAF V;  2CE1 A;  3A9F A;  2L91 A;  5GTI V;  1EB7 A;  3WFB C;  3O1Y A;  5DJQ B;  5GTH V;  2ZXY A;  3CWB D;  3PXW A;  1S6V B;  4H0K A;  2BGV X;  3OA8 A;  1I6E A;  2EXV A;  1C75 A;  1HZU A;  1RZ5 A;  1CXA A;  1K3G A;  1YNR A;  3CX5 W;  1R0Q A;  3OCD B;  1DII C;  1I5T A;  1GKS A;  3VRD A;  2N18 B;  1CSV A;  4RSZ A;  4AAN A;  5DF5 A;  4AAO A;  4WQA A;  1W2L A;  1KX7 A;  2PCB B;  2C1D A;  1KB0 A;  3PTZ A;  3NWV A;  1YFC A;  5B66 V;  1CHI A;  2N9I A;  3WFD C;  3MK7 C;  1FI3 A;  3L4M A;  4L3G A;  3PLN A;  4FAN A;  4IL6 V;  3L73 D;  4RJT A;  4FAV A;  1J3S A;  1H9X A;  4P4Q B;  2ZBO A;  1CC5 A;  2B11 B;  2BH4 X;  2MHM A;  2Y0C A;  1K3H A;  4AAM A;  3ZOX A;  5CIB B;  1DW0 A;  3HQ8 A;  3PH2 B;  1M6Z A;  4O1Q A;  1N90 A;  1HCM A;  4EDF A;  1HJ4 A;  1I55 A;  4D6T D;  3H1J D;  4FA9 A;  1KX2 A;  1SQP D;  4WQ9 A;  4YE1 A;  351C A;  1SQB D;  1YIQ A;  3A0H V;  3RN0 A;  1CSX A;  1HH7 A;  155C A;  1P84 D;  1BGY D;  4XXL A;  4U3F D;  1KV9 A;  3HQ9 A;  3MK7 B;  4XYD B;  3ITK A;  1H9Y A;  2GB8 B;  4EIC A;  1YEB A;  2I8F A;  3PRJ A;  1MZ4 A;  1M70 A;  3OCD A;  1CTJ A;  1CSU A;  1CIE A;  1A2S A;  1QKS A;  3ZOO A;  1NMI A;  2ZON G;  2C9X B;  1WEJ F;  1KIB A;  5CIG B;  2C2C A;  3WFE C;  2QG4 A;  4WQ8 A;  2Q3E A;  3HQ7 A;  5B6Q A;  2CA4 B;  3CXH W;  2BH5 X;  2PCC B;  5C0Z A;  4EIE A;  2C1V A;  3SLE A;  2AIU A;  1FCD C;  2KNC B;  1CHJ A;  1LFM A;  3KZI V;  2CA3 B;  3GG2 A;  2XTS B;  5KLI B;  1FI7 A;  5E79 V;  2BCC D;  3TGU D;  1H31 B;  1PP9 D;  1A8C A;  1I8P A;  2QJK B;  3L71 D;  4WQD A;  1E29 A;  2O3J A;  1RAQ A;  3NBT A;  1HZV A;  1C52 A;  3L74 D;  2FYN B;  1M60 A;  2D0W A;  2GIW A;  3L72 D;  1C6R A;  4Y5R A;  2AI5 A;  2AXT V;  4FB1 A;  2OZ1 B;  1CHH A;  4AX3 A;  1OCD A;  1CCH A;  1RAP A;  3DMI A;  4LJI A;  1QL4 A;  1LC1 A;  1I54 A;  4FA5 A;  1DW2 A;  1CRI A;  1F1C A;  3VNW A;  5CIE B;  2CXB A;  2N9J A;  3WC8 A;  451C A;  1N9C A;  1QYZ A;  1QN2 A;  3HQ6 A;  3M97 X;  4A7P A;  2JTI B;  2FWL A;  1LC2 A;  5TIS V;  1DW1 A;  4WQC A;  3GW6 A;  5DFS A;  3O5C A;  1H31 A;  1CRY A;  4PD4 D;  3X39 A;  1DVV A;  4WQB A;  2GC7 D;  5CIC B;  5KAI V;  1KYO W;  2PAC A;  1CO6 A;  3BCC D;  3VMA A;  2V08 A;  3SXT A;  3H1H D;  1SQX D;  3TYI A;  1BCC D;  2ORL A;  1GDV A;  4PWA A;  4H0J A;  1LMS A;  1NTK D;  1GQ1 A;  2OZ1 A;  2ZZS 1;  1HRC A;  4JCG A;  2QJY B;  1CNO A;  4PW9 B;  1CYC A;  1CXC A;  1NML A;  1SQQ D;  3FWL A;  1AYG A;  1NIR A;  5H2F V;  2IBZ D;  1YTC A;  1I8O A;  4WQE A;  3VYM A;  1AOF A;  1BL9 A;  3ZIY A;  1HRO A;  3L4O A;  2JWA A;  1COR A;  1H32 B;  4MU8 A;  3SVW A;  1CRG A;  2C1U A;  4KMG A;  1COT A;  3NBS A;  1N50 A;  3SWS A;  3WU2 V;  2KS1 A;  1WVE C;  3O0R C;  3PXT A;  2ZOO A;  1L0N D;  2B0Z B;  1MG3 D;  2C8S A;  1DVH A;  4AAL A;  1CTY A;  4FA4 A;  4UB8 V;  4L1Q A;  2N9Y B;  2Y0E A;  3DR0 A;  1H1O A;  2N3B A;  2DGE A;  2HV4 A;  3PXS A;  1GIW A;  1IRV A;  1CIG A;  1CIF A;  3H1K D;  5CIH B;  3CXH D;  2YK3 A;  3H1I D;  3C2C A;  2RN0 A;  1BE3 D;  3CP5 A;  3L75 D;  5CYT R;  2MTA C;  1F1F A;  2VHD A;  1C2N A;  4EID A;  3H1L D;  4UB6 V;  1HJ5 A;  1H33 B;  3WFC C;  1IRW A;  1U75 B;  4O1W A;  2YIU B;  1AKK A;  1L0L D;  3PHL A;  1H32 A;  1VYD A;  1CCR A;  1ZRT D;  5KKZ B;  4QAO A;  3TF5 A; 
#chains in the Genus database with same CATH topology
 2ZFC A;  1EZV D;  4L3H A;  3U1A A;  2NPS B;  2QJP C;  5B5E V;  4YXD C;  3SFE C;  3IFM A;  1LS9 A;  1S4X A;  3CX5 D;  1SQQ G;  1KB9 D;  4N0K A;  2Z4E A;  1YCC A;  1C6S A;  3AE7 C;  1NTM E;  1DD4 A;  2J58 A;  2ZAE B;  2OYI C;  3IN6 A;  2P58 A;  4PV1 C;  1I6D A;  1IFD A;  1IFJ A;  2KSJ A;  2E74 C;  2A06 E;  1QX8 A;  3TDK A;  5E79 H;  3O6Q B;  1GK4 A;  3TGU G;  1C7M A;  1SQV J;  1H33 A;  3Q3D A;  1J1D B;  3L70 D;  2V7Q J;  2IDB A;  5APU A;  3O20 A;  4H0L D;  5CCG A;  3RLM A;  2IYP A;  3ZOY A;  2HOD B;  1H89 A;  4Y99 C;  5AVU B;  3TNU A;  1BCC J;  1L2P A;  3HD7 B;  1AFO A;  5BU5 A;  1RF0 A;  2OTL P;  4WY4 C;  1E2R A;  1PPJ D;  2B10 B;  3SWF A;  3A7O A;  2V4H A;  3RMZ A;  1HF9 A;  1YJN P;  2LIR A;  3A0B E;  3CCR P;  4GED B;  1JDL A;  4Q5P A;  3H1L G;  4GDO A;  2Y0D A;  2C1D B;  3CL3 D;  1CRH A;  2D2C B;  3P8C E;  1FDI A;  2GC4 D;  3FXE A;  2V07 A;  3VP9 A;  2BPB B;  3LIE A;  1OFC X;  2JQR A;  3NMD A;  3F89 A;  5CJ4 A;  4JBZ A;  3R2P A;  1EB7 A;  2WSC H;  3O1Y A;  3PXW A;  1M1J C;  5CCH C;  1S6V B;  3TSI A;  1NO4 A;  3H1K J;  1NGM B;  1KV4 A;  3AEE C;  3OA8 A;  1I6E A;  1FE6 A;  2YO2 A;  1YNR A;  1Q2N A;  1H0T B;  4GKG A;  2K9J A;  1BE3 J;  1DII C;  1EQ7 A;  1GKS A;  2Q1K A;  4RSZ A;  2OYI A;  5KLV G;  1IFN A;  3BAS A;  3OA7 A;  3V2P A;  1KB0 A;  1FZC C;  2A45 I;  2IFM A;  3VOP A;  2I1K A;  4C7R A;  1N7L A;  2YXR B;  2JEE A;  4L3G A;  3PLN A;  4FAN A;  3L73 D;  1J3S A;  3II6 A;  1G1I A;  1EC5 A;  2O01 J;  1IC2 A;  2K1A A;  4LGD E;  3M91 A;  1IK9 A;  1K3H A;  4WY4 A;  2JR8 A;  3ZOX A;  1KYO H;  1NTM J;  1CI6 B;  1N90 A;  1HJ4 A;  1I55 A;  4FA9 A;  4N78 D;  1URQ B;  1AQ5 A;  1KQL A;  3RN0 A;  1VF5 D;  2E43 A;  3W68 A;  1HH7 A;  3ITK A;  4XYD B;  2IBZ I;  3JCU E;  1MZ9 A;  3PRJ A;  1NTZ G;  3OCD A;  1KIL D;  2CPS A;  3H1J E;  1QKS A;  3B5N D;  3H1H E;  4L73 A;  1SQQ K;  5CIG B;  2C2C A;  2Q3I A;  2E75 B;  4WQ8 A;  1VQ6 P;  2PCC B;  2KP8 A;  2E42 A;  3CCE P;  3SLE A;  1M1J A;  3IF4 A;  1W2E A;  2KNC B;  1CHJ A;  3KZI V;  2H88 C;  2XTS B;  5KLI B;  5E79 V;  3M9H A;  1H31 B;  2IX7 C;  1IFI A;  1JCD A;  3MGN A;  3VP8 A;  4IFM A;  1N2D C;  1FZC A;  3KYQ A;  1HZV A;  1OW6 A;  3Q2Y A;  5AW1 B;  3RK3 D;  2FYN B;  3CC7 P;  2QIW A;  3V2Q A;  1FC2 C;  4IL6 H;  4IFD K;  1N7S D;  3AEB C;  4ZNC A;  1GU5 A;  2HFE D;  2AI5 A;  2JWD A;  2Z5H A;  1FAV A;  3L71 E;  4FB1 A;  2OZ1 B;  2JJL A;  4W7Z A;  4AX3 A;  2PRR A;  3H32 B;  2PAJ A;  3DMI A;  1M57 D;  4OVN F;  3USS A;  1QVF O;  1DW2 A;  3G6E P;  2WWW A;  2N9J A;  4D6T G;  5AW4 B;  1GL2 B;  3CLQ A;  3RK2 C;  3NFQ A;  3L70 G;  3M97 X;  1S1C X;  1JY3 P;  1JY2 N;  2HPC A;  2JTI B;  1RQU A;  1DEE G;  1LC2 A;  3H6P A;  5C39 A;  3BVH A;  1LTB C;  4WQC A;  4TLF A;  3B8E B;  3OJA B;  3AEG C;  3A0B H;  3OAK A;  1JM0 A;  1P84 H;  5CBN A;  1PPJ G;  1L0L E;  3X39 A;  4YXW H;  3CPW O;  3KPE A;  1DD3 A;  1PV3 A;  3JSV C;  5DJT B;  2WVR A;  2GC7 D;  4N6J A;  2W27 A;  1ZW0 A;  3BCC D;  3VMA A;  4QMA A;  3SXT A;  1T3U A;  1OW8 A;  2FYZ A;  1SQX D;  2JP3 A;  2ORL A;  2FXO A;  3CMA P;  1M90 Q;  1S72 P;  2ZYG A;  1AJY A;  3CX5 E;  4OGQ B;  1VQ4 P;  1LMS A;  1NH4 A;  4ZMD A;  1NTK K;  5KLV K;  2BCC G;  1HRC A;  1CYC A;  1SQQ D;  3L37 A;  4NPD A;  3FWL A;  3H1J J;  1AYG A;  1SQP J;  2VRS A;  5CCH D;  3VYM A;  1AOF A;  4JYC A;  3CCQ P;  1G2C B;  3Q5P A;  5APV A;  3E1R A;  3CCJ P;  1H32 B;  3L72 G;  4KMG A;  1COT A;  1N50 A;  3SWS A;  4GIF A;  3C1L A;  1WVE C;  1LP1 A;  3PXT A;  2B0Z B;  1MG3 D;  4K35 A;  4AAL A;  2QSI A;  1CTY A;  4H13 B;  4Z1M H;  2XZR A;  2K3R A;  2O01 N;  2HV4 A;  1IRV A;  1OZH A;  1SP4 A;  4H0L C;  1KQF B;  3TYY A;  2I1J A;  2IFN A;  1PIX A;  5CIH B;  2K37 A;  1NTZ K;  3CXH D;  2YK3 A;  1MUU A;  2Q5U A;  1NOH A;  2O1K A;  5CYT R;  4KHX A;  1WT6 A;  2A45 G;  2IPP A;  3H1L D;  4HB1 A;  4R4M A;  4AQR D;  1HUC A;  1BDD A;  1PP9 J;  1HJ5 A;  2SPZ A;  3S1K A;  3L71 J;  1U75 B;  3H1I E;  1EDL A;  5AW6 B;  5CMZ A;  4HYT B;  2YIU B;  3L75 E;  5AVQ B;  1GMJ A;  3L74 J;  1AV1 A;  3JCU H;  1ZR2 A;  2Y9Z A;  1IO3 A;  5IY5 1;  1YQ3 C;  3EFF K;  3D70 A;  2ZT9 B;  2C0W A;  1QL3 A;  4WVZ A;  1TU3 F;  1ZRT E;  1L9B C;  1DIQ C;  1SFC B;  2IBZ G;  1JOC A;  1Q82 Q;  3M06 A;  4GYD A;  1FOC A;  5TJH A;  1YTZ T;  2WT7 B;  2WSE J;  1W5C T;  4C7N A;  2BEQ D;  1AOQ A;  3FWN A;  1DT1 A;  1C2R A;  5AVS B;  5KLV D;  1S3J A;  3AE1 C;  2Q9I A;  1LNQ A;  5AW7 B;  1RZ6 A;  1CIH A;  3L73 E;  4J20 A;  3LW5 H;  2QA4 P;  3CYT I;  3A5T A;  3LID A;  3RBX A;  3GHG C;  2C9N Y;  1DW3 A;  1K8A Q;  2N1T D;  1LTJ C;  2M5A B;  3H1K G;  2NPS D;  1GJQ A;  2B9B A;  3AEF C;  4IFF A;  3A0B V;  2M0B A;  1NKZ B;  4H44 B;  3JBT B;  3M9B A;  1BE3 G;  4NFG B;  5DJQ C;  1PL5 A;  4V2K A;  1YJW P;  5AW5 B;  2KYV A;  4I1L A;  4GT1 A;  1KYO E;  1RF1 C;  1T8Z A;  1KIL E;  2FYU D;  1S5L E;  1YEA A;  5M1B A;  1ZZH A;  1VF5 C;  1OW7 A;  2L4D A;  5AVV B;  5CHX A;  1HVV A;  2D0S A;  4PJ0 E;  1HJ3 A;  1NTZ D;  2Z5I A;  2ZVO B;  2K88 A;  2XDJ A;  4DCK A;  2OYH C;  1FHB A;  1KIL C;  3IR9 A;  1USE A;  1BSN A;  1SVF A;  2M8R A;  1L0N J;  5KJ7 D;  3IAO A;  3WFB C;  3CWB D;  4L74 A;  1USD A;  2JDI H;  4H0K A;  2EXV A;  4B86 A;  1YIT P;  1J1E B;  2WPS A;  1K3G A;  3PH0 A;  3CX5 H;  1FZB A;  3H1I J;  3AEC C;  1SQX G;  1KB9 H;  3L75 J;  3VRD A;  2N18 B;  1HJ0 A;  3L35 A;  1N73 B;  4AAO A;  2MKV A;  2D2C D;  3NTN A;  2J59 M;  3EFG A;  4AUW A;  2H43 A;  4EYY Q;  1QGK B;  4YTP C;  3GHG A;  2R5D A;  3MK7 C;  1FI3 A;  1K04 A;  3CI9 A;  1MV8 A;  3RK3 C;  4RJT A;  5B66 E;  1LTJ A;  2XNX A;  4P4Q B;  2WSC J;  4I7Z C;  1N7S C;  4IL6 E;  1CC5 A;  2B11 B;  2Y0C A;  4BRY B;  1KTM A;  1FDM A;  3HQ8 A;  3C9I A;  1M6Z A;  1E79 H;  2HYN A;  4D6T D;  1SQB D;  1RF1 A;  3O8Z A;  3HTK A;  155C A;  3HUS B;  1BGY D;  4XXL A;  2KI7 B;  1NU1 J;  1SLQ A;  4EIC A;  1MZ4 A;  2PGD A;  1CTJ A;  1CIE A;  3BCC E;  4BWN A;  2KLU A;  3RL0 g;  5BU8 B;  3ZOO A;  2QJK C;  2ZON G;  2OYH A;  1WEJ F;  1A02 F;  1KIL A;  5CBO A;  1P84 E;  1EDJ A;  3AE8 C;  4U3F E;  1HTL C;  3B5N A;  5GTI H;  3CXH W;  1Z56 A;  5C0Z A;  3MTU E;  4EIE A;  2I8D A;  4DT0 A;  3GLM A;  1FZA A;  1CZQ A;  1SQQ E;  3V5B A;  3E7K A;  2BCC D;  1VQ8 P;  1FDO A;  1XTC C;  2YIU C;  1I8P A;  4O9B A;  4AYC A;  2CK3 H;  3FX0 A;  3TK1 A;  4WQD A;  3ZDM A;  1C52 A;  1SS1 A;  3MZW B;  2KB7 P;  3TGU E;  1VQM P;  2B87 A;  3L72 D;  1W5C E;  2E5T A;  5AVT B;  3P8M C;  1N7S A;  4XE5 B;  2LR2 A;  1OCD A;  4LJI A;  4ZKU A;  1FOS F;  1LT9 C;  3CXH E;  3G3Z A;  4FA5 A;  3H1J G;  2BAS A;  1SQP G;  4PD4 H;  1QYZ A;  1LWU C;  3OW2 O;  4BXL A;  4A7P A;  2FWL A;  1OVV A;  4JF7 A;  5L8R J;  3H1L E;  1L4A B;  3N4X A;  3JC2 2;  1AQT A;  2C9L Y;  1Y8A A;  2YO3 A;  3EQ2 A;  2NZ2 A;  1KOR A;  2KZJ A;  3CCU P;  1ZME C;  5DFS A;  1FS0 E;  2QJY C;  4WB4 A;  2KS1 B;  2LKM A;  4PD4 D;  1YHQ P;  1JTH B;  4WQB A;  2KXP B;  3PP5 A;  3CCM P;  2YMY A;  5CIC B;  2PAC A;  1CO6 A;  1S5L H;  2V08 A;  1BDC A;  2E76 B;  4H44 C;  1KQS O;  5KAI E;  2FYU G;  1HJB A;  1BCC D;  1SQX K;  4PJ0 H;  3KXD A;  1VQK P;  1GDV A;  4RO0 A;  4H0J A;  1GQ1 A;  1HBW A;  1KYO I;  4GOE A;  3AE2 C;  4JCG A;  3T97 B;  1GL2 D;  5APT A;  1VPC A;  1PP9 G;  3FXD A;  2IBZ D;  1YTC A;  1R8E A;  1T2K C;  1NTK E;  3BAT A;  3MHV A;  3CWB G;  1PGP A;  5KLV E;  3L74 G;  3L4O A;  1COR A;  4U3F J;  4MU8 A;  4DJG A;  2FFD C;  2PFX A;  4EIJ A;  5CCH A;  1JY3 N;  3NBS A;  2ZOO A;  1OVU A;  1KMI Z;  3DR0 A;  2KSE A;  1H1O A;  1LT9 A;  1VQP P;  3PJS K;  3H1K D;  4OGQ D;  3RL0 C;  1OX3 A;  2N1T C;  1LWU A;  5B66 H;  2NPS C;  2JKV A;  1IZN B;  3M9Q A;  1BE3 D;  3CP5 A;  3AE6 C;  3G71 P;  5AW3 B;  3TGU J;  3L36 A;  1H33 B;  3I56 P;  1IRW A;  1NTZ E;  1GZL A;  2KK7 A;  4UB6 E;  3CC4 P;  3S4R A;  1SQB G;  4GOF A;  3TNU B;  3HE4 A;  5KKZ B;  1BGY G;  1ZR4 A;  2YCC A;  2C0X A;  4RKU J;  4JQ0 D;  2P10 A;  4H13 D;  3HE5 A;  3QH9 A;  1DEB A;  1YIC A;  3H1L J;  1J1D C;  1QL1 A;  5C9M A;  1NTM D;  2Q7C A;  3HUS C;  5KJ7 C;  2KIK A;  3QWO C;  1UIX A;  5AUR A;  1U74 B;  2A06 D;  3HD7 C;  1PZQ A;  3UIA A;  1MFZ A;  4WWI A;  2IZ0 A;  2B89 A;  1EZV E;  2N3Y A;  3Q1M A;  2DVH A;  1JNM A;  5AW2 B;  2WPR A;  2FFD A;  1P84 I;  4HKZ H;  4LLH A;  1OAE A;  1KB9 E;  2UWJ E;  1CYI A;  3WU2 H;  1L0N G;  2YMK A;  3CU4 A;  1NHL A;  1LTS C;  2D2C C;  1SQP K;  2QJP B;  5AW8 B;  5AVX B;  1CRJ A;  4UB8 H;  1S9K D;  2FRC A;  1CW5 A;  3H1H J;  3AE3 C;  3WUV A;  3OA8 B;  3N7N A;  2KLV A;  4D6T E;  2ZT9 D;  2N1T A;  1GW3 A;  2K9J B;  3SJL A;  1YQ4 C;  3L70 E;  1NTK J;  2NPS A;  1CYJ A;  5CID B;  2GA1 A;  2L5G B;  5APW A;  2OYI B;  1CSW A;  1SFC D;  1JY2 P;  4PV1 B;  2YKP A;  1S5L V;  3CXH H;  1FI9 A;  3U1C A;  4ZKP A;  3ORV A;  2E74 B;  3WUI A;  1AA0 A;  1L9J C;  1C6O A;  4DY9 A;  3BRV B;  2FYU K;  4PJ0 V;  3B71 A;  1IQC A;  2M3B A;  1PPJ E;  5CIF B;  3A3Y B;  4C46 A;  5BVZ A;  2QRX A;  2Y9Y A;  3LW5 J;  3KHU A;  1EXJ A;  4KT0 J;  1VL2 A;  1PGJ A;  5TIS H;  1EDK A;  1NKN A;  4WY4 B;  2L91 A;  3L4F A;  3O6Q A;  5B5E H;  3BRT B;  2ZXY A;  2FKW B;  2G8Y A;  1SQV G;  2FY8 A;  2HOD A;  5KJ7 A;  2BCC E;  5GTI E;  5KAI H;  4H44 D;  1NJI Q;  5GTH E;  2BGV X;  1JY3 O;  1C75 A;  3HD7 A;  1NU1 G;  1RZ5 A;  4GOD A;  1BCC G;  1R0Q A;  3OCD B;  3AE4 C;  1CSV A;  4WQA A;  1KX7 A;  2PCB B;  1URQ C;  2C1D A;  3PTZ A;  2N9B A;  3NWV A;  3NXS A;  1YJ9 P;  3VN0 A;  1KD1 Q;  3EWK A;  5B66 V;  1CHI A;  2N9I A;  1T2K D;  3L4M A;  4IL6 V;  1M1J B;  1JEK A;  1L0L J;  3P7K A;  2R3S A;  3CCL P;  1Q7Y Q;  3M0A A;  1LTT C;  2MHM A;  2W6J H;  2E75 C;  2E5Y A;  5CIB B;  1DW0 A;  3PH2 B;  1AVO A;  4O1Q A;  3H1J D;  1YIJ P;  1KX2 A;  1SQP D;  4WQ9 A;  1M7L A;  2P1J A;  3M0D C;  1SQB K;  1LTI C;  1FZC B;  1YIQ A;  3SFD C;  1IO4 A;  4PD4 E;  3RL0 D;  1KV9 A;  5KLI C;  3HQ9 A;  3A0H E;  4IL6 X;  2QM8 A;  2QEX P;  1M70 A;  1H0T A;  1CSU A;  4N78 E;  1G1J A;  3CME P;  2M3E A;  1YI2 P;  3VMZ A;  1EDI A;  1BSH A;  4I6M C;  1GDT A;  3L70 J;  2FYN C;  2BH5 X;  4UB6 H;  1X9V A;  1Y47 A;  1X8Y A;  2HPC B;  1NYH A;  3I5C A;  1JMB A;  1UII A;  4HJG H;  2H7H A;  2QVA A;  3GG2 A;  2IBZ E;  1L0N K;  3KDP B;  1PP9 D;  2LXC B;  1CI6 A;  1GL2 C;  3WUT A;  2ZXX A;  4K3A A;  3L71 D;  2WSF H;  1NTM G;  1M1K Q;  4TT3 H;  1URQ A;  1DH3 A;  1E29 A;  1RAQ A;  3NBT A;  5AW0 B;  1NVO A;  3HD7 D;  3L74 D;  3U59 A;  1M60 A;  2D0W A;  2A06 G;  4ASV A;  2FXM A;  2PP6 A;  4Y5R A;  1WMK A;  2FXP A;  1LTG C;  1LGH B;  2YKQ A;  4HH2 A;  1CSB A;  3H1K E;  1CHH A;  3D6Z A;  5APS A;  1CCH A;  2AXT E;  3RK3 E;  1QL4 A;  1LC1 A;  1EZV I;  1F1C A;  3S9O A;  4EI2 A;  3KQG A;  3MUD C;  2CXB A;  3WC8 A;  1BE3 E;  1VQ9 P;  1N9C A;  1QN2 A;  5EFW B;  4LC1 A;  3CX5 I;  4XFJ A;  4OGQ C;  1KB9 I;  2KNC A;  5TIS V;  3Q5S A;  3GW6 A;  1JCC A;  1K9M Q;  3FGA D;  1H31 A;  1NWQ A;  1U7J A;  1LP1 B;  3CD6 P;  5DJU B;  2DW3 A;  2WPV B;  1SQV K;  5KAI V;  1MKM A;  3VYI A;  1GU4 A;  1RHZ B;  2G3A A;  1NU1 K;  2ZJS E;  3RK2 B;  3VMY A;  5AW9 B;  3B4S A;  3L73 J;  3GMA A;  4JYB A;  5APY A;  4PWA A;  4JPZ B;  1RE4 C;  3V6I A;  1VQN P;  3KZI H;  3V4Q A;  1VDF A;  2XV5 A;  1HGV A;  3CCV P;  2OZ1 A;  1H88 A;  2ZZS 1;  4H13 C;  4KJM A;  3H32 A;  1Y9B A;  3H25 A;  4RES B;  4EOT A;  4PW9 B;  2J5U A;  1NML A;  1SQX E;  5KAF H;  2RH0 A;  1L4A D;  1GL2 A;  3G9R A;  1I8O A;  1IFP A;  1OIP A;  4ASW A;  4W7Y A;  5GTH H;  1BL9 A;  3ZIY A;  5H2F E;  1FZE A;  1MFT A;  2QM7 A;  3SVW A;  1ZN5 A;  1CRG A;  1QLE D;  4I2L C;  2AXC A;  2H8P D;  2RKL A;  5AVW B;  1S9K E;  1L0N D;  1FOS E;  1M8O B;  2P67 A;  2E76 D;  3WU2 E;  4FA4 A;  1URQ D;  4L1Q A;  2N3B A;  1T6A A;  3PXS A;  4IOI H;  1CIF A;  3MUD A;  4UB8 E;  1RE3 C;  3H1I D;  3C2C A;  4C7N B;  3L75 D;  1PGQ A;  1N86 A;  2ZT9 C;  3ABV C;  2LXB A;  2VHD A;  3Q5R A;  4EID A;  2E75 D;  2YNY A;  4UB6 V;  4DZO A;  1SFC C;  2ITA A;  3WMM 0;  3I55 P;  2MJZ A;  4O1W A;  2A45 H;  5K5G B;  2XU6 A;  1G2C A;  2OTJ P;  2P7J A;  1IJD B;  1IFM A;  3H1H G;  3PHL A;  1H32 A;  1KQG B;  1VYD A;  4H0L B;  1CCR A;  1ZRT D;  3A0H H;  4QAO A;  2V7Q H;  1YBK A;  1NTK G;  1RE4 A;  1DX7 A;  3VTP C;  3ZBM A;  3VMX A;  5TIS E;  1NTM K;  1CTZ A;  3WUU A;  4PD4 I;  2LIT A;  1FJ0 A;  1SQV D;  1KN7 A;  5B5E E;  1NNO A;  3ZOW A;  1A02 J;  4NPE A;  4K3I A;  1A56 A;  1NU1 D;  2OGU A;  1CED A;  4WQ7 A;  3SWK A;  1MG2 D;  1FZG A;  2YQB A;  2RMZ A;  1OWA A;  2AEF A;  4FA1 A;  1ZOY C;  2CE0 A;  5CCG D;  3ZCF A;  1DIP A;  3E1I A;  5EXQ A;  3BCC J;  1J2J B;  3RN1 A;  3L71 G;  1CRC A;  1RQV A;  1EXI A;  2IZ1 A;  2B12 B;  1NAY A;  3GF3 A;  1IK7 A;  1SQX J;  1KYO D;  1RE3 A;  1LTA C;  1X22 A;  1SQP E;  4MN4 C;  1FU1 A;  3P32 A;  2WZ7 A;  2AXT H;  2FBW C;  1Q86 Q;  2GM4 A;  2YXQ B;  1SQQ J;  3CCS P;  4EIF A;  3W67 A;  4DOJ A;  1SFC A;  5KTB A;  1IZL 0;  1J1E C;  2AEJ A;  3GHG B;  2OYO A;  2B4Z A;  1VQ7 P;  3DP5 A;  1ETP A;  2WT7 A;  1L0L G;  1Q81 Q;  1X0T A;  2BCN B;  3V4W A;  5APQ A;  2GUS A;  3AEA C;  1LTJ B;  3F5H A;  2N18 C;  1E8E A;  1N73 C;  2Q6Q A;  3SWY A;  1JB0 J;  1B7V A;  2BLF B;  1GU2 A;  1FJK A;  1N15 A;  2KOG A;  5KAF V;  1EZV G;  2FYU E;  2CE1 A;  3A9F A;  3V2N A;  5GTI V;  2ZYD A;  1ZXG A;  2O01 H;  5DJQ B;  5GTH V;  1D7M A;  3K5B A;  1GD2 E;  1RF1 B;  2M5A A;  3HTK B;  2ZXE B;  1PP9 E;  2R32 A;  1HZU A;  1CXA A;  3RBZ A;  1X79 B;  1VF5 B;  3CX5 W;  3HRN A;  1E5W A;  1RH5 B;  4PV1 D;  1VQ5 P;  2E74 D;  1I5T A;  1ZLL A;  2NRG A;  3CWB E;  1K05 A;  5AVY B;  3L74 E;  4AAN A;  5DF5 A;  1U57 A;  2OYH B;  1N8R Q;  1U7M A;  2P2U A;  1W2L A;  1KIL B;  2R44 A;  3B5N B;  1YFC A;  5CJ0 A;  2GUV A;  3WFD C;  5APX A;  5H2F H;  2W6B A;  4FAV A;  1H9X A;  4WY4 D;  2WIT A;  2ZBO A;  1JO5 A;  4U7J A;  2IYO A;  2BH4 X;  3AE9 C;  2BEZ F;  4AAM A;  1WRG A;  4W80 A;  3G4S P;  1HGZ A;  1HCM A;  4EDF A;  1JMM A;  1QL2 A;  1Q90 D;  4YE1 A;  351C A;  2QE7 H;  3A0H V;  1CSX A;  1P84 D;  3CC2 P;  4OWF A;  4U3F D;  3MK7 B;  2XKM A;  1H9Y A;  2GB8 B;  2B87 B;  2HR3 A;  1YEB A;  1GK6 A;  2I8F A;  3RK3 B;  1JUN A;  3P8C D;  3H1I G;  1A2S A;  4I7Z B;  1N73 A;  1NMI A;  1N7S B;  2OQQ A;  1SQB E;  2C9X B;  3L75 G;  5KLV J;  1H8A A;  1GTW A;  1ZV8 A;  1KIB A;  3R4Y A;  1BGY E;  3WFE C;  2QG4 A;  2Q3E A;  3HQ7 A;  5B6Q A;  2CA4 B;  1FJP A;  2W6A A;  3V2R A;  2C1V A;  3RGU A;  4R4L A;  1YTZ I;  4M3L A;  2AIU A;  1FCD C;  2HLO A;  1HWT C;  1LFM A;  2CA3 B;  1AVY A;  4Y99 B;  1FI7 A;  3MP7 B;  3TGU D;  4BRY A;  3CXH I;  3KZI E;  3D71 A;  1A8C A;  5E79 E;  2QJK B;  2KZI A;  2WMM A;  5KAF E;  1L4A C;  2O3J A;  2FYU J;  1S5L X;  1QEX A;  3HUS A;  1L0N E;  2R3C A;  1KC8 Q;  2GIW A;  1PGO A;  4Y28 J;  3L73 G;  1C6R A;  2OTK E;  2HG5 D;  3A2A A;  2XND H;  1NTZ J;  4CPG A;  2AXT V;  4L76 A;  1NAF A;  2O1J A;  1T3J A;  1RAP A;  1KFN A;  5AVR B;  1ZP0 C;  3GF7 A;  1I54 A;  1CRI A;  3VNW A;  5CIE B;  2WTY A;  1OVR A;  2E76 C;  2CPB A;  3L72 E;  451C A;  3CWB J;  3HQ6 A;  1L0L K;  2POH A;  2OAR A;  1KZU B;  1FBM A;  3D6Y A;  1R5S A;  1DW1 A;  2WSF J;  3O5C A;  1CRY A;  1KFM A;  1DVV A;  1KYO W;  2W83 C;  3SSU A;  1FZF A;  1LT9 B;  1VQO P;  2WPQ A;  3H1H D;  1XTG B;  2WSS H;  2ZYA A;  3TYI A;  2R5B A;  3C8V A;  1LWU B;  1W2B O;  2WQY C;  1SQV E;  1NTK D;  3MIW A;  4OH8 B;  1YYC A;  1PFI A;  2JO1 A;  1NU1 E;  2QJY B;  1CNO A;  2KUB A;  1CXC A;  1BCC E;  2YKO A;  3D0W A;  1JY2 O;  2W8Z A;  3AE5 C;  4D6T J;  1NIR A;  5H2F V;  4WQE A;  1SQB J;  4N3Y B;  1L4A A;  1BGY J;  1HRO A;  1S2E A;  2JWA A;  3HE4 B;  2C1U A;  2KS1 A;  3WU2 V;  3HE5 B;  4YPC A;  3O0R C;  2H89 C;  2C8S A;  1DVH A;  1JTH A;  1VQL P;  5CCG C;  1OXZ A;  3MD0 A;  4UB8 V;  2N9Y B;  3RK2 D;  2Y0E A;  2AEM A;  2DGE A;  4WBA A;  1GIW A;  1CIG A;  1OMI A;  5KKZ C;  1QVG O;  1RF0 C;  1HH0 A;  4L75 A;  4NPF X;  2RN0 A;  1LT1 A;  2FFD B;  2MTA C;  1F1F A;  2BCC J;  1C2N A;  3B5N C;  3T97 A;  1M56 D;  1K73 Q;  1R5L A;  1GW4 A;  2WSE H;  1RY3 A;  3WFC C;  2K9Y A;  4XA4 A;  1LJ2 A;  2B88 A;  3BCC G;  1AKK A;  1L0L D;  3AED C;  3M0D A;  2W90 A;  2ZVN B;  3L72 J;  5AVZ B;  3RL0 B;  4U3F G;  3TF5 A;  2N1T B; 
#chains in the Genus database with same CATH homology
 2YCC A;  1IO3 A;  1EZV D;  4L3H A;  1YIC A;  5IY5 1;  3ZBM A;  5B5E V;  5C9M A;  1NTM D;  1CTZ A;  1LS9 A;  2LIT A;  1FJ0 A;  1QL3 A;  1SQV D;  3CX5 D;  1L9B C;  1KB9 D;  1NNO A;  4N0K A;  1DIQ C;  3ZOW A;  5AUR A;  1U74 B;  2A06 D;  4K3I A;  1A56 A;  4GYD A;  1FOC A;  1YCC A;  1C6S A;  1NU1 D;  5TJH A;  1CED A;  4WQ7 A;  2N3Y A;  1W5C T;  2DVH A;  1MG2 D;  1AOQ A;  2YQB A;  1DT1 A;  2RMZ A;  1C2R A;  1I6D A;  1OAE A;  5KLV D;  4FA1 A;  2CE0 A;  1CYI A;  1RZ6 A;  1CIH A;  3TDK A;  4J20 A;  3ZCF A;  3CU4 A;  3CYT I;  1C7M A;  1H33 A;  2QJP B;  1DW3 A;  3L70 D;  1CRJ A;  3O20 A;  5EXQ A;  3RLM A;  3ZOY A;  3RN1 A;  2FRC A;  1CRC A;  2B12 B;  3OA8 B;  1KYO D;  1GJQ A;  3A0B V;  1E2R A;  1PPJ D;  2K9J B;  2B10 B;  3SJL A;  3JBT B;  3RMZ A;  2LIR A;  1CYJ A;  5CID B;  4NFG B;  5DJQ C;  1CSW A;  4V2K A;  4GED B;  1JDL A;  4Q5P A;  1S5L V;  1FI9 A;  3ORV A;  2Y0D A;  2C1D B;  3WUI A;  1L9J C;  1C6O A;  1CRH A;  4EIF A;  4DY9 A;  2FYU D;  1IZL 0;  1YEA A;  4PJ0 V;  1IQC A;  2B4Z A;  3DP5 A;  5CIF B;  1ZZH A;  2GC4 D;  1ETP A;  2L4D A;  2V07 A;  2D0S A;  1HJ3 A;  2BCN B;  2BPB B;  1NTZ D;  3KHU A;  2N18 C;  1E8E A;  1B7V A;  2JQR A;  1FHB A;  2BLF B;  1GU2 A;  1N15 A;  5KAF V;  2CE1 A;  3A9F A;  2L91 A;  5GTI V;  1EB7 A;  3WFB C;  3O1Y A;  5DJQ B;  5GTH V;  2ZXY A;  3CWB D;  3PXW A;  1S6V B;  4H0K A;  2BGV X;  3OA8 A;  1I6E A;  2EXV A;  1C75 A;  1HZU A;  1RZ5 A;  1CXA A;  1K3G A;  1YNR A;  3CX5 W;  1R0Q A;  3OCD B;  1DII C;  1I5T A;  1GKS A;  3VRD A;  2N18 B;  1CSV A;  4RSZ A;  4AAN A;  5DF5 A;  4AAO A;  4WQA A;  1W2L A;  1KX7 A;  2PCB B;  2C1D A;  1KB0 A;  3PTZ A;  3NWV A;  1YFC A;  5B66 V;  1CHI A;  2N9I A;  3WFD C;  3MK7 C;  1FI3 A;  3L4M A;  4L3G A;  3PLN A;  4FAN A;  4IL6 V;  3L73 D;  4RJT A;  4FAV A;  1J3S A;  1H9X A;  4P4Q B;  2ZBO A;  1CC5 A;  2B11 B;  2BH4 X;  2MHM A;  2Y0C A;  1K3H A;  4AAM A;  3ZOX A;  5CIB B;  1DW0 A;  3HQ8 A;  3PH2 B;  1M6Z A;  4O1Q A;  1N90 A;  1HCM A;  4EDF A;  1HJ4 A;  1I55 A;  4D6T D;  3H1J D;  4FA9 A;  1KX2 A;  1SQP D;  4WQ9 A;  4YE1 A;  351C A;  1SQB D;  1YIQ A;  3A0H V;  3RN0 A;  1CSX A;  1HH7 A;  155C A;  1P84 D;  1BGY D;  4XXL A;  4U3F D;  1KV9 A;  3HQ9 A;  3MK7 B;  4XYD B;  3ITK A;  1H9Y A;  2GB8 B;  4EIC A;  1YEB A;  2I8F A;  3PRJ A;  1MZ4 A;  1M70 A;  3OCD A;  1CTJ A;  1CSU A;  1CIE A;  1A2S A;  1QKS A;  3ZOO A;  1NMI A;  2ZON G;  2C9X B;  1WEJ F;  1KIB A;  5CIG B;  2C2C A;  3WFE C;  2QG4 A;  4WQ8 A;  2Q3E A;  3HQ7 A;  5B6Q A;  2CA4 B;  3CXH W;  2BH5 X;  2PCC B;  5C0Z A;  4EIE A;  2C1V A;  3SLE A;  2AIU A;  1FCD C;  2KNC B;  1CHJ A;  1LFM A;  3KZI V;  2CA3 B;  3GG2 A;  2XTS B;  5KLI B;  1FI7 A;  5E79 V;  2BCC D;  3TGU D;  1H31 B;  1PP9 D;  1A8C A;  1I8P A;  2QJK B;  3L71 D;  4WQD A;  1E29 A;  2O3J A;  1RAQ A;  3NBT A;  1HZV A;  1C52 A;  3L74 D;  2FYN B;  1M60 A;  2D0W A;  2GIW A;  3L72 D;  1C6R A;  4Y5R A;  2AI5 A;  2AXT V;  4FB1 A;  2OZ1 B;  1CHH A;  4AX3 A;  1OCD A;  1CCH A;  1RAP A;  3DMI A;  4LJI A;  1QL4 A;  1LC1 A;  1I54 A;  4FA5 A;  1DW2 A;  1CRI A;  1F1C A;  3VNW A;  5CIE B;  2CXB A;  2N9J A;  3WC8 A;  451C A;  1N9C A;  1QYZ A;  1QN2 A;  3HQ6 A;  3M97 X;  4A7P A;  2JTI B;  2FWL A;  1LC2 A;  5TIS V;  1DW1 A;  4WQC A;  3GW6 A;  5DFS A;  3O5C A;  1H31 A;  1CRY A;  4PD4 D;  3X39 A;  1DVV A;  4WQB A;  2GC7 D;  5CIC B;  5KAI V;  1KYO W;  2PAC A;  1CO6 A;  3BCC D;  3VMA A;  2V08 A;  3SXT A;  3H1H D;  1SQX D;  3TYI A;  1BCC D;  2ORL A;  1GDV A;  4PWA A;  4H0J A;  1LMS A;  1NTK D;  1GQ1 A;  2OZ1 A;  2ZZS 1;  1HRC A;  4JCG A;  2QJY B;  1CNO A;  4PW9 B;  1CYC A;  1CXC A;  1NML A;  1SQQ D;  3FWL A;  1AYG A;  1NIR A;  5H2F V;  2IBZ D;  1YTC A;  1I8O A;  4WQE A;  3VYM A;  1AOF A;  1BL9 A;  3ZIY A;  1HRO A;  3L4O A;  2JWA A;  1COR A;  1H32 B;  4MU8 A;  3SVW A;  1CRG A;  2C1U A;  4KMG A;  1COT A;  3NBS A;  1N50 A;  3SWS A;  3WU2 V;  2KS1 A;  1WVE C;  3O0R C;  3PXT A;  2ZOO A;  1L0N D;  2B0Z B;  1MG3 D;  2C8S A;  1DVH A;  4AAL A;  1CTY A;  4FA4 A;  4UB8 V;  4L1Q A;  2N9Y B;  2Y0E A;  3DR0 A;  1H1O A;  2N3B A;  2DGE A;  2HV4 A;  3PXS A;  1GIW A;  1IRV A;  1CIG A;  1CIF A;  3H1K D;  5CIH B;  3CXH D;  2YK3 A;  3H1I D;  3C2C A;  2RN0 A;  1BE3 D;  3CP5 A;  3L75 D;  5CYT R;  2MTA C;  1F1F A;  2VHD A;  1C2N A;  4EID A;  3H1L D;  4UB6 V;  1HJ5 A;  1H33 B;  3WFC C;  1IRW A;  1U75 B;  4O1W A;  2YIU B;  1AKK A;  1L0L D;  3PHL A;  1H32 A;  1VYD A;  1CCR A;  1ZRT D;  5KKZ B;  4QAO A;  3TF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...