1P84F

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
74
structure length
74
Chain Sequence
VTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
total genus 27
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1p84F00
1NTMH 1SQBH 3CWBH 2BCCH 2IBZH 1SQXH 2FYUH 1BE3H 1NU1H 5KLVH 1PPJH 1PP9H 3BCCH 1SQVH 3L71H 3L72H 3L74H 3CX5F 3H1LH 3H1JH 1KYOF 4PD4F 1EZVH 1KB9F 2A06H 4D6TH 1L0NH 3L70H 3L73H 4U3FH 3CXHF 1SQPH 1P84F 1BCCH 1L0LH 1SQQH 3H1IH 3L75H 3H1KH 3TGUH 1BGYH 1NTZH 1NTKH 3H1HH
chains in the Genus database with same CATH superfamily
4X65B 1VQLV 4CH3A 2NN4A 4JZGA 1SRYA 1YHQV 3B4SA 1Q6IA 4I55A 2CH7A 3P30A 3L70H 2P22C 4LP8A 1K7DA 3AG2C 3U10A 2XAFA 2A0LA 3JASA 4FIPC 3H1IH 3RYFA 4PA7A 3OR6C 4LF7B 1UFIA 4JI0B 2W0XA 1GH6A 3BCCH 4HZ3A 3ZMVA 4DRXA 4C7UA 3BY6A 3JD2A 4UVAA 3CCVV 4B7KA 1OZ0A 2KKWA 2Y0IA 3AG4C 4EKWA 3CCQV 1H2NA 3OUSA 1V9PA 2OCHA 1RP3B 1SS3A 5B1OA 1PNLA 1JA8A 4DV0O 4MVZA 5EBMC 2R72A 4DV3B 1VF7A 1BZKA 3RWRD 3CMEV 4EFEA 4FK5C 5H6RA 4CH5A 4QE7A 3CX5F 2PYJA 1M57C 1VQ5V 3TETA 1XILA 1FYJA 2ZR3A 1RPOA 4JI6O 3SDLA 3CD6V 2UUCB 2WLLB 1GKFA 2CUGA 2DYSC 5E1AC 3K5OA 5LGNA 1ZL8B 4LF4O 3D8CA 1K9MW 4QIWF 3CB2A 2KSDA 4FLZA 1AVMA 1G6UA 1SQPH 5IYZB 2PTMA 3CC4V 3J7AU 5A2QN 3K04A 2F1MA 2ZDIC 2AW9A 4JF3A 3JALA 2F95B 3DTUB 5D5PA 3FKSG 2A79B 3A0BZ 3H01A 3ZMZA 2VQEB 4YIPA 4ZHQA 4B08A 5HFMA 4QJFB 4GKKB 4JYAO 2FTKA 4EFBA 3RW0A 3OUFA 3AG2B 1E79G 4Z1VA 5JVDA 5KX5A 2LFSA 4DR2O 4EB6B 1QLNA 1MNGA 4UCVA 1Q6HA 3VQXA 3STLC 5BMVA 5LP6A 4NXNB 4DV2B 1JJOA 4WFGA 4GX1A 3WB2A 4JAAA 2F4VO 2Q9LA 4BR6A 2EIKB 2UXDO 3JATB 4LF9B 1R3KC 4O2BA 3E2EA 4JYCA 4FLTA 2JVDA 1BQ0A 3ABLC 2A3QA 3TXSA 1YJNV 2L6LA 1E1RG 2YC0A 1TVKA 2JJ2G 1MG1A 5EIBC 5KMGA 1Q43A 1JFFA 3G6EV 2WLJA 1FXVA 3JD3A 1P49A 4DR5O 2IM9A 4FM1A 1AI5A 2GBOA 2QR4A 2CGNA 4QPJA 4TQFA 1JR9A 2QDOA 4AQYO 4MTXA 1FJGB 2HHHB 2LP7A 5LBQA 1YSCA 4PA3A 5KX5B 1Y67A 5CA0A 3ZX6A 3VQVA 2HFEC 1S5HC 1J95A 4R50A 3SYCA 2YDEA 1IBLB 3APQA 2ZE7A 3K9SA 3N27A 3A8TA 2P4KA 1VEWA 1VMGA 2QA4V 2AHZA 1LR1A 3H1KH 4KL1A 1DLBA 5C8YA 2RN9A 2HG5C 4YHHO 3M8AA 4J11A 5B1NA 2BTQA 2N05A 3CE2A 3LSUA 1XOUA 2CE4A 2EZOA 3ZHUA 1XMQO 4F6RA 4X1KB 2XHBA 1IBMO 1LNQA 5LP6C 2XOKG 2Q67A 4Q20A 1G4YB 1XI1A 1WN7A 1XDCA 4FLUA 5LHHA 1HNWO 2B9ZA 1FXHA 2QTOA 4X62O 4Z1MG 3C3SA 4JI8B 1NH2D 5JCOC 4K8XA 5JJJB 1SZXA 4MVSA 3K58A 2ZM6O 1D5NA 3LNMB 4JTDB 3HR0A 1YTFB 4JASA 3U0ZA 3K06A 4JI4O 1OCOB 2FL4A 2DWDC 4YJ3A 4DK0A 1Y76A 3B77A 3IFXA 3ZN0A 2HEPA 2UUAB 2HVJC 3PJSK 1M93A 4TOIA 3FAVB 1NQTA 5L3GA 2BTQB 1RPRA 3CHXA 4OPHA 1ZL8A 3R66A 1VP7A 5L3CA 4KHPO 4DW0A 1QU7A 5LMNO 3A2FA 5BR8B 3BEHA 4DV1B 4JI2O 5B3SB 2ZXWB 5IYZA 3U11A 2YI9A 5KA5A 3ZMSA 1VQPV 5LGTA 4TSFG 5L3DA 4FFBA 2R9IA 2ADQB 4JZ2A 4DV6B 4H33A 2RCVA 1GRJA 3ABLB 2Q7HA 1PNKA 1Y74B 4EB6A 3WU2Z 4GUNA 3MAQA 4CC5A 2AZ0A 4IGGA 1JMKC 2M6YA 2JGDB 5EBLC 4DK1A 4YJ3B 3D36C 5FPRA 2OTJV 2NLJC 1KB9F 3F7VC 5IT9N 2GTAA 2RJZA 4L8JA 1KBHA 3N2KA 2HP8A 2V7QG 2DYRB 4JI7B 2E5LO 3QTCA 1PP9H 3ZMTA 2OIEA 2R70A 4A5UB 1RFYA 3EFFK 3UT5A 2JRIA 3ASOC 2ITDC 1YVWA 1P84F 4JI3O 3TXQA 1SC5B 3JCUZ 4DV5O 5KUMA 4O4JA 2UUBB 1VF6A 2QWPB 4G28B 4K3AA 2XTAA 3STZC 4D7SA 1NH2B 3H9VA 2ZT9B 4JV5B 2YXYA 4LF6B 3CPWU 4YXWG 3OM3B 3T2MA 3HKBA 1AP6A 4U3FH 3HPLC 3DXRB 3K0DA 2QM8A 4KUMA 3Q4HA 1TGOA 4CZZA 3LDEA 4L87A 2EIMC 2GTSA 4ICGA 3LDDA 4LNUA 4MVRA 1XNRO 5IY5C 5LXTB 1AR5A 1J5EB 3CCUV 4QNHB 1ZTEA 1SF9A 1M1KW 1OCCB 2UU9B 1EN4A 3C3TA 3BPZA 2VQFB 4K35A 3JCZA 3D36A 1FFXB 3B40A 3SPIA 5BXZA 2XUMA 4AILC 1PPJH 1H8EG 4X20B 1XNQB 4B3TO 3KZIZ 4RUEA 1OCRB 3AK2A 4LWSB 5FNVB 1XHZA 1PV0A 1R73A 3HKBB 3FFQA 4BIOA 1OCRC 1COWG 3ABUA 4MTOA 5LGUA 2PGGA 2DE0X 2QKSA 2V4DA 1N32O 1JQ0A 1L1FA 1V54C 1WB7A 3BVOA 1XMOO 1Y76B 1KU9A 4GYCB 3AG1C 2ZKOA 2DOSA 5KHGA 3UCSC 2B1IA 3UKMA 3OMIB 1RM1B 4KFMA 4XDJA 1Q90D 1YJ9V 4FJCC 3SPCA 4MSWC 1IZ3A 4FMTA 1ZLZA 3CS5A 3CRMA 3PN1A 1N36O 1HNZB 2OCCB 1RM1C 1YJWV 3ZIAG 1FFXA 4LFCB 4UCUA 3RYIB 1N34O 2YEVB 1WJZA 3CCJV 3EHBB 3SJBC 1SZTA 1Y6XA 3ZRWB 4B3RO 1YF2A 4BWAA 3JD4A 1I08A 3AK1A 5FNVA 2ARHA 4YJ2A 1HR0B 1SQVH 5K1PA 2ZQMA 4FZ1A 1Q82W 3W7WA 4ZKIA 1K34A 1S76D 1XBLA 3WG7B 1CEZA 1HNXB 4B3MB 5KHHA 1BCCH 2JGDA 1ZX3A 3OTFA 4TUYB 4PV1B 1XUQA 4RWUA 3D3IA 1K4DC 1KQSU 4CBCA 4JPRA 2Y4TA 3HKCA 4GKJO 1OHHG 1OCZC 1D2DA 4WFBV 3CP1A 3OMNB 4FFKA 4E4EA 3SR2C 1SKVA 3SJQC 3MHHC 5EC1C 4JAVA 3TCUA 2EJ7A 5LMUO 3OT7A 3CMAV 1QBZA 4PI2A 4DR7B 5K1XA 3RYIA 1U96A 4OPAA 4OGQB 1LUVA 2YEVA 1YEWA 1AILA 3X2QB 1RSOA 4IL6Z 1K97A 3GB7C 3WB1A 3APOA 4PD4F 4YJ2B 3T1YB 1IX9A 5L3FA 5DEDA 1YDXA 3O65A 4XDKA 3VQWA 3QVNA 4N23A 5IYBO 2L35A 3K59A 1QQCA 2UXBB 2CH7B 1QR9A 1WPBA 2Q73A 5A9GA 4ZI7B 1QVFU 2PI4A 4TUYA 4NR1A 3B09A 4R7CA 4H0LB 5CN0A 4J7KA 3AK3A 4YY3O 4JGSA 4P30A 3OR7C 1K3EA 3HKCB 4B7EA 3L9DA 1GM8A 5IWAO 5H6QA 1KP2A 1M56B 2CTRA 4JYBA 1N33O 2OTLV 2PI5A 4UB6Z 3KKYA 2Y69B 4DUYB 4LFAB 4DXWA 1K8AW 1JPXA 3OTOO 4DV4B 1B3QA 1KYOF 5IJ0A 2HVKC 4J42A 2IU0A 5H9CA 1NVPB 3JAWB 3OAAG 5LHGA 2LGWA 2BSKA 2ZIOA 3JAKB 3FYIB 4JI5O 1AB3A 1SA0B 2EBOA 4X65O 4UFZA 3ABTA 4HYOA 1ROPA 2EZPA 2LGQA 4DUZO 3OE7G 4BAYA 1G1XB 4WFHA 3ZS8C 2E76B 3FYEB 1VIBA 1YXBA 4JTCB 3SYPA 2EILB 4DV7O 3RYHA 4OXSA 3RT3C 1WAZA 4JI0O 1S5JA 2DWEC 5EK0A 3CYOA 2PUSA 3BHPA 4BIUA 1K5QA 2Q6AA 1NT2B 3CCEV 1M56C 4MVOA 1K5SA 4DR4O 4R6ZA 3ZEDA 2EULA 3T4DA 5JH7A 5LA6B 2XT9A 1SESA 5EIBD 2QWRB 3HKEB 2H94A 5LOVB 3T1CA 1R3JC 2JEXA 2CK3G 5IJ9A 4CS3A 1JX9A 1HDJA 2LW1A 1XHXA 4X66B 3KG2A 4JI6B 2LQTA 1ZWIC 4I0XB 3SJCC 3JATA 5GTHZ 1NR7A 3JYCA 2WLHA 1QCEA 4U7NA 3RYHB 1I5YA 4O4LB 4WBNA 1SQGA 2IH3C 2XAGA 1GN4A 4I7ZB 1H2GA 2BOCC 3D3QA 4K0KO 5LHIA 1MABG 3K5MA 2QJ1A 1H2MA 4JYYA 1URFA 3QF7A 2GSMB 3JD0A 1TUBA 4KP4A 2Q7EA 4DYLA 1NKDA 2EIMB 4J80A 2IJHA 3CRAA 1I7FA 5JH7B 2OIGA 5LA6A 1EN5A 2ODMA 4DR2B 1GO3F 3R65A 4FLWA 3ZN1A 4X1YA 4N21A 1FXKA 5LOVA 4DR3B 2BTOA 3K08A 4I4TA 4IT5A 5CB4A 1QNMA 4NXNO 2F4VB 2A9HA 4UCRA 3K9AA 1GMGA 3FB6C 4LF9O 2HR3A 1R3LC 3I5DA 1Y4MA 2DW4A 4IYHA 3K79A 4UVBA 4MVQA 3T1HB 4PHZA 4JAUA 2N74A 4ASUG 5L3EA 1IBKO 2G38A 2ADPA 1IDSA 1XL6A 2BCCH 2ZIMA 4JTAB 4FLXA 1Z2GA 3L74H 5EYPB 3UM7A 1W0KG 2QKCA 2OT5A 2IJKA 2F43G 1G8MA 1XEQA 1NI8A 1AR1B 5BY1A 4CH4A 1VQ8V 4LBEC 2E74B 2XAHA 4AQYB 1FJGO 1KC8W 4NXMB 3E35A 2X7RB 3TK1A 4X1YB 2GUZB 1R3IC 3A0RA 1X4TA 3QO8A 4FVMA 2ZINA 1JVMA 4QGPA 2PZSA 1IBLO 1I0HA 2DQ0A 3F5TA 2ILMA 4RQFA 5D5QA 4WF9V 3RYCB 1QR8A 3X2QC 4CS2A 4NTWA 4ZOLB 4IYIA 1QLEB 5B3SC 3ZHRA 2P67A 1XMQB 1VQ4V 1FXKC 1T5EA 3F7YC 2O57A 1EZVH 2Q69A 1IBMB 3RYFB 4B3SO 5H2FZ 4MW8A 3CXHF 4I9QA 5B5EZ 5KAFZ 5EYPA 3GVMA 3UQ8A 4TV9B 1BT8A 2WLKA 1ZUQA 1EM1A 2YUAA 4I55B 1DF4A 1GM7A 2QSAA 3CWBH 2OWOA 1AJPA 1NBMG 5F2VO 1HNWB 2WLIA 1VQKV 4X62B 2EILC 2F93B 1BHAA 4JI8O 3E8BA 3FB5C 1F51A 4PA6A 3SYAA 1Y74A 2KQXA 2PF4E 5HFLA 3JSLA 2ATKC 2HJDA 1Z5WA 4RO2A 5KHIA 4LF5O 1M57B 5IJ9B 2YXLA 1BMFG 3F5WC 4U3JB 2OYQA 5B1BC 4OX9O 3WFVA 4MS2A 4NKGB 3IC9A 3E8GA 1OJHA 2WLLA 3ZHQA 2ZNJA 4FM2A 1AI4A 4FLVA 1DGSA 5J2TA 3THOA 1SERA 4ZOLA 2EJRA 2EINC 3QO5A 4KHPB 1MZEA 2UXCO 3GWKC 4O4LA 4WBNB 5BR8O 4DV1O 1AJQA 1ENVA 5EZYA 4TV9A 2VS0A 3L71H 1H2SB 5DN6G 4LFBO 1HP8A 3OEEG 2X6BA 5KHJA 4O4JB 3SYQA 2A06H 1Q7YW 4GCZA 2NR5A 3CJHB 4NYKA 2QEXV 4DV6O 3E22A 3RVZA 4XDLA 2B5UA 5JVDB 4ZIBA 3BA9A 5B66Z 4KXRA 5DM6V 3G71V 3E8FA 3Q4HB 4U3JA 2RMKB 3ABMB 2DYSB 1WA8B 5EC2C 4W4LA 3NXSA 3CRRA 5FPOA 1K33A 3EXAA 4Z2WA 4ZHQB 5J2TB 5LXTA 2Q0AA 3N2GB 1MSWD 2X6CA 4J7ZA 1Z5VA 3K5NA 5FL7G 4NB5A 1N8RW 3CC7V 3ASOB 2E5LB 4CH6A 3DSQA 2Q4PA 1BQZA 5LYJA 4P9OA 1OCCC 3SPGA 1MMMA 3K3WA 4JI3B 4PDVA 2KG7A 2LFRA 3ZMUA 3KCYA 3I56V 4UV8A 4X20A 3CJHA 1L8DA 2P90A 4O2BB 2ETNA 3AG7A 2R9RB 3E86A 4EEQA 5CA1A 1WP8A 2Y48A 3CEIA 3LUTB 4TV8A 1L0NH 1SQFA 1TVKB 4NTYA 1V55B 4LF8O 3G80A 4BW5A 1W59A 3TGUH 3JSNA 1WA8A 1I94O 2JEUA 3SGIA 2N04A 2BE3A 1SQXH 3ZJZA 1XNRB 3OGIB 3N2GA 4X9QA 4DR1O 3E83A 1J5EO 4BIZA 4JI1O 3P3PA 2OCCC 3CCMV 2JK5C 4X64B 1WPXA 4LH6A 4F6RB 2E75B 4U7OA 4DR6B 3M99B 2ZE5A 3BABA 3WB0A 1YITV 2W6JG 2WPDG 5ITZA 4W4KA 1PKXA 4DW1A 5GONB 4UB8Z 5CBFA 4PA4A 1XNQO 5C8YB 4B3TB 2YIBD 1FFTB 4TWKA 3S3XA 2WLIB 2WLNA 5CA1B 2X0LA 3FB8C 5KA6A 3UO2A 4H37A 2ITCC 1FPOA 2CTQA 4LF7O 5KLVH 1HW7A 2ZCEA 1N32B 3AG3C 2LW7A 2Z0AA 4XBFA 1XMOB 3B2EE 1F23A 5IE9A 5TISZ 1AI6A 3SYOA 3LSQA 4G27B 4QE9A 5CBGA 4DV0B 1SQBH 1VQ7V 4DV3O 2HKOA 2IJIA 4GZRB 3JAMN 3ML0A 1DTOA 1MZFA 3A0HZ 2XAQA 3OFNG 1NZ6A 3OW2U 5GTIZ 3HKDB 2DJVA 3EVKA 4LFCO 5ITZB 1ORQC 1EFRG 4TQDA 4O4HA 1VQNV 3FAVA 2UUCO 2P6JA 1UJWB 1NTZH 1RSOB 2M7WA 1QLEC 3ZRXA 4CC6A 4HAMA 4B3RB 3I55V 2RNBA 4J10A 3E22B 4LF4B 1QVGU 1VQOV 1FKAO 1BL8A 4X88A 1HNXO 1XL4A 3L73H 1BS3A 1Q3EA 1R6TA 2HJFC 5CA3A 3ZRVA 2MW2B 2VQEO 3QG5A 4GKKO 2BOBC 3N2KB 4GX2A 4JYAB 1P4RA 3SPJA 2JJ1G 4R8CA 3K5LA 1KKDA 3WG7C 2D2CB 5LL6Y 5LMUB 4X1IA 2VRZA 4GLXA 4DR7O 1NTKH 1Q81W 4DV2O 3AG4B 4O4HB 1OCZB 2IW5A 2UXDB 3JAWA 2IU3A 1PL0A 2F66C 5IYDO 1R1BA 3ZCCA 4IHJA 1YIJV 2Q7GA 2QWQB 2YIBA 1HWYA 2RQ6A 5B1AC 4J9ZB 2K1EA 3DXRA 1VQ6V 1OV9A 2FKXA 2XNDG 4I9WA 2Q5ZA 3E8HA 4DR5B 3BFRA 5IWAB 3E89A 3VOUA 4D6TH 4WFAV 3M7MX 1TA8A 2HHHO 2FB5A 1BGYH 1VARA 2AXTZ 4DUYO 1KECA 4NVPA 4DV4O 5BMVB 5LP6B 2YXHA 2YIAA 4GT1A 1WP7A 1M4UA 2CAZC 1Q86W 3TJTA 3RVYA 4UCSA 4LNUB 5GONA 4WFFA 3FD9A 4HBNA 2FMLA 4YHHB 1OCOC 4JI5B 3IGAC 2W6IG 3LSSA 4IHJB 1NTMH 4O2AB 4FPPA 2CTWA 4UCTA 3DC5A 5GW7A 3LDCA 4PJ0Z 1S3JA 1FS0G 1US6A 3FB7C 3H1LH 3H1JH 1B06A 1GTOA 2Z3YA 4PELA 3W7SA 3OD4A 2CTPA 4DUZB 4TT3G 1AI7A 2JS5A 5KMGB 4H44B 1XREA 3J80N 3ASNB 2Y0PA 2DYRC 1YTFD 3O9OA 4DV7B 3H1HH 2IBZH 2YI8A 5DECA 2EIJC 4LWSA 1IXMA 2VWKA 1F4NA 3BAAA 4MW3A 1VF6C 4AI8A 3ICXA 1JOYA 3S3WA 5C93A 3CXCU 2ZM6B 5KUKA 4RUFA 1TUBB 1MOFA 4DR4B 1AR4A 3HKDA 4JI4B 3ZHSA 4FZ0A 4UV9A 2UXNA 1Q5OA 2UUAO 4LCUC 1K92A 1CPYA 3OMAB 2H3OA 4E2LA 4PDMA 3CRQA 1S0VA 1FXKB 1EBOA 2MK3A 3ZRWA 1GM9A 3DC6A 1GN2A 1V54B 2DQ3A 4X89A 4DO2A 5JJEB 2B1GA 2R9AA 4X1KA 4X66O 2D3OW 5LMNB 2EX3A 1AROP 4JI2B 5H5NA 3RBZA 3OEHG 1P7BA 1THZA 2Q68A 3ZHTA 3CC2V 2CGOA 3L72H 3W7TA 3T4ZA 2Y69C 2QWOB 1NS1A 4P2ZA 1WNSA 4K0KB 1CP9A 1KUQA 1Q8IA 2NNUA 3BA8A 1KD1W 3RN4A 2FYUH 1NU1H 4YIOA 5JWPA 4X1IB 5B1BB 3B8MA 4Q6GA 5JCOA 4GX0A 2ZE8A 2QM7A 3CCLV 4BW9A 5J2UA 3CCSV 2GUZA 2YSUB 3L75H 4DR3O 5KAIZ 1ZSPA 4JI7O 3IAYA 4UCOA 1VQ9V 4FM0A 1KKCA 2P7TC 2H8PC 5IYCO 1PL4A 4ZI7A 1WLEA 2LJ2A 3ZBHA 1S77D 2LO1A 2ZR2A 3T1HO 1L0LH 2HLDG 2XAJA 4HNAA 1GN3A 2W0FC 4DV5B 2JGUA 2UUBO 2AZ2A 2V1DA 4FFBB 1IBKB 4WCEV 3W7UA 4CS4A 2WSSG 3OGCC 4JV5O 4LF6O 3G4SV 3BRCA 3MDSA 4J7JA 4MTFA 2Q0OC 1DK1A 1BHBA 2ZNIA 1YI2V 3MD0A 1M9NA 2AHYA 3K03A 2K9PA 2AGAA 3ASNC 1BSMA 2DN9A 2P5OA 1H2KA 4MTGA 4IIJB 4NXMO 3G67A 3AG3B 5J2UB 1IURA 3K0GA 4GX5A 3RGBA 5JQGA 4F6EA 1K4CC 1KP3A 5EBWC 2F23A 4O2AA 3ETEA 4PDRA 1R6NA 3AEIA 3AG1B 4ZBMA 1PNMA 2XASA 1O9GA 1X59A 4UUJC 5CBHA 1D5AA 1VF5B 3NR7A 2UU9O 4PI0A 3HB3B 1FD9A 3J81N 1PM9A 2PY5A 2VQFO 4LH7A 3UT5B 4J9YB 2JS3A 5IJ0B 2UXXA 3CSXA 1B04A 4HNAB 4PA9A 4NTXA 3W7XA 2BSKB 4B3SB 3JAKA 3ETGA 1V55C 1SA0A 5EZYB 1SQQH 2QWNB 5CMUA 1YCIA 4MVUA 2ZXWC 3P3NA 1W2BU 2PYLA 2QE7G 2ZDIA 4G2KA 1B6QA 2Z5UA 1E1QG 1UPGA 3IJ4A 1BE3H 4IIJA 4H13B 2A7WA 2P4VA 1SETA 5JQGB 2WWWA 4AHCA 3HKEA 2WA4A 5FLXN 4LF5B 4DRXB 5IY5B 2P06A 1TUEB 2ZE6A 3P32A 3DGEA 4OX9B 3ZRSA 2ZD9A 2QKAA 3VBBA 1N36B 1HNZO 4I5SA 1R6KA 2JIZG 2JDIG 2GHYA 1N34B 2UXCB 4RAIA 1NR1A 3QNEA 1NVPD 5LYJB 2EIKC 2GDSA 4LR3A 3IC7A 1MSDA 1HR0O 1DF5A 4LFBB 2KG7B 1W0JG 1AJNA 5E79Z 2X6AA 1M5IA 2Y4UA 4I0XA 4D7TA 2VWJA 4B3MO 1IVSA 1JCHA 4O4IA 2QM4A 1KMIZ 3ABKC 4GKJB 3ZHVA 3KCXA 1N0JA 4TV8B 2YIDA 2KB1A 4MVMA 5CB4B 4RQEA 4MT8A 1H38A 3K57A 2E3CA 1GAXA 1N4CA 3JALB 5BZBA 2IH1C 4LC1A 1PD3A 1F4MA 1EN6A 2QTSA 2EIJB 3JARA 1Q6UA 1EZJA 1P7GA 1TAEA 1S5LZ 2RDCA 2WA3A 2WAMA 3SJAC 3ETQA 2GV9A 4F4LA 1GN6A 4X8AA 1H8HG 4UVCA 3B8NA 4I4TB 4QPKA 5J9PC 1M90W 4I50A 1N0NA 4UXNA 3C90A 3T1YO 1LUWA 5AG2A 4FLYA 3JD1A 1WB8A 1AP5A 1QHTA 5IDJA 4J41A 1YZBA 1O9HA 2UXBO 4K8ZA 1Y66A 2YICA 3GWOA 4WFEA 1S72V 1ZAUA 2Q8VA 4O4IB 1GK9A 4YY3B 1H2LA 1NJIW 1I5XA 3ABMC 1XQ8A 3JASB 3FX7A 1F7YA 2C2AA 1VQMV 4P9PA 2WLMA 4LF8B 3QO7A 1N33B 3UO3A 1CXZB 1JFFB 3CCRV 2EINB 1I94B 3RFRA 1IXBA 4PDLA 2IJJA 2QGNA 4LFAO 3JARB 1A32A 5L3BA 2CDYA 3OTOB 4DR1B 3G6BA 3RYCA 3ABKB 2DMXA 3MHSC 3LNNA 4JI1B 3CRCA 5KHKA 5CA0B 3SPHA 4X64O 1JJ2U 1U97A 4ABMA 3VQYA 3ETDA 2YS8A 4DR6O 1MA1A 5B1AB 1K73W 5JJNB 1FAFA 4I50B
chains in the Genus database with same CATH topology
1NTMH 1SQBH 3CWBH 2BCCH 2IBZH 1SQXH 2FYUH 1BE3H 1NU1H 5KLVH 1PPJH 1PP9H 3BCCH 1SQVH 3L71H 3L72H 3L74H 3CX5F 3H1LH 3H1JH 1KYOF 4PD4F 1EZVH 1KB9F 2A06H 4D6TH 1L0NH 3L70H 3L73H 4U3FH 3CXHF 1SQPH 1P84F 1BCCH 1L0LH 1SQQH 3H1IH 3L75H 3H1KH 3TGUH 1BGYH 1NTZH 1NTKH 3H1HH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTM H;  1SQB H;  3CWB H;  2BCC H;  2IBZ H;  1SQX H;  2FYU H;  1BE3 H;  1NU1 H;  5KLV H;  1PPJ H;  1PP9 H;  3BCC H;  1SQV H;  3L71 H;  3L72 H;  3L74 H;  3CX5 F;  3H1L H;  3H1J H;  1KYO F;  4PD4 F;  1EZV H;  1KB9 F;  2A06 H;  4D6T H;  1L0N H;  3L70 H;  3L73 H;  4U3F H;  3CXH F;  1SQP H;  1P84 F;  1BCC H;  1L0L H;  1SQQ H;  3H1I H;  3L75 H;  3H1K H;  3TGU H;  1BGY H;  1NTZ H;  1NTK H;  3H1H H; 
#chains in the Genus database with same CATH topology
 4X65 B;  1VQL V;  4CH3 A;  2NN4 A;  4JZG A;  1SRY A;  1YHQ V;  3B4S A;  1Q6I A;  4I55 A;  2CH7 A;  3P30 A;  3L70 H;  2P22 C;  4LP8 A;  1K7D A;  3AG2 C;  3U10 A;  2XAF A;  2A0L A;  3JAS A;  4FIP C;  3H1I H;  3RYF A;  4PA7 A;  3OR6 C;  4LF7 B;  1UFI A;  4JI0 B;  2W0X A;  1GH6 A;  3BCC H;  4HZ3 A;  3ZMV A;  4DRX A;  4C7U A;  3BY6 A;  3JD2 A;  4UVA A;  3CCV V;  4B7K A;  1OZ0 A;  2KKW A;  2Y0I A;  3AG4 C;  4EKW A;  3CCQ V;  1H2N A;  3OUS A;  1V9P A;  2OCH A;  1RP3 B;  1SS3 A;  5B1O A;  1PNL A;  1JA8 A;  4DV0 O;  4MVZ A;  5EBM C;  2R72 A;  4DV3 B;  1VF7 A;  1BZK A;  3RWR D;  3CME V;  4EFE A;  4FK5 C;  5H6R A;  4CH5 A;  4QE7 A;  3CX5 F;  2PYJ A;  1M57 C;  1VQ5 V;  3TET A;  1XIL A;  1FYJ A;  2ZR3 A;  1RPO A;  4JI6 O;  3SDL A;  3CD6 V;  2UUC B;  2WLL B;  1GKF A;  2CUG A;  2DYS C;  5E1A C;  3K5O A;  5LGN A;  1ZL8 B;  4LF4 O;  3D8C A;  1K9M W;  4QIW F;  3CB2 A;  2KSD A;  4FLZ A;  1AVM A;  1G6U A;  1SQP H;  5IYZ B;  2PTM A;  3CC4 V;  3J7A U;  5A2Q N;  3K04 A;  2F1M A;  2ZDI C;  2AW9 A;  4JF3 A;  3JAL A;  2F95 B;  3DTU B;  5D5P A;  3FKS G;  2A79 B;  3A0B Z;  3H01 A;  3ZMZ A;  2VQE B;  4YIP A;  4ZHQ A;  4B08 A;  5HFM A;  4QJF B;  4GKK B;  4JYA O;  2FTK A;  4EFB A;  3RW0 A;  3OUF A;  3AG2 B;  1E79 G;  4Z1V A;  5JVD A;  5KX5 A;  2LFS A;  4DR2 O;  4EB6 B;  1QLN A;  1MNG A;  4UCV A;  1Q6H A;  3VQX A;  3STL C;  5BMV A;  5LP6 A;  4NXN B;  4DV2 B;  1JJO A;  4WFG A;  4GX1 A;  3WB2 A;  4JAA A;  2F4V O;  2Q9L A;  4BR6 A;  2EIK B;  2UXD O;  3JAT B;  4LF9 B;  1R3K C;  4O2B A;  3E2E A;  4JYC A;  4FLT A;  2JVD A;  1BQ0 A;  3ABL C;  2A3Q A;  3TXS A;  1YJN V;  2L6L A;  1E1R G;  2YC0 A;  1TVK A;  2JJ2 G;  1MG1 A;  5EIB C;  5KMG A;  1Q43 A;  1JFF A;  3G6E V;  2WLJ A;  1FXV A;  3JD3 A;  1P49 A;  4DR5 O;  2IM9 A;  4FM1 A;  1AI5 A;  2GBO A;  2QR4 A;  2CGN A;  4QPJ A;  4TQF A;  1JR9 A;  2QDO A;  4AQY O;  4MTX A;  1FJG B;  2HHH B;  2LP7 A;  5LBQ A;  1YSC A;  4PA3 A;  5KX5 B;  1Y67 A;  5CA0 A;  3ZX6 A;  3VQV A;  2HFE C;  1S5H C;  1J95 A;  4R50 A;  3SYC A;  2YDE A;  1IBL B;  3APQ A;  2ZE7 A;  3K9S A;  3N27 A;  3A8T A;  2P4K A;  1VEW A;  1VMG A;  2QA4 V;  2AHZ A;  1LR1 A;  3H1K H;  4KL1 A;  1DLB A;  5C8Y A;  2RN9 A;  2HG5 C;  4YHH O;  3M8A A;  4J11 A;  5B1N A;  2BTQ A;  2N05 A;  3CE2 A;  3LSU A;  1XOU A;  2CE4 A;  2EZO A;  3ZHU A;  1XMQ O;  4F6R A;  4X1K B;  2XHB A;  1IBM O;  1LNQ A;  5LP6 C;  2XOK G;  2Q67 A;  4Q20 A;  1G4Y B;  1XI1 A;  1WN7 A;  1XDC A;  4FLU A;  5LHH A;  1HNW O;  2B9Z A;  1FXH A;  2QTO A;  4X62 O;  4Z1M G;  3C3S A;  4JI8 B;  1NH2 D;  5JCO C;  4K8X A;  5JJJ B;  1SZX A;  4MVS A;  3K58 A;  2ZM6 O;  1D5N A;  3LNM B;  4JTD B;  3HR0 A;  1YTF B;  4JAS A;  3U0Z A;  3K06 A;  4JI4 O;  1OCO B;  2FL4 A;  2DWD C;  4YJ3 A;  4DK0 A;  1Y76 A;  3B77 A;  3IFX A;  3ZN0 A;  2HEP A;  2UUA B;  2HVJ C;  3PJS K;  1M93 A;  4TOI A;  3FAV B;  1NQT A;  5L3G A;  2BTQ B;  1RPR A;  3CHX A;  4OPH A;  1ZL8 A;  3R66 A;  1VP7 A;  5L3C A;  4KHP O;  4DW0 A;  1QU7 A;  5LMN O;  3A2F A;  5BR8 B;  3BEH A;  4DV1 B;  4JI2 O;  5B3S B;  2ZXW B;  5IYZ A;  3U11 A;  2YI9 A;  5KA5 A;  3ZMS A;  1VQP V;  5LGT A;  4TSF G;  5L3D A;  4FFB A;  2R9I A;  2ADQ B;  4JZ2 A;  4DV6 B;  4H33 A;  2RCV A;  1GRJ A;  3ABL B;  2Q7H A;  1PNK A;  1Y74 B;  4EB6 A;  3WU2 Z;  4GUN A;  3MAQ A;  4CC5 A;  2AZ0 A;  4IGG A;  1JMK C;  2M6Y A;  2JGD B;  5EBL C;  4DK1 A;  4YJ3 B;  3D36 C;  5FPR A;  2OTJ V;  2NLJ C;  1KB9 F;  3F7V C;  5IT9 N;  2GTA A;  2RJZ A;  4L8J A;  1KBH A;  3N2K A;  2HP8 A;  2V7Q G;  2DYR B;  4JI7 B;  2E5L O;  3QTC A;  1PP9 H;  3ZMT A;  2OIE A;  2R70 A;  4A5U B;  1RFY A;  3EFF K;  3UT5 A;  2JRI A;  3ASO C;  2ITD C;  1YVW A;  1P84 F;  4JI3 O;  3TXQ A;  1SC5 B;  3JCU Z;  4DV5 O;  5KUM A;  4O4J A;  2UUB B;  1VF6 A;  2QWP B;  4G28 B;  4K3A A;  2XTA A;  3STZ C;  4D7S A;  1NH2 B;  3H9V A;  2ZT9 B;  4JV5 B;  2YXY A;  4LF6 B;  3CPW U;  4YXW G;  3OM3 B;  3T2M A;  3HKB A;  1AP6 A;  4U3F H;  3HPL C;  3DXR B;  3K0D A;  2QM8 A;  4KUM A;  3Q4H A;  1TGO A;  4CZZ A;  3LDE A;  4L87 A;  2EIM C;  2GTS A;  4ICG A;  3LDD A;  4LNU A;  4MVR A;  1XNR O;  5IY5 C;  5LXT B;  1AR5 A;  1J5E B;  3CCU V;  4QNH B;  1ZTE A;  1SF9 A;  1M1K W;  1OCC B;  2UU9 B;  1EN4 A;  3C3T A;  3BPZ A;  2VQF B;  4K35 A;  3JCZ A;  3D36 A;  1FFX B;  3B40 A;  3SPI A;  5BXZ A;  2XUM A;  4AIL C;  1PPJ H;  1H8E G;  4X20 B;  1XNQ B;  4B3T O;  3KZI Z;  4RUE A;  1OCR B;  3AK2 A;  4LWS B;  5FNV B;  1XHZ A;  1PV0 A;  1R73 A;  3HKB B;  3FFQ A;  4BIO A;  1OCR C;  1COW G;  3ABU A;  4MTO A;  5LGU A;  2PGG A;  2DE0 X;  2QKS A;  2V4D A;  1N32 O;  1JQ0 A;  1L1F A;  1V54 C;  1WB7 A;  3BVO A;  1XMO O;  1Y76 B;  1KU9 A;  4GYC B;  3AG1 C;  2ZKO A;  2DOS A;  5KHG A;  3UCS C;  2B1I A;  3UKM A;  3OMI B;  1RM1 B;  4KFM A;  4XDJ A;  1Q90 D;  1YJ9 V;  4FJC C;  3SPC A;  4MSW C;  1IZ3 A;  4FMT A;  1ZLZ A;  3CS5 A;  3CRM A;  3PN1 A;  1N36 O;  1HNZ B;  2OCC B;  1RM1 C;  1YJW V;  3ZIA G;  1FFX A;  4LFC B;  4UCU A;  3RYI B;  1N34 O;  2YEV B;  1WJZ A;  3CCJ V;  3EHB B;  3SJB C;  1SZT A;  1Y6X A;  3ZRW B;  4B3R O;  1YF2 A;  4BWA A;  3JD4 A;  1I08 A;  3AK1 A;  5FNV A;  2ARH A;  4YJ2 A;  1HR0 B;  1SQV H;  5K1P A;  2ZQM A;  4FZ1 A;  1Q82 W;  3W7W A;  4ZKI A;  1K34 A;  1S76 D;  1XBL A;  3WG7 B;  1CEZ A;  1HNX B;  4B3M B;  5KHH A;  1BCC H;  2JGD A;  1ZX3 A;  3OTF A;  4TUY B;  4PV1 B;  1XUQ A;  4RWU A;  3D3I A;  1K4D C;  1KQS U;  4CBC A;  4JPR A;  2Y4T A;  3HKC A;  4GKJ O;  1OHH G;  1OCZ C;  1D2D A;  4WFB V;  3CP1 A;  3OMN B;  4FFK A;  4E4E A;  3SR2 C;  1SKV A;  3SJQ C;  3MHH C;  5EC1 C;  4JAV A;  3TCU A;  2EJ7 A;  5LMU O;  3OT7 A;  3CMA V;  1QBZ A;  4PI2 A;  4DR7 B;  5K1X A;  3RYI A;  1U96 A;  4OPA A;  4OGQ B;  1LUV A;  2YEV A;  1YEW A;  1AIL A;  3X2Q B;  1RSO A;  4IL6 Z;  1K97 A;  3GB7 C;  3WB1 A;  3APO A;  4PD4 F;  4YJ2 B;  3T1Y B;  1IX9 A;  5L3F A;  5DED A;  1YDX A;  3O65 A;  4XDK A;  3VQW A;  3QVN A;  4N23 A;  5IYB O;  2L35 A;  3K59 A;  1QQC A;  2UXB B;  2CH7 B;  1QR9 A;  1WPB A;  2Q73 A;  5A9G A;  4ZI7 B;  1QVF U;  2PI4 A;  4TUY A;  4NR1 A;  3B09 A;  4R7C A;  4H0L B;  5CN0 A;  4J7K A;  3AK3 A;  4YY3 O;  4JGS A;  4P30 A;  3OR7 C;  1K3E A;  3HKC B;  4B7E A;  3L9D A;  1GM8 A;  5IWA O;  5H6Q A;  1KP2 A;  1M56 B;  2CTR A;  4JYB A;  1N33 O;  2OTL V;  2PI5 A;  4UB6 Z;  3KKY A;  2Y69 B;  4DUY B;  4LFA B;  4DXW A;  1K8A W;  1JPX A;  3OTO O;  4DV4 B;  1B3Q A;  1KYO F;  5IJ0 A;  2HVK C;  4J42 A;  2IU0 A;  5H9C A;  1NVP B;  3JAW B;  3OAA G;  5LHG A;  2LGW A;  2BSK A;  2ZIO A;  3JAK B;  3FYI B;  4JI5 O;  1AB3 A;  1SA0 B;  2EBO A;  4X65 O;  4UFZ A;  3ABT A;  4HYO A;  1ROP A;  2EZP A;  2LGQ A;  4DUZ O;  3OE7 G;  4BAY A;  1G1X B;  4WFH A;  3ZS8 C;  2E76 B;  3FYE B;  1VIB A;  1YXB A;  4JTC B;  3SYP A;  2EIL B;  4DV7 O;  3RYH A;  4OXS A;  3RT3 C;  1WAZ A;  4JI0 O;  1S5J A;  2DWE C;  5EK0 A;  3CYO A;  2PUS A;  3BHP A;  4BIU A;  1K5Q A;  2Q6A A;  1NT2 B;  3CCE V;  1M56 C;  4MVO A;  1K5S A;  4DR4 O;  4R6Z A;  3ZED A;  2EUL A;  3T4D A;  5JH7 A;  5LA6 B;  2XT9 A;  1SES A;  5EIB D;  2QWR B;  3HKE B;  2H94 A;  5LOV B;  3T1C A;  1R3J C;  2JEX A;  2CK3 G;  5IJ9 A;  4CS3 A;  1JX9 A;  1HDJ A;  2LW1 A;  1XHX A;  4X66 B;  3KG2 A;  4JI6 B;  2LQT A;  1ZWI C;  4I0X B;  3SJC C;  3JAT A;  5GTH Z;  1NR7 A;  3JYC A;  2WLH A;  1QCE A;  4U7N A;  3RYH B;  1I5Y A;  4O4L B;  4WBN A;  1SQG A;  2IH3 C;  2XAG A;  1GN4 A;  4I7Z B;  1H2G A;  2BOC C;  3D3Q A;  4K0K O;  5LHI A;  1MAB G;  3K5M A;  2QJ1 A;  1H2M A;  4JYY A;  1URF A;  3QF7 A;  2GSM B;  3JD0 A;  1TUB A;  4KP4 A;  2Q7E A;  4DYL A;  1NKD A;  2EIM B;  4J80 A;  2IJH A;  3CRA A;  1I7F A;  5JH7 B;  2OIG A;  5LA6 A;  1EN5 A;  2ODM A;  4DR2 B;  1GO3 F;  3R65 A;  4FLW A;  3ZN1 A;  4X1Y A;  4N21 A;  1FXK A;  5LOV A;  4DR3 B;  2BTO A;  3K08 A;  4I4T A;  4IT5 A;  5CB4 A;  1QNM A;  4NXN O;  2F4V B;  2A9H A;  4UCR A;  3K9A A;  1GMG A;  3FB6 C;  4LF9 O;  2HR3 A;  1R3L C;  3I5D A;  1Y4M A;  2DW4 A;  4IYH A;  3K79 A;  4UVB A;  4MVQ A;  3T1H B;  4PHZ A;  4JAU A;  2N74 A;  4ASU G;  5L3E A;  1IBK O;  2G38 A;  2ADP A;  1IDS A;  1XL6 A;  2BCC H;  2ZIM A;  4JTA B;  4FLX A;  1Z2G A;  3L74 H;  5EYP B;  3UM7 A;  1W0K G;  2QKC A;  2OT5 A;  2IJK A;  2F43 G;  1G8M A;  1XEQ A;  1NI8 A;  1AR1 B;  5BY1 A;  4CH4 A;  1VQ8 V;  4LBE C;  2E74 B;  2XAH A;  4AQY B;  1FJG O;  1KC8 W;  4NXM B;  3E35 A;  2X7R B;  3TK1 A;  4X1Y B;  2GUZ B;  1R3I C;  3A0R A;  1X4T A;  3QO8 A;  4FVM A;  2ZIN A;  1JVM A;  4QGP A;  2PZS A;  1IBL O;  1I0H A;  2DQ0 A;  3F5T A;  2ILM A;  4RQF A;  5D5Q A;  4WF9 V;  3RYC B;  1QR8 A;  3X2Q C;  4CS2 A;  4NTW A;  4ZOL B;  4IYI A;  1QLE B;  5B3S C;  3ZHR A;  2P67 A;  1XMQ B;  1VQ4 V;  1FXK C;  1T5E A;  3F7Y C;  2O57 A;  1EZV H;  2Q69 A;  1IBM B;  3RYF B;  4B3S O;  5H2F Z;  4MW8 A;  3CXH F;  4I9Q A;  5B5E Z;  5KAF Z;  5EYP A;  3GVM A;  3UQ8 A;  4TV9 B;  1BT8 A;  2WLK A;  1ZUQ A;  1EM1 A;  2YUA A;  4I55 B;  1DF4 A;  1GM7 A;  2QSA A;  3CWB H;  2OWO A;  1AJP A;  1NBM G;  5F2V O;  1HNW B;  2WLI A;  1VQK V;  4X62 B;  2EIL C;  2F93 B;  1BHA A;  4JI8 O;  3E8B A;  3FB5 C;  1F51 A;  4PA6 A;  3SYA A;  1Y74 A;  2KQX A;  2PF4 E;  5HFL A;  3JSL A;  2ATK C;  2HJD A;  1Z5W A;  4RO2 A;  5KHI A;  4LF5 O;  1M57 B;  5IJ9 B;  2YXL A;  1BMF G;  3F5W C;  4U3J B;  2OYQ A;  5B1B C;  4OX9 O;  3WFV A;  4MS2 A;  4NKG B;  3IC9 A;  3E8G A;  1OJH A;  2WLL A;  3ZHQ A;  2ZNJ A;  4FM2 A;  1AI4 A;  4FLV A;  1DGS A;  5J2T A;  3THO A;  1SER A;  4ZOL A;  2EJR A;  2EIN C;  3QO5 A;  4KHP B;  1MZE A;  2UXC O;  3GWK C;  4O4L A;  4WBN B;  5BR8 O;  4DV1 O;  1AJQ A;  1ENV A;  5EZY A;  4TV9 A;  2VS0 A;  3L71 H;  1H2S B;  5DN6 G;  4LFB O;  1HP8 A;  3OEE G;  2X6B A;  5KHJ A;  4O4J B;  3SYQ A;  2A06 H;  1Q7Y W;  4GCZ A;  2NR5 A;  3CJH B;  4NYK A;  2QEX V;  4DV6 O;  3E22 A;  3RVZ A;  4XDL A;  2B5U A;  5JVD B;  4ZIB A;  3BA9 A;  5B66 Z;  4KXR A;  5DM6 V;  3G71 V;  3E8F A;  3Q4H B;  4U3J A;  2RMK B;  3ABM B;  2DYS B;  1WA8 B;  5EC2 C;  4W4L A;  3NXS A;  3CRR A;  5FPO A;  1K33 A;  3EXA A;  4Z2W A;  4ZHQ B;  5J2T B;  5LXT A;  2Q0A A;  3N2G B;  1MSW D;  2X6C A;  4J7Z A;  1Z5V A;  3K5N A;  5FL7 G;  4NB5 A;  1N8R W;  3CC7 V;  3ASO B;  2E5L B;  4CH6 A;  3DSQ A;  2Q4P A;  1BQZ A;  5LYJ A;  4P9O A;  1OCC C;  3SPG A;  1MMM A;  3K3W A;  4JI3 B;  4PDV A;  2KG7 A;  2LFR A;  3ZMU A;  3KCY A;  3I56 V;  4UV8 A;  4X20 A;  3CJH A;  1L8D A;  2P90 A;  4O2B B;  2ETN A;  3AG7 A;  2R9R B;  3E86 A;  4EEQ A;  5CA1 A;  1WP8 A;  2Y48 A;  3CEI A;  3LUT B;  4TV8 A;  1L0N H;  1SQF A;  1TVK B;  4NTY A;  1V55 B;  4LF8 O;  3G80 A;  4BW5 A;  1W59 A;  3TGU H;  3JSN A;  1WA8 A;  1I94 O;  2JEU A;  3SGI A;  2N04 A;  2BE3 A;  1SQX H;  3ZJZ A;  1XNR B;  3OGI B;  3N2G A;  4X9Q A;  4DR1 O;  3E83 A;  1J5E O;  4BIZ A;  4JI1 O;  3P3P A;  2OCC C;  3CCM V;  2JK5 C;  4X64 B;  1WPX A;  4LH6 A;  4F6R B;  2E75 B;  4U7O A;  4DR6 B;  3M99 B;  2ZE5 A;  3BAB A;  3WB0 A;  1YIT V;  2W6J G;  2WPD G;  5ITZ A;  4W4K A;  1PKX A;  4DW1 A;  5GON B;  4UB8 Z;  5CBF A;  4PA4 A;  1XNQ O;  5C8Y B;  4B3T B;  2YIB D;  1FFT B;  4TWK A;  3S3X A;  2WLI B;  2WLN A;  5CA1 B;  2X0L A;  3FB8 C;  5KA6 A;  3UO2 A;  4H37 A;  2ITC C;  1FPO A;  2CTQ A;  4LF7 O;  5KLV H;  1HW7 A;  2ZCE A;  1N32 B;  3AG3 C;  2LW7 A;  2Z0A A;  4XBF A;  1XMO B;  3B2E E;  1F23 A;  5IE9 A;  5TIS Z;  1AI6 A;  3SYO A;  3LSQ A;  4G27 B;  4QE9 A;  5CBG A;  4DV0 B;  1SQB H;  1VQ7 V;  4DV3 O;  2HKO A;  2IJI A;  4GZR B;  3JAM N;  3ML0 A;  1DTO A;  1MZF A;  3A0H Z;  2XAQ A;  3OFN G;  1NZ6 A;  3OW2 U;  5GTI Z;  3HKD B;  2DJV A;  3EVK A;  4LFC O;  5ITZ B;  1ORQ C;  1EFR G;  4TQD A;  4O4H A;  1VQN V;  3FAV A;  2UUC O;  2P6J A;  1UJW B;  1NTZ H;  1RSO B;  2M7W A;  1QLE C;  3ZRX A;  4CC6 A;  4HAM A;  4B3R B;  3I55 V;  2RNB A;  4J10 A;  3E22 B;  4LF4 B;  1QVG U;  1VQO V;  1FKA O;  1BL8 A;  4X88 A;  1HNX O;  1XL4 A;  3L73 H;  1BS3 A;  1Q3E A;  1R6T A;  2HJF C;  5CA3 A;  3ZRV A;  2MW2 B;  2VQE O;  3QG5 A;  4GKK O;  2BOB C;  3N2K B;  4GX2 A;  4JYA B;  1P4R A;  3SPJ A;  2JJ1 G;  4R8C A;  3K5L A;  1KKD A;  3WG7 C;  2D2C B;  5LL6 Y;  5LMU B;  4X1I A;  2VRZ A;  4GLX A;  4DR7 O;  1NTK H;  1Q81 W;  4DV2 O;  3AG4 B;  4O4H B;  1OCZ B;  2IW5 A;  2UXD B;  3JAW A;  2IU3 A;  1PL0 A;  2F66 C;  5IYD O;  1R1B A;  3ZCC A;  4IHJ A;  1YIJ V;  2Q7G A;  2QWQ B;  2YIB A;  1HWY A;  2RQ6 A;  5B1A C;  4J9Z B;  2K1E A;  3DXR A;  1VQ6 V;  1OV9 A;  2FKX A;  2XND G;  4I9W A;  2Q5Z A;  3E8H A;  4DR5 B;  3BFR A;  5IWA B;  3E89 A;  3VOU A;  4D6T H;  4WFA V;  3M7M X;  1TA8 A;  2HHH O;  2FB5 A;  1BGY H;  1VAR A;  2AXT Z;  4DUY O;  1KEC A;  4NVP A;  4DV4 O;  5BMV B;  5LP6 B;  2YXH A;  2YIA A;  4GT1 A;  1WP7 A;  1M4U A;  2CAZ C;  1Q86 W;  3TJT A;  3RVY A;  4UCS A;  4LNU B;  5GON A;  4WFF A;  3FD9 A;  4HBN A;  2FML A;  4YHH B;  1OCO C;  4JI5 B;  3IGA C;  2W6I G;  3LSS A;  4IHJ B;  1NTM H;  4O2A B;  4FPP A;  2CTW A;  4UCT A;  3DC5 A;  5GW7 A;  3LDC A;  4PJ0 Z;  1S3J A;  1FS0 G;  1US6 A;  3FB7 C;  3H1L H;  3H1J H;  1B06 A;  1GTO A;  2Z3Y A;  4PEL A;  3W7S A;  3OD4 A;  2CTP A;  4DUZ B;  4TT3 G;  1AI7 A;  2JS5 A;  5KMG B;  4H44 B;  1XRE A;  3J80 N;  3ASN B;  2Y0P A;  2DYR C;  1YTF D;  3O9O A;  4DV7 B;  3H1H H;  2IBZ H;  2YI8 A;  5DEC A;  2EIJ C;  4LWS A;  1IXM A;  2VWK A;  1F4N A;  3BAA A;  4MW3 A;  1VF6 C;  4AI8 A;  3ICX A;  1JOY A;  3S3W A;  5C93 A;  3CXC U;  2ZM6 B;  5KUK A;  4RUF A;  1TUB B;  1MOF A;  4DR4 B;  1AR4 A;  3HKD A;  4JI4 B;  3ZHS A;  4FZ0 A;  4UV9 A;  2UXN A;  1Q5O A;  2UUA O;  4LCU C;  1K92 A;  1CPY A;  3OMA B;  2H3O A;  4E2L A;  4PDM A;  3CRQ A;  1S0V A;  1FXK B;  1EBO A;  2MK3 A;  3ZRW A;  1GM9 A;  3DC6 A;  1GN2 A;  1V54 B;  2DQ3 A;  4X89 A;  4DO2 A;  5JJE B;  2B1G A;  2R9A A;  4X1K A;  4X66 O;  2D3O W;  5LMN B;  2EX3 A;  1ARO P;  4JI2 B;  5H5N A;  3RBZ A;  3OEH G;  1P7B A;  1THZ A;  2Q68 A;  3ZHT A;  3CC2 V;  2CGO A;  3L72 H;  3W7T A;  3T4Z A;  2Y69 C;  2QWO B;  1NS1 A;  4P2Z A;  1WNS A;  4K0K B;  1CP9 A;  1KUQ A;  1Q8I A;  2NNU A;  3BA8 A;  1KD1 W;  3RN4 A;  2FYU H;  1NU1 H;  4YIO A;  5JWP A;  4X1I B;  5B1B B;  3B8M A;  4Q6G A;  5JCO A;  4GX0 A;  2ZE8 A;  2QM7 A;  3CCL V;  4BW9 A;  5J2U A;  3CCS V;  2GUZ A;  2YSU B;  3L75 H;  4DR3 O;  5KAI Z;  1ZSP A;  4JI7 O;  3IAY A;  4UCO A;  1VQ9 V;  4FM0 A;  1KKC A;  2P7T C;  2H8P C;  5IYC O;  1PL4 A;  4ZI7 A;  1WLE A;  2LJ2 A;  3ZBH A;  1S77 D;  2LO1 A;  2ZR2 A;  3T1H O;  1L0L H;  2HLD G;  2XAJ A;  4HNA A;  1GN3 A;  2W0F C;  4DV5 B;  2JGU A;  2UUB O;  2AZ2 A;  2V1D A;  4FFB B;  1IBK B;  4WCE V;  3W7U A;  4CS4 A;  2WSS G;  3OGC C;  4JV5 O;  4LF6 O;  3G4S V;  3BRC A;  3MDS A;  4J7J A;  4MTF A;  2Q0O C;  1DK1 A;  1BHB A;  2ZNI A;  1YI2 V;  3MD0 A;  1M9N A;  2AHY A;  3K03 A;  2K9P A;  2AGA A;  3ASN C;  1BSM A;  2DN9 A;  2P5O A;  1H2K A;  4MTG A;  4IIJ B;  4NXM O;  3G67 A;  3AG3 B;  5J2U B;  1IUR A;  3K0G A;  4GX5 A;  3RGB A;  5JQG A;  4F6E A;  1K4C C;  1KP3 A;  5EBW C;  2F23 A;  4O2A A;  3ETE A;  4PDR A;  1R6N A;  3AEI A;  3AG1 B;  4ZBM A;  1PNM A;  2XAS A;  1O9G A;  1X59 A;  4UUJ C;  5CBH A;  1D5A A;  1VF5 B;  3NR7 A;  2UU9 O;  4PI0 A;  3HB3 B;  1FD9 A;  3J81 N;  1PM9 A;  2PY5 A;  2VQF O;  4LH7 A;  3UT5 B;  4J9Y B;  2JS3 A;  5IJ0 B;  2UXX A;  3CSX A;  1B04 A;  4HNA B;  4PA9 A;  4NTX A;  3W7X A;  2BSK B;  4B3S B;  3JAK A;  3ETG A;  1V55 C;  1SA0 A;  5EZY B;  1SQQ H;  2QWN B;  5CMU A;  1YCI A;  4MVU A;  2ZXW C;  3P3N A;  1W2B U;  2PYL A;  2QE7 G;  2ZDI A;  4G2K A;  1B6Q A;  2Z5U A;  1E1Q G;  1UPG A;  3IJ4 A;  1BE3 H;  4IIJ A;  4H13 B;  2A7W A;  2P4V A;  1SET A;  5JQG B;  2WWW A;  4AHC A;  3HKE A;  2WA4 A;  5FLX N;  4LF5 B;  4DRX B;  5IY5 B;  2P06 A;  1TUE B;  2ZE6 A;  3P32 A;  3DGE A;  4OX9 B;  3ZRS A;  2ZD9 A;  2QKA A;  3VBB A;  1N36 B;  1HNZ O;  4I5S A;  1R6K A;  2JIZ G;  2JDI G;  2GHY A;  1N34 B;  2UXC B;  4RAI A;  1NR1 A;  3QNE A;  1NVP D;  5LYJ B;  2EIK C;  2GDS A;  4LR3 A;  3IC7 A;  1MSD A;  1HR0 O;  1DF5 A;  4LFB B;  2KG7 B;  1W0J G;  1AJN A;  5E79 Z;  2X6A A;  1M5I A;  2Y4U A;  4I0X A;  4D7T A;  2VWJ A;  4B3M O;  1IVS A;  1JCH A;  4O4I A;  2QM4 A;  1KMI Z;  3ABK C;  4GKJ B;  3ZHV A;  3KCX A;  1N0J A;  4TV8 B;  2YID A;  2KB1 A;  4MVM A;  5CB4 B;  4RQE A;  4MT8 A;  1H38 A;  3K57 A;  2E3C A;  1GAX A;  1N4C A;  3JAL B;  5BZB A;  2IH1 C;  4LC1 A;  1PD3 A;  1F4M A;  1EN6 A;  2QTS A;  2EIJ B;  3JAR A;  1Q6U A;  1EZJ A;  1P7G A;  1TAE A;  1S5L Z;  2RDC A;  2WA3 A;  2WAM A;  3SJA C;  3ETQ A;  2GV9 A;  4F4L A;  1GN6 A;  4X8A A;  1H8H G;  4UVC A;  3B8N A;  4I4T B;  4QPK A;  5J9P C;  1M90 W;  4I50 A;  1N0N A;  4UXN A;  3C90 A;  3T1Y O;  1LUW A;  5AG2 A;  4FLY A;  3JD1 A;  1WB8 A;  1AP5 A;  1QHT A;  5IDJ A;  4J41 A;  1YZB A;  1O9H A;  2UXB O;  4K8Z A;  1Y66 A;  2YIC A;  3GWO A;  4WFE A;  1S72 V;  1ZAU A;  2Q8V A;  4O4I B;  1GK9 A;  4YY3 B;  1H2L A;  1NJI W;  1I5X A;  3ABM C;  1XQ8 A;  3JAS B;  3FX7 A;  1F7Y A;  2C2A A;  1VQM V;  4P9P A;  2WLM A;  4LF8 B;  3QO7 A;  1N33 B;  3UO3 A;  1CXZ B;  1JFF B;  3CCR V;  2EIN B;  1I94 B;  3RFR A;  1IXB A;  4PDL A;  2IJJ A;  2QGN A;  4LFA O;  3JAR B;  1A32 A;  5L3B A;  2CDY A;  3OTO B;  4DR1 B;  3G6B A;  3RYC A;  3ABK B;  2DMX A;  3MHS C;  3LNN A;  4JI1 B;  3CRC A;  5KHK A;  5CA0 B;  3SPH A;  4X64 O;  1JJ2 U;  1U97 A;  4ABM A;  3VQY A;  3ETD A;  2YS8 A;  4DR6 O;  1MA1 A;  5B1A B;  1K73 W;  5JJN B;  1FAF A;  4I50 B; 
#chains in the Genus database with same CATH homology
 1NTM H;  1SQB H;  3CWB H;  2BCC H;  2IBZ H;  1SQX H;  2FYU H;  1BE3 H;  1NU1 H;  5KLV H;  1PPJ H;  1PP9 H;  3BCC H;  1SQV H;  3L71 H;  3L72 H;  3L74 H;  3CX5 F;  3H1L H;  3H1J H;  1KYO F;  4PD4 F;  1EZV H;  1KB9 F;  2A06 H;  4D6T H;  1L0N H;  3L70 H;  3L73 H;  4U3F H;  3CXH F;  1SQP H;  1P84 F;  1BCC H;  1L0L H;  1SQQ H;  3H1I H;  3L75 H;  3H1K H;  3TGU H;  1BGY H;  1NTZ H;  1NTK H;  3H1H H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...