1P84F

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
74
structure length
74
Chain Sequence
VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 27
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1p84F00
1PP9H 3L71H 4D6TH 1SQVH 2FYUH 3L72H 1BE3H 1L0LH 1BCCH 4PD4F 1EZVH 1NTKH 5KLVH 3L70H 1BGYH 3H1LH 1KB9F 3TGUH 4U3FH 3CWBH 3H1KH 1L0NH 3L75H 1NTMH 1SQQH 2A06H 3CXHF 3H1IH 2BCCH 3BCCH 3CX5F 1SQBH 3H1HH 1NU1H 1NTZH 2IBZH 1KYOF 3L74H 1P84F 1PPJH 1SQPH 3H1JH 1SQXH 3L73H
chains in the Genus database with same CATH superfamily
4FLZA 4B7KA 5LP6B 2UUAB 2UUAO 1XDCA 5JQGB 1JOYA 1A32A 1QHTA 4LF5B 4LF5O 1G8MA 1L0NH 2F23A 2Q9LA 1IXBA 1AILA 4OXSA 4W4LA 3ZHTA 3E8HA 5LL6Y 4X64B 1SQXH 4X64O 3FYIB 1YHQV 1WPBA 2Q0OC 4CH3A 1AI5A 1G1XB 5DEDA 2NNUA 4GCZA 2OYQA 1B06A 2LW7A 3K5NA 5B1NA 2HFEC 1F7YA 5KHHA 1M56C 2EJRA 4JTDB 4FM1A 1PNMA 4FPPA 5J2UB 4DR6B 1F4MA 1SRYA 1I5YA 3K5OA 1XREA 3M7MX 4LFBB 4LFBO 4FLXA 2BTQA 3R66A 1K5QA 1O9HA 1SQVH 1BE3H 2BOBC 2VQEB 4KP4A 1KP2A 2GHYA 2ZE7A 4LP8A 1H2NA 3RVZA 3H1IH 4HNAA 5LYJB 3DGEA 2X6BA 3L74H 4ZIBA 1VQ6V 1VQKV 5LGUA 4I0XB 4JI3B 4JI3O 3OW2U 2QSAA 4R7CA 2YEVB 2OCHA 1GO3F 2Y48A 4KHPO 5EBWC 2A06H 1KBHA 1LR1A 2KG7A 3OMNB 3STLC 2XAFA 1M4UA 2Y69B 5K1XA 1YTFB 3ZHVA 1YJNV 4DRXB 4DYLA 3RFRA 4PDLA 3WU2Z 3RVYA 3BHPA 2JEXA 1S5JA 1VF6C 4KFMA 4J7KA 4P30A 4LH7A 3K5MA 2GBOA 3CXHF 1MG1A 2P67A 4NXNB 4YIOA 2DYSC 3K04A 1Q6UA 4O4IA 1QCEA 2Q7HA 3SJQC 5TISZ 5KHGA 5D5QA 1TAEA 1F51A 3CS5A 4LCUC 4UV9A 4FLTA 4MTFA 2IJIA 5LGTA 4TV8B 3BA9A 1FXKB 3A0BZ 2PZSA 1IXMA 1Q5OA 3TJTA 1XILA 1QR8A 3GWKC 3AG4B 1VIBA 2Q7GA 5LA6B 4PI0A 1KC8W 4GKKB 3B8MA 4JTCB 4UCOA 4FM2A 4BIOA 3CRCA 3NR7A 4PA3A 4BIUA 4BW9A 5J2TA 1YJ9V 3U0ZA 1AVMA 3MAQA 3IC9A 2ZINA 1VQ4V 3H9VA 3NXSA 2Q0AA 2R70A 1B6QA 1OHHG 4OPHA 2DYRC 2WLHA 3FKSG 4FJCC 3LDDA 5LOVA 3HKEB 4X1IA 4O4JB 2A9HA 2DQ0A 4F6EA 2RCVA 2X6CA 5IY5B 4GX1A 5GTHZ 3L71H 3ZHSA 2JGDB 5JH7A 4JI7O 1SQGA 1MZFA 1NT2B 1AROP 1PD3A 4LFAB 2RQ6A 4PHZA 1GRJA 2ZDIA 1JPXA 2WSSG 3SPCA 1W0JG 1KUQA 2B1IA 1HNXB 5KAIZ 1M57B 1Q90D 3AG7A 2HP8A 4DV1B 3KCXA 3IGAC 3M8AA 1JFFA 4JTAB 4N23A 1X59A 5KA6A 2CH7A 2IW5A 1XHZA 5H9CA 5EC1C 1EZVH 4B3SB 2ZKOA 2OT5A 4B3SO 1PL0A 2Y69C 4CH4A 5E79Z 3UM7A 3H1KH 2XNDG 3FAVA 1K7DA 4X1KA 5B3SC 2LW1A 2PY5A 2EZPA 1I0HA 2EULA 2IBZH 5LXTA 3CRQA 1ZAUA 5KHJA 1QU7A 1MZEA 1FFTB 5JCOA 1WA8B 2Z5UA 3FB7C 5KX5A 2R9RB 1GM7A 4PA4A 3JD1A 4TQFA 2X0LA 1XOUA 1K34A 2XTAA 4U7OA 5CBHA 4HAMA 1HR0O 1ZTEA 3N2GB 1IURA 3P32A 5AG2A 3CRMA 1NS1A 1FXKC 3ABUA 2F93B 2ZD9A 5FLXN 2XASA 5IJ0B 5CB4B 4JAVA 5CA1A 4OGQB 1YEWA 3JD4A 2ZT9B 4JPRA 1DF5A 2ADQB 1KU9A 4LWSB 4WFEA 3CC4V 5KMGA 1IBLO 2VWKA 1RM1B 2OCCC 1IVSA 1H8HG 2JVDA 4DR3B 3TXSA 3ZS8C 4DR3O 1XNRB 2V4DA 1XNRO 4DR7B 4PELA 3DC5A 4F6RA 5L3EA 2WLKA 2ZIOA 1N4CA 3FB5C 2R72A 3ZCCA 2JJ2G 1GK9A 3R65A 4LF4B 3IAYA 1XHXA 4LF4O 2P06A 2R9AA 3RYFA 4TV9A 1PKXA 2QWQB 1BL8A 3CEIA 4O2AB 3ZRSA 3JARA 3JATA 1Q81W 2KKWA 3G80A 3K79A 4PDRA 1R73A 4JAUA 4GUNA 3SYCA 4Q20A 4LF7B 2JGUA 3ZIAG 2AW9A 4LF7O 1LUVA 1NVPD 4UXNA 2DMXA 4G28B 2QWOB 3E8FA 5B1AB 4X8AA 2OTLV 1AI6A 4K35A 1NR1A 1ZUQA 4FZ0A 1GH6A 1MOFA 3SJCC 2JS5A 1SKVA 4IGGA 1FAFA 2QM7A 3MD0A 4B3TO 5BXZA 4FLWA 4LF8O 3OR6C 3SYPA 2WA3A 4NTWA 4IIJB 2GTAA 1Z5WA 2IM9A 1WB7A 1TVKB 4D7SA 2QGNA 2N05A 1GN3A 5LHIA 4HZ3A 3JAKA 5JCOC 3RYCB 2HHHB 2HHHO 3QO7A 5EYPB 3THOA 3MDSA 4WBNA 3JASA 1BHBA 3WB1A 2DWDC 1W59A 1YI2V 1L8DA 1FFXA 4JI2B 1S5HC 4JI2O 2E3CA 3CCEV 1N33B 3QO5A 4GYCB 2VQFB 2GTSA 3E89A 2VQFO 1XMOB 1XMOO 5GONB 4GKJB 4O4LB 1B3QA 4XDLA 4YXWG 2PYJA 3F7VC 4PA9A 3RWRD 4OX9O 1ZLZA 2VWJA 4LH6A 1US6A 2WWWA 1GKFA 4N21A 4H44B 4J41A 5E1AC 2EINC 3C90A 2F4VB 2FYUH 3BPZA 4X66B 4X66O 4MVOA 1JVMA 1P49A 1VARA 2IH3C 2RNBA 1VQLV 4IHJB 1QLNA 4O4HB 3GWOA 4DV4B 1H2MA 1VF7A 3GVMA 4DV4O 4AQYB 4FMTA 5KUMA 4AQYO 2ZQMA 2LGQA 2QWPB 4FFKA 1NH2B 1N8RW 1VMGA 5LMNB 1S76D 3K58A 1PNLA 1E79G 1EBOA 2P7TC 4Q6GA 3BA8A 4U3JB 1QNMA 2UUBB 2YIBD 3OUFA 3EVKA 5B1BC 1WPXA 2PI4A 2UUCO 2YIAA 1EFRG 2DE0X 4UCSA 2P5OA 2E76B 2ZM6B 1UJWB 5IE9A 1KQSU 2JK5C 3CPWU 4UVCA 3AG2B 4IL6Z 3CCVV 3K0GA 3DXRA 5GTIZ 1YITV 5B1AC 5BR8B 4MS2A 2WLIB 1E1QG 5L3GA 4GX0A 3JAMN 1AB3A 3T4ZA 4B7EA 1VF6A 5LHHA 5BY1A 3LNNA 3G4SV 1OCZB 1XEQA 3T1HB 3T1HO 1FXHA 3K59A 5JJNB 1IBKB 2IU3A 4NVPA 1AJNA 4TUYA 1MSDA 4AHCA 5L3CA 3E22A 2P6JA 1G4YB 2WLLB 4JZ2A 3G67A 3H1JH 1ZX3A 5EBMC 4P2ZA 3OTFA 2EIJC 1YF2A 5FNVB 3P3PA 2Z3YA 2WLMA 1QBZA 1WJZA 1EN4A 5L3FA 4CS3A 2X6AA 2QJ1A 4JYAO 5CA0B 5C8YA 4DR1B 3I56V 2R9IA 4DR1O 1VQOV 1JMKC 1FJGO 4LC1A 4O2BA 4ASUG 3ZRXA 4ICGA 2UU9B 2UU9O 3F5TA 3TK1A 1BHAA 2E75B 3UT5A 5CBFA 4DR4B 4JI4O 4DR4O 3QVNA 2HJFC 2PI5A 2CTRA 3BCCH 3VBBA 3CXCU 4GX5A 4GZRB 2UXCB 2UXCO 5J2UA 3RN4A 1Y6XA 2BSKA 2Y4TA 1SA0B 3L73H 4QPKA 2YI9A 1Q82W 2CAZC 3SYQA 2ZR3A 1KKCA 2ETNA 1VQPV 2ZNJA 2A7WA 3QF7A 1VQMV 4BWAA 4YIPA 3B8NA 1H2GA 4EFBA 1TA8A 1NU1H 1NTZH 1KMIZ 2W0FC 3J7AU 3OD4A 3A0HZ 4JV5B 2H94A 2BTQB 4UVAA 4JV5O 3WG7B 3JSLA 4EB6B 1L0LH 4GLXA 2QWRB 2ZE6A 1EN6A 4KHPB 2HLDG 1FKAO 3FB6C 4HNAB 1SC5B 1IBMO 1LNQA 1DK1A 5JVDA 2IJJA 3OT7A 5CMUA 4UV8A 1RP3B 3H01A 4I9QA 3K06A 2FMLA 1AP6A 1TGOA 2DN9A 3ABLC 4NTYA 1N34O 3VQXA 4FLUA 1OCZC 1N36B 3OTOO 1N36O 2NR5A 3ZEDA 1MA1A 4ABMA 3ZJZA 1SQPH 3QNEA 5JWPA 3OAAG 2QKAA 3IJ4A 3C3SA 3AG3B 2ATKC 2HKOA 2RMKB 3ASNC 3D8CA 1GN2A 2YIBA 2EIMB 1CPYA 5LP6C 3RYIB 3LUTB 2ADPA 2Q7EA 2QEXV 4I4TB 2K9PA 2OIGA 3ZMUA 3ML0A 1K8AW 1JX9A 1OCRB 5KHIA 1FXKA 4NB5A 4O4IB 4TSFG 4JI8O 1HW7A 1QLEB 4RO2A 5CA3A 1VEWA 3AK1A 1V55B 2Q68A 3ABKB 4X1YB 5DN6G 3L70H 3LDCA 1Q6IA 5B66Z 3L75H 4EKWA 1Y74A 2O57A 2BTOA 2F95B 4QGPA 5EC2C 3E2EA 3IFXA 2DW4A 2VRZA 2W6JG 3DSQA 3CRAA 4KUMA 4XBFA 4LF6B 1BMFG 4LF6O 3OE7G 3HKCA 4EFEA 3JCUZ 3CSXA 4YJ3A 1I08A 3PJSK 2Y4UA 1M1KW 3ZMTA 3BAAA 1SQFA 3D36C 1M93A 1SZTA 3CJHB 2E5LO 4X62O 2BOCC 2NLJC 3JSNA 4O4JA 2JJ1G 3DTUB 1D2DA 4X20B 3SDLA 2HVKC 3OGCC 1VQ5V 4JI0B 2JGDA 4JI0O 4JI7B 4X65O 2WLNA 1NJIW 1KB9F 4LNUA 4MTOA 1XL4A 3WG7C 2Q67A 1NVPB 4DK0A 1HWYA 2V1DA 1R6KA 1VQ9V 1Q6HA 3CCQV 3BABA 5JH7B 1GN4A 3G71V 2YIDA 3K0DA 1XI1A 5H5NA 5K1PA 3W7XA 3M99B 2ZCEA 2GSMB 1PM9A 4K8XA 1Y76A 3X2QB 2ZXWB 3CX5F 1DTOA 1SQBH 1FXVA 2WAMA 2CUGA 1P84F 1UPGA 1BS3A 4CZZA 1ZL8B 1BT8A 4CH6A 2UXBO 2CTPA 1XQ8A 2Y0IA 3P30A 2LFSA 1R6TA 2CH7B 1WA8A 3LNMB 1KP3A 3HKBA 3A2FA 1NKDA 1D5NA 4W4KA 4E2LA 4C7UA 4DV7O 2YSUB 5IYDO 1YSCA 4DO2A 2NN4A 1TUEB 5BZBA 3CB2A 3SPGA 1L1FA 5FPRA 1HR0B 1XMQB 4GX2A 1XMQO 3N2GA 5KX5B 1H8EG 2IJHA 1EZJA 3TXQA 4WFAV 1OCRC 1VP7A 1W2BU 2OTJV 5D5PA 4DUYO 2UXDO 3BFRA 3AG4C 5IJ0A 1FYJA 5A9GA 4J9ZB 3ASOB 3HPLC 2JRIA 1CP9A 4FM0A 1S3JA 2HR3A 1TUBB 5J9PC 3STZC 3ZN0A 1IBLB 3OFNG 3VQVA 3ZBHA 5BMVB 1S0VA 3ZHRA 1HNWB 1K92A 1HNWO 2Q5ZA 5LMUB 1S72V 3N27A 1Q7YW 5LMUO 2HEPA 3D3IA 5LHGA 2IH1C 4WFGA 4UCTA 4LF9O 1V54B 3G6EV 4K8ZA 2RJZA 2QA4V 3OUSA 1PL4A 5ITZB 3QO8A 4RWUA 3RW0A 4MSWC 2IJKA 5IY5C 1DF4A 1OZ0A 3JYCA 4I50A 3JD0A 4FFBB 1Z5VA 4LFCB 4LFCO 2DJVA 4BAYA 2CGOA 1M57C 2Q6AA 4B3MO 4BW5A 3ZMZA 1SF9A 3RBZA 3N2KA 5EZYA 3J80N 3ICXA 2WA4A 4DR5B 4B3TB 4DR2B 4DR5O 2K1EA 4DR2O 1RPOA 3ABMB 4LF8B 1K4DC 1GM8A 4DUZB 4DUZO 3JAWA 2LFRA 3Q4HB 2JS3A 4IIJA 3VQWA 3ETQA 4ZI7B 1QR9A 4DV2O 1I7FA 3EXAA 4MTGA 2HG5C 3OEEG 3WB0A 3K08A 4NTXA 2JEUA 2KB1A 3RYCA 4YJ2B 4B08A 3O65A 2WPDG 4R50A 4J42A 3HKDA 2ODMA 2GV9A 3AK2A 1F23A 1M5IA 1XL6A 2EILB 2JDIG 4I9WA 1OV9A 4DK1A 4FLVA 5B1OA 3AG1B 4UVBA 3QG5A 4PA6A 4OPAA 4O4LA 2X7RB 4UFZA 4ZOLA 4E4EA 4KXRA 2ZE5A 1G6UA 2L35A 4UB6Z 4H0LB 3APQA 4MVUA 4OX9B 5IYZB 3RYHA 1H2SB 3EFFK 5KAFZ 1U96A 2YS8A 3OGIB 1RFYA 2YXYA 1YTFD 3JALA 1DLBA 1CEZA 1Q43A 3UO3A 2CDYA 4UB8Z 1RSOB 1WNSA 1VF5B 2FL4A 1WP8A 1RM1C 5GW7A 4IHJA 4FZ1A 3K3WA 3BRCA 3F5WC 4RQEA 2YUAA 1M56B 1NI8A 2ZE8A 3SYAA 2EZOA 1HNZO 1AP5A 3U10A 2GUZA 3UCSC 4F4LA 1Q86W 4B3RO 1Y67A 2UUCB 1AR5A 4CBCA 5LGNA 1URFA 4MVZA 2ZIMA 3CCUV 4JI6B 4JI6O 3CP1A 2WLIA 1WAZA 1WB8A 3VQYA 4WFHA 4RAIA 3B4SA 4UCUA 1R6NA 5IJ9A 1V9PA 2MW2B 2QTSA 4MW3A 4I55A 3FX7A 4ZHQB 2W0XA 1AI4A 5L3DA 2QWNB 1O9GA 3E35A 3LDEA 3ZRWB 2FTKA 4AILC 1Q3EA 4EEQA 4X88A 4NXMO 5LP6A 2DYSB 4QIWF 2QKSA 5JQGA 1NTKH 1K9MW 4JI5B 4JI5O 3ZMVA 3CYOA 4R8CA 4Z2WA 3AG1C 3SJBC 4JYAB 4TUYB 4PI2A 3CHXA 4FVMA 1FJGB 2YC0A 4H37A 2M7WA 4I5SA 4Z1VA 1JR9A 3SPHA 2Q69A 4RUEA 5H2FZ 3W7WA 3SJAC 2YI8A 4JI4B 2PTMA 4K0KB 5C8YB 1SETA 4K0KO 1YCIA 2W6IG 1QVFU 3APOA 5IWAB 5IWAO 1FD9A 3MHSC 4QPJA 4ZBMA 1CXZB 4O2BB 3GB7C 2EX3A 1SA0A 2XAJA 5FL7G 3KCYA 3CRRA 3D36A 4U7NA 3SYOA 1PNKA 3K9AA 1FS0G 3LSQA 2A3QA 3UT5B 2XAQA 2QR4A 3HB3B 3KZIZ 3S3WA 2YXLA 4Z1MG 1P4RA 1P7BA 3ABTA 1YDXA 1K73W 2BSKB 3CCRV 4DR6O 1YJWV 5LYJA 2DYRB 4MVRA 4DV3B 4DV3O 5IT9N 4I0XA 1S5LZ 2GDSA 3OEHG 4EB6A 2YEVA 2VQEO 2WLJA 1WP7A 1R3KC 2PF4E 4RUFA 2RDCA 4RQFA 2BCCH 3AG2C 1IBMB 4DW0A 1IX9A 2YDEA 4WFBV 2AZ0A 2FKXA 3K5LA 4MVQA 1HDJA 3CCJV 5KUKA 4DRXA 1W0KG 4JYBA 1YXBA 3WB2A 1GTOA 1BCCH 2F66C 3W7UA 5KLVH 1S77D 1T5EA 2QM8A 2V7QG 4PA7A 1N34B 3S3XA 4UCVA 3OTOB 3CCMV 4TQDA 3CMAV 2KG7B 4H33A 5JVDB 2H8PC 3AEIA 1U97A 3B2EE 2OIEA 4YY3B 4KL1A 4YY3O 5B3SB 2C2AA 3PN1A 2QM4A 3I5DA 4NKGB 4JASA 4PV1B 5C93A 1IZ3A 3RYIA 4NXNO 4WF9V 4I4TA 4TV8A 2LJ2A 1E1RG 1J5EB 2XT9A 3FD9A 1PPJH 1J5EO 4JI8B 5HFMA 1H38A 1THZA 3CD6V 4BR6A 1OJHA 1HP8A 4XDKA 4DV6B 4X1YA 5H6RA 4DV6O 4K3AA 5LA6A 3H1LH 1PV0A 3ETGA 2D2CB 4JYYA 3UKMA 2AXTZ 2A79B 2E74B 4IT5A 3AK3A 4JYCA 2HJDA 2Y0PA 4L8JA 1BQ0A 2FB5A 5DECA 3A0RA 1KECA 3T1CA 2XOKG 2Q4PA 1JQ0A 3G6BA 4J11A 2QE7G 2Q73A 4GKKO 4ZKIA 1Y74B 1JJ2U 5B5EZ 1DGSA 3CJHA 3HKEA 2OCCB 2E5LB 4X62B 5J2TB 2QDOA 3H1HH 2P90A 2QTOA 4TWKA 4X9QA 2XAHA 1GAXA 2L6LA 4DV5B 1UFIA 4X20A 2ZNIA 4DV5O 3HKCB 1AJQA 1NBMG 1SESA 2EIKB 4UUJC 4YJ3B 3T4DA 2RN9A 4X65B 1EN5A 1XNQB 5H6QA 1XNQO 1ENVA 1FPOA 5JJEB 2UXNA 4FLYA 5LOVB 1NTMH 1I5XA 2HVJC 2H3OA 5L3BA 3FB8C 4X1IB 4CH5A 1M9NA 2M6YA 1KKDA 3UQ8A 4XDJA 2EJ7A 4YHHB 3ZMSA 3KG2A 4YHHO 3K9SA 4WFFA 1Y4MA 3FYEB 3CE2A 2DOSA 1J95A 1K4CC 1K5SA 4LFAO 4LNUB 3KKYA 1SZXA 1XUQA 1HNXO 5KA5A 4TT3G 4QNHB 1AR4A 1X4TA 2VS0A 4DV1O 1ZL8A 2UXBB 1K33A 1JFFB 3O9OA 2G38A 2ARHA 4U3FH 3FAVB 4DV7B 2LP7A 4X1KB 2XHBA 1Y76B 4WCEV 1NH2D 3AG3C 1ORQC 1H2KA 4JF3A 1BSMA 1WLEA 1H2LA 2JIZG 5LXTB 2EIMC 1QQCA 3E83A 1NZ6A 4A5UB 3T1YB 3T1YO 3HKBB 1NR7A 5IYBO 1YVWA 2CK3G 1R1BA 2XAGA 2YXHA 1BGYH 1QLEC 4DUYB 3SGIA 1K3EA 2UXDB 4P9OA 4FIPC 1V55C 5CB4A 3A8TA 3JD2A 3ABKC 3QTCA 2P22C 3ZHQA 4JAAA 3VOUA 5DM6V 1TUBA 4LWSA 4J80A 5LBQA 2ITCC 4MVSA 2AHZA 3J81N 4GT1A 4D6TH 4CS4A 2EBOA 2AGAA 3DC6A 5BMVA 3IC7A 2LQTA 1EM1A 5CA1B 3UO2A 2EINB 4P9PA 1AI7A 4UCRA 1ZSPA 5CBGA 5KMGB 3E8GA 4LF9B 4PJ0Z 4D7TA 3CC2V 2CTQA 5EIBC 3L72H 4O2AA 2N74A 2KQXA 5ITZA 5HFLA 1OCOB 3OR7C 4L87A 3P3NA 4DR7O 4F6RB 4J7JA 2EIKC 4FFBA 1MNGA 2XUMA 1RPRA 1KYOF 1COWG 3L9DA 3K03A 3RYFB 2ITDC 4TV9B 1AJPA 4LR3A 2A0LA 5A2QN 3B40A 1NQTA 3JARB 1N0JA 3JATB 4HBNA 4J7ZA 5EBLC 5B1BB 4B3MB 1XBLA 4I50B 2OWOA 1KD1W 3WFVA 2D3OW 3LSSA 5JJJB 1SS3A 2UXXA 2ZDIC 2F1MA 5FPOA 5IYCO 3Q4HA 1OCCB 4ZI7A 4DV2B 4TOIA 3X2QC 2ZXWC 2DQ3A 1B04A 1TVKA 3D3QA 2CGNA 1MMMA 3HR0A 3N2KB 5EZYB 2B5UA 2Z0AA 4YJ2A 4FK5C 5EYPA 1ROPA 2P4KA 3ETDA 5IDJA 3W7TA 3JAWB 4PDVA 1LUWA 1VQ7V 3ZX6A 4JGSA 3CC7V 5KHKA 2BE3A 5GONA 3ZRVA 3JAKB 2YICA 4NR1A 5EK0A 2EIJB 4WBNB 3LSUA 3HKDB 3TETA 3CCSV 3C3TA 3JASB 5IYZA 4MT8A 3B09A 4AI8A 1FFXB 3SR2C 1N33O 3ASOC 4MTXA 4CS2A 3E8BA 4J9YB 2AHYA 4GKJO 4PD4F 4NYKA 1BQZA 1YIJV 4ZOLB 1Y66A 4MW8A 1RSOA 1JCHA 4DV0B 4DV0O 3RYHB 1P7GA 4O4HA 1F4NA 4J10A 4H13B 1VQ8V 1YZBA 2B1GA 4PDMA 3TCUA 3F7YC 1JA8A 4QE9A 3CMEV 2F4VO 3RT3C 2CTWA 1K97A 1ZWIC 3JALB 3JCZA 2AZ2A 1SERA 2PYLA 3W7SA 1HNZB 1R3LC 2KSDA 1V54C 1VQNV 2LGWA 1SQQH 2PGGA 4BIZA 4U3JA 4B3RB 3ZN1A 1OCOC 4IYIA 4MVMA 3JD3A 2QKCA 2N04A 1Q8IA 5LMNO 4CC5A 4CC6A 3TGUH 2GUZB 3BEHA 5CN0A 4R6ZA 3RGBA 4DXWA 4HYOA 3CCLV 4JI1B 2UUBO 1GN6A 4JI1O 3K57A 1MABG 2F43G 1GM9A 2IU0A 1WN7A 1IDSA 3T2MA 1D5AA 2MK3A 3OMIB 2ZM6O 1MSWD 3BVOA 1PP9H 2B9ZA 2P4VA 2Q8VA 4QE7A 1GMGA 1M90W 3ABMC 3DXRB 4ZHQA 3U11A 3MHHC 5BR8O 1OCCC 5F2VO 2PUSA 1AR1B 1Z2GA 2DWEC 3ZRWA 3EHBB 1QVGU 2ZR2A 1BZKA 2WLLA 1R3JC 3ABLB 5EIBD 4G27B 2CE4A 3E86A 3FFQA 5IJ9B 4DW1A 4NXMB 3SPIA 1I94B 4IYHA 1I94O 3B77A 3BY6A 4I55B 4G2KA 3SPJA 5FNVA 3ETEA 2EILC 4I7ZB 1N0NA 4QJFB 1IBKO 3CWBH 3ZHUA 3I55V 4JZGA 2ILMA 1R3IC 5CA0A 1JJOA 4X89A 2LO1A 3OMAB 3E22B 3OM3B 1N32B 1N32O 3ASNB 4LBEC
chains in the Genus database with same CATH topology
1PP9H 3L71H 4D6TH 1SQVH 2FYUH 3L72H 1BE3H 1L0LH 1BCCH 4PD4F 1EZVH 1NTKH 5KLVH 3L70H 1BGYH 3H1LH 1KB9F 3TGUH 4U3FH 3CWBH 3H1KH 1L0NH 3L75H 1NTMH 1SQQH 2A06H 3CXHF 3H1IH 2BCCH 3BCCH 3CX5F 1SQBH 3H1HH 1NU1H 1NTZH 2IBZH 1KYOF 3L74H 1P84F 1PPJH 1SQPH 3H1JH 1SQXH 3L73H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP9 H;  3L71 H;  4D6T H;  1SQV H;  2FYU H;  3L72 H;  1BE3 H;  1L0L H;  1BCC H;  4PD4 F;  1EZV H;  1NTK H;  5KLV H;  3L70 H;  1BGY H;  3H1L H;  1KB9 F;  3TGU H;  4U3F H;  3CWB H;  3H1K H;  1L0N H;  3L75 H;  1NTM H;  1SQQ H;  2A06 H;  3CXH F;  3H1I H;  2BCC H;  3BCC H;  3CX5 F;  1SQB H;  3H1H H;  1NU1 H;  1NTZ H;  2IBZ H;  1KYO F;  3L74 H;  1P84 F;  1PPJ H;  1SQP H;  3H1J H;  1SQX H;  3L73 H; 
#chains in the Genus database with same CATH topology
 4FLZ A;  4B7K A;  5LP6 B;  2UUA B;  2UUA O;  1XDC A;  5JQG B;  1JOY A;  1A32 A;  1QHT A;  4LF5 B;  4LF5 O;  1G8M A;  1L0N H;  2F23 A;  2Q9L A;  1IXB A;  1AIL A;  4OXS A;  4W4L A;  3ZHT A;  3E8H A;  5LL6 Y;  4X64 B;  1SQX H;  4X64 O;  3FYI B;  1YHQ V;  1WPB A;  2Q0O C;  4CH3 A;  1AI5 A;  1G1X B;  5DED A;  2NNU A;  4GCZ A;  2OYQ A;  1B06 A;  2LW7 A;  3K5N A;  5B1N A;  2HFE C;  1F7Y A;  5KHH A;  1M56 C;  2EJR A;  4JTD B;  4FM1 A;  1PNM A;  4FPP A;  5J2U B;  4DR6 B;  1F4M A;  1SRY A;  1I5Y A;  3K5O A;  1XRE A;  3M7M X;  4LFB B;  4LFB O;  4FLX A;  2BTQ A;  3R66 A;  1K5Q A;  1O9H A;  1SQV H;  1BE3 H;  2BOB C;  2VQE B;  4KP4 A;  1KP2 A;  2GHY A;  2ZE7 A;  4LP8 A;  1H2N A;  3RVZ A;  3H1I H;  4HNA A;  5LYJ B;  3DGE A;  2X6B A;  3L74 H;  4ZIB A;  1VQ6 V;  1VQK V;  5LGU A;  4I0X B;  4JI3 B;  4JI3 O;  3OW2 U;  2QSA A;  4R7C A;  2YEV B;  2OCH A;  1GO3 F;  2Y48 A;  4KHP O;  5EBW C;  2A06 H;  1KBH A;  1LR1 A;  2KG7 A;  3OMN B;  3STL C;  2XAF A;  1M4U A;  2Y69 B;  5K1X A;  1YTF B;  3ZHV A;  1YJN V;  4DRX B;  4DYL A;  3RFR A;  4PDL A;  3WU2 Z;  3RVY A;  3BHP A;  2JEX A;  1S5J A;  1VF6 C;  4KFM A;  4J7K A;  4P30 A;  4LH7 A;  3K5M A;  2GBO A;  3CXH F;  1MG1 A;  2P67 A;  4NXN B;  4YIO A;  2DYS C;  3K04 A;  1Q6U A;  4O4I A;  1QCE A;  2Q7H A;  3SJQ C;  5TIS Z;  5KHG A;  5D5Q A;  1TAE A;  1F51 A;  3CS5 A;  4LCU C;  4UV9 A;  4FLT A;  4MTF A;  2IJI A;  5LGT A;  4TV8 B;  3BA9 A;  1FXK B;  3A0B Z;  2PZS A;  1IXM A;  1Q5O A;  3TJT A;  1XIL A;  1QR8 A;  3GWK C;  3AG4 B;  1VIB A;  2Q7G A;  5LA6 B;  4PI0 A;  1KC8 W;  4GKK B;  3B8M A;  4JTC B;  4UCO A;  4FM2 A;  4BIO A;  3CRC A;  3NR7 A;  4PA3 A;  4BIU A;  4BW9 A;  5J2T A;  1YJ9 V;  3U0Z A;  1AVM A;  3MAQ A;  3IC9 A;  2ZIN A;  1VQ4 V;  3H9V A;  3NXS A;  2Q0A A;  2R70 A;  1B6Q A;  1OHH G;  4OPH A;  2DYR C;  2WLH A;  3FKS G;  4FJC C;  3LDD A;  5LOV A;  3HKE B;  4X1I A;  4O4J B;  2A9H A;  2DQ0 A;  4F6E A;  2RCV A;  2X6C A;  5IY5 B;  4GX1 A;  5GTH Z;  3L71 H;  3ZHS A;  2JGD B;  5JH7 A;  4JI7 O;  1SQG A;  1MZF A;  1NT2 B;  1ARO P;  1PD3 A;  4LFA B;  2RQ6 A;  4PHZ A;  1GRJ A;  2ZDI A;  1JPX A;  2WSS G;  3SPC A;  1W0J G;  1KUQ A;  2B1I A;  1HNX B;  5KAI Z;  1M57 B;  1Q90 D;  3AG7 A;  2HP8 A;  4DV1 B;  3KCX A;  3IGA C;  3M8A A;  1JFF A;  4JTA B;  4N23 A;  1X59 A;  5KA6 A;  2CH7 A;  2IW5 A;  1XHZ A;  5H9C A;  5EC1 C;  1EZV H;  4B3S B;  2ZKO A;  2OT5 A;  4B3S O;  1PL0 A;  2Y69 C;  4CH4 A;  5E79 Z;  3UM7 A;  3H1K H;  2XND G;  3FAV A;  1K7D A;  4X1K A;  5B3S C;  2LW1 A;  2PY5 A;  2EZP A;  1I0H A;  2EUL A;  2IBZ H;  5LXT A;  3CRQ A;  1ZAU A;  5KHJ A;  1QU7 A;  1MZE A;  1FFT B;  5JCO A;  1WA8 B;  2Z5U A;  3FB7 C;  5KX5 A;  2R9R B;  1GM7 A;  4PA4 A;  3JD1 A;  4TQF A;  2X0L A;  1XOU A;  1K34 A;  2XTA A;  4U7O A;  5CBH A;  4HAM A;  1HR0 O;  1ZTE A;  3N2G B;  1IUR A;  3P32 A;  5AG2 A;  3CRM A;  1NS1 A;  1FXK C;  3ABU A;  2F93 B;  2ZD9 A;  5FLX N;  2XAS A;  5IJ0 B;  5CB4 B;  4JAV A;  5CA1 A;  4OGQ B;  1YEW A;  3JD4 A;  2ZT9 B;  4JPR A;  1DF5 A;  2ADQ B;  1KU9 A;  4LWS B;  4WFE A;  3CC4 V;  5KMG A;  1IBL O;  2VWK A;  1RM1 B;  2OCC C;  1IVS A;  1H8H G;  2JVD A;  4DR3 B;  3TXS A;  3ZS8 C;  4DR3 O;  1XNR B;  2V4D A;  1XNR O;  4DR7 B;  4PEL A;  3DC5 A;  4F6R A;  5L3E A;  2WLK A;  2ZIO A;  1N4C A;  3FB5 C;  2R72 A;  3ZCC A;  2JJ2 G;  1GK9 A;  3R65 A;  4LF4 B;  3IAY A;  1XHX A;  4LF4 O;  2P06 A;  2R9A A;  3RYF A;  4TV9 A;  1PKX A;  2QWQ B;  1BL8 A;  3CEI A;  4O2A B;  3ZRS A;  3JAR A;  3JAT A;  1Q81 W;  2KKW A;  3G80 A;  3K79 A;  4PDR A;  1R73 A;  4JAU A;  4GUN A;  3SYC A;  4Q20 A;  4LF7 B;  2JGU A;  3ZIA G;  2AW9 A;  4LF7 O;  1LUV A;  1NVP D;  4UXN A;  2DMX A;  4G28 B;  2QWO B;  3E8F A;  5B1A B;  4X8A A;  2OTL V;  1AI6 A;  4K35 A;  1NR1 A;  1ZUQ A;  4FZ0 A;  1GH6 A;  1MOF A;  3SJC C;  2JS5 A;  1SKV A;  4IGG A;  1FAF A;  2QM7 A;  3MD0 A;  4B3T O;  5BXZ A;  4FLW A;  4LF8 O;  3OR6 C;  3SYP A;  2WA3 A;  4NTW A;  4IIJ B;  2GTA A;  1Z5W A;  2IM9 A;  1WB7 A;  1TVK B;  4D7S A;  2QGN A;  2N05 A;  1GN3 A;  5LHI A;  4HZ3 A;  3JAK A;  5JCO C;  3RYC B;  2HHH B;  2HHH O;  3QO7 A;  5EYP B;  3THO A;  3MDS A;  4WBN A;  3JAS A;  1BHB A;  3WB1 A;  2DWD C;  1W59 A;  1YI2 V;  1L8D A;  1FFX A;  4JI2 B;  1S5H C;  4JI2 O;  2E3C A;  3CCE V;  1N33 B;  3QO5 A;  4GYC B;  2VQF B;  2GTS A;  3E89 A;  2VQF O;  1XMO B;  1XMO O;  5GON B;  4GKJ B;  4O4L B;  1B3Q A;  4XDL A;  4YXW G;  2PYJ A;  3F7V C;  4PA9 A;  3RWR D;  4OX9 O;  1ZLZ A;  2VWJ A;  4LH6 A;  1US6 A;  2WWW A;  1GKF A;  4N21 A;  4H44 B;  4J41 A;  5E1A C;  2EIN C;  3C90 A;  2F4V B;  2FYU H;  3BPZ A;  4X66 B;  4X66 O;  4MVO A;  1JVM A;  1P49 A;  1VAR A;  2IH3 C;  2RNB A;  1VQL V;  4IHJ B;  1QLN A;  4O4H B;  3GWO A;  4DV4 B;  1H2M A;  1VF7 A;  3GVM A;  4DV4 O;  4AQY B;  4FMT A;  5KUM A;  4AQY O;  2ZQM A;  2LGQ A;  2QWP B;  4FFK A;  1NH2 B;  1N8R W;  1VMG A;  5LMN B;  1S76 D;  3K58 A;  1PNL A;  1E79 G;  1EBO A;  2P7T C;  4Q6G A;  3BA8 A;  4U3J B;  1QNM A;  2UUB B;  2YIB D;  3OUF A;  3EVK A;  5B1B C;  1WPX A;  2PI4 A;  2UUC O;  2YIA A;  1EFR G;  2DE0 X;  4UCS A;  2P5O A;  2E76 B;  2ZM6 B;  1UJW B;  5IE9 A;  1KQS U;  2JK5 C;  3CPW U;  4UVC A;  3AG2 B;  4IL6 Z;  3CCV V;  3K0G A;  3DXR A;  5GTI Z;  1YIT V;  5B1A C;  5BR8 B;  4MS2 A;  2WLI B;  1E1Q G;  5L3G A;  4GX0 A;  3JAM N;  1AB3 A;  3T4Z A;  4B7E A;  1VF6 A;  5LHH A;  5BY1 A;  3LNN A;  3G4S V;  1OCZ B;  1XEQ A;  3T1H B;  3T1H O;  1FXH A;  3K59 A;  5JJN B;  1IBK B;  2IU3 A;  4NVP A;  1AJN A;  4TUY A;  1MSD A;  4AHC A;  5L3C A;  3E22 A;  2P6J A;  1G4Y B;  2WLL B;  4JZ2 A;  3G67 A;  3H1J H;  1ZX3 A;  5EBM C;  4P2Z A;  3OTF A;  2EIJ C;  1YF2 A;  5FNV B;  3P3P A;  2Z3Y A;  2WLM A;  1QBZ A;  1WJZ A;  1EN4 A;  5L3F A;  4CS3 A;  2X6A A;  2QJ1 A;  4JYA O;  5CA0 B;  5C8Y A;  4DR1 B;  3I56 V;  2R9I A;  4DR1 O;  1VQO V;  1JMK C;  1FJG O;  4LC1 A;  4O2B A;  4ASU G;  3ZRX A;  4ICG A;  2UU9 B;  2UU9 O;  3F5T A;  3TK1 A;  1BHA A;  2E75 B;  3UT5 A;  5CBF A;  4DR4 B;  4JI4 O;  4DR4 O;  3QVN A;  2HJF C;  2PI5 A;  2CTR A;  3BCC H;  3VBB A;  3CXC U;  4GX5 A;  4GZR B;  2UXC B;  2UXC O;  5J2U A;  3RN4 A;  1Y6X A;  2BSK A;  2Y4T A;  1SA0 B;  3L73 H;  4QPK A;  2YI9 A;  1Q82 W;  2CAZ C;  3SYQ A;  2ZR3 A;  1KKC A;  2ETN A;  1VQP V;  2ZNJ A;  2A7W A;  3QF7 A;  1VQM V;  4BWA A;  4YIP A;  3B8N A;  1H2G A;  4EFB A;  1TA8 A;  1NU1 H;  1NTZ H;  1KMI Z;  2W0F C;  3J7A U;  3OD4 A;  3A0H Z;  4JV5 B;  2H94 A;  2BTQ B;  4UVA A;  4JV5 O;  3WG7 B;  3JSL A;  4EB6 B;  1L0L H;  4GLX A;  2QWR B;  2ZE6 A;  1EN6 A;  4KHP B;  2HLD G;  1FKA O;  3FB6 C;  4HNA B;  1SC5 B;  1IBM O;  1LNQ A;  1DK1 A;  5JVD A;  2IJJ A;  3OT7 A;  5CMU A;  4UV8 A;  1RP3 B;  3H01 A;  4I9Q A;  3K06 A;  2FML A;  1AP6 A;  1TGO A;  2DN9 A;  3ABL C;  4NTY A;  1N34 O;  3VQX A;  4FLU A;  1OCZ C;  1N36 B;  3OTO O;  1N36 O;  2NR5 A;  3ZED A;  1MA1 A;  4ABM A;  3ZJZ A;  1SQP H;  3QNE A;  5JWP A;  3OAA G;  2QKA A;  3IJ4 A;  3C3S A;  3AG3 B;  2ATK C;  2HKO A;  2RMK B;  3ASN C;  3D8C A;  1GN2 A;  2YIB A;  2EIM B;  1CPY A;  5LP6 C;  3RYI B;  3LUT B;  2ADP A;  2Q7E A;  2QEX V;  4I4T B;  2K9P A;  2OIG A;  3ZMU A;  3ML0 A;  1K8A W;  1JX9 A;  1OCR B;  5KHI A;  1FXK A;  4NB5 A;  4O4I B;  4TSF G;  4JI8 O;  1HW7 A;  1QLE B;  4RO2 A;  5CA3 A;  1VEW A;  3AK1 A;  1V55 B;  2Q68 A;  3ABK B;  4X1Y B;  5DN6 G;  3L70 H;  3LDC A;  1Q6I A;  5B66 Z;  3L75 H;  4EKW A;  1Y74 A;  2O57 A;  2BTO A;  2F95 B;  4QGP A;  5EC2 C;  3E2E A;  3IFX A;  2DW4 A;  2VRZ A;  2W6J G;  3DSQ A;  3CRA A;  4KUM A;  4XBF A;  4LF6 B;  1BMF G;  4LF6 O;  3OE7 G;  3HKC A;  4EFE A;  3JCU Z;  3CSX A;  4YJ3 A;  1I08 A;  3PJS K;  2Y4U A;  1M1K W;  3ZMT A;  3BAA A;  1SQF A;  3D36 C;  1M93 A;  1SZT A;  3CJH B;  2E5L O;  4X62 O;  2BOC C;  2NLJ C;  3JSN A;  4O4J A;  2JJ1 G;  3DTU B;  1D2D A;  4X20 B;  3SDL A;  2HVK C;  3OGC C;  1VQ5 V;  4JI0 B;  2JGD A;  4JI0 O;  4JI7 B;  4X65 O;  2WLN A;  1NJI W;  1KB9 F;  4LNU A;  4MTO A;  1XL4 A;  3WG7 C;  2Q67 A;  1NVP B;  4DK0 A;  1HWY A;  2V1D A;  1R6K A;  1VQ9 V;  1Q6H A;  3CCQ V;  3BAB A;  5JH7 B;  1GN4 A;  3G71 V;  2YID A;  3K0D A;  1XI1 A;  5H5N A;  5K1P A;  3W7X A;  3M99 B;  2ZCE A;  2GSM B;  1PM9 A;  4K8X A;  1Y76 A;  3X2Q B;  2ZXW B;  3CX5 F;  1DTO A;  1SQB H;  1FXV A;  2WAM A;  2CUG A;  1P84 F;  1UPG A;  1BS3 A;  4CZZ A;  1ZL8 B;  1BT8 A;  4CH6 A;  2UXB O;  2CTP A;  1XQ8 A;  2Y0I A;  3P30 A;  2LFS A;  1R6T A;  2CH7 B;  1WA8 A;  3LNM B;  1KP3 A;  3HKB A;  3A2F A;  1NKD A;  1D5N A;  4W4K A;  4E2L A;  4C7U A;  4DV7 O;  2YSU B;  5IYD O;  1YSC A;  4DO2 A;  2NN4 A;  1TUE B;  5BZB A;  3CB2 A;  3SPG A;  1L1F A;  5FPR A;  1HR0 B;  1XMQ B;  4GX2 A;  1XMQ O;  3N2G A;  5KX5 B;  1H8E G;  2IJH A;  1EZJ A;  3TXQ A;  4WFA V;  1OCR C;  1VP7 A;  1W2B U;  2OTJ V;  5D5P A;  4DUY O;  2UXD O;  3BFR A;  3AG4 C;  5IJ0 A;  1FYJ A;  5A9G A;  4J9Z B;  3ASO B;  3HPL C;  2JRI A;  1CP9 A;  4FM0 A;  1S3J A;  2HR3 A;  1TUB B;  5J9P C;  3STZ C;  3ZN0 A;  1IBL B;  3OFN G;  3VQV A;  3ZBH A;  5BMV B;  1S0V A;  3ZHR A;  1HNW B;  1K92 A;  1HNW O;  2Q5Z A;  5LMU B;  1S72 V;  3N27 A;  1Q7Y W;  5LMU O;  2HEP A;  3D3I A;  5LHG A;  2IH1 C;  4WFG A;  4UCT A;  4LF9 O;  1V54 B;  3G6E V;  4K8Z A;  2RJZ A;  2QA4 V;  3OUS A;  1PL4 A;  5ITZ B;  3QO8 A;  4RWU A;  3RW0 A;  4MSW C;  2IJK A;  5IY5 C;  1DF4 A;  1OZ0 A;  3JYC A;  4I50 A;  3JD0 A;  4FFB B;  1Z5V A;  4LFC B;  4LFC O;  2DJV A;  4BAY A;  2CGO A;  1M57 C;  2Q6A A;  4B3M O;  4BW5 A;  3ZMZ A;  1SF9 A;  3RBZ A;  3N2K A;  5EZY A;  3J80 N;  3ICX A;  2WA4 A;  4DR5 B;  4B3T B;  4DR2 B;  4DR5 O;  2K1E A;  4DR2 O;  1RPO A;  3ABM B;  4LF8 B;  1K4D C;  1GM8 A;  4DUZ B;  4DUZ O;  3JAW A;  2LFR A;  3Q4H B;  2JS3 A;  4IIJ A;  3VQW A;  3ETQ A;  4ZI7 B;  1QR9 A;  4DV2 O;  1I7F A;  3EXA A;  4MTG A;  2HG5 C;  3OEE G;  3WB0 A;  3K08 A;  4NTX A;  2JEU A;  2KB1 A;  3RYC A;  4YJ2 B;  4B08 A;  3O65 A;  2WPD G;  4R50 A;  4J42 A;  3HKD A;  2ODM A;  2GV9 A;  3AK2 A;  1F23 A;  1M5I A;  1XL6 A;  2EIL B;  2JDI G;  4I9W A;  1OV9 A;  4DK1 A;  4FLV A;  5B1O A;  3AG1 B;  4UVB A;  3QG5 A;  4PA6 A;  4OPA A;  4O4L A;  2X7R B;  4UFZ A;  4ZOL A;  4E4E A;  4KXR A;  2ZE5 A;  1G6U A;  2L35 A;  4UB6 Z;  4H0L B;  3APQ A;  4MVU A;  4OX9 B;  5IYZ B;  3RYH A;  1H2S B;  3EFF K;  5KAF Z;  1U96 A;  2YS8 A;  3OGI B;  1RFY A;  2YXY A;  1YTF D;  3JAL A;  1DLB A;  1CEZ A;  1Q43 A;  3UO3 A;  2CDY A;  4UB8 Z;  1RSO B;  1WNS A;  1VF5 B;  2FL4 A;  1WP8 A;  1RM1 C;  5GW7 A;  4IHJ A;  4FZ1 A;  3K3W A;  3BRC A;  3F5W C;  4RQE A;  2YUA A;  1M56 B;  1NI8 A;  2ZE8 A;  3SYA A;  2EZO A;  1HNZ O;  1AP5 A;  3U10 A;  2GUZ A;  3UCS C;  4F4L A;  1Q86 W;  4B3R O;  1Y67 A;  2UUC B;  1AR5 A;  4CBC A;  5LGN A;  1URF A;  4MVZ A;  2ZIM A;  3CCU V;  4JI6 B;  4JI6 O;  3CP1 A;  2WLI A;  1WAZ A;  1WB8 A;  3VQY A;  4WFH A;  4RAI A;  3B4S A;  4UCU A;  1R6N A;  5IJ9 A;  1V9P A;  2MW2 B;  2QTS A;  4MW3 A;  4I55 A;  3FX7 A;  4ZHQ B;  2W0X A;  1AI4 A;  5L3D A;  2QWN B;  1O9G A;  3E35 A;  3LDE A;  3ZRW B;  2FTK A;  4AIL C;  1Q3E A;  4EEQ A;  4X88 A;  4NXM O;  5LP6 A;  2DYS B;  4QIW F;  2QKS A;  5JQG A;  1NTK H;  1K9M W;  4JI5 B;  4JI5 O;  3ZMV A;  3CYO A;  4R8C A;  4Z2W A;  3AG1 C;  3SJB C;  4JYA B;  4TUY B;  4PI2 A;  3CHX A;  4FVM A;  1FJG B;  2YC0 A;  4H37 A;  2M7W A;  4I5S A;  4Z1V A;  1JR9 A;  3SPH A;  2Q69 A;  4RUE A;  5H2F Z;  3W7W A;  3SJA C;  2YI8 A;  4JI4 B;  2PTM A;  4K0K B;  5C8Y B;  1SET A;  4K0K O;  1YCI A;  2W6I G;  1QVF U;  3APO A;  5IWA B;  5IWA O;  1FD9 A;  3MHS C;  4QPJ A;  4ZBM A;  1CXZ B;  4O2B B;  3GB7 C;  2EX3 A;  1SA0 A;  2XAJ A;  5FL7 G;  3KCY A;  3CRR A;  3D36 A;  4U7N A;  3SYO A;  1PNK A;  3K9A A;  1FS0 G;  3LSQ A;  2A3Q A;  3UT5 B;  2XAQ A;  2QR4 A;  3HB3 B;  3KZI Z;  3S3W A;  2YXL A;  4Z1M G;  1P4R A;  1P7B A;  3ABT A;  1YDX A;  1K73 W;  2BSK B;  3CCR V;  4DR6 O;  1YJW V;  5LYJ A;  2DYR B;  4MVR A;  4DV3 B;  4DV3 O;  5IT9 N;  4I0X A;  1S5L Z;  2GDS A;  3OEH G;  4EB6 A;  2YEV A;  2VQE O;  2WLJ A;  1WP7 A;  1R3K C;  2PF4 E;  4RUF A;  2RDC A;  4RQF A;  2BCC H;  3AG2 C;  1IBM B;  4DW0 A;  1IX9 A;  2YDE A;  4WFB V;  2AZ0 A;  2FKX A;  3K5L A;  4MVQ A;  1HDJ A;  3CCJ V;  5KUK A;  4DRX A;  1W0K G;  4JYB A;  1YXB A;  3WB2 A;  1GTO A;  1BCC H;  2F66 C;  3W7U A;  5KLV H;  1S77 D;  1T5E A;  2QM8 A;  2V7Q G;  4PA7 A;  1N34 B;  3S3X A;  4UCV A;  3OTO B;  3CCM V;  4TQD A;  3CMA V;  2KG7 B;  4H33 A;  5JVD B;  2H8P C;  3AEI A;  1U97 A;  3B2E E;  2OIE A;  4YY3 B;  4KL1 A;  4YY3 O;  5B3S B;  2C2A A;  3PN1 A;  2QM4 A;  3I5D A;  4NKG B;  4JAS A;  4PV1 B;  5C93 A;  1IZ3 A;  3RYI A;  4NXN O;  4WF9 V;  4I4T A;  4TV8 A;  2LJ2 A;  1E1R G;  1J5E B;  2XT9 A;  3FD9 A;  1PPJ H;  1J5E O;  4JI8 B;  5HFM A;  1H38 A;  1THZ A;  3CD6 V;  4BR6 A;  1OJH A;  1HP8 A;  4XDK A;  4DV6 B;  4X1Y A;  5H6R A;  4DV6 O;  4K3A A;  5LA6 A;  3H1L H;  1PV0 A;  3ETG A;  2D2C B;  4JYY A;  3UKM A;  2AXT Z;  2A79 B;  2E74 B;  4IT5 A;  3AK3 A;  4JYC A;  2HJD A;  2Y0P A;  4L8J A;  1BQ0 A;  2FB5 A;  5DEC A;  3A0R A;  1KEC A;  3T1C A;  2XOK G;  2Q4P A;  1JQ0 A;  3G6B A;  4J11 A;  2QE7 G;  2Q73 A;  4GKK O;  4ZKI A;  1Y74 B;  1JJ2 U;  5B5E Z;  1DGS A;  3CJH A;  3HKE A;  2OCC B;  2E5L B;  4X62 B;  5J2T B;  2QDO A;  3H1H H;  2P90 A;  2QTO A;  4TWK A;  4X9Q A;  2XAH A;  1GAX A;  2L6L A;  4DV5 B;  1UFI A;  4X20 A;  2ZNI A;  4DV5 O;  3HKC B;  1AJQ A;  1NBM G;  1SES A;  2EIK B;  4UUJ C;  4YJ3 B;  3T4D A;  2RN9 A;  4X65 B;  1EN5 A;  1XNQ B;  5H6Q A;  1XNQ O;  1ENV A;  1FPO A;  5JJE B;  2UXN A;  4FLY A;  5LOV B;  1NTM H;  1I5X A;  2HVJ C;  2H3O A;  5L3B A;  3FB8 C;  4X1I B;  4CH5 A;  1M9N A;  2M6Y A;  1KKD A;  3UQ8 A;  4XDJ A;  2EJ7 A;  4YHH B;  3ZMS A;  3KG2 A;  4YHH O;  3K9S A;  4WFF A;  1Y4M A;  3FYE B;  3CE2 A;  2DOS A;  1J95 A;  1K4C C;  1K5S A;  4LFA O;  4LNU B;  3KKY A;  1SZX A;  1XUQ A;  1HNX O;  5KA5 A;  4TT3 G;  4QNH B;  1AR4 A;  1X4T A;  2VS0 A;  4DV1 O;  1ZL8 A;  2UXB B;  1K33 A;  1JFF B;  3O9O A;  2G38 A;  2ARH A;  4U3F H;  3FAV B;  4DV7 B;  2LP7 A;  4X1K B;  2XHB A;  1Y76 B;  4WCE V;  1NH2 D;  3AG3 C;  1ORQ C;  1H2K A;  4JF3 A;  1BSM A;  1WLE A;  1H2L A;  2JIZ G;  5LXT B;  2EIM C;  1QQC A;  3E83 A;  1NZ6 A;  4A5U B;  3T1Y B;  3T1Y O;  3HKB B;  1NR7 A;  5IYB O;  1YVW A;  2CK3 G;  1R1B A;  2XAG A;  2YXH A;  1BGY H;  1QLE C;  4DUY B;  3SGI A;  1K3E A;  2UXD B;  4P9O A;  4FIP C;  1V55 C;  5CB4 A;  3A8T A;  3JD2 A;  3ABK C;  3QTC A;  2P22 C;  3ZHQ A;  4JAA A;  3VOU A;  5DM6 V;  1TUB A;  4LWS A;  4J80 A;  5LBQ A;  2ITC C;  4MVS A;  2AHZ A;  3J81 N;  4GT1 A;  4D6T H;  4CS4 A;  2EBO A;  2AGA A;  3DC6 A;  5BMV A;  3IC7 A;  2LQT A;  1EM1 A;  5CA1 B;  3UO2 A;  2EIN B;  4P9P A;  1AI7 A;  4UCR A;  1ZSP A;  5CBG A;  5KMG B;  3E8G A;  4LF9 B;  4PJ0 Z;  4D7T A;  3CC2 V;  2CTQ A;  5EIB C;  3L72 H;  4O2A A;  2N74 A;  2KQX A;  5ITZ A;  5HFL A;  1OCO B;  3OR7 C;  4L87 A;  3P3N A;  4DR7 O;  4F6R B;  4J7J A;  2EIK C;  4FFB A;  1MNG A;  2XUM A;  1RPR A;  1KYO F;  1COW G;  3L9D A;  3K03 A;  3RYF B;  2ITD C;  4TV9 B;  1AJP A;  4LR3 A;  2A0L A;  5A2Q N;  3B40 A;  1NQT A;  3JAR B;  1N0J A;  3JAT B;  4HBN A;  4J7Z A;  5EBL C;  5B1B B;  4B3M B;  1XBL A;  4I50 B;  2OWO A;  1KD1 W;  3WFV A;  2D3O W;  3LSS A;  5JJJ B;  1SS3 A;  2UXX A;  2ZDI C;  2F1M A;  5FPO A;  5IYC O;  3Q4H A;  1OCC B;  4ZI7 A;  4DV2 B;  4TOI A;  3X2Q C;  2ZXW C;  2DQ3 A;  1B04 A;  1TVK A;  3D3Q A;  2CGN A;  1MMM A;  3HR0 A;  3N2K B;  5EZY B;  2B5U A;  2Z0A A;  4YJ2 A;  4FK5 C;  5EYP A;  1ROP A;  2P4K A;  3ETD A;  5IDJ A;  3W7T A;  3JAW B;  4PDV A;  1LUW A;  1VQ7 V;  3ZX6 A;  4JGS A;  3CC7 V;  5KHK A;  2BE3 A;  5GON A;  3ZRV A;  3JAK B;  2YIC A;  4NR1 A;  5EK0 A;  2EIJ B;  4WBN B;  3LSU A;  3HKD B;  3TET A;  3CCS V;  3C3T A;  3JAS B;  5IYZ A;  4MT8 A;  3B09 A;  4AI8 A;  1FFX B;  3SR2 C;  1N33 O;  3ASO C;  4MTX A;  4CS2 A;  3E8B A;  4J9Y B;  2AHY A;  4GKJ O;  4PD4 F;  4NYK A;  1BQZ A;  1YIJ V;  4ZOL B;  1Y66 A;  4MW8 A;  1RSO A;  1JCH A;  4DV0 B;  4DV0 O;  3RYH B;  1P7G A;  4O4H A;  1F4N A;  4J10 A;  4H13 B;  1VQ8 V;  1YZB A;  2B1G A;  4PDM A;  3TCU A;  3F7Y C;  1JA8 A;  4QE9 A;  3CME V;  2F4V O;  3RT3 C;  2CTW A;  1K97 A;  1ZWI C;  3JAL B;  3JCZ A;  2AZ2 A;  1SER A;  2PYL A;  3W7S A;  1HNZ B;  1R3L C;  2KSD A;  1V54 C;  1VQN V;  2LGW A;  1SQQ H;  2PGG A;  4BIZ A;  4U3J A;  4B3R B;  3ZN1 A;  1OCO C;  4IYI A;  4MVM A;  3JD3 A;  2QKC A;  2N04 A;  1Q8I A;  5LMN O;  4CC5 A;  4CC6 A;  3TGU H;  2GUZ B;  3BEH A;  5CN0 A;  4R6Z A;  3RGB A;  4DXW A;  4HYO A;  3CCL V;  4JI1 B;  2UUB O;  1GN6 A;  4JI1 O;  3K57 A;  1MAB G;  2F43 G;  1GM9 A;  2IU0 A;  1WN7 A;  1IDS A;  3T2M A;  1D5A A;  2MK3 A;  3OMI B;  2ZM6 O;  1MSW D;  3BVO A;  1PP9 H;  2B9Z A;  2P4V A;  2Q8V A;  4QE7 A;  1GMG A;  1M90 W;  3ABM C;  3DXR B;  4ZHQ A;  3U11 A;  3MHH C;  5BR8 O;  1OCC C;  5F2V O;  2PUS A;  1AR1 B;  1Z2G A;  2DWE C;  3ZRW A;  3EHB B;  1QVG U;  2ZR2 A;  1BZK A;  2WLL A;  1R3J C;  3ABL B;  5EIB D;  4G27 B;  2CE4 A;  3E86 A;  3FFQ A;  5IJ9 B;  4DW1 A;  4NXM B;  3SPI A;  1I94 B;  4IYH A;  1I94 O;  3B77 A;  3BY6 A;  4I55 B;  4G2K A;  3SPJ A;  5FNV A;  3ETE A;  2EIL C;  4I7Z B;  1N0N A;  4QJF B;  1IBK O;  3CWB H;  3ZHU A;  3I55 V;  4JZG A;  2ILM A;  1R3I C;  5CA0 A;  1JJO A;  4X89 A;  2LO1 A;  3OMA B;  3E22 B;  3OM3 B;  1N32 B;  1N32 O;  3ASN B;  4LBE C; 
#chains in the Genus database with same CATH homology
 1PP9 H;  3L71 H;  4D6T H;  1SQV H;  2FYU H;  3L72 H;  1BE3 H;  1L0L H;  1BCC H;  4PD4 F;  1EZV H;  1NTK H;  5KLV H;  3L70 H;  1BGY H;  3H1L H;  1KB9 F;  3TGU H;  4U3F H;  3CWB H;  3H1K H;  1L0N H;  3L75 H;  1NTM H;  1SQQ H;  2A06 H;  3CXH F;  3H1I H;  2BCC H;  3BCC H;  3CX5 F;  1SQB H;  3H1H H;  1NU1 H;  1NTZ H;  2IBZ H;  1KYO F;  3L74 H;  1P84 F;  1PPJ H;  1SQP H;  3H1J H;  1SQX H;  3L73 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...