1P84F

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
74
structure length
74
Chain Sequence
b'VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 27
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1p84F00
1P84F 3BCCH 1SQXH 3L73H 2A06H 1BE3H 1PPJH 1EZVH 1BGYH 3H1HH 3H1KH 1KYOF 1NTZH 1NU1H 3L70H 1SQBH 3H1LH 1SQQH 1NTKH 3TGUH 1BCCH 1PP9H 4D6TH 5KLVH 1SQPH 1SQVH 4U3FH 3H1JH 1NTMH 3H1IH 3CXHF 3CWBH 1L0NH 3L72H 3L74H 2BCCH 2FYUH 2IBZH 3L71H 1L0LH 3CX5F 4PD4F 3L75H 1KB9F
chains in the Genus database with same CATH superfamily
1GRJA 1R1BA 1SC5B 4DV0O 3CJHA 3CMEV 4DV0B 4O4LB 1EZVH 1HWYA 3SJCC 2ZE8A 3BA8A 1S72V 3CRAA 3MAQA 2CTWA 1K33A 1Y66A 4FLVA 2JGUA 2WLJA 3X2QC 1QR9A 2UXDO 3JAKB 4DR6B 1WP8A 2UXDB 2DYRC 5CBHA 5CMUA 4TQFA 2UUAO 1H2MA 2E74B 2P7TC 2UUAB 4AILC 4UCSA 1YJNV 1NQTA 2F43G 2AXTZ 1KP2A 2ZNJA 4YJ2B 3TXQA 1K34A 2Q0OC 3ABMC 3JATB 1GN2A 1I5XA 4BW9A 4Z1MG 2R9RB 1BSMA 3CXHF 3HKCA 2EULA 2DOSA 4JF3A 3F5TA 2KKWA 4CZZA 3JSNA 3UO2A 2EIJC 1SS3A 3ZHTA 3D36C 2BOCC 1YDXA 5KA5A 4PA9A 2LW7A 4J10A 3K58A 3T4ZA 4GX1A 1HDJA 1AR4A 1SQGA 5EZYB 1WN7A 3M7MX 4OGQB 4MW3A 4X20B 3ABLC 2ODMA 4WFEA 1KP3A 4FVMA 4JGSA 4BIZA 4NYKA 3WB1A 3P32A 2B1GA 3JSLA 5GTHZ 1R6TA 4JAAA 3RVYA 2DJVA 4O4HB 2CH7A 2F4VO 5EYPB 3UT5B 2Q0AA 2F4VB 3C90A 5CA0A 3VBBA 1QVFU 3CB2A 4F6EA 4QE9A 5LBQA 3CC4V 5H5NA 2ATKC 4MSWC 4DV6O 1K4DC 4JI0O 4DV6B 3RYFA 1YSCA 2CAZC 4JI0B 1K7DA 1P7GA 4AHCA 2WLLB 3OW2U 2NNUA 3QF7A 4OXSA 2JGDA 3HR0A 3VQXA 2PI4A 5E1AC 4RWUA 5JJNB 1NBMG 4XDLA 2ADPA 3F7VC 1Q43A 1YIJV 1B3QA 3K04A 1B04A 1G6UA 2ZIOA 1GH6A 1VF5B 2KSDA 1QVGU 2ZXWC 5B1AC 4CS4A 2UXNA 3KG2A 1H2LA 2ZDIC 1NTZH 3ZHUA 1YZBA 2BSKB 5IYZA 3ZMSA 1M56C 1XNQO 1GO3F 3ETQA 3H1JH 4R7CA 1MSWD 1XNQB 3AG2C 3WG7C 3CRQA 3LNMB 1M57B 4UVCA 1Q86W 4TUYA 4HYOA 4MVRA 1L0LH 2AW9A 5LP6A 1Z5WA 2N74A 1TA8A 5GTIZ 1JVMA 5ITZB 2F93B 3ZS8C 3FAVB 1EN5A 4B08A 4JZGA 3K5NA 2WLKA 1M93A 3MD0A 4PI0A 3CCUV 3SPCA 2E76B 3HKEA 3CX5F 2EZOA 3BEHA 3DGEA 1N8RW 4PJ0Z 5CB4B 2LJ2A 4O2AB 1XNRO 2KG7B 2XAQA 4LH7A 5E79Z 1F23A 1XNRB 4X62O 1PNKA 4X62B 2B9ZA 3CRMA 1P4RA 1PM9A 2ZE5A 3BAAA 1H8EG 5IT9N 1PNMA 4DW1A 3MDSA 2Q7GA 1OV9A 4LP8A 4XDKA 5JVDA 3K06A 4X65O 1DK1A 5LHHA 4UUJC 4X65B 3ZMUA 4FFBA 2IU0A 1XQ8A 1D5AA 3E89A 3A0HZ 4K8XA 3N2KB 1QU7A 2QWPB 3G67A 1JPXA 2VS0A 3IGAC 4B3TO 4DR2B 1K97A 4B3TB 1H2NA 4JAUA 3UCSC 2BTQB 4X89A 4TOIA 5KHJA 2YIDA 3OM3B 1RSOB 4J11A 4X88A 1GM9A 4A5UB 3AG3B 2LQTA 3CS5A 3ZMVA 1IXMA 1GKFA 3M99B 1LNQA 3CCMV 1RPOA 3OR7C 3OGIB 3JASA 1Q5OA 3UO3A 4PD4F 4UFZA 2Q73A 3RWRD 2JRIA 2CTRA 3FB8C 1SKVA 1RPRA 2R9AA 5J2TB 3HPLC 2R72A 3EXAA 1NT2B 2DW4A 1KUQA 5EIBC 1BL8A 2WLIA 4YJ3A 3S3WA 2AHZA 4G28B 4HZ3A 3AEIA 3BVOA 3K79A 5IYBO 2YIAA 1BQ0A 4IIJB 2L35A 4D7SA 2IH3C 2PUSA 3OEHG 4X1IB 4LFBO 2P6JA 4NXMO 4FFKA 4LFBB 4NXMB 3CHXA 1ROPA 4B7KA 5L3GA 2QM7A 2Z0AA 1JJ2U 4DXWA 4U3JB 3TCUA 5IJ0B 3WB2A 4MTFA 1JJOA 2CGNA 5LL6Y 1WB8A 4BIUA 4DO2A 1M57C 1O9GA 3R65A 2HG5C 1Q82W 3H1IH 3SGIA 2JVDA 1GMGA 1GN4A 3HKDA 1NS1A 1KB9F 1TUBA 2LO1A 3FB5C 4Z1VA 1JFFA 1LUVA 1V54B 2IU3A 5CA3A 3LDEA 4NTWA 3K08A 4FIPC 5B1NA 4JI5O 4NTXA 2BTOA 4JI5B 3JYCA 4J9YB 3RN4A 4BW5A 1N4CA 4RAIA 1ZWIC 4P30A 1G4YB 1YVWA 4LF5O 5KAIZ 3RGBA 3M8AA 3EVKA 5L3FA 1SQBH 4TWKA 3S3XA 1YJWV 3B8NA 3T4DA 2ZIMA 2ZKOA 3OAAG 1DLBA 3X2QB 2DWEC 1YTFD 3IC9A 3AG7A 2AZ0A 3SYOA 2IW5A 1PL4A 1K73W 3K59A 4B3RO 2CK3G 4B3RB 4CC5A 1XI1A 4F4LA 2XNDG 4J42A 1K3EA 3E22B 3ABMB 1Y76A 1FKAO 3AK3A 3DXRB 5KAFZ 3SPGA 1Y4MA 4GKJO 3AG3C 2PYLA 5LMUO 4GKJB 2ILMA 1E1QG 4I55B 5LMUB 4ZBMA 3DC5A 4NTYA 3H1LH 3E2EA 1LR1A 1XL6A 2Q67A 3RYHB 3A8TA 2LGQA 4IHJA 5DEDA 1ZTEA 2D3OW 3OTFA 1F7YA 3FX7A 4CS3A 4G2KA 4JYCA 2PTMA 4E4EA 3Q4HA 2YEVA 4MS2A 3QO8A 2EX3A 3GWOA 2XUMA 3LDDA 3ABLB 1G8MA 2GTSA 3O9OA 4I50B 4O4LA 4OPHA 2PGGA 3WU2Z 1VMGA 3I5DA 1Y74B 1VF6C 5KUKA 1UJWB 3QVNA 3CCRV 4EB6B 1KQSU 5LA6B 3LSUA 1QLEC 4L8JA 4WFFA 2HHHO 4QJFB 4IT5A 2HHHB 1V55B 2RMKB 4N23A 1X4TA 1TAEA 5DN6G 3SR2C 3TXSA 5AG2A 1GN3A 4YJ2A 5KUMA 2YS8A 2F66C 3W7XA 4RQEA 3FB6C 3ZMZA 2PYJA 5LOVB 4PV1B 2IBZH 5FNVB 4CBCA 4GLXA 4JI7O 1J5EO 4FLZA 4MTGA 1WAZA 4FLXA 4JI7B 1J5EB 1SA0B 2A06H 2W0XA 1N33O 3H1KH 2PI5A 1SQQH 1XMOO 3OFNG 2PZSA 5H2FZ 4ASUG 3I56V 3AG4B 2IJKA 1XMOB 1AJQA 4FLWA 3SYCA 5EZYA 5LGUA 4CC6A 3CPWU 1V54C 2OYQA 1FYJA 4RO2A 4DV7B 4AQYO 5EBWC 1FXVA 1AR1B 3HKBB 4I4TB 4AQYB 1THZA 4O4HA 5BZBA 1ZUQA 1KECA 5KMGB 2YICA 2A0LA 5EYPA 3UT5A 3G71V 5CA1B 1FXKC 4QIWF 3KCYA 5TISZ 4LNUB 4JYBA 3F5WC 5LMNO 4YY3O 1MOFA 2WLLA 3RYIB 4PI2A 4YY3B 3E86A 2M6YA 4F6RA 1QLNA 1GK9A 4FM1A 4WFGA 4ZOLB 2QSAA 2VQFO 5LHGA 3ZCCA 2Q68A 2VQFB 3ZEDA 2VWJA 1FFXA 4X1YB 5EC1C 1OJHA 3WB0A 3ASNC 1CXZB 2DQ3A 1VF7A 1D2DA 3JD1A 2D2CB 4H33A 3CCEV 2V1DA 2XAHA 2JK5C 4TV8B 4GT1A 2BSKA 3ZRVA 4U7NA 2PF4E 4FM2A 4O4IB 2CDYA 3PJSK 3GWKC 5LYJA 2OTJV 2NLJC 1F4NA 4JTDB 5IYDO 5ITZA 3B4SA 4NVPA 2UU9O 1NJIW 3DSQA 3B40A 2UU9B 4N21A 4LWSA 4TSFG 2G38A 5B1OA 3OMAB 4P2ZA 2F1MA 3L72H 1AI6A 4QPKA 1AI5A 1A32A 1BT8A 2QWRB 2QTSA 1QQCA 5KX5B 3FD9A 1W0KG 1S77D 3SJBC 4I5SA 1EN6A 5CB4A 1FPOA 2HVKC 1I7FA 4O2AA 1IX9A 1VQKV 4I0XA 3RT3C 3JARB 4EFBA 2GSMB 3QNEA 4JYYA 1V55C 2K9PA 4O4JB 3B77A 1OCOB 4JI6O 4XBFA 4JI6B 3U0ZA 2Y0PA 3BY6A 5C8YB 3W7UA 4J9ZB 2WA4A 1Z2GA 2E3CA 4UXNA 3UM7A 1UPGA 2JJ1G 4FPPA 1VQLV 1W59A 1OZ0A 4R6ZA 3G6EV 5FPRA 2HVJC 3FFQA 4UB6Z 4G27B 4MVMA 4Q6GA 4BWAA 2OT5A 2ZCEA 3J80N 1ENVA 3JALA 1V9PA 2BTQA 5IE9A 3AG4C 4PDLA 4KP4A 5JWPA 2WLNA 1XL4A 1RSOA 4LC1A 1I94O 2EILB 3ZN1A 5EBMC 5H6RA 2BE3A 2XTAA 3RYCB 2QGNA 5D5PA 3T1YO 3T1YB 2JS3A 2ZR3A 3CRCA 1AJPA 4DR7O 5LXTB 3CRRA 1RM1B 5IDJA 3APQA 4NXNO 4DR7B 1BE3H 5H9CA 1K8AW 2X6CA 4NXNB 1BGYH 4KFMA 1XILA 3BABA 5J2TA 3ZHRA 2V4DA 3JCZA 1M9NA 3JD2A 5HFLA 4Q20A 4MT8A 2WAMA 3ZIAG 3ZN0A 4LF6O 4H44B 1AILA 2X0LA 4LF6B 4RUEA 4FLTA 5JCOA 5DM6V 2EJ7A 1XDCA 5FPOA 2LFRA 3ZJZA 1L0NH 5JJEB 2R9IA 1TUEB 3JAMN 3OT7A 4YIOA 3KCXA 3CP1A 2OTLV 4W4LA 4WBNA 1JR9A 5FLXN 2CE4A 4DV5O 2RJZA 4U3JA 4WFBV 3JD0A 5IJ0A 3C3TA 4DV5B 3U10A 1HP8A 2JEXA 1EN4A 2Y69B 3ZX6A 4P9OA 2ZD9A 3RYFB 3QG5A 4JI1O 4YXWG 3TK1A 3LSQA 4ZHQB 4JI1B 1VIBA 1FS0G 5IJ9A 3CCQV 4IL6Z 1PL0A 1US6A 4DK0A 4IYHA 1J95A 4X1KA 3BA9A 1BS3A 2R70A 2DYSC 1R3JC 2Y0IA 1K5QA 2YXHA 3OMNB 3ICXA 5EK0A 1VQ5V 1XOUA 2QM8A 4L87A 2GHYA 4TV9B 4FZ0A 2EIMC 5KHKA 1L8DA 4CH4A 3I55V 5IYZB 1P49A 1OCRB 5CBGA 4H13B 2EJRA 1FD9A 1NVPD 2ZINA 1SQVH 2X6AA 4TUYB 1MABG 1OCOC 3A0BZ 2XHBA 4UVBA 2ETNA 4FZ1A 3BCCH 5B1BC 2GUZB 3C3SA 1IBLO 1IBKO 4QPJA 1IBLB 2P5OA 1IBKB 3RVZA 1QLEB 5KHHA 5BY1A 2HJDA 2X7RB 3L9DA 2XOKG 4DR3O 4LFAO 4DR3B 3E22A 5J9PC 2JIZG 3K5LA 1WLEA 4LFAB 5A2QN 1TVKB 2EBOA 3W7WA 1BMFG 3DXRA 4XDJA 3ML0A 3CSXA 3KKYA 4EFEA 2EILC 4LCUC 3BFRA 3THOA 4UV9A 2NN4A 3D36A 3J81N 3OE7G 3RYHA 2ARHA 4NR1A 3ETGA 1RM1C 4YIPA 1Q6IA 2XAJA 3K5OA 4C7UA 5JVDB 1VQOV 3ZRSA 1RFYA 2CTQA 1ZX3A 2F23A 4FFBB 3T1HO 2IM9A 2FTKA 4BAYA 3T1HB 1NU1H 1I5YA 3E8BA 3VOUA 2ADQB 3TJTA 4J7KA 1BHBA 4I50A 2FL4A 3OD4A 4K0KO 1EFRG 3QO7A 3QTCA 3CD6V 3E83A 1Y74A 5F2VO 3SYAA 4EB6A 4B3SO 1FXKB 2YC0A 4GUNA 4B3SB 1VQ8V 3ABKB 2Q69A 5LGNA 2Q7HA 5JQGA 5J2UB 1GAXA 4LF5B 2H8PC 4GKKO 4NB5A 2QWOB 4GKKB 2WWWA 3DTUB 2OIEA 3B2EE 1WP7A 1GM8A 1DGSA 3O65A 1U97A 1WA8B 1XHXA 2VWKA 1Q3EA 2WSSG 1R73A 2JDIG 4HNAA 3P3PA 1HNWO 3OGCC 2Y69C 3JAWA 4MVSA 2HKOA 3ASNB 1ZL8B 2DN9A 4JV5O 3T2MA 3BRCA 4YJ3B 4JV5B 4KL1A 3LNNA 2ZDIA 2FYUH 4DRXA 3OTOO 1EM1A 1HW7A 1KKDA 4X66O 2KQXA 2ITDC 3OTOB 4X66B 4PA6A 4J7JA 3FYEB 4LF4O 4CS2A 3L70H 4LF4B 1N32O 1VQNV 5BR8O 4E2LA 1YF2A 1PKXA 1N32B 4I4TA 5BR8B 4K3AA 5KMGA 5CA1A 3JD3A 1W2BU 4R8CA 3SPHA 1OCRC 1R3LC 1KU9A 4DV3O 1PD3A 4LNUA 4QGPA 1QBZA 3RYIA 3SYPA 1AP5A 2EZPA 2DWDC 1JA8A 1AJNA 3HKDB 4ZOLA 1TUBB 1Q6HA 3JAKA 4GYCB 5HFMA 3ABTA 4DR4O 1SQFA 4PDVA 4MTOA 4DR4B 1MMMA 4Z2WA 5L3EA 4X1YA 2Z5UA 1S5JA 1I0HA 2W6IG 1KYOF 4HAMA 4JTCB 3SYQA 1H38A 4GCZA 3RW0A 2GTAA 3CC2V 1K5SA 5EIBD 3JATA 4OX9O 5IWAO 2GV9A 1FFTB 4OX9B 5IWAB 1OCZB 2P06A 1P84F 2ZT9B 1JQ0A 4DYLA 3ZHVA 1XREA 1SESA 2Q5ZA 1D5NA 2HJFC 1P7BA 1N33B 2FMLA 5KA6A 3ZHQA 2XAGA 2UXCO 2OIGA 2UXCB 1XUQA 4PDRA 4MTXA 2YI9A 1WPXA 1JOYA 4X20A 1FXHA 2HEPA 4J7ZA 1RP3B 1BQZA 3CYOA 4MVUA 4ABMA 1QCEA 1IDSA 2JJ2G 4LF7O 2QKAA 3MHHC 4LR3A 1Y76B 4LF7B 2H3OA 4CH3A 1SERA 3JARA 4JZ2A 3SPJA 2QR4A 4ZI7B 4B7EA 3PN1A 3ABKC 4O2BB 5B3SC 1Q90D 4PA7A 1WNSA 3OMIB 1M5IA 5LMNB 2HR3A 3P3NA 5C8YA 3K03A 1GN6A 4U3FH 5L3CA 1F51A 2YEVB 3ETDA 2YSUB 5IY5C 3OUSA 4KXRA 1X59A 1MZFA 4DW0A 4CH6A 4UCRA 3OR6C 3N2GB 5DECA 1Q7YW 1YTFB 2N05A 1G1XB 2GDSA 4DV4O 3H1HH 2K1EA 4DR6O 1ZLZA 4DV4B 5D5QA 2YXYA 4JAVA 2LW1A 5BMVB 4AI8A 1YJ9V 2Q8VA 1K9MW 3CCJV 4GZRB 1VQ7V 4QNHB 4EEQA 4NKGB 3RYCA 3ASOC 2XAFA 3EHBB 1VQ9V 4BR6A 1AR5A 5LXTA 4JI4O 1VEWA 5GONB 3FAVA 4JI4B 3G80A 1SQPH 1Q6UA 5L3DA 3G6BA 2WLMA 2DYSB 4LBEC 2PY5A 1SZXA 3D3IA 4DUZO 4LF9O 5JH7B 3CC7V 3LDCA 4LF9B 4DUZB 3R66A 2CTPA 1Z5VA 2EIMB 4P9PA 1YHQV 1NH2B 4UVAA 2XT9A 3CXCU 2KG7A 2Z3YA 1ORQC 2N04A 3CE2A 4WF9V 2OCCC 4DK1A 3NR7A 1JCHA 2EIKC 3QO5A 2MK3A 3OEEG 4H37A 3K0GA 4UCTA 3CEIA 5L3BA 1AROP 5B1BB 4LH6A 2RNBA 3HB3B 1WB7A 3BPZA 1OCZC 3ZRWB 5KHIA 4JYAO 1LUWA 3L71H 4JYAB 3VQWA 3CJHB 1AP6A 3N2KA 2RQ6A 3AG1C 1NR1A 2MW2B 4ZHQA 1PNLA 1XBLA 2ZQMA 1M90W 4F6RB 2C2AA 4X9QA 3H9VA 2AHYA 2BOBC 1KBHA 1GM7A 3A0RA 3NXSA 2W0FC 1NTKH 1SZTA 4MVZA 2YI8A 3U11A 2DQ0A 1I94B 3MHSC 1FFXB 4BIOA 1YI2V 1IZ3A 4GX0A 3ETEA 2A7WA 2IJIA 4TV9A 4LFCO 2O57A 3E35A 3JD4A 4LFCB 1CEZA 4HBNA 1NZ6A 1H2KA 3LUTB 1N34O 2P4KA 1YEWA 3SJQC 1N34B 1OHHG 4FM0A 3HKCB 3UKMA 1SETA 5LYJB 2QJ1A 1E79G 1KMIZ 2EINB 1B6QA 4JI8O 1Q8IA 1MNGA 2HLDG 2XASA 4JI8B 1K92A 1AI7A 4K8ZA 3ABUA 4DUYO 1WPBA 1VF6A 2GUZA 4DUYB 4I9WA 4LWSB 2IJJA 4JI3O 1MZEA 4JI3B 5K1PA 4MW8A 4IIJA 2ZE6A 2M7WA 2CUGA 2UXXA 5H6QA 3TETA 2ZM6O 4KUMA 3RBZA 1KD1W 3T1CA 2ZE7A 3CWBH 4X1IA 2ZM6B 3K9AA 1U96A 2Q7EA 1S0VA 2IJHA 1COWG 3AK1A 1TVKA 2CH7B 1Q81W 2P22C 1YITV 3CCLV 3E8GA 4I0XB 4W4KA 5CA0B 2RN9A 2VRZA 3LSSA 4ICGA 5IYCO 2QKCA 1MG1A 3N27A 2P90A 1M4UA 1JX9A 1NI8A 4RQFA 2DE0X 2JGDB 2Q6AA 2ZR2A 1JMKC 1IVSA 4PDMA 4KHPO 3VQYA 1N0JA 3IC7A 4KHPB 3IFXA 4I9QA 3VQVA 2UUBO 3AK2A 2UUBB 2B5UA 4DR2O 1YXBA 2X6BA 1IBMO 3JALB 2JS5A 1IBMB 2P67A 3L73H 1B06A 1IXBA 1PPJH 2QEXV 1FXKA 4TQDA 5CBFA 1IURA 3B09A 3J7AU 2WLHA 5J2UA 4DV2O 4DR1O 4TT3G 2Q4PA 3A2FA 1YCIA 4DV2B 4DR1B 3D3QA 2QDOA 1VARA 2A9HA 5LP6B 1NKDA 2E75B 1W0JG 5GW7A 1AVMA 1H8HG 2KB1A 1KC8W 1WJZA 1Y67A 2GBOA 2QKSA 1SQXH 1WA8A 1XMQO 4IYIA 3STLC 1S3JA 1XMQB 4JTAB 2HP8A 4J41A 3P30A 1ZL8A 4WFHA 3GB7C 1Y6XA 3HKEB 2A79B 3E8HA 1R3KC 2YXLA 1GTOA 1OCCB 5EC2C 3OUFA 2DMXA 1XEQA 2WPDG 2QE7G 5KHGA 1BZKA 3SPIA 3EFFK 2JEUA 2LFSA 4I55A 2WA3A 3E8FA 2L6LA 2AZ2A 4UB8Z 4WBNB 4X8AA 3GVMA 4WCEV 2W6JG 2B1IA 5EBLC 2ZNIA 3K9SA 3ZMTA 4I7ZB 1VP7A 2YUAA 1R6NA 1VQPV 2P4VA 4ZIBA 3D8CA 1SRYA 1R3IC 4UCVA 2EINC 4B3MO 4B3MB 4K0KB 2F95B 1N0NA 1L1FA 1T5EA 2LP7A 3W7SA 5IJ9B 4OPAA 4UCOA 5LA6A 4X1KB 3CMAV 4CH5A 3IJ4A 4K35A 4D7TA 5B3SB 3TGUH 1ZSPA 1N36O 3DC6A 1S76D 2QM4A 2FKXA 5KLVH 1N36B 4JPRA 1VQ6V 3JASB 3K5MA 5LOVA 3L75H 2Q9LA 2QA4V 1XHZA 4PHZA 1VQ4V 5FNVA 3G4SV 5IY5B 1FAFA 2OCHA 1HNWB 1SA0A 4FLUA 4D6TH 4JI2O 2WLIB 3W7TA 1H2SB 3FB7C 4DR5O 4JI2B 1S5LZ 1DF4A 4ZKIA 4DR5B 4IGGA 3STZC 2RCVA 4R50A 2OWOA 2DYRB 2FB5A 2RDCA 4DV1O 3B8MA 3ASOB 4LF8O 2ITCC 3ZHSA 4DV1B 1NR7A 4H0LB 4LF8B 1PP9H 1EBOA 1ZAUA 5A9GA 1EZJA 3HKBA 3FKSG 5LHIA 3K0DA 1NTMH 4PELA 2CGOA 5BXZA 3K57A 1I08A 1AB3A 3SDLA 4U7OA 4ZI7A 1HR0O 4EKWA 4JASA 4MVQA 4O2BA 1HR0B 1QR8A 2EIJB 2HFEC 4DV3B 1VQMV 1DF5A 3IAYA 3SJAC 5LP6C 1KKCA 5C93A 3FYIB 2QWQB 2AGAA 4J80A 4QE7A 4UV8A 1URFA 2BCCH 2Y48A 1NVPB 1DTOA 2Y4TA 2NR5A 3ZRXA 2QWNB 4WFAV 1NH2D 3UQ8A 4FMTA 5LGTA 2OCCB 2EIKB 1JFFB 2YIBD 1HNZO 1O9HA 3N2GA 5FL7G 1HNZB 1K4CC 2LGWA 4UCUA 4RUFA 5BMVA 1OCCC 5B5EZ 4TV8A 3L74H 5JCOC 2Y4UA 3KZIZ 3WFVA 1R6KA 2IH1C 1QNMA 4O4IA 5JQGB 5K1XA 4FK5C 1CPYA 2V7QG 3AG1B 1SF9A 4FLYA 1E1RG 1H2GA 2E5LO 5GONA 1TGOA 2E5LB 2UUCO 1F4MA 2UXBO 2UUCB 1MA1A 1AI4A 4HNAB 2UXBB 3JCUZ 3ZBHA 2QTOA 1HNXO 3JAWB 5KX5A 5JH7A 1HNXB 5CN0A 2ZXWB 4GX2A 5B1AB 4PA4A 4DRXB 1UFIA 2YIBA 1BHAA 5JJJB 1M56B 1MSDA 3CCVV 4MVOA 4FJCC 3F7YC 3AG2B 2YDEA 4GX5A 3WG7B 4O4JA 3RFRA 5B66Z 4PA3A 4DV7O 3K3WA 1FJGO 3BHPA 1FJGB 3H01A 4IHJB 1BCCH 3APOA 1M1KW 2VQEO 3CCSV 2VQEB 1PV0A 2A3QA 4X64O 4YHHO 1QHTA 3Q4HB 1S5HC 4X64B 4YHHB 1CP9A 3ZRWA 2H94A
chains in the Genus database with same CATH topology
1P84F 3BCCH 1SQXH 3L73H 2A06H 1BE3H 1PPJH 1EZVH 1BGYH 3H1HH 3H1KH 1KYOF 1NTZH 1NU1H 3L70H 1SQBH 3H1LH 1SQQH 1NTKH 3TGUH 1BCCH 1PP9H 4D6TH 5KLVH 1SQPH 1SQVH 4U3FH 3H1JH 1NTMH 3H1IH 3CXHF 3CWBH 1L0NH 3L72H 3L74H 2BCCH 2FYUH 2IBZH 3L71H 1L0LH 3CX5F 4PD4F 3L75H 1KB9F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P84 F;  3BCC H;  1SQX H;  3L73 H;  2A06 H;  1BE3 H;  1PPJ H;  1EZV H;  1BGY H;  3H1H H;  3H1K H;  1KYO F;  1NTZ H;  1NU1 H;  3L70 H;  1SQB H;  3H1L H;  1SQQ H;  1NTK H;  3TGU H;  1BCC H;  1PP9 H;  4D6T H;  5KLV H;  1SQP H;  1SQV H;  4U3F H;  3H1J H;  1NTM H;  3H1I H;  3CXH F;  3CWB H;  1L0N H;  3L72 H;  3L74 H;  2BCC H;  2FYU H;  2IBZ H;  3L71 H;  1L0L H;  3CX5 F;  4PD4 F;  3L75 H;  1KB9 F; 
#chains in the Genus database with same CATH topology
 1GRJ A;  1R1B A;  1SC5 B;  4DV0 O;  3CJH A;  3CME V;  4DV0 B;  4O4L B;  1EZV H;  1HWY A;  3SJC C;  2ZE8 A;  3BA8 A;  1S72 V;  3CRA A;  3MAQ A;  2CTW A;  1K33 A;  1Y66 A;  4FLV A;  2JGU A;  2WLJ A;  3X2Q C;  1QR9 A;  2UXD O;  3JAK B;  4DR6 B;  1WP8 A;  2UXD B;  2DYR C;  5CBH A;  5CMU A;  4TQF A;  2UUA O;  1H2M A;  2E74 B;  2P7T C;  2UUA B;  4AIL C;  4UCS A;  1YJN V;  1NQT A;  2F43 G;  2AXT Z;  1KP2 A;  2ZNJ A;  4YJ2 B;  3TXQ A;  1K34 A;  2Q0O C;  3ABM C;  3JAT B;  1GN2 A;  1I5X A;  4BW9 A;  4Z1M G;  2R9R B;  1BSM A;  3CXH F;  3HKC A;  2EUL A;  2DOS A;  4JF3 A;  3F5T A;  2KKW A;  4CZZ A;  3JSN A;  3UO2 A;  2EIJ C;  1SS3 A;  3ZHT A;  3D36 C;  2BOC C;  1YDX A;  5KA5 A;  4PA9 A;  2LW7 A;  4J10 A;  3K58 A;  3T4Z A;  4GX1 A;  1HDJ A;  1AR4 A;  1SQG A;  5EZY B;  1WN7 A;  3M7M X;  4OGQ B;  4MW3 A;  4X20 B;  3ABL C;  2ODM A;  4WFE A;  1KP3 A;  4FVM A;  4JGS A;  4BIZ A;  4NYK A;  3WB1 A;  3P32 A;  2B1G A;  3JSL A;  5GTH Z;  1R6T A;  4JAA A;  3RVY A;  2DJV A;  4O4H B;  2CH7 A;  2F4V O;  5EYP B;  3UT5 B;  2Q0A A;  2F4V B;  3C90 A;  5CA0 A;  3VBB A;  1QVF U;  3CB2 A;  4F6E A;  4QE9 A;  5LBQ A;  3CC4 V;  5H5N A;  2ATK C;  4MSW C;  4DV6 O;  1K4D C;  4JI0 O;  4DV6 B;  3RYF A;  1YSC A;  2CAZ C;  4JI0 B;  1K7D A;  1P7G A;  4AHC A;  2WLL B;  3OW2 U;  2NNU A;  3QF7 A;  4OXS A;  2JGD A;  3HR0 A;  3VQX A;  2PI4 A;  5E1A C;  4RWU A;  5JJN B;  1NBM G;  4XDL A;  2ADP A;  3F7V C;  1Q43 A;  1YIJ V;  1B3Q A;  3K04 A;  1B04 A;  1G6U A;  2ZIO A;  1GH6 A;  1VF5 B;  2KSD A;  1QVG U;  2ZXW C;  5B1A C;  4CS4 A;  2UXN A;  3KG2 A;  1H2L A;  2ZDI C;  1NTZ H;  3ZHU A;  1YZB A;  2BSK B;  5IYZ A;  3ZMS A;  1M56 C;  1XNQ O;  1GO3 F;  3ETQ A;  3H1J H;  4R7C A;  1MSW D;  1XNQ B;  3AG2 C;  3WG7 C;  3CRQ A;  3LNM B;  1M57 B;  4UVC A;  1Q86 W;  4TUY A;  4HYO A;  4MVR A;  1L0L H;  2AW9 A;  5LP6 A;  1Z5W A;  2N74 A;  1TA8 A;  5GTI Z;  1JVM A;  5ITZ B;  2F93 B;  3ZS8 C;  3FAV B;  1EN5 A;  4B08 A;  4JZG A;  3K5N A;  2WLK A;  1M93 A;  3MD0 A;  4PI0 A;  3CCU V;  3SPC A;  2E76 B;  3HKE A;  3CX5 F;  2EZO A;  3BEH A;  3DGE A;  1N8R W;  4PJ0 Z;  5CB4 B;  2LJ2 A;  4O2A B;  1XNR O;  2KG7 B;  2XAQ A;  4LH7 A;  5E79 Z;  1F23 A;  1XNR B;  4X62 O;  1PNK A;  4X62 B;  2B9Z A;  3CRM A;  1P4R A;  1PM9 A;  2ZE5 A;  3BAA A;  1H8E G;  5IT9 N;  1PNM A;  4DW1 A;  3MDS A;  2Q7G A;  1OV9 A;  4LP8 A;  4XDK A;  5JVD A;  3K06 A;  4X65 O;  1DK1 A;  5LHH A;  4UUJ C;  4X65 B;  3ZMU A;  4FFB A;  2IU0 A;  1XQ8 A;  1D5A A;  3E89 A;  3A0H Z;  4K8X A;  3N2K B;  1QU7 A;  2QWP B;  3G67 A;  1JPX A;  2VS0 A;  3IGA C;  4B3T O;  4DR2 B;  1K97 A;  4B3T B;  1H2N A;  4JAU A;  3UCS C;  2BTQ B;  4X89 A;  4TOI A;  5KHJ A;  2YID A;  3OM3 B;  1RSO B;  4J11 A;  4X88 A;  1GM9 A;  4A5U B;  3AG3 B;  2LQT A;  3CS5 A;  3ZMV A;  1IXM A;  1GKF A;  3M99 B;  1LNQ A;  3CCM V;  1RPO A;  3OR7 C;  3OGI B;  3JAS A;  1Q5O A;  3UO3 A;  4PD4 F;  4UFZ A;  2Q73 A;  3RWR D;  2JRI A;  2CTR A;  3FB8 C;  1SKV A;  1RPR A;  2R9A A;  5J2T B;  3HPL C;  2R72 A;  3EXA A;  1NT2 B;  2DW4 A;  1KUQ A;  5EIB C;  1BL8 A;  2WLI A;  4YJ3 A;  3S3W A;  2AHZ A;  4G28 B;  4HZ3 A;  3AEI A;  3BVO A;  3K79 A;  5IYB O;  2YIA A;  1BQ0 A;  4IIJ B;  2L35 A;  4D7S A;  2IH3 C;  2PUS A;  3OEH G;  4X1I B;  4LFB O;  2P6J A;  4NXM O;  4FFK A;  4LFB B;  4NXM B;  3CHX A;  1ROP A;  4B7K A;  5L3G A;  2QM7 A;  2Z0A A;  1JJ2 U;  4DXW A;  4U3J B;  3TCU A;  5IJ0 B;  3WB2 A;  4MTF A;  1JJO A;  2CGN A;  5LL6 Y;  1WB8 A;  4BIU A;  4DO2 A;  1M57 C;  1O9G A;  3R65 A;  2HG5 C;  1Q82 W;  3H1I H;  3SGI A;  2JVD A;  1GMG A;  1GN4 A;  3HKD A;  1NS1 A;  1KB9 F;  1TUB A;  2LO1 A;  3FB5 C;  4Z1V A;  1JFF A;  1LUV A;  1V54 B;  2IU3 A;  5CA3 A;  3LDE A;  4NTW A;  3K08 A;  4FIP C;  5B1N A;  4JI5 O;  4NTX A;  2BTO A;  4JI5 B;  3JYC A;  4J9Y B;  3RN4 A;  4BW5 A;  1N4C A;  4RAI A;  1ZWI C;  4P30 A;  1G4Y B;  1YVW A;  4LF5 O;  5KAI Z;  3RGB A;  3M8A A;  3EVK A;  5L3F A;  1SQB H;  4TWK A;  3S3X A;  1YJW V;  3B8N A;  3T4D A;  2ZIM A;  2ZKO A;  3OAA G;  1DLB A;  3X2Q B;  2DWE C;  1YTF D;  3IC9 A;  3AG7 A;  2AZ0 A;  3SYO A;  2IW5 A;  1PL4 A;  1K73 W;  3K59 A;  4B3R O;  2CK3 G;  4B3R B;  4CC5 A;  1XI1 A;  4F4L A;  2XND G;  4J42 A;  1K3E A;  3E22 B;  3ABM B;  1Y76 A;  1FKA O;  3AK3 A;  3DXR B;  5KAF Z;  3SPG A;  1Y4M A;  4GKJ O;  3AG3 C;  2PYL A;  5LMU O;  4GKJ B;  2ILM A;  1E1Q G;  4I55 B;  5LMU B;  4ZBM A;  3DC5 A;  4NTY A;  3H1L H;  3E2E A;  1LR1 A;  1XL6 A;  2Q67 A;  3RYH B;  3A8T A;  2LGQ A;  4IHJ A;  5DED A;  1ZTE A;  2D3O W;  3OTF A;  1F7Y A;  3FX7 A;  4CS3 A;  4G2K A;  4JYC A;  2PTM A;  4E4E A;  3Q4H A;  2YEV A;  4MS2 A;  3QO8 A;  2EX3 A;  3GWO A;  2XUM A;  3LDD A;  3ABL B;  1G8M A;  2GTS A;  3O9O A;  4I50 B;  4O4L A;  4OPH A;  2PGG A;  3WU2 Z;  1VMG A;  3I5D A;  1Y74 B;  1VF6 C;  5KUK A;  1UJW B;  3QVN A;  3CCR V;  4EB6 B;  1KQS U;  5LA6 B;  3LSU A;  1QLE C;  4L8J A;  4WFF A;  2HHH O;  4QJF B;  4IT5 A;  2HHH B;  1V55 B;  2RMK B;  4N23 A;  1X4T A;  1TAE A;  5DN6 G;  3SR2 C;  3TXS A;  5AG2 A;  1GN3 A;  4YJ2 A;  5KUM A;  2YS8 A;  2F66 C;  3W7X A;  4RQE A;  3FB6 C;  3ZMZ A;  2PYJ A;  5LOV B;  4PV1 B;  2IBZ H;  5FNV B;  4CBC A;  4GLX A;  4JI7 O;  1J5E O;  4FLZ A;  4MTG A;  1WAZ A;  4FLX A;  4JI7 B;  1J5E B;  1SA0 B;  2A06 H;  2W0X A;  1N33 O;  3H1K H;  2PI5 A;  1SQQ H;  1XMO O;  3OFN G;  2PZS A;  5H2F Z;  4ASU G;  3I56 V;  3AG4 B;  2IJK A;  1XMO B;  1AJQ A;  4FLW A;  3SYC A;  5EZY A;  5LGU A;  4CC6 A;  3CPW U;  1V54 C;  2OYQ A;  1FYJ A;  4RO2 A;  4DV7 B;  4AQY O;  5EBW C;  1FXV A;  1AR1 B;  3HKB B;  4I4T B;  4AQY B;  1THZ A;  4O4H A;  5BZB A;  1ZUQ A;  1KEC A;  5KMG B;  2YIC A;  2A0L A;  5EYP A;  3UT5 A;  3G71 V;  5CA1 B;  1FXK C;  4QIW F;  3KCY A;  5TIS Z;  4LNU B;  4JYB A;  3F5W C;  5LMN O;  4YY3 O;  1MOF A;  2WLL A;  3RYI B;  4PI2 A;  4YY3 B;  3E86 A;  2M6Y A;  4F6R A;  1QLN A;  1GK9 A;  4FM1 A;  4WFG A;  4ZOL B;  2QSA A;  2VQF O;  5LHG A;  3ZCC A;  2Q68 A;  2VQF B;  3ZED A;  2VWJ A;  1FFX A;  4X1Y B;  5EC1 C;  1OJH A;  3WB0 A;  3ASN C;  1CXZ B;  2DQ3 A;  1VF7 A;  1D2D A;  3JD1 A;  2D2C B;  4H33 A;  3CCE V;  2V1D A;  2XAH A;  2JK5 C;  4TV8 B;  4GT1 A;  2BSK A;  3ZRV A;  4U7N A;  2PF4 E;  4FM2 A;  4O4I B;  2CDY A;  3PJS K;  3GWK C;  5LYJ A;  2OTJ V;  2NLJ C;  1F4N A;  4JTD B;  5IYD O;  5ITZ A;  3B4S A;  4NVP A;  2UU9 O;  1NJI W;  3DSQ A;  3B40 A;  2UU9 B;  4N21 A;  4LWS A;  4TSF G;  2G38 A;  5B1O A;  3OMA B;  4P2Z A;  2F1M A;  3L72 H;  1AI6 A;  4QPK A;  1AI5 A;  1A32 A;  1BT8 A;  2QWR B;  2QTS A;  1QQC A;  5KX5 B;  3FD9 A;  1W0K G;  1S77 D;  3SJB C;  4I5S A;  1EN6 A;  5CB4 A;  1FPO A;  2HVK C;  1I7F A;  4O2A A;  1IX9 A;  1VQK V;  4I0X A;  3RT3 C;  3JAR B;  4EFB A;  2GSM B;  3QNE A;  4JYY A;  1V55 C;  2K9P A;  4O4J B;  3B77 A;  1OCO B;  4JI6 O;  4XBF A;  4JI6 B;  3U0Z A;  2Y0P A;  3BY6 A;  5C8Y B;  3W7U A;  4J9Z B;  2WA4 A;  1Z2G A;  2E3C A;  4UXN A;  3UM7 A;  1UPG A;  2JJ1 G;  4FPP A;  1VQL V;  1W59 A;  1OZ0 A;  4R6Z A;  3G6E V;  5FPR A;  2HVJ C;  3FFQ A;  4UB6 Z;  4G27 B;  4MVM A;  4Q6G A;  4BWA A;  2OT5 A;  2ZCE A;  3J80 N;  1ENV A;  3JAL A;  1V9P A;  2BTQ A;  5IE9 A;  3AG4 C;  4PDL A;  4KP4 A;  5JWP A;  2WLN A;  1XL4 A;  1RSO A;  4LC1 A;  1I94 O;  2EIL B;  3ZN1 A;  5EBM C;  5H6R A;  2BE3 A;  2XTA A;  3RYC B;  2QGN A;  5D5P A;  3T1Y O;  3T1Y B;  2JS3 A;  2ZR3 A;  3CRC A;  1AJP A;  4DR7 O;  5LXT B;  3CRR A;  1RM1 B;  5IDJ A;  3APQ A;  4NXN O;  4DR7 B;  1BE3 H;  5H9C A;  1K8A W;  2X6C A;  4NXN B;  1BGY H;  4KFM A;  1XIL A;  3BAB A;  5J2T A;  3ZHR A;  2V4D A;  3JCZ A;  1M9N A;  3JD2 A;  5HFL A;  4Q20 A;  4MT8 A;  2WAM A;  3ZIA G;  3ZN0 A;  4LF6 O;  4H44 B;  1AIL A;  2X0L A;  4LF6 B;  4RUE A;  4FLT A;  5JCO A;  5DM6 V;  2EJ7 A;  1XDC A;  5FPO A;  2LFR A;  3ZJZ A;  1L0N H;  5JJE B;  2R9I A;  1TUE B;  3JAM N;  3OT7 A;  4YIO A;  3KCX A;  3CP1 A;  2OTL V;  4W4L A;  4WBN A;  1JR9 A;  5FLX N;  2CE4 A;  4DV5 O;  2RJZ A;  4U3J A;  4WFB V;  3JD0 A;  5IJ0 A;  3C3T A;  4DV5 B;  3U10 A;  1HP8 A;  2JEX A;  1EN4 A;  2Y69 B;  3ZX6 A;  4P9O A;  2ZD9 A;  3RYF B;  3QG5 A;  4JI1 O;  4YXW G;  3TK1 A;  3LSQ A;  4ZHQ B;  4JI1 B;  1VIB A;  1FS0 G;  5IJ9 A;  3CCQ V;  4IL6 Z;  1PL0 A;  1US6 A;  4DK0 A;  4IYH A;  1J95 A;  4X1K A;  3BA9 A;  1BS3 A;  2R70 A;  2DYS C;  1R3J C;  2Y0I A;  1K5Q A;  2YXH A;  3OMN B;  3ICX A;  5EK0 A;  1VQ5 V;  1XOU A;  2QM8 A;  4L87 A;  2GHY A;  4TV9 B;  4FZ0 A;  2EIM C;  5KHK A;  1L8D A;  4CH4 A;  3I55 V;  5IYZ B;  1P49 A;  1OCR B;  5CBG A;  4H13 B;  2EJR A;  1FD9 A;  1NVP D;  2ZIN A;  1SQV H;  2X6A A;  4TUY B;  1MAB G;  1OCO C;  3A0B Z;  2XHB A;  4UVB A;  2ETN A;  4FZ1 A;  3BCC H;  5B1B C;  2GUZ B;  3C3S A;  1IBL O;  1IBK O;  4QPJ A;  1IBL B;  2P5O A;  1IBK B;  3RVZ A;  1QLE B;  5KHH A;  5BY1 A;  2HJD A;  2X7R B;  3L9D A;  2XOK G;  4DR3 O;  4LFA O;  4DR3 B;  3E22 A;  5J9P C;  2JIZ G;  3K5L A;  1WLE A;  4LFA B;  5A2Q N;  1TVK B;  2EBO A;  3W7W A;  1BMF G;  3DXR A;  4XDJ A;  3ML0 A;  3CSX A;  3KKY A;  4EFE A;  2EIL C;  4LCU C;  3BFR A;  3THO A;  4UV9 A;  2NN4 A;  3D36 A;  3J81 N;  3OE7 G;  3RYH A;  2ARH A;  4NR1 A;  3ETG A;  1RM1 C;  4YIP A;  1Q6I A;  2XAJ A;  3K5O A;  4C7U A;  5JVD B;  1VQO V;  3ZRS A;  1RFY A;  2CTQ A;  1ZX3 A;  2F23 A;  4FFB B;  3T1H O;  2IM9 A;  2FTK A;  4BAY A;  3T1H B;  1NU1 H;  1I5Y A;  3E8B A;  3VOU A;  2ADQ B;  3TJT A;  4J7K A;  1BHB A;  4I50 A;  2FL4 A;  3OD4 A;  4K0K O;  1EFR G;  3QO7 A;  3QTC A;  3CD6 V;  3E83 A;  1Y74 A;  5F2V O;  3SYA A;  4EB6 A;  4B3S O;  1FXK B;  2YC0 A;  4GUN A;  4B3S B;  1VQ8 V;  3ABK B;  2Q69 A;  5LGN A;  2Q7H A;  5JQG A;  5J2U B;  1GAX A;  4LF5 B;  2H8P C;  4GKK O;  4NB5 A;  2QWO B;  4GKK B;  2WWW A;  3DTU B;  2OIE A;  3B2E E;  1WP7 A;  1GM8 A;  1DGS A;  3O65 A;  1U97 A;  1WA8 B;  1XHX A;  2VWK A;  1Q3E A;  2WSS G;  1R73 A;  2JDI G;  4HNA A;  3P3P A;  1HNW O;  3OGC C;  2Y69 C;  3JAW A;  4MVS A;  2HKO A;  3ASN B;  1ZL8 B;  2DN9 A;  4JV5 O;  3T2M A;  3BRC A;  4YJ3 B;  4JV5 B;  4KL1 A;  3LNN A;  2ZDI A;  2FYU H;  4DRX A;  3OTO O;  1EM1 A;  1HW7 A;  1KKD A;  4X66 O;  2KQX A;  2ITD C;  3OTO B;  4X66 B;  4PA6 A;  4J7J A;  3FYE B;  4LF4 O;  4CS2 A;  3L70 H;  4LF4 B;  1N32 O;  1VQN V;  5BR8 O;  4E2L A;  1YF2 A;  1PKX A;  1N32 B;  4I4T A;  5BR8 B;  4K3A A;  5KMG A;  5CA1 A;  3JD3 A;  1W2B U;  4R8C A;  3SPH A;  1OCR C;  1R3L C;  1KU9 A;  4DV3 O;  1PD3 A;  4LNU A;  4QGP A;  1QBZ A;  3RYI A;  3SYP A;  1AP5 A;  2EZP A;  2DWD C;  1JA8 A;  1AJN A;  3HKD B;  4ZOL A;  1TUB B;  1Q6H A;  3JAK A;  4GYC B;  5HFM A;  3ABT A;  4DR4 O;  1SQF A;  4PDV A;  4MTO A;  4DR4 B;  1MMM A;  4Z2W A;  5L3E A;  4X1Y A;  2Z5U A;  1S5J A;  1I0H A;  2W6I G;  1KYO F;  4HAM A;  4JTC B;  3SYQ A;  1H38 A;  4GCZ A;  3RW0 A;  2GTA A;  3CC2 V;  1K5S A;  5EIB D;  3JAT A;  4OX9 O;  5IWA O;  2GV9 A;  1FFT B;  4OX9 B;  5IWA B;  1OCZ B;  2P06 A;  1P84 F;  2ZT9 B;  1JQ0 A;  4DYL A;  3ZHV A;  1XRE A;  1SES A;  2Q5Z A;  1D5N A;  2HJF C;  1P7B A;  1N33 B;  2FML A;  5KA6 A;  3ZHQ A;  2XAG A;  2UXC O;  2OIG A;  2UXC B;  1XUQ A;  4PDR A;  4MTX A;  2YI9 A;  1WPX A;  1JOY A;  4X20 A;  1FXH A;  2HEP A;  4J7Z A;  1RP3 B;  1BQZ A;  3CYO A;  4MVU A;  4ABM A;  1QCE A;  1IDS A;  2JJ2 G;  4LF7 O;  2QKA A;  3MHH C;  4LR3 A;  1Y76 B;  4LF7 B;  2H3O A;  4CH3 A;  1SER A;  3JAR A;  4JZ2 A;  3SPJ A;  2QR4 A;  4ZI7 B;  4B7E A;  3PN1 A;  3ABK C;  4O2B B;  5B3S C;  1Q90 D;  4PA7 A;  1WNS A;  3OMI B;  1M5I A;  5LMN B;  2HR3 A;  3P3N A;  5C8Y A;  3K03 A;  1GN6 A;  4U3F H;  5L3C A;  1F51 A;  2YEV B;  3ETD A;  2YSU B;  5IY5 C;  3OUS A;  4KXR A;  1X59 A;  1MZF A;  4DW0 A;  4CH6 A;  4UCR A;  3OR6 C;  3N2G B;  5DEC A;  1Q7Y W;  1YTF B;  2N05 A;  1G1X B;  2GDS A;  4DV4 O;  3H1H H;  2K1E A;  4DR6 O;  1ZLZ A;  4DV4 B;  5D5Q A;  2YXY A;  4JAV A;  2LW1 A;  5BMV B;  4AI8 A;  1YJ9 V;  2Q8V A;  1K9M W;  3CCJ V;  4GZR B;  1VQ7 V;  4QNH B;  4EEQ A;  4NKG B;  3RYC A;  3ASO C;  2XAF A;  3EHB B;  1VQ9 V;  4BR6 A;  1AR5 A;  5LXT A;  4JI4 O;  1VEW A;  5GON B;  3FAV A;  4JI4 B;  3G80 A;  1SQP H;  1Q6U A;  5L3D A;  3G6B A;  2WLM A;  2DYS B;  4LBE C;  2PY5 A;  1SZX A;  3D3I A;  4DUZ O;  4LF9 O;  5JH7 B;  3CC7 V;  3LDC A;  4LF9 B;  4DUZ B;  3R66 A;  2CTP A;  1Z5V A;  2EIM B;  4P9P A;  1YHQ V;  1NH2 B;  4UVA A;  2XT9 A;  3CXC U;  2KG7 A;  2Z3Y A;  1ORQ C;  2N04 A;  3CE2 A;  4WF9 V;  2OCC C;  4DK1 A;  3NR7 A;  1JCH A;  2EIK C;  3QO5 A;  2MK3 A;  3OEE G;  4H37 A;  3K0G A;  4UCT A;  3CEI A;  5L3B A;  1ARO P;  5B1B B;  4LH6 A;  2RNB A;  3HB3 B;  1WB7 A;  3BPZ A;  1OCZ C;  3ZRW B;  5KHI A;  4JYA O;  1LUW A;  3L71 H;  4JYA B;  3VQW A;  3CJH B;  1AP6 A;  3N2K A;  2RQ6 A;  3AG1 C;  1NR1 A;  2MW2 B;  4ZHQ A;  1PNL A;  1XBL A;  2ZQM A;  1M90 W;  4F6R B;  2C2A A;  4X9Q A;  3H9V A;  2AHY A;  2BOB C;  1KBH A;  1GM7 A;  3A0R A;  3NXS A;  2W0F C;  1NTK H;  1SZT A;  4MVZ A;  2YI8 A;  3U11 A;  2DQ0 A;  1I94 B;  3MHS C;  1FFX B;  4BIO A;  1YI2 V;  1IZ3 A;  4GX0 A;  3ETE A;  2A7W A;  2IJI A;  4TV9 A;  4LFC O;  2O57 A;  3E35 A;  3JD4 A;  4LFC B;  1CEZ A;  4HBN A;  1NZ6 A;  1H2K A;  3LUT B;  1N34 O;  2P4K A;  1YEW A;  3SJQ C;  1N34 B;  1OHH G;  4FM0 A;  3HKC B;  3UKM A;  1SET A;  5LYJ B;  2QJ1 A;  1E79 G;  1KMI Z;  2EIN B;  1B6Q A;  4JI8 O;  1Q8I A;  1MNG A;  2HLD G;  2XAS A;  4JI8 B;  1K92 A;  1AI7 A;  4K8Z A;  3ABU A;  4DUY O;  1WPB A;  1VF6 A;  2GUZ A;  4DUY B;  4I9W A;  4LWS B;  2IJJ A;  4JI3 O;  1MZE A;  4JI3 B;  5K1P A;  4MW8 A;  4IIJ A;  2ZE6 A;  2M7W A;  2CUG A;  2UXX A;  5H6Q A;  3TET A;  2ZM6 O;  4KUM A;  3RBZ A;  1KD1 W;  3T1C A;  2ZE7 A;  3CWB H;  4X1I A;  2ZM6 B;  3K9A A;  1U96 A;  2Q7E A;  1S0V A;  2IJH A;  1COW G;  3AK1 A;  1TVK A;  2CH7 B;  1Q81 W;  2P22 C;  1YIT V;  3CCL V;  3E8G A;  4I0X B;  4W4K A;  5CA0 B;  2RN9 A;  2VRZ A;  3LSS A;  4ICG A;  5IYC O;  2QKC A;  1MG1 A;  3N27 A;  2P90 A;  1M4U A;  1JX9 A;  1NI8 A;  4RQF A;  2DE0 X;  2JGD B;  2Q6A A;  2ZR2 A;  1JMK C;  1IVS A;  4PDM A;  4KHP O;  3VQY A;  1N0J A;  3IC7 A;  4KHP B;  3IFX A;  4I9Q A;  3VQV A;  2UUB O;  3AK2 A;  2UUB B;  2B5U A;  4DR2 O;  1YXB A;  2X6B A;  1IBM O;  3JAL B;  2JS5 A;  1IBM B;  2P67 A;  3L73 H;  1B06 A;  1IXB A;  1PPJ H;  2QEX V;  1FXK A;  4TQD A;  5CBF A;  1IUR A;  3B09 A;  3J7A U;  2WLH A;  5J2U A;  4DV2 O;  4DR1 O;  4TT3 G;  2Q4P A;  3A2F A;  1YCI A;  4DV2 B;  4DR1 B;  3D3Q A;  2QDO A;  1VAR A;  2A9H A;  5LP6 B;  1NKD A;  2E75 B;  1W0J G;  5GW7 A;  1AVM A;  1H8H G;  2KB1 A;  1KC8 W;  1WJZ A;  1Y67 A;  2GBO A;  2QKS A;  1SQX H;  1WA8 A;  1XMQ O;  4IYI A;  3STL C;  1S3J A;  1XMQ B;  4JTA B;  2HP8 A;  4J41 A;  3P30 A;  1ZL8 A;  4WFH A;  3GB7 C;  1Y6X A;  3HKE B;  2A79 B;  3E8H A;  1R3K C;  2YXL A;  1GTO A;  1OCC B;  5EC2 C;  3OUF A;  2DMX A;  1XEQ A;  2WPD G;  2QE7 G;  5KHG A;  1BZK A;  3SPI A;  3EFF K;  2JEU A;  2LFS A;  4I55 A;  2WA3 A;  3E8F A;  2L6L A;  2AZ2 A;  4UB8 Z;  4WBN B;  4X8A A;  3GVM A;  4WCE V;  2W6J G;  2B1I A;  5EBL C;  2ZNI A;  3K9S A;  3ZMT A;  4I7Z B;  1VP7 A;  2YUA A;  1R6N A;  1VQP V;  2P4V A;  4ZIB A;  3D8C A;  1SRY A;  1R3I C;  4UCV A;  2EIN C;  4B3M O;  4B3M B;  4K0K B;  2F95 B;  1N0N A;  1L1F A;  1T5E A;  2LP7 A;  3W7S A;  5IJ9 B;  4OPA A;  4UCO A;  5LA6 A;  4X1K B;  3CMA V;  4CH5 A;  3IJ4 A;  4K35 A;  4D7T A;  5B3S B;  3TGU H;  1ZSP A;  1N36 O;  3DC6 A;  1S76 D;  2QM4 A;  2FKX A;  5KLV H;  1N36 B;  4JPR A;  1VQ6 V;  3JAS B;  3K5M A;  5LOV A;  3L75 H;  2Q9L A;  2QA4 V;  1XHZ A;  4PHZ A;  1VQ4 V;  5FNV A;  3G4S V;  5IY5 B;  1FAF A;  2OCH A;  1HNW B;  1SA0 A;  4FLU A;  4D6T H;  4JI2 O;  2WLI B;  3W7T A;  1H2S B;  3FB7 C;  4DR5 O;  4JI2 B;  1S5L Z;  1DF4 A;  4ZKI A;  4DR5 B;  4IGG A;  3STZ C;  2RCV A;  4R50 A;  2OWO A;  2DYR B;  2FB5 A;  2RDC A;  4DV1 O;  3B8M A;  3ASO B;  4LF8 O;  2ITC C;  3ZHS A;  4DV1 B;  1NR7 A;  4H0L B;  4LF8 B;  1PP9 H;  1EBO A;  1ZAU A;  5A9G A;  1EZJ A;  3HKB A;  3FKS G;  5LHI A;  3K0D A;  1NTM H;  4PEL A;  2CGO A;  5BXZ A;  3K57 A;  1I08 A;  1AB3 A;  3SDL A;  4U7O A;  4ZI7 A;  1HR0 O;  4EKW A;  4JAS A;  4MVQ A;  4O2B A;  1HR0 B;  1QR8 A;  2EIJ B;  2HFE C;  4DV3 B;  1VQM V;  1DF5 A;  3IAY A;  3SJA C;  5LP6 C;  1KKC A;  5C93 A;  3FYI B;  2QWQ B;  2AGA A;  4J80 A;  4QE7 A;  4UV8 A;  1URF A;  2BCC H;  2Y48 A;  1NVP B;  1DTO A;  2Y4T A;  2NR5 A;  3ZRX A;  2QWN B;  4WFA V;  1NH2 D;  3UQ8 A;  4FMT A;  5LGT A;  2OCC B;  2EIK B;  1JFF B;  2YIB D;  1HNZ O;  1O9H A;  3N2G A;  5FL7 G;  1HNZ B;  1K4C C;  2LGW A;  4UCU A;  4RUF A;  5BMV A;  1OCC C;  5B5E Z;  4TV8 A;  3L74 H;  5JCO C;  2Y4U A;  3KZI Z;  3WFV A;  1R6K A;  2IH1 C;  1QNM A;  4O4I A;  5JQG B;  5K1X A;  4FK5 C;  1CPY A;  2V7Q G;  3AG1 B;  1SF9 A;  4FLY A;  1E1R G;  1H2G A;  2E5L O;  5GON A;  1TGO A;  2E5L B;  2UUC O;  1F4M A;  2UXB O;  2UUC B;  1MA1 A;  1AI4 A;  4HNA B;  2UXB B;  3JCU Z;  3ZBH A;  2QTO A;  1HNX O;  3JAW B;  5KX5 A;  5JH7 A;  1HNX B;  5CN0 A;  2ZXW B;  4GX2 A;  5B1A B;  4PA4 A;  4DRX B;  1UFI A;  2YIB A;  1BHA A;  5JJJ B;  1M56 B;  1MSD A;  3CCV V;  4MVO A;  4FJC C;  3F7Y C;  3AG2 B;  2YDE A;  4GX5 A;  3WG7 B;  4O4J A;  3RFR A;  5B66 Z;  4PA3 A;  4DV7 O;  3K3W A;  1FJG O;  3BHP A;  1FJG B;  3H01 A;  4IHJ B;  1BCC H;  3APO A;  1M1K W;  2VQE O;  3CCS V;  2VQE B;  1PV0 A;  2A3Q A;  4X64 O;  4YHH O;  1QHT A;  3Q4H B;  1S5H C;  4X64 B;  4YHH B;  1CP9 A;  3ZRW A;  2H94 A; 
#chains in the Genus database with same CATH homology
 1P84 F;  3BCC H;  1SQX H;  3L73 H;  2A06 H;  1BE3 H;  1PPJ H;  1EZV H;  1BGY H;  3H1H H;  3H1K H;  1KYO F;  1NTZ H;  1NU1 H;  3L70 H;  1SQB H;  3H1L H;  1SQQ H;  1NTK H;  3TGU H;  1BCC H;  1PP9 H;  4D6T H;  5KLV H;  1SQP H;  1SQV H;  4U3F H;  3H1J H;  1NTM H;  3H1I H;  3CXH F;  3CWB H;  1L0N H;  3L72 H;  3L74 H;  2BCC H;  2FYU H;  2IBZ H;  3L71 H;  1L0L H;  3CX5 F;  4PD4 F;  3L75 H;  1KB9 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...