1P84F

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
74
structure length
74
Chain Sequence
VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
total genus 27
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1p84F00
1L0LH 1NTMH 1PP9H 3CWBH 1BGYH 3H1HH 5KLVH 1BE3H 3TGUH 2BCCH 3L71H 3H1LH 4U3FH 3H1JH 1EZVH 1SQQH 3H1KH 1P84F 3CXHF 1SQBH 3L75H 3L74H 4PD4F 4D6TH 1NTZH 3H1IH 1SQPH 1KYOF 3L72H 1NU1H 3L73H 2A06H 2FYUH 1PPJH 1SQVH 3CX5F 3L70H 3BCCH 1L0NH 1NTKH 1SQXH 1BCCH 2IBZH 1KB9F
chains in the Genus database with same CATH superfamily
2IJJA 3FB6C 3RYFB 1Q82W 4Q20A 4EEQA 1VQ5V 3F7VC 5IYDO 4J7ZA 3CXHF 1SQBH 5CN0A 3ZRVA 1XNRB 3H1IH 1XHZA 4XDKA 2RDCA 1YITV 4NXMB 2QKSA 4I0XB 1OCRC 1FD9A 3JARB 3BAAA 1VF6C 4JTDB 2DMXA 4HNAA 3JSLA 4MTXA 2UXDO 1G8MA 1KKCA 4BR6A 2DQ3A 1MABG 2XAQA 2FKXA 2WLIB 4LF5O 2E74B 5IWAO 4KFMA 4LNUA 1IBLO 1I7FA 1NR7A 3I56V 2RNBA 5LMNO 2Q8VA 1X4TA 3T1YB 3OEEG 3HB3B 4AQYO 5LMUO 5JJJB 2R70A 2YS8A 2VQEB 5FPRA 4I0XA 4FZ1A 3JASA 2PI5A 3JD0A 4XDJA 1CPYA 1R73A 4WFEA 1MSWD 1Q90D 3ETGA 3K9AA 4JI1O 1AI6A 4I4TB 1G1XB 1K92A 5EYPB 3ABTA 3FYIB 1VQ8V 2HVJC 1M57C 4PV1B 3O65A 4PA9A 4LFCB 4LC1A 5BXZA 3U10A 1HNXB 3VQYA 1R6NA 4DV5O 1QLEC 1UJWB 4NXNB 3KKYA 5J2UA 4LR3A 2BSKB 3MHSC 3SJAC 3UO3A 3RYIB 4R50A 3CCMV 4B3SO 1HDJA 4MT8A 1WP8A 1SA0B 1YHQV 5JH7B 4BW5A 2EULA 1JQ0A 5KLVH 2N74A 3SPGA 1YI2V 1VF6A 1Y74B 1N36O 2LP7A 2UXNA 2X6AA 3GWOA 1H2KA 2ZQMA 3CEIA 3JCUZ 2HG5C 3CS5A 5EIBD 4ZOLA 1WLEA 2HJFC 3ZS8C 4JGSA 4B08A 2F93B 4TV8B 4I4TA 4Z1MG 2VWKA 2YXLA 3K58A 1HNZO 3OTOO 3ZIAG 4O4LB 3RYCA 2EIMB 3NR7A 5JJEB 1QNMA 4GX2A 2M7WA 1M90W 4MVSA 5BR8O 3CCVV 1TUBA 4UCTA 3OTOB 1KB9F 3SJQC 3AG7A 2UXCB 1UPGA 4MTOA 4D7SA 2JGDA 1R6TA 1D2DA 2XOKG 4UXNA 5IDJA 4HAMA 1P49A 4IGGA 4OX9O 5LL6Y 1SQPH 1OCRB 4ZBMA 1XHXA 4EFBA 4L8JA 4RQEA 3E89A 5CA0A 1NJIW 2R9AA 4O4JB 3NXSA 4IIJB 4DUYO 4K0KB 4DYLA 2EZPA 2Y4TA 4DV6B 2K1EA 1AVMA 1YEWA 2BSKA 3K5NA 3FAVB 4JI4B 5GONB 1DF5A 5E79Z 2A3QA 1VQOV 3E86A 4X1IB 1L8DA 1G6UA 2Q7GA 3SPIA 2EINB 4UUJC 1V54C 3JD2A 4JAAA 3QF7A 3CRMA 4C7UA 1TVKA 1M57B 1SZXA 5KHKA 2UXBB 3UT5B 2BTQB 3LNNA 2BE3A 1JA8A 2LW1A 4YHHB 4YIPA 3O9OA 4ICGA 3ABMC 2VQFO 1NKDA 2O57A 3JATB 3AK3A 2W6IG 3HKBB 3BEHA 2OYQA 1YVWA 3L9DA 3C3TA 2JS5A 1HNWO 1JCHA 1IXBA 1GKFA 1Q43A 4CH4A 1SC5B 3AG2B 3IFXA 1ZLZA 1BSMA 5JQGA 4H0LB 2CTRA 1THZA 4WFBV 4LFBB 5A2QN 4J11A 3K0DA 1DTOA 5H5NA 4WFHA 1L0NH 2QWNB 2WLKA 2ZT9B 4NB5A 4JTAB 2LW7A 4BIZA 5ITZB 3APQA 2KQXA 1H2NA 3TETA 2ZD9A 4U7OA 1GM9A 3IJ4A 5K1XA 1YXBA 4FLVA 4BAYA 1FFTB 1VEWA 2ITDC 2UXXA 3W7XA 3W7UA 2KSDA 3EHBB 2HKOA 3T1HB 3TGUH 4GZRB 4DV1O 2F4VB 4JF3A 3KZIZ 3QNEA 5EBMC 3FYEB 1XL6A 5B1BB 5ITZA 4LF4O 4R6ZA 2PZSA 2OTJV 3P30A 3R66A 3MD0A 1S76D 3HKCB 1K73W 5FNVB 2ZXWC 1FXHA 3OGCC 2P5OA 2JRIA 2MK3A 4BIUA 3ZMVA 1KECA 2BOCC 4QPJA 4LH7A 5EZYA 2IU3A 1MZEA 3AG4C 3K59A 4YJ2A 1Q6IA 2CDYA 5KMGB 1OHHG 3B2EE 3P3NA 4DV1B 4H44B 1K7DA 3K06A 3HR0A 3TCUA 3BY6A 2EILB 3K0GA 4WFFA 2QTSA 3EXAA 3BA8A 4RUEA 2UU9O 2XNDG 4KXRA 4RAIA 4I7ZB 3CJHB 3K5MA 4DRXB 4TWKA 2Y0IA 1H8HG 5LYJA 5GTIZ 2JJ1G 2XAHA 1T5EA 3BABA 2ZM6B 1M9NA 2ADPA 1IDSA 4EB6B 4R7CA 1WPXA 2ZKOA 3JAKA 1K3EA 2ZE7A 1Y67A 4NTYA 4AI8A 4LBEC 3JSNA 1NTZH 4MVZA 1FXVA 1XI1A 3N2GB 1BS3A 3T2MA 3CPWU 3H9VA 2VS0A 4UV8A 5JQGB 3ZRSA 1CXZB 3ZMTA 4CZZA 1Y76B 5IJ9B 1FFXA 1GN4A 4YJ3B 1VQKV 4KHPO 2N05A 1FJGB 1B04A 5B1AC 5F2VO 4LF9O 1NS1A 2V1DA 5IJ0B 2LGWA 1B3QA 3J80N 1JOYA 4X66O 5LOVB 1YDXA 2A79B 1NT2B 4O4HA 4H13B 5CA3A 4I50A 5HFLA 2X0LA 4IL6Z 2R9IA 3DSQA 1YSCA 4JV5B 5KX5B 4E2LA 4GX5A 3SPHA 5E1AC 3AG2C 3SYOA 2EZOA 4EFEA 2VQEO 1S72V 2IJIA 5FLXN 5LP6C 4MW3A 2HEPA 5LMUB 1WAZA 4GUNA 5L3BA 4AILC 3LDEA 3ETEA 4QGPA 4LFAO 1AJPA 3RW0A 1GN2A 3H1LH 3GWKC 4JI2O 4PDLA 5KUKA 3E35A 3B09A 3LUTB 1W59A 5L3FA 2VQFB 5JVDA 4X64O 5EZYB 4KUMA 4Z1VA 5LA6B 4OX9B 1FPOA 1J5EB 2KG7A 2WLLB 1Y4MA 1AROP 1XREA 4NXMO 1K8AW 3ABKC 3FKSG 1Q5OA 4UCOA 2DJVA 3K3WA 2CAZC 4G2KA 1ZL8B 4IHJB 2WLMA 2P4KA 3ZHSA 2LO1A 1OCOB 2DYSC 3J81N 3SYAA 2QM8A 3T1HO 1M93A 1QU7A 1XQ8A 4JI4O 1DLBA 4MW8A 2YDEA 2EIKC 1ZAUA 2X7RB 3A0HZ 1IBLB 5B1AB 4JI7O 3RVYA 3ZHUA 4X1KA 4FPPA 1K9MW 4NYKA 1J95A 3JD1A 2HFEC 3G71V 1NVPB 3RVZA 4CS3A 2XHBA 4MVOA 2WA4A 3OFNG 2YC0A 4J7JA 2CUGA 2CH7B 4JI1B 1J5EO 5KX5A 5CB4B 4DV2O 3B77A 1K34A 4U7NA 4DR3O 3OM3B 3RYCB 5GTHZ 4BWAA 4RO2A 3ABKB 2ARHA 4UCVA 3BFRA 3OTFA 4CC5A 1HW7A 3HKCA 3JCZA 5CA1B 4DV6O 3HKDA 3OW2U 2D2CB 2WA3A 4X8AA 2JEXA 1MOFA 3L73H 4UB6Z 4FFBA 5H2FZ 1N4CA 1MZFA 5BR8B 2ZE8A 4H33A 1F7YA 1Y66A 5LGNA 1RSOA 1QHTA 3B4SA 3WB0A 1XMQO 1URFA 2OCHA 1P84F 3LSUA 3BRCA 4DR2B 5CMUA 3VQWA 1I0HA 1K5SA 4FM2A 4DR6O 1Q7YW 2QEXV 4DV3B 1EN4A 3ETDA 1YTFB 1NQTA 2ZDIA 1FXKC 3PJSK 5DN6G 3T4DA 4GKJB 2AXTZ 3K03A 5LYJB 3SYCA 4FFBB 1PNMA 2GV9A 1MMMA 5LXTA 1XUQA 3HKEB 2AGAA 1OV9A 2AHZA 2ODMA 4NTWA 5A9GA 1P4RA 2CE4A 3AG1B 3ASNB 2F4VO 4DR3B 1R6KA 2B5UA 2P06A 2GUZA 4JV5O 1BQ0A 2Y69C 2A06H 2LFSA 3C3SA 4J80A 5LP6A 3UO2A 4JI5O 4JI0B 4FVMA 4JI6O 4UFZA 3TJTA 1PKXA 4FLYA 1U97A 2YSUB 4PD4F 4DV7B 3CXCU 2L35A 3CRAA 4P9OA 4CS2A 4DK0A 1QLNA 4X62O 5IY5B 3ABLB 3JALA 1D5NA 3CC2V 4MTGA 2QGNA 4HZ3A 4NKGB 4TSFG 2Y69B 1M5IA 2CGNA 2Y48A 2A0LA 2X6CA 5IT9N 3ASNC 4I55A 5C8YB 4NR1A 2QWQB 5D5QA 4DR6B 4K3AA 2HHHB 1EFRG 1AI5A 2ZCEA 1YJ9V 2DOSA 4ZI7B 2XTAA 1OZ0A 2QDOA 4DW1A 4TQDA 4FZ0A 4ZKIA 2AZ0A 2CTWA 1BQZA 4KHPB 2RCVA 3SGIA 1KD1W 3CRRA 1RM1B 2GSMB 1H2SB 1M56C 2NNUA 3VQVA 1JVMA 3ICXA 2ADQB 3DC6A 3CCUV 1SKVA 1QVGU 3AG3C 3AK2A 5IJ9A 1I5YA 1XL4A 2JS3A 2ZR3A 4ZOLB 4IT5A 4LF4B 2H3OA 2Q5ZA 2UU9B 2F95B 4YXWG 1H8EG 2FB5A 5LHHA 4LNUB 1HNXO 2G38A 5IYZA 3OE7G 1LUVA 4I9QA 5BMVB 2K9PA 2E75B 3A0RA 3IC9A 3QVNA 2GHYA 2LGQA 2Q7EA 4LF6O 4QIWF 5KA5A 4Q6GA 4DR4B 4GKKB 3WG7B 3I5DA 1K4DC 3D3IA 3ZEDA 4EB6A 2YIAA 1P7GA 4JAVA 3UT5A 5DM6V 4TUYB 2ZR2A 3AEIA 2CH7A 1SQGA 4HNAB 3SPCA 1K97A 4PA6A 1N34O 2ZDIC 1I94O 3RWRD 2PYLA 4G27B 1MG1A 4AHCA 1OCOC 3LDCA 4NVPA 1SESA 4O4LA 1KUQA 1V55B 1UFIA 4JAUA 1XILA 4YHHO 3D8CA 3IAYA 1PL0A 2RQ6A 4U3JA 2HHHO 2KKWA 1WA8B 2ATKC 5LOVA 2CTPA 1SQQH 3RFRA 4GX0A 2UUAB 4J9YB 5EIBC 3H01A 3QO5A 1IVSA 3CRQA 2Z3YA 4DV0B 2XT9A 2YXYA 1KC8W 2GTSA 2E76B 1NH2D 2UUAO 1NTKH 1GRJA 1LNQA 1GN3A 2YIBA 1N33B 5KMGA 4DUZO 1VMGA 1FS0G 5KHJA 1XMQB 2BTOA 4DV7O 4GX1A 2B1GA 2RJZA 3H1KH 3T4ZA 4LF5B 3L74H 2QR4A 4KL1A 2GUZB 1ZTEA 5KHHA 4TV9B 5BZBA 4ZHQA 4K8ZA 3CCQV 5L3DA 3W7SA 3AG3B 1PD3A 4QNHB 3CSXA 4FK5C 4LCUC 1MNGA 4W4KA 2QE7G 2W0XA 2OTLV 2KB1A 4DR1O 4RQFA 4FLTA 2QWPB 2H94A 2ZM6O 3M99B 3G80A 2YIBD 1K5QA 1YTFD 4JI8O 4I5SA 4A5UB 1ENVA 3CCSV 1O9GA 1M4UA 2V4DA 1VQ9V 4F6RA 1ZX3A 2CK3G 1SQVH 1Q3EA 3FB5C 1Q8IA 4YY3B 3P32A 3CE2A 1RSOB 4OPHA 1IBMO 2QTOA 4DR5B 2QM4A 1X59A 2C2AA 1FJGO 5JWPA 1IZ3A 4JI3B 3CB2A 3CC7V 1NZ6A 3BCCH 3OMIB 4DR7O 3OAAG 2PY5A 4DUZB 3LNMB 3ZMSA 1BE3H 5EBLC 3CCJV 1GK9A 4U3FH 4JZGA 1NVPD 1DK1A 4ZI7A 1R3LC 3T1CA 2YI8A 3ABUA 1BMFG 2EJ7A 3EFFK 2YUAA 2EBOA 2EX3A 1S0VA 2UUBB 1N32O 5D5PA 2DYRB 4DO2A 3HKDB 2Q9LA 3AG1C 4K35A 1VF5B 1NR1A 3UCSC 1M56B 1N33O 4LF7O 3M8AA 2R72A 1VQ6V 5LP6B 1OCCB 1VIBA 1Q81W 1FFXB 5L3CA 1S5JA 2UUCO 1HWYA 2WLIA 5LHGA 1XEQA 2CTQA 3SDLA 5FL7G 1B06A 5IYZB 1H38A 1VQNV 1XOUA 3SJCC 3L71H 4YY3O 4OPAA 2BOBC 4TUYA 4B7KA 4DV4O 1RFYA 2D3OW 4J9ZB 3JD3A 1IURA 3ZX6A 1KMIZ 4PELA 1W0JG 3VBBA 1US6A 3MAQA 3CHXA 2QSAA 2RN9A 5TISZ 3BVOA 1YIJV 3DXRA 3R65A 4P2ZA 4DUYB 4K0KO 2IBZH 3SYPA 3ABLC 3QO8A 3H1HH 1H2LA 2PF4E 4JPRA 4ABMA 4GKKO 4D6TH 4JI2B 2AHYA 1EBOA 4DR2O 2MW2B 1OCZB 4HYOA 5LMNB 3ZRWB 1I08A 4BW9A 3ZCCA 2NLJC 5DECA 2GBOA 4PDVA 1S5HC 1BT8A 3F5WC 4LFCO 1IXMA 4LWSA 4JI3O 4P30A 4LF8B 2VWJA 2ZINA 4LFBO 1BHBA 2IH1C 4PI2A 4B3TB 3OMNB 4DR4O 2ZIMA 3JAWB 4HBNA 1XBLA 3A8TA 1FXKB 1AR1B 2EILC 1G4YB 3E8HA 3FAVA 1AILA 4WBNA 1SETA 1SZTA 1F51A 3G6BA 3H1JH 3PN1A 4X20B 4ZIBA 4JI8B 4QE9A 3L75H 2OT5A 4TT3G 3B40A 3AG4B 3LSSA 1WPBA 4O2AA 4B3SB 1SQXH 1R3JC 3J7AU 3RYHB 4UVBA 3CCRV 1VQMV 3ZRWA 2F43G 4F6RB 2WLLA 3VQXA 2XAGA 5IYBO 2Q4PA 1Y76A 5B1BC 2Q6AA 3W7TA 1WJZA 2WAMA 3QG5A 4UCUA 2IJHA 4X9QA 2UXCO 2FMLA 1YF2A 3L70H 1BCCH 2P4VA 4L87A 3X2QB 4N23A 2DE0X 2N04A 5KA6A 2Z5UA 4RUFA 4ASUG 4RWUA 1S3JA 1OJHA 3C90A 1YZBA 2JIZG 3EVKA 4LF9B 2YICA 1BL8A 2Q73A 3DC5A 1WP7A 4Z2WA 5AG2A 4X88A 1ORQC 4X1YB 3K08A 5L3EA 4MSWC 2P7TC 4JZ2A 3T1YO 2JEUA 2Q67A 1QVFU 5LHIA 1YJWV 2KG7B 2DYRC 1HNWB 3IGAC 4UVCA 1AJNA 1N32B 4IYIA 1HNZB 1K33A 2WSSG 1AR4A 2PGGA 4FLZA 2ZE6A 2HR3A 2QWOB 2L6LA 1QR9A 4UCSA 1NH2B 3WB2A 4J10A 4NXNO 3OGIB 3D36C 2QKCA 1S77D 3FD9A 3K9SA 5KAFZ 1WA8A 3ML0A 2F23A 1VQLV 3JAWA 3ZHQA 4AQYB 2DWEC 1MSDA 2ZIOA 3RT3C 2ZNIA 2VRZA 1Q86W 2P67A 2NR5A 4TOIA 4I50B 3N2KA 5B66Z 1Y74A 1JR9A 5CA0B 1HR0B 3SYQA 5J9PC 3SPJA 1FAFA 4JYBA 1WB7A 2EJRA 4FFKA 3ASOC 1IX9A 2FL4A 4PDMA 1AR5A 1VF7A 2Y0PA 1JPXA 1H2GA 2OIGA 4JYYA 2OCCB 1LUWA 3OR6C 5DEDA 2QM7A 2HJDA 3P3PA 3CCLV 3AK1A 1VQ7V 4W4LA 3U0ZA 3BHPA 4DV0O 3E8BA 4LWSB 1VQ4V 1SA0A 2B1IA 2ZXWB 3DGEA 4GCZA 3N2KB 4DV3O 5B1OA 1E1QG 1V54B 3JAKB 3APOA 4JTCB 1XNQB 3F7YC 2WPDG 1BHAA 2PUSA 3HKBA 2EIMC 1COWG 3ZMUA 5B1NA 3ASOB 1B6QA 4FLWA 5EYPA 3D36A 3MDSA 4E4EA 1ZSPA 3CRCA 3LSQA 3WB1A 4TV8A 2W0FC 4LFAB 4NTXA 4LF8O 1PL4A 1GM8A 4GYCB 4G28B 1BZKA 1Z5WA 1EM1A 2NN4A 3L72H 4O4HB 1TGOA 3GB7C 2DW4A 2Q7HA 3SJBC 4X89A 3B8MA 4FLXA 1U96A 2CGOA 1N34B 5KHIA 3E2EA 5BY1A 1PNLA 1OCZC 1TVKB 4MTFA 5KAIZ 1IBMB 5LGTA 1IBKB 2OWOA 3QTCA 4B3MB 1KU9A 3RYHA 3A0BZ 4B3RB 1WNSA 4JASA 3OT7A 1F4NA 1QLEB 2YI9A 4IIJA 2LQTA 5BMVA 4F6EA 2V7QG 2Q0AA 3SR2C 3K04A 1LR1A 4X66B 3ABMB 2YXHA 3E8GA 4UV9A 2WWWA 1DF4A 1QCEA 1CP9A 5JVDB 4JYCA 1N8RW 3THOA 3I55V 1GMGA 1RPOA 1MA1A 5IE9A 3HPLC 5HFMA 4PDRA 1R1BA 5EC2C 3JASB 2E5LB 1V9PA 1HR0O 4R8CA 1TAEA 1E79G 2RMKB 2JK5C 4I55B 4MVRA 5C8YA 3U11A 2QWRB 1L1FA 4IHJA 3OEHG 4B7EA 3STLC 3K79A 1PV0A 1KQSU 3JATA 2Q68A 2DN9A 3RYFA 3LDDA 2IJKA 5K1PA 4FM1A 4DV4B 3E83A 4D7TA 1R3KC 4DV2B 2IU0A 1BGYH 4OXSA 4QPKA 2AZ2A 5C93A 3CJHA 3ZHVA 3K5OA 5H9CA 4O4IA 1N0NA 4JI7B 4QJFB 1QQCA 4UVAA 3TK1A 4K8XA 3FX7A 3JYCA 2XAJA 1WN7A 3ZN0A 2Z0AA 3WFVA 3CCEV 5LA6A 1EZJA 5FNVA 4WCEV 2BCCH 5GW7A 1AI7A 3ZMZA 4WF9V 2XUMA 3CMAV 1VP7A 1N36B 4YIOA 3UKMA 1F4MA 3E22A 4WFAV 1HP8A 4OGQB 5H6RA 3FB8C 4ZHQB 4GLXA 3CX5F 2QA4V 3N27A 5B3SB 2R9RB 2WLHA 1FYJA 3OMAB 4O2BA 4XDLA 1GTOA 5B5EZ 4O2AB 3STZC 2OIEA 2UUBO 4FLUA 2XASA 3CYOA 1R3IC 4DK1A 4DR5O 1RM1C 1DGSA 3F5TA 5H6QA 1XDCA 4X65B 3E22B 1FKAO 1JJOA 4WFGA 1EZVH 4XBFA 3RBZA 2E5LO 1AP5A 1GO3F 1Y6XA 5J2TB 4DR7B 4J41A 4H37A 3M7MX 5JH7A 2ZNJA 1ZWIC 2WLJA 2PTMA 2JGUA 1NI8A 2A7WA 4FM0A 2ZE5A 1YJNV 3KCXA 5J2UB 1L0LH 4CH6A 3K5LA 1PM9A 3OR7C 2EIJC 1XNQO 1SRYA 4UB8Z 3S3XA 1W2BU 1KP3A 1VARA 1SQFA 4FJCC 2YEVA 1JFFA 4UCRA 3CP1A 4CBCA 4DV5B 3JALB 2FYUH 1ZUQA 1P7BA 4B3RO 1Z5VA 1JX9A 1K4CC 2LJ2A 4FMTA 5JCOA 4BIOA 1OCCC 2ETNA 3DXRB 3VOUA 4YJ2B 3D3QA 4PA4A 4DXWA 1QR8A 2ILMA 2DYSB 3A2FA 3IC7A 2IH3C 1EN5A 2DWDC 2FTKA 4PHZA 1PPJH 1E1RG 2QJ1A 1WB8A 5CBHA 3ZBHA 4X65O 1GM7A 2EIKB 4LF6B 1A32A 1SS3A 4F4LA 2IM9A 5IJ0A 1TUBB 3K57A 4O4JA 4LP8A 4X64B 1KYOF 1H2MA 2P22C 1JMKC 3B8NA 4P9PA 1ROPA 4IYHA 3X2QC 3OUSA 2HLDG 2GTAA 5J2TA 1NTMH 3GVMA 2YIDA 3BA9A 2P6JA 4DW0A 1RPRA 1FXKA 4O2BB 1JJ2U 1I94B 4TQFA 1CEZA 4GT1A 4WBNB 1Q6UA 1GN6A 1AP6A 1NBMG 5IWAB 2F66C 2Q0OC 2EINC 2B9ZA 2DQ0A 1M1KW 4DRXA 2OCCC 2YEVB 2Q69A 3S3WA 2UXDB 5JJNB 1XMOO 1O9HA 1VQPV 3FB7C 1Z2GA 4X1KB 5JCOC 2E3CA 4LH6A 4QE7A 3JAMN 4MVMA 2PYJA 3RN4A 2HVKC 3DTUB 1XNRO 3CWBH 3N2GA 4O4IB 3G67A 4PA3A 5FPOA 3ZHTA 4PA7A 5LXTB 3HKEA 2UUCB 3ZHRA 3RYIA 3BPZA 4JI5B 4JI0O 4LF7B 2JVDA 1I5XA 4CH5A 2P90A 3FFQA 1TUEB 2ITCC 1AB3A 5IY5C 4DR1B 3ZRXA 1KKDA 2LFRA 1GAXA 1SERA 4X1IA 2QKAA 2HP8A 2A9HA 1KBHA 4PJ0Z 2UXBO 5CBFA 3ZJZA 3ETQA 1N0JA 2JDIG 3TXSA 4GKJO 3UQ8A 3JD4A 3TXQA 1V55C 4CC6A 2BTQA 5EK0A 4N21A 4MVQA 1GH6A 2EIJB 5CA1A 4KP4A 3OUFA 4CH3A 4JYAB 5EC1C 3Q4HB 5EBWC 1S5LZ 3MHHC 3UM7A 4J7KA 5KUMA 4X20A 4JYAO 1AJQA 3KG2A 2PI4A 2JGDB 4YJ3A 4B3TO 1IBKO 1PNKA 4CS4A 3CD6V 3G6EV 1PP9H 1AI4A 2IW5A 3CMEV 1W0KG 4U3JB 2H8PC 3WG7C 2Y4UA 4MS2A 3JARA 3RGBA 4B3MO 2W6JG 2F1MA 5L3GA 5IYCO 4JI6B 2XAFA 1Q6HA 1NU1H 5CB4A 4MVUA 1RP3B 4EKWA 3G4SV 2GDSA 3Q4HA 2AW9A 2WLNA 3ZN1A 5CBGA 1ZL8A 1EN6A 1D5AA 1JFFB 2JJ2G 1KP2A 4I9WA 5B3SC 3W7WA 4J42A 3WU2Z 1QBZA 4X62B 1TA8A 1YCIA 3E8FA 4FIPC 5LGUA 3QO7A 1F23A 5LBQA 2X6BA 3CC4V 4TV9A 3OD4A 2M6YA 4PI0A 1SF9A 5GONA 1XMOB 3KCYA 4X1YA 5KHGA
chains in the Genus database with same CATH topology
1L0LH 1NTMH 1PP9H 3CWBH 1BGYH 3H1HH 5KLVH 1BE3H 3TGUH 2BCCH 3L71H 3H1LH 4U3FH 3H1JH 1EZVH 1SQQH 3H1KH 1P84F 3CXHF 1SQBH 3L75H 3L74H 4PD4F 4D6TH 1NTZH 3H1IH 1SQPH 1KYOF 3L72H 1NU1H 3L73H 2A06H 2FYUH 1PPJH 1SQVH 3CX5F 3L70H 3BCCH 1L0NH 1NTKH 1SQXH 1BCCH 2IBZH 1KB9F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0L H;  1NTM H;  1PP9 H;  3CWB H;  1BGY H;  3H1H H;  5KLV H;  1BE3 H;  3TGU H;  2BCC H;  3L71 H;  3H1L H;  4U3F H;  3H1J H;  1EZV H;  1SQQ H;  3H1K H;  1P84 F;  3CXH F;  1SQB H;  3L75 H;  3L74 H;  4PD4 F;  4D6T H;  1NTZ H;  3H1I H;  1SQP H;  1KYO F;  3L72 H;  1NU1 H;  3L73 H;  2A06 H;  2FYU H;  1PPJ H;  1SQV H;  3CX5 F;  3L70 H;  3BCC H;  1L0N H;  1NTK H;  1SQX H;  1BCC H;  2IBZ H;  1KB9 F; 
#chains in the Genus database with same CATH topology
 2IJJ A;  3FB6 C;  3RYF B;  1Q82 W;  4Q20 A;  4EEQ A;  1VQ5 V;  3F7V C;  5IYD O;  4J7Z A;  3CXH F;  1SQB H;  5CN0 A;  3ZRV A;  1XNR B;  3H1I H;  1XHZ A;  4XDK A;  2RDC A;  1YIT V;  4NXM B;  2QKS A;  4I0X B;  1OCR C;  1FD9 A;  3JAR B;  3BAA A;  1VF6 C;  4JTD B;  2DMX A;  4HNA A;  3JSL A;  4MTX A;  2UXD O;  1G8M A;  1KKC A;  4BR6 A;  2DQ3 A;  1MAB G;  2XAQ A;  2FKX A;  2WLI B;  4LF5 O;  2E74 B;  5IWA O;  4KFM A;  4LNU A;  1IBL O;  1I7F A;  1NR7 A;  3I56 V;  2RNB A;  5LMN O;  2Q8V A;  1X4T A;  3T1Y B;  3OEE G;  3HB3 B;  4AQY O;  5LMU O;  5JJJ B;  2R70 A;  2YS8 A;  2VQE B;  5FPR A;  4I0X A;  4FZ1 A;  3JAS A;  2PI5 A;  3JD0 A;  4XDJ A;  1CPY A;  1R73 A;  4WFE A;  1MSW D;  1Q90 D;  3ETG A;  3K9A A;  4JI1 O;  1AI6 A;  4I4T B;  1G1X B;  1K92 A;  5EYP B;  3ABT A;  3FYI B;  1VQ8 V;  2HVJ C;  1M57 C;  4PV1 B;  3O65 A;  4PA9 A;  4LFC B;  4LC1 A;  5BXZ A;  3U10 A;  1HNX B;  3VQY A;  1R6N A;  4DV5 O;  1QLE C;  1UJW B;  4NXN B;  3KKY A;  5J2U A;  4LR3 A;  2BSK B;  3MHS C;  3SJA C;  3UO3 A;  3RYI B;  4R50 A;  3CCM V;  4B3S O;  1HDJ A;  4MT8 A;  1WP8 A;  1SA0 B;  1YHQ V;  5JH7 B;  4BW5 A;  2EUL A;  1JQ0 A;  5KLV H;  2N74 A;  3SPG A;  1YI2 V;  1VF6 A;  1Y74 B;  1N36 O;  2LP7 A;  2UXN A;  2X6A A;  3GWO A;  1H2K A;  2ZQM A;  3CEI A;  3JCU Z;  2HG5 C;  3CS5 A;  5EIB D;  4ZOL A;  1WLE A;  2HJF C;  3ZS8 C;  4JGS A;  4B08 A;  2F93 B;  4TV8 B;  4I4T A;  4Z1M G;  2VWK A;  2YXL A;  3K58 A;  1HNZ O;  3OTO O;  3ZIA G;  4O4L B;  3RYC A;  2EIM B;  3NR7 A;  5JJE B;  1QNM A;  4GX2 A;  2M7W A;  1M90 W;  4MVS A;  5BR8 O;  3CCV V;  1TUB A;  4UCT A;  3OTO B;  1KB9 F;  3SJQ C;  3AG7 A;  2UXC B;  1UPG A;  4MTO A;  4D7S A;  2JGD A;  1R6T A;  1D2D A;  2XOK G;  4UXN A;  5IDJ A;  4HAM A;  1P49 A;  4IGG A;  4OX9 O;  5LL6 Y;  1SQP H;  1OCR B;  4ZBM A;  1XHX A;  4EFB A;  4L8J A;  4RQE A;  3E89 A;  5CA0 A;  1NJI W;  2R9A A;  4O4J B;  3NXS A;  4IIJ B;  4DUY O;  4K0K B;  4DYL A;  2EZP A;  2Y4T A;  4DV6 B;  2K1E A;  1AVM A;  1YEW A;  2BSK A;  3K5N A;  3FAV B;  4JI4 B;  5GON B;  1DF5 A;  5E79 Z;  2A3Q A;  1VQO V;  3E86 A;  4X1I B;  1L8D A;  1G6U A;  2Q7G A;  3SPI A;  2EIN B;  4UUJ C;  1V54 C;  3JD2 A;  4JAA A;  3QF7 A;  3CRM A;  4C7U A;  1TVK A;  1M57 B;  1SZX A;  5KHK A;  2UXB B;  3UT5 B;  2BTQ B;  3LNN A;  2BE3 A;  1JA8 A;  2LW1 A;  4YHH B;  4YIP A;  3O9O A;  4ICG A;  3ABM C;  2VQF O;  1NKD A;  2O57 A;  3JAT B;  3AK3 A;  2W6I G;  3HKB B;  3BEH A;  2OYQ A;  1YVW A;  3L9D A;  3C3T A;  2JS5 A;  1HNW O;  1JCH A;  1IXB A;  1GKF A;  1Q43 A;  4CH4 A;  1SC5 B;  3AG2 B;  3IFX A;  1ZLZ A;  1BSM A;  5JQG A;  4H0L B;  2CTR A;  1THZ A;  4WFB V;  4LFB B;  5A2Q N;  4J11 A;  3K0D A;  1DTO A;  5H5N A;  4WFH A;  1L0N H;  2QWN B;  2WLK A;  2ZT9 B;  4NB5 A;  4JTA B;  2LW7 A;  4BIZ A;  5ITZ B;  3APQ A;  2KQX A;  1H2N A;  3TET A;  2ZD9 A;  4U7O A;  1GM9 A;  3IJ4 A;  5K1X A;  1YXB A;  4FLV A;  4BAY A;  1FFT B;  1VEW A;  2ITD C;  2UXX A;  3W7X A;  3W7U A;  2KSD A;  3EHB B;  2HKO A;  3T1H B;  3TGU H;  4GZR B;  4DV1 O;  2F4V B;  4JF3 A;  3KZI Z;  3QNE A;  5EBM C;  3FYE B;  1XL6 A;  5B1B B;  5ITZ A;  4LF4 O;  4R6Z A;  2PZS A;  2OTJ V;  3P30 A;  3R66 A;  3MD0 A;  1S76 D;  3HKC B;  1K73 W;  5FNV B;  2ZXW C;  1FXH A;  3OGC C;  2P5O A;  2JRI A;  2MK3 A;  4BIU A;  3ZMV A;  1KEC A;  2BOC C;  4QPJ A;  4LH7 A;  5EZY A;  2IU3 A;  1MZE A;  3AG4 C;  3K59 A;  4YJ2 A;  1Q6I A;  2CDY A;  5KMG B;  1OHH G;  3B2E E;  3P3N A;  4DV1 B;  4H44 B;  1K7D A;  3K06 A;  3HR0 A;  3TCU A;  3BY6 A;  2EIL B;  3K0G A;  4WFF A;  2QTS A;  3EXA A;  3BA8 A;  4RUE A;  2UU9 O;  2XND G;  4KXR A;  4RAI A;  4I7Z B;  3CJH B;  3K5M A;  4DRX B;  4TWK A;  2Y0I A;  1H8H G;  5LYJ A;  5GTI Z;  2JJ1 G;  2XAH A;  1T5E A;  3BAB A;  2ZM6 B;  1M9N A;  2ADP A;  1IDS A;  4EB6 B;  4R7C A;  1WPX A;  2ZKO A;  3JAK A;  1K3E A;  2ZE7 A;  1Y67 A;  4NTY A;  4AI8 A;  4LBE C;  3JSN A;  1NTZ H;  4MVZ A;  1FXV A;  1XI1 A;  3N2G B;  1BS3 A;  3T2M A;  3CPW U;  3H9V A;  2VS0 A;  4UV8 A;  5JQG B;  3ZRS A;  1CXZ B;  3ZMT A;  4CZZ A;  1Y76 B;  5IJ9 B;  1FFX A;  1GN4 A;  4YJ3 B;  1VQK V;  4KHP O;  2N05 A;  1FJG B;  1B04 A;  5B1A C;  5F2V O;  4LF9 O;  1NS1 A;  2V1D A;  5IJ0 B;  2LGW A;  1B3Q A;  3J80 N;  1JOY A;  4X66 O;  5LOV B;  1YDX A;  2A79 B;  1NT2 B;  4O4H A;  4H13 B;  5CA3 A;  4I50 A;  5HFL A;  2X0L A;  4IL6 Z;  2R9I A;  3DSQ A;  1YSC A;  4JV5 B;  5KX5 B;  4E2L A;  4GX5 A;  3SPH A;  5E1A C;  3AG2 C;  3SYO A;  2EZO A;  4EFE A;  2VQE O;  1S72 V;  2IJI A;  5FLX N;  5LP6 C;  4MW3 A;  2HEP A;  5LMU B;  1WAZ A;  4GUN A;  5L3B A;  4AIL C;  3LDE A;  3ETE A;  4QGP A;  4LFA O;  1AJP A;  3RW0 A;  1GN2 A;  3H1L H;  3GWK C;  4JI2 O;  4PDL A;  5KUK A;  3E35 A;  3B09 A;  3LUT B;  1W59 A;  5L3F A;  2VQF B;  5JVD A;  4X64 O;  5EZY B;  4KUM A;  4Z1V A;  5LA6 B;  4OX9 B;  1FPO A;  1J5E B;  2KG7 A;  2WLL B;  1Y4M A;  1ARO P;  1XRE A;  4NXM O;  1K8A W;  3ABK C;  3FKS G;  1Q5O A;  4UCO A;  2DJV A;  3K3W A;  2CAZ C;  4G2K A;  1ZL8 B;  4IHJ B;  2WLM A;  2P4K A;  3ZHS A;  2LO1 A;  1OCO B;  2DYS C;  3J81 N;  3SYA A;  2QM8 A;  3T1H O;  1M93 A;  1QU7 A;  1XQ8 A;  4JI4 O;  1DLB A;  4MW8 A;  2YDE A;  2EIK C;  1ZAU A;  2X7R B;  3A0H Z;  1IBL B;  5B1A B;  4JI7 O;  3RVY A;  3ZHU A;  4X1K A;  4FPP A;  1K9M W;  4NYK A;  1J95 A;  3JD1 A;  2HFE C;  3G71 V;  1NVP B;  3RVZ A;  4CS3 A;  2XHB A;  4MVO A;  2WA4 A;  3OFN G;  2YC0 A;  4J7J A;  2CUG A;  2CH7 B;  4JI1 B;  1J5E O;  5KX5 A;  5CB4 B;  4DV2 O;  3B77 A;  1K34 A;  4U7N A;  4DR3 O;  3OM3 B;  3RYC B;  5GTH Z;  4BWA A;  4RO2 A;  3ABK B;  2ARH A;  4UCV A;  3BFR A;  3OTF A;  4CC5 A;  1HW7 A;  3HKC A;  3JCZ A;  5CA1 B;  4DV6 O;  3HKD A;  3OW2 U;  2D2C B;  2WA3 A;  4X8A A;  2JEX A;  1MOF A;  3L73 H;  4UB6 Z;  4FFB A;  5H2F Z;  1N4C A;  1MZF A;  5BR8 B;  2ZE8 A;  4H33 A;  1F7Y A;  1Y66 A;  5LGN A;  1RSO A;  1QHT A;  3B4S A;  3WB0 A;  1XMQ O;  1URF A;  2OCH A;  1P84 F;  3LSU A;  3BRC A;  4DR2 B;  5CMU A;  3VQW A;  1I0H A;  1K5S A;  4FM2 A;  4DR6 O;  1Q7Y W;  2QEX V;  4DV3 B;  1EN4 A;  3ETD A;  1YTF B;  1NQT A;  2ZDI A;  1FXK C;  3PJS K;  5DN6 G;  3T4D A;  4GKJ B;  2AXT Z;  3K03 A;  5LYJ B;  3SYC A;  4FFB B;  1PNM A;  2GV9 A;  1MMM A;  5LXT A;  1XUQ A;  3HKE B;  2AGA A;  1OV9 A;  2AHZ A;  2ODM A;  4NTW A;  5A9G A;  1P4R A;  2CE4 A;  3AG1 B;  3ASN B;  2F4V O;  4DR3 B;  1R6K A;  2B5U A;  2P06 A;  2GUZ A;  4JV5 O;  1BQ0 A;  2Y69 C;  2A06 H;  2LFS A;  3C3S A;  4J80 A;  5LP6 A;  3UO2 A;  4JI5 O;  4JI0 B;  4FVM A;  4JI6 O;  4UFZ A;  3TJT A;  1PKX A;  4FLY A;  1U97 A;  2YSU B;  4PD4 F;  4DV7 B;  3CXC U;  2L35 A;  3CRA A;  4P9O A;  4CS2 A;  4DK0 A;  1QLN A;  4X62 O;  5IY5 B;  3ABL B;  3JAL A;  1D5N A;  3CC2 V;  4MTG A;  2QGN A;  4HZ3 A;  4NKG B;  4TSF G;  2Y69 B;  1M5I A;  2CGN A;  2Y48 A;  2A0L A;  2X6C A;  5IT9 N;  3ASN C;  4I55 A;  5C8Y B;  4NR1 A;  2QWQ B;  5D5Q A;  4DR6 B;  4K3A A;  2HHH B;  1EFR G;  1AI5 A;  2ZCE A;  1YJ9 V;  2DOS A;  4ZI7 B;  2XTA A;  1OZ0 A;  2QDO A;  4DW1 A;  4TQD A;  4FZ0 A;  4ZKI A;  2AZ0 A;  2CTW A;  1BQZ A;  4KHP B;  2RCV A;  3SGI A;  1KD1 W;  3CRR A;  1RM1 B;  2GSM B;  1H2S B;  1M56 C;  2NNU A;  3VQV A;  1JVM A;  3ICX A;  2ADQ B;  3DC6 A;  3CCU V;  1SKV A;  1QVG U;  3AG3 C;  3AK2 A;  5IJ9 A;  1I5Y A;  1XL4 A;  2JS3 A;  2ZR3 A;  4ZOL B;  4IT5 A;  4LF4 B;  2H3O A;  2Q5Z A;  2UU9 B;  2F95 B;  4YXW G;  1H8E G;  2FB5 A;  5LHH A;  4LNU B;  1HNX O;  2G38 A;  5IYZ A;  3OE7 G;  1LUV A;  4I9Q A;  5BMV B;  2K9P A;  2E75 B;  3A0R A;  3IC9 A;  3QVN A;  2GHY A;  2LGQ A;  2Q7E A;  4LF6 O;  4QIW F;  5KA5 A;  4Q6G A;  4DR4 B;  4GKK B;  3WG7 B;  3I5D A;  1K4D C;  3D3I A;  3ZED A;  4EB6 A;  2YIA A;  1P7G A;  4JAV A;  3UT5 A;  5DM6 V;  4TUY B;  2ZR2 A;  3AEI A;  2CH7 A;  1SQG A;  4HNA B;  3SPC A;  1K97 A;  4PA6 A;  1N34 O;  2ZDI C;  1I94 O;  3RWR D;  2PYL A;  4G27 B;  1MG1 A;  4AHC A;  1OCO C;  3LDC A;  4NVP A;  1SES A;  4O4L A;  1KUQ A;  1V55 B;  1UFI A;  4JAU A;  1XIL A;  4YHH O;  3D8C A;  3IAY A;  1PL0 A;  2RQ6 A;  4U3J A;  2HHH O;  2KKW A;  1WA8 B;  2ATK C;  5LOV A;  2CTP A;  1SQQ H;  3RFR A;  4GX0 A;  2UUA B;  4J9Y B;  5EIB C;  3H01 A;  3QO5 A;  1IVS A;  3CRQ A;  2Z3Y A;  4DV0 B;  2XT9 A;  2YXY A;  1KC8 W;  2GTS A;  2E76 B;  1NH2 D;  2UUA O;  1NTK H;  1GRJ A;  1LNQ A;  1GN3 A;  2YIB A;  1N33 B;  5KMG A;  4DUZ O;  1VMG A;  1FS0 G;  5KHJ A;  1XMQ B;  2BTO A;  4DV7 O;  4GX1 A;  2B1G A;  2RJZ A;  3H1K H;  3T4Z A;  4LF5 B;  3L74 H;  2QR4 A;  4KL1 A;  2GUZ B;  1ZTE A;  5KHH A;  4TV9 B;  5BZB A;  4ZHQ A;  4K8Z A;  3CCQ V;  5L3D A;  3W7S A;  3AG3 B;  1PD3 A;  4QNH B;  3CSX A;  4FK5 C;  4LCU C;  1MNG A;  4W4K A;  2QE7 G;  2W0X A;  2OTL V;  2KB1 A;  4DR1 O;  4RQF A;  4FLT A;  2QWP B;  2H94 A;  2ZM6 O;  3M99 B;  3G80 A;  2YIB D;  1K5Q A;  1YTF D;  4JI8 O;  4I5S A;  4A5U B;  1ENV A;  3CCS V;  1O9G A;  1M4U A;  2V4D A;  1VQ9 V;  4F6R A;  1ZX3 A;  2CK3 G;  1SQV H;  1Q3E A;  3FB5 C;  1Q8I A;  4YY3 B;  3P32 A;  3CE2 A;  1RSO B;  4OPH A;  1IBM O;  2QTO A;  4DR5 B;  2QM4 A;  1X59 A;  2C2A A;  1FJG O;  5JWP A;  1IZ3 A;  4JI3 B;  3CB2 A;  3CC7 V;  1NZ6 A;  3BCC H;  3OMI B;  4DR7 O;  3OAA G;  2PY5 A;  4DUZ B;  3LNM B;  3ZMS A;  1BE3 H;  5EBL C;  3CCJ V;  1GK9 A;  4U3F H;  4JZG A;  1NVP D;  1DK1 A;  4ZI7 A;  1R3L C;  3T1C A;  2YI8 A;  3ABU A;  1BMF G;  2EJ7 A;  3EFF K;  2YUA A;  2EBO A;  2EX3 A;  1S0V A;  2UUB B;  1N32 O;  5D5P A;  2DYR B;  4DO2 A;  3HKD B;  2Q9L A;  3AG1 C;  4K35 A;  1VF5 B;  1NR1 A;  3UCS C;  1M56 B;  1N33 O;  4LF7 O;  3M8A A;  2R72 A;  1VQ6 V;  5LP6 B;  1OCC B;  1VIB A;  1Q81 W;  1FFX B;  5L3C A;  1S5J A;  2UUC O;  1HWY A;  2WLI A;  5LHG A;  1XEQ A;  2CTQ A;  3SDL A;  5FL7 G;  1B06 A;  5IYZ B;  1H38 A;  1VQN V;  1XOU A;  3SJC C;  3L71 H;  4YY3 O;  4OPA A;  2BOB C;  4TUY A;  4B7K A;  4DV4 O;  1RFY A;  2D3O W;  4J9Z B;  3JD3 A;  1IUR A;  3ZX6 A;  1KMI Z;  4PEL A;  1W0J G;  3VBB A;  1US6 A;  3MAQ A;  3CHX A;  2QSA A;  2RN9 A;  5TIS Z;  3BVO A;  1YIJ V;  3DXR A;  3R65 A;  4P2Z A;  4DUY B;  4K0K O;  2IBZ H;  3SYP A;  3ABL C;  3QO8 A;  3H1H H;  1H2L A;  2PF4 E;  4JPR A;  4ABM A;  4GKK O;  4D6T H;  4JI2 B;  2AHY A;  1EBO A;  4DR2 O;  2MW2 B;  1OCZ B;  4HYO A;  5LMN B;  3ZRW B;  1I08 A;  4BW9 A;  3ZCC A;  2NLJ C;  5DEC A;  2GBO A;  4PDV A;  1S5H C;  1BT8 A;  3F5W C;  4LFC O;  1IXM A;  4LWS A;  4JI3 O;  4P30 A;  4LF8 B;  2VWJ A;  2ZIN A;  4LFB O;  1BHB A;  2IH1 C;  4PI2 A;  4B3T B;  3OMN B;  4DR4 O;  2ZIM A;  3JAW B;  4HBN A;  1XBL A;  3A8T A;  1FXK B;  1AR1 B;  2EIL C;  1G4Y B;  3E8H A;  3FAV A;  1AIL A;  4WBN A;  1SET A;  1SZT A;  1F51 A;  3G6B A;  3H1J H;  3PN1 A;  4X20 B;  4ZIB A;  4JI8 B;  4QE9 A;  3L75 H;  2OT5 A;  4TT3 G;  3B40 A;  3AG4 B;  3LSS A;  1WPB A;  4O2A A;  4B3S B;  1SQX H;  1R3J C;  3J7A U;  3RYH B;  4UVB A;  3CCR V;  1VQM V;  3ZRW A;  2F43 G;  4F6R B;  2WLL A;  3VQX A;  2XAG A;  5IYB O;  2Q4P A;  1Y76 A;  5B1B C;  2Q6A A;  3W7T A;  1WJZ A;  2WAM A;  3QG5 A;  4UCU A;  2IJH A;  4X9Q A;  2UXC O;  2FML A;  1YF2 A;  3L70 H;  1BCC H;  2P4V A;  4L87 A;  3X2Q B;  4N23 A;  2DE0 X;  2N04 A;  5KA6 A;  2Z5U A;  4RUF A;  4ASU G;  4RWU A;  1S3J A;  1OJH A;  3C90 A;  1YZB A;  2JIZ G;  3EVK A;  4LF9 B;  2YIC A;  1BL8 A;  2Q73 A;  3DC5 A;  1WP7 A;  4Z2W A;  5AG2 A;  4X88 A;  1ORQ C;  4X1Y B;  3K08 A;  5L3E A;  4MSW C;  2P7T C;  4JZ2 A;  3T1Y O;  2JEU A;  2Q67 A;  1QVF U;  5LHI A;  1YJW V;  2KG7 B;  2DYR C;  1HNW B;  3IGA C;  4UVC A;  1AJN A;  1N32 B;  4IYI A;  1HNZ B;  1K33 A;  2WSS G;  1AR4 A;  2PGG A;  4FLZ A;  2ZE6 A;  2HR3 A;  2QWO B;  2L6L A;  1QR9 A;  4UCS A;  1NH2 B;  3WB2 A;  4J10 A;  4NXN O;  3OGI B;  3D36 C;  2QKC A;  1S77 D;  3FD9 A;  3K9S A;  5KAF Z;  1WA8 A;  3ML0 A;  2F23 A;  1VQL V;  3JAW A;  3ZHQ A;  4AQY B;  2DWE C;  1MSD A;  2ZIO A;  3RT3 C;  2ZNI A;  2VRZ A;  1Q86 W;  2P67 A;  2NR5 A;  4TOI A;  4I50 B;  3N2K A;  5B66 Z;  1Y74 A;  1JR9 A;  5CA0 B;  1HR0 B;  3SYQ A;  5J9P C;  3SPJ A;  1FAF A;  4JYB A;  1WB7 A;  2EJR A;  4FFK A;  3ASO C;  1IX9 A;  2FL4 A;  4PDM A;  1AR5 A;  1VF7 A;  2Y0P A;  1JPX A;  1H2G A;  2OIG A;  4JYY A;  2OCC B;  1LUW A;  3OR6 C;  5DED A;  2QM7 A;  2HJD A;  3P3P A;  3CCL V;  3AK1 A;  1VQ7 V;  4W4L A;  3U0Z A;  3BHP A;  4DV0 O;  3E8B A;  4LWS B;  1VQ4 V;  1SA0 A;  2B1I A;  2ZXW B;  3DGE A;  4GCZ A;  3N2K B;  4DV3 O;  5B1O A;  1E1Q G;  1V54 B;  3JAK B;  3APO A;  4JTC B;  1XNQ B;  3F7Y C;  2WPD G;  1BHA A;  2PUS A;  3HKB A;  2EIM C;  1COW G;  3ZMU A;  5B1N A;  3ASO B;  1B6Q A;  4FLW A;  5EYP A;  3D36 A;  3MDS A;  4E4E A;  1ZSP A;  3CRC A;  3LSQ A;  3WB1 A;  4TV8 A;  2W0F C;  4LFA B;  4NTX A;  4LF8 O;  1PL4 A;  1GM8 A;  4GYC B;  4G28 B;  1BZK A;  1Z5W A;  1EM1 A;  2NN4 A;  3L72 H;  4O4H B;  1TGO A;  3GB7 C;  2DW4 A;  2Q7H A;  3SJB C;  4X89 A;  3B8M A;  4FLX A;  1U96 A;  2CGO A;  1N34 B;  5KHI A;  3E2E A;  5BY1 A;  1PNL A;  1OCZ C;  1TVK B;  4MTF A;  5KAI Z;  1IBM B;  5LGT A;  1IBK B;  2OWO A;  3QTC A;  4B3M B;  1KU9 A;  3RYH A;  3A0B Z;  4B3R B;  1WNS A;  4JAS A;  3OT7 A;  1F4N A;  1QLE B;  2YI9 A;  4IIJ A;  2LQT A;  5BMV A;  4F6E A;  2V7Q G;  2Q0A A;  3SR2 C;  3K04 A;  1LR1 A;  4X66 B;  3ABM B;  2YXH A;  3E8G A;  4UV9 A;  2WWW A;  1DF4 A;  1QCE A;  1CP9 A;  5JVD B;  4JYC A;  1N8R W;  3THO A;  3I55 V;  1GMG A;  1RPO A;  1MA1 A;  5IE9 A;  3HPL C;  5HFM A;  4PDR A;  1R1B A;  5EC2 C;  3JAS B;  2E5L B;  1V9P A;  1HR0 O;  4R8C A;  1TAE A;  1E79 G;  2RMK B;  2JK5 C;  4I55 B;  4MVR A;  5C8Y A;  3U11 A;  2QWR B;  1L1F A;  4IHJ A;  3OEH G;  4B7E A;  3STL C;  3K79 A;  1PV0 A;  1KQS U;  3JAT A;  2Q68 A;  2DN9 A;  3RYF A;  3LDD A;  2IJK A;  5K1P A;  4FM1 A;  4DV4 B;  3E83 A;  4D7T A;  1R3K C;  4DV2 B;  2IU0 A;  1BGY H;  4OXS A;  4QPK A;  2AZ2 A;  5C93 A;  3CJH A;  3ZHV A;  3K5O A;  5H9C A;  4O4I A;  1N0N A;  4JI7 B;  4QJF B;  1QQC A;  4UVA A;  3TK1 A;  4K8X A;  3FX7 A;  3JYC A;  2XAJ A;  1WN7 A;  3ZN0 A;  2Z0A A;  3WFV A;  3CCE V;  5LA6 A;  1EZJ A;  5FNV A;  4WCE V;  2BCC H;  5GW7 A;  1AI7 A;  3ZMZ A;  4WF9 V;  2XUM A;  3CMA V;  1VP7 A;  1N36 B;  4YIO A;  3UKM A;  1F4M A;  3E22 A;  4WFA V;  1HP8 A;  4OGQ B;  5H6R A;  3FB8 C;  4ZHQ B;  4GLX A;  3CX5 F;  2QA4 V;  3N27 A;  5B3S B;  2R9R B;  2WLH A;  1FYJ A;  3OMA B;  4O2B A;  4XDL A;  1GTO A;  5B5E Z;  4O2A B;  3STZ C;  2OIE A;  2UUB O;  4FLU A;  2XAS A;  3CYO A;  1R3I C;  4DK1 A;  4DR5 O;  1RM1 C;  1DGS A;  3F5T A;  5H6Q A;  1XDC A;  4X65 B;  3E22 B;  1FKA O;  1JJO A;  4WFG A;  1EZV H;  4XBF A;  3RBZ A;  2E5L O;  1AP5 A;  1GO3 F;  1Y6X A;  5J2T B;  4DR7 B;  4J41 A;  4H37 A;  3M7M X;  5JH7 A;  2ZNJ A;  1ZWI C;  2WLJ A;  2PTM A;  2JGU A;  1NI8 A;  2A7W A;  4FM0 A;  2ZE5 A;  1YJN V;  3KCX A;  5J2U B;  1L0L H;  4CH6 A;  3K5L A;  1PM9 A;  3OR7 C;  2EIJ C;  1XNQ O;  1SRY A;  4UB8 Z;  3S3X A;  1W2B U;  1KP3 A;  1VAR A;  1SQF A;  4FJC C;  2YEV A;  1JFF A;  4UCR A;  3CP1 A;  4CBC A;  4DV5 B;  3JAL B;  2FYU H;  1ZUQ A;  1P7B A;  4B3R O;  1Z5V A;  1JX9 A;  1K4C C;  2LJ2 A;  4FMT A;  5JCO A;  4BIO A;  1OCC C;  2ETN A;  3DXR B;  3VOU A;  4YJ2 B;  3D3Q A;  4PA4 A;  4DXW A;  1QR8 A;  2ILM A;  2DYS B;  3A2F A;  3IC7 A;  2IH3 C;  1EN5 A;  2DWD C;  2FTK A;  4PHZ A;  1PPJ H;  1E1R G;  2QJ1 A;  1WB8 A;  5CBH A;  3ZBH A;  4X65 O;  1GM7 A;  2EIK B;  4LF6 B;  1A32 A;  1SS3 A;  4F4L A;  2IM9 A;  5IJ0 A;  1TUB B;  3K57 A;  4O4J A;  4LP8 A;  4X64 B;  1KYO F;  1H2M A;  2P22 C;  1JMK C;  3B8N A;  4P9P A;  1ROP A;  4IYH A;  3X2Q C;  3OUS A;  2HLD G;  2GTA A;  5J2T A;  1NTM H;  3GVM A;  2YID A;  3BA9 A;  2P6J A;  4DW0 A;  1RPR A;  1FXK A;  4O2B B;  1JJ2 U;  1I94 B;  4TQF A;  1CEZ A;  4GT1 A;  4WBN B;  1Q6U A;  1GN6 A;  1AP6 A;  1NBM G;  5IWA B;  2F66 C;  2Q0O C;  2EIN C;  2B9Z A;  2DQ0 A;  1M1K W;  4DRX A;  2OCC C;  2YEV B;  2Q69 A;  3S3W A;  2UXD B;  5JJN B;  1XMO O;  1O9H A;  1VQP V;  3FB7 C;  1Z2G A;  4X1K B;  5JCO C;  2E3C A;  4LH6 A;  4QE7 A;  3JAM N;  4MVM A;  2PYJ A;  3RN4 A;  2HVK C;  3DTU B;  1XNR O;  3CWB H;  3N2G A;  4O4I B;  3G67 A;  4PA3 A;  5FPO A;  3ZHT A;  4PA7 A;  5LXT B;  3HKE A;  2UUC B;  3ZHR A;  3RYI A;  3BPZ A;  4JI5 B;  4JI0 O;  4LF7 B;  2JVD A;  1I5X A;  4CH5 A;  2P90 A;  3FFQ A;  1TUE B;  2ITC C;  1AB3 A;  5IY5 C;  4DR1 B;  3ZRX A;  1KKD A;  2LFR A;  1GAX A;  1SER A;  4X1I A;  2QKA A;  2HP8 A;  2A9H A;  1KBH A;  4PJ0 Z;  2UXB O;  5CBF A;  3ZJZ A;  3ETQ A;  1N0J A;  2JDI G;  3TXS A;  4GKJ O;  3UQ8 A;  3JD4 A;  3TXQ A;  1V55 C;  4CC6 A;  2BTQ A;  5EK0 A;  4N21 A;  4MVQ A;  1GH6 A;  2EIJ B;  5CA1 A;  4KP4 A;  3OUF A;  4CH3 A;  4JYA B;  5EC1 C;  3Q4H B;  5EBW C;  1S5L Z;  3MHH C;  3UM7 A;  4J7K A;  5KUM A;  4X20 A;  4JYA O;  1AJQ A;  3KG2 A;  2PI4 A;  2JGD B;  4YJ3 A;  4B3T O;  1IBK O;  1PNK A;  4CS4 A;  3CD6 V;  3G6E V;  1PP9 H;  1AI4 A;  2IW5 A;  3CME V;  1W0K G;  4U3J B;  2H8P C;  3WG7 C;  2Y4U A;  4MS2 A;  3JAR A;  3RGB A;  4B3M O;  2W6J G;  2F1M A;  5L3G A;  5IYC O;  4JI6 B;  2XAF A;  1Q6H A;  1NU1 H;  5CB4 A;  4MVU A;  1RP3 B;  4EKW A;  3G4S V;  2GDS A;  3Q4H A;  2AW9 A;  2WLN A;  3ZN1 A;  5CBG A;  1ZL8 A;  1EN6 A;  1D5A A;  1JFF B;  2JJ2 G;  1KP2 A;  4I9W A;  5B3S C;  3W7W A;  4J42 A;  3WU2 Z;  1QBZ A;  4X62 B;  1TA8 A;  1YCI A;  3E8F A;  4FIP C;  5LGU A;  3QO7 A;  1F23 A;  5LBQ A;  2X6B A;  3CC4 V;  4TV9 A;  3OD4 A;  2M6Y A;  4PI0 A;  1SF9 A;  5GON A;  1XMO B;  3KCY A;  4X1Y A;  5KHG A; 
#chains in the Genus database with same CATH homology
 1L0L H;  1NTM H;  1PP9 H;  3CWB H;  1BGY H;  3H1H H;  5KLV H;  1BE3 H;  3TGU H;  2BCC H;  3L71 H;  3H1L H;  4U3F H;  3H1J H;  1EZV H;  1SQQ H;  3H1K H;  1P84 F;  3CXH F;  1SQB H;  3L75 H;  3L74 H;  4PD4 F;  4D6T H;  1NTZ H;  3H1I H;  1SQP H;  1KYO F;  3L72 H;  1NU1 H;  3L73 H;  2A06 H;  2FYU H;  1PPJ H;  1SQV H;  3CX5 F;  3L70 H;  3BCC H;  1L0N H;  1NTK H;  1SQX H;  1BCC H;  2IBZ H;  1KB9 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...