1P84J

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EVKLQESGAGLVQPSQSLSLTCSVTGYSITSGYYWNWIRLFPGNKLEWVGYISNVGDNNYNPSLKDRLSITRDTSKNQFFLKLNSVTTEDTATYYCARSEYYSVTGYAMDYWGQGTTVTVSSAWRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2003-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p84J00
1MCEA 4PLNC 2H1PL 3QAZC 1JBJA 5DWUH 4LCYB 3ARDD 4Z7QE 4FFVC 2Q8AH 2R2CA 3KHQA 1AXTH 2AQ1A 5L2KD 2X4QB 3IJHB 1JHLL 3QCTL 4N9OB 2DKSA 4O51B 2BVUA 4LLDA 1UH3A 3GI8L 5LAXB 1TETL 3ZDXF 4NZUL 1S7RA 5CD3A 4BH8A 4ETQA 3TYFA 4WV1A 3ARGA 4BK5A 4DEPB 3JWNC 1LEKB 3HC4H 4B53A 2P7TB 4UU9A 3D85A 4HT1L 4PY8J 4ZPTA 5D8JL 2YBRA 3LRGA 3QT2A 4EQ3A 4HS3B 5E1HB 1IGJA 3TO2B 5HJ3A 1I1FA 4NBYB 2Z8WC 3FB5A 1M71B 3RU8L 1I4FB 1ZSDA 1AR1D 4JVUA 3F6LA 1TPXB 3OGOE 2LE9A 3LS5L 3VWKC 5JDSA 4FXKB 1QSEE 5TQ0L 3H7BA 4GLRI 4RMUA 4Z0BH 3QR2A 1YY9D 5C0RL 2P5EE 4YFDB 1X5JA 4XMLL 2SEBA 4JFHD 4LRIC 3T0BA 3VXUB 3QIWD 4LEXH 3DGGB 3TZVD 4J4PD 2J1KA 4ISVB 1OT2A 4S2SA 4QKXB 5D2NE 2P8MB 1WF5A 1U8IB 1MRDH 1FYHB 1T1YA 2NMSA 4XVUD 1QR1B 4LSSH 4BZ2H 1UWXH 2VISA 4NN6C 1BQLH 2X70A 3UO1L 1I85A 4KK9D 3RJQB 5GXBB 1CE1H 4OCLC 3SDCC 3HNVL 3QA3A 3HNSL 4JM2C 1JGLL 1FFNA 4UAOC 3U2SA 3RDTD 1AH1A 3HG1E 4TN9A 5KS9A 5I8OH 5JIHA 4XWOC 3HI5H 4K7PX 2ERJC 3O6KH 3UC0H 4G6AC 2A6DA 5CGYD 3O11B 4X6CA 4POZD 1JNHA 1DFBH 3QZWA 3QJHB 3GNMH 5IWLC 1OSPH 3BN3B 3R4DA 1D9KC 1SY6A 2Y9RT 4GFTB 4PJIA 2YWZA 3ZKMD 4LAJH 1YNTB 5AD0B 4ZO9A 4HZLB 1PY4A 2XQBL 1INDH 3E6FB 4YAQB 4XMPH 3KYKL 5DJCB 4PJXB 4OZGA 1OW0A 2E7BA 5DUMH 5C0AE 3H42L 5FUOL 3SQBA 1OCWH 1SEQH 3KS0J 3VFVB 5HHXL 4UQ3A 1EVTC 4F58L 1C08A 1L9NA 3G04A 3OJMB 1PSKH 3PDOA 1GZPB 4GRWE 4H1LB 3WFCL 1AD9B 3NAAH 1U8QB 4HQQL 3O2DA 4D3CH 4HDIA 1P4IH 2DJ4A 2P46B 1MRFL 5GIRA 1EAJA 4UB0L 4L9LC 5KJRL 4C54A 4I4WA 1DN2A 5HI5D 1QLFA 3VXRD 2PYEB 5CILL 1MLBB 1B88A 4KPHH 3ULVD 2XY2A 4G8GB 1UH4A 1T21A 4CADA 2EH8L 4I13B 2VOTA 1AJ7H 1J0KA 4BK4A 3VA2C 2VIRA 1V05A 3V5DB 3L5IA 2AJZA 3QUYA 1EMTH 3AS0A 4DWHA 3GJFK 1T7XA 2BX5A 1RZGB 4C55A 2O5ZH 1GGCH 4AG4L 1UM4H 5F9WB 5C08B 3RAJH 2C7UB 2X4UB 4D0DB 4HG4J 1MVFA 3UTSB 5ESVA 1CICD 4HLJA 4XNYH 1KCRH 1KG0A 5EBMA 4OFVA 3MV7B 1HXYB 2C1PB 2NY4B 4G8EB 3TYGH 1RZKC 3KPQB 4KRPC 1QG3A 5F89A 1H3VA 1J0ZA 2VQ1B 2OM5A 3A67L 1MPAH 1HK6A 3RKDC 2X1XR 5GRXG 1JGVH 2EO1A 2HRLA 5IF0A 1RHFA 1CZ8L 1S7WB 4L4TE 3STZA 3V9FA 1LDSA 3WS3B 3U46B 1TIUA 4U1IB 1LQSR 5IMLA 3U30C 5K9QG 4PRIB 1GOFA 2V5MA 4R4FL 4KHTH 3TBWB 1P4BH 4K3EL 4YLQT 4PJFE 1IGCH 1LP9A 2WM0A 3PWNA 5D7IE 3U1SH 2ZUWA 3KLSA 4GQ9L 3SKMA 2IBZX 4BM7A 1E4KA 3P40A 2G75A 2PXYB 4X5WA 4HMCA 1FZMA 1V7ML 4LCUB 5ICYB 1DQJA 4MLIA 4WUUA 3PWLA 3TPUA 4XCCH 5H35B 1YYLH 4NHCH 4MJIA 1AC6A 3V52L 4FFYL 1RUKH 2JKXA 4NUJA 1U3HB 4N68A 3CFJB 4HD9A 2R2HA 2J88H 1DQQB 4OF8A 4Y5XB 1HH6B 4P46A 2PYFB 4UILL 1IZJA 3ME0A 1CGTA 4NQDA 5CIPA 3T08A 2XA8L 4X8JB 4O2CB 1LK2A 5I66B 2FX9H 2GEEA 5JW4N 3CDYA 1NMCB 2YPVH 4W81A 3VXTB 3W81A 4Q9QL 2GFBB 2C1OB 5EIIA 4BSWB 3GSXB 3G6JA 1YEDB 2HKFL 4PGCB 4XNMB 2UUDH 3QEGL 4M1DH 3FQTB 5DYOA 4GXVL 3TA3A 3S37L 2IALB 4OD1H 4LP5A 5M95B 2Q8BH 4WFED 3BD4A 2OI9C 4Y19E 4XPBH 4YXHL 4JRXD 2VXSH 1MREL 1NC4B 4YJZL 2PO6B 3D1MC 3OF6A 5L8LB 1M7DA 1RVFH 4R3SA 2A6IB 4X6DF 3V7AE 3T1WA 1KB5A 4QXUL 2XN9D 1K3IA 2E3VA 5SWZD 1HI6B 4N0UA 4EUPA 4MZ2A 1ADQA 1OQOA 1VDGA 1RZJH 4GW4B 1YJDL 3DRQA 4GAJL 3UZEA 1EAPA 2I25N 3RHWF 4Z7NE 4WU7B 4AQ1B 2NY2B 2X4SB 1D5BA 1A5FL 4PR5B 4LHUA 4RCAA 4PJBA 5EU4B 1L7IL 4NKIL 1TVBA 4R26L 3LH2H 2X4NB 5L88L 3OR7B 3C6SA 5DRNA 3BDYL 1LE9B 1S9VA 3QWRD 3AB0B 1FNSH 3MLVH 3MC0A 4JM4H 3NCFB 4L3EB 4L5FH 4RMWA 1FVDB 3T3MF 3WO4C 5HGGS 3DHJA 3WKMH 5DQJA 3DO7B 4Z7UF 3RL1B 4ZD3H 4J1UB 2PN5A 4PJHB 1KTRL 4UT6H 4ODWB 1NUGA 4MVBC 3ZHKA 5FB8A 1TVHA 4OIBA 2DB8A 4ZPVA 43C9B 4YGAB 1NDMA 4QGTA 2FX8L 1UT9A 4OV5B 1ZA6A 3QUZC 3DX6B 2P4AB 1ORSA 1JN6B 3K8MA 1BQUA 4MJ2A 4HK0A 1J0HA 4QTIL 3MODL 4XTRC 3RUGF 3O8XB 1XIWB 3O4LA 5E1AB 4AT6B 4KRNA 3S98A 2GJZB 4TVPH 5DRWB 3BPOB 3M1BA 1BIIB 4YXKL 2MQ0A 4HUUA 2R0LL 2BRRH 4DOHB 5INDA 3QHZL 3MBEA 2ZNXA 3QQ9D 1RK0A 3IKCA 1AGCA 1NKRA 4YHPB 4Z5RB 1QLRB 4I18B 3ZKSD 2FATH 3MACH 4CU7A 4WENB 5T1LD 4NPYA 4PBXA 5BV7H 4QHNA 3KWWB 5IB4A 4JQIL 3SPVB 3RL2B 2RR3A 1I9JL 1G9NC 4YDLB 4WWID 1MRCH 2NY3C 5D1QD 1C7SA 4FABL 3OKDA 4DUVA 3C60C 4WEBH 1VENA 4JRWA 1A7RH 1UEYA 4OD2B 5DD5L 2YN3A 1YA5A 3VFUB 1TZIB 3MLPA 3ZTJG 3LDBB 4RFOL 5EU6A 5K9JL 4YWGH 2FYYB 2GSGA 4QXTA 1DE4B 5ANMA 3PP3H 2AXHA 1G7HA 5C7XL 3K80A 4NO0A 3OR6B 2B2XL 5DEFB 5C0CE 3ZKXB 5F8RC 3LKNA 5HYSB 2FEDC 4NQEB 5DJ0B 1AI1H 3AREB 1XF2A 5B4MC 5JZ7C 4Y1AD 5TPWH 5EBGA 3BUYA 1J8HD 4NQSB 3WHE0 3ZMRA 1S78C 3EJYC 2Z0BA 3GSVA 1P6AB 2J8OA 3N85H 2V5TA 1Z9OA 4ALAH 1J1PH 2DTML 4NQTA 4PJCA 5HBBA 5EC2B 4QOKA 4Y4HC 25C8L 2Z4QA 1X5AA 2DDQH 5JIPA 5JW3L 3QCUL 1HEZA 1UJTA 2C3VA 4JFXB 1JZ8A 1QYGL 4M61A 3UTPD 1SMOA 1U8MA 1BF8A 4JO3H 4PD4J 4AEHH 3TJHC 1LE5B 5D5MF 2OP4L 3TIEA 1S3KL 5ISZA 4MD4B 4JANB 5KN5B 4D9RE 1OTSD 4HG4K 4PREA 4A2LA 3LQZB 1KJ3L 4M1GH 3SCMC 5C9JA 4ZAKD 2QHRH 4IRSB 2B4CH 3R0MA 3EYUL 5E4EC 4G42B 4Y2DC 2RBLA 2VAAB 4P3CL 1QA9B 3WS6C 3G5YB 1FHGA 2FWOB 3W0WB 4CMHB 4H1LH 1ZLUH 4CVZB 3QIBA 4OTXL 3E6HA 3MNWA 1X5LA 1OY3B 4G9FB 1BEYL 5ESQA 5MI0B 3Q2CA 3MJ6A 2B1AL 7FABH 1ZANH 1IEBA 1IGYB 2DQFB 3K0WA 4M6NH 4I0PD 4U6VH 2R2EA 4JPKH 4P3DB 3IVKA 3EDEA 4DZ8A 4JKPH 1RZKL 5T1KD 1E4XH 5J6HB 3QXDA 2F5BH 3T2OA 5I17A 1F3JB 4XHQA 1JV5A 4MMXC 1LO3L 1OGTB 1JNNL 4LNVA 4RX4A 4XBGA 5C0FA 3WJJA 3C6LB 2P8LA 2BVTA 1SBSH 3IAGC 5JO5B 2X89D 1NCTA 3WE6A 1M7XA 4XRCA 4PJDF 5D70L 2L7UA 3QNYB 5J6GB 1JPTH 1L7TH 4Q97A 2X1PA 1X5FA 1MCWW 5D7LD 3L7EA 1I8LC 4JPIA 4Y5YB 2C3GA 2CQVA 2QEJA 5JR1H 4JEGB 3WXWH 4MXWL 4NYLA 4P2CG 3CXHK 2ATPB 2XTJD 4GW1A 2HWZL 1BBJA 5JNYA 5KBNC 5DJDB 1QFWL 1DL7L 5HVHC 3BKML 3KXFB 2N1KA 4MJ6B 1CD9B 5B38B 2OX5A 3MA9H 4LSVH 1A21A 3O0RL 4WO4B 3SKOB 2R56H 3NCJH 1HHKA 2AABL 2YD9A 2OL3B 4YHYB 2E7CA 2Y5EA 4PPTA 2ORBL 1A8JH 3ILPA 4BH7B 4P2RD 3SE4C 2OBGA 5L2JA 3VGFA 1T2QH 4WNQA 2AJXH 4NDMB 3L5XL 2B20A 1R3JA 3BP4A 2RCSL 3RPKA 3V4UL 1G7LB 2J8UF 4GRMA 5I1HL 3QCVL 5C0AA 5DJZA 5T5FH 3B9EA 4RNRB 1MFCL 4NP4L 2Q6WB 1L0XA 4TPRL 2F54D 5BMFL 2XTLA 4YDJA 3HZVB 3Q5OA 3KPMA 2CIKA 2NZIA 1JI2A 4G6FD 3CH8A 4JR9H 1JZ6A 3GKWH 2I26N 1A3LH 1YPZF 1LO0L 4QHUB 4GOSA 2OS7A 3EOYG 3B6SB 2BNRE 4FQ1L 2YXFA 1INEH 1HKLH 1NL0H 5JOEA 4JQVC 2D31B 2OJZH 4KTEH 3NZHL 2FB4H 1NGPH 4JN1H 3O3BB 1FFPB 1UVQA 3E8UL 3AVEA 3DROA 4OAWA 1KPVB 1ZHKB 3L3IA 3DXAE 1NC2D 4DQOH 1WSST 3UCRA 3REWA 3OKOB 2JK5A 1YEHH 4ZUUA 3IF1A 3RWEB 4Y8DC 5FV1L 3WMSA 3T09A 1JHLH 5FCSH 1FN4A 5HYJB 1YECL 2ZSVA 2GJ6A 2NY5H 4FQJL 1GC1H 3SO5A 2FL5B 1KLUA 3RBSA 1FNFA 2BVQA 4ODUA 3GGWA 2FZ3B 2YPLB 2ADJA 2VLKE 1CDYA 2DL2A 4HT1H 3KAAA 3QHTC 4Q58C 4DTGL 3GM8A 2V7HB 1FBIH 2AJSH 4IM8A 1BAFL 2OR9L 2F74A 4JY4B 5AYQA 1UXSA 5E8NA 2HN7A 2YXMA 3WDIA 3KPSB 4PBWD 3LQAC 3I6LE 4L4TA 4U1MB 1KNOA 1WWWX 1RIVL 5K93A 5TQ0H 1E6JL 5ITFA 1DQDL 5C0RH 3MRPA 4P2QB 5DRXA 1JPGB 3CFKA 4IDJL 3MOQA 4HCRL 4MWFA 4L4VB 4EI5D 5E8OA 4DKEH 2IPKA 5KG9B 4Y4FA 4TVPE 4TVSa 4WI5A 2I24N 2FIKA 3TESA 1D5IH 5EC1B 2NY1C 2F53D 5I75C 2JELL 5DI8B 3FRUB 5HGHA 43CAB 4MD5B 1ZGLB 4X6EB 3DJ9A 2VJXA 5HYEA 1QNZL 4MSWB 4OT1H 3UBXA 3P0VL 4NUGH 3QUKB 5MHSD 1G7IB 1A0QL 4X4ZA 4LU5L 9CGTA 4KUZL 4LIQH 4H25A 1AQDA 1KCUL 1FO0A 4M8QA 2VZTA 3L5WA 1X44A 3UO1H 5MEPB 3VXMA 1I3RB 4OIAA 3QJFA 2VLRA 4ZTPH 1QRKA 3VXSB 3HNVH 3I6KB 1QSVA 3HNSH 4IRJD 1ZLWK 3TLRA 3KPNB 1JGLH 3ALXA 2HT2C 4ZUWA 4MNQE 4F3FB 3MRHA 3FO9A 1G9NL 2PO6C 4APQC 4U3CA 2XV6B 5KSVA 2PTVA 3HZMA 2OLDA 3CDGB 4PV8B 3D39A 1WTGT 4P4KC 2XZZA 1A1NB 4PTTB 1R24B 1IBGL 2VLLB 2YMXL 4XCYB 5D9SB 3G6AA 4M62L 4LKCA 6FABL 5C8JB 5H8DA 3CCHA 3U4EB 3KYKH 3PHOB 2X40A 2IQ9L 1Q72L 2HFGH 3H42H 3P77A 5FUOH 3UAJC 5GGUB 3RWGA 2BNQB 2OZ4A 2NY2C 4PD4K 5HHXH 5LKNA 1MFAL 3QDJB 4RBPH 4NGHL 1NSNH 2PR4L 4FTVE 1LHZA 5GGSY 1FAKT 3ROOA 2Y36L 2VRAA 1EFXD 4UV4L 3WFCH 3MNZA 4HQQH 4K71C 1K8IB 5CBAA 4JN2A 3ECBA 1MRFH 4KK5C 5MEOB 2NX5A 3HC3L 3MV8D 4HWEL 1WIPA 1QEWB 2XZQH 5B3NA 5DEGB 2DQGL 3AB0C 2P42B 4KAQH 5CILH 4JVPA 3MR9A 3SDDD 4CJ0A 4QO1A 1U42A 3KNBA 1QRNB 2EH8H 4NFCA 4KROD 3B9VA 3SGDI 1IGTA 2ZOLA 4XCEB 3VXQB 2RFXB 2P5WA 2J2ZA 4DGYL 1GZQB 3QIUC 3MGTA 4ZFZA 3L3OB 3SY0A 3SDCA 4JM2A 1KJ2L 2ICCA 1MJ7H 5EFIB 4JRYE 4NBZB 3ZE2E 1ZS8B 4JHAH 1FC1A 2VO5A 2OK0L 4X7TB 5TH2A 5K59F 1X5YA 1ETZA 4HIIA 1RUML 5I76B 5IUSA 1MWAL 5D7JD 5DK2B 1KEGL 3QFDB 5IWLA 1QFPA 3ARBC 1B2WH 1D9KA 5BOZG 2Z8RA 4J23A 4MDIA 3B5TA 2PYEE 5FYJU 1KFAL 1I7UA 3VFOA 4G8GE 4YHKL 3WL9B 3RPIB 1N7ML 4C4KO 4LVHC 1GSMA 3SJVE 3A67H 3TBYB 5HGAA 2R1XB 3CPLA 3ZTNH 4FQXB 4PJFF 2IANE 3PWPE 5D7IF 1EJOL 1CZ8H 5IJKC 5DJ6A 1F3DJ 4X7SH 4HWBL 4HIJA 5H94B 4RFNC 5I1AA 1X3DA 2VH5H 2EDNA 2V9TA 5ENWB 1R5VB 4L9LA 4R4FH 4X0KA 1Z9MA 1ZHLA 3MUGB 4K3EH 5GGTL 1Q1JH 5L6YH 5C08E 3JUZA 3DV4A 1NFIB 5T3XH 3UTSE 2A9NL 4GQ9H 1S7UA 2VERN 3MV7E 5FDYA 1CGWA 3VFPA 1HXMB 3VFWA 1Q94B 1PLGL 3LDBC 5T5NF 1T7WA 1BD2B 1V7MH 1A9EB 1HYSC 3U9UB 5C92A 1FNLA 2HJLA 5EU5A 4MHHG 2R39A 3VW3H 4FFYH 1YN6B 1FNEB 3RTQD 3OZ9H 1OTUD 3S36X 4I3SH 4UILH 2XA8H 3GM0A 4NN7C 4ZFOL 3S96B 3SGJA 4Z7VF 2JB6B 4PRIE 3LKRB 3MNVB 3QEQA 1LWRA 4WW1B 4OBSA 3C08H 4Q9QH 4N8CH 5DSCA 1C1EL 4I8DA 4LKXA 2HKFH 2G60H 5FUCC 1EGJA 3KDMA 1IKNA 3P73A 1PJ9A 4GXVH 4WFHE 5DC4B 2ED9A 3GSNB 5FYLD 3S37H 4NQXA 3VE0B 3U7AA 4OZ4A 4R2GD 3MXVH 1VPOL 5C6WH 4YXHH 3MRQB 4GRLA 4OZFA 3TZVC 4J4PC 3BDXA 4BKLA 2Z31D 2CLRA 2YEZA 5FUZL 2V2TA 4QXUH 4HFUL 4ELMA 2DF3A 1UC6A 2Q3AA 3ZSSA 4P57A 5EUOB 4Z77A 4XVUC 1PKQB 4PRDB 4WI3A 5JHDD 4UUJA 5TE6L 1G6RL 3K4DA 3U7WL 2VDRL 5BRZD 1FL3B 1NBQA 1PG7X 1YJDH 3RX5A 4PGDB 4HZAA 4GAJH 4YBQD 5EPMA 1VGKA 2DD8L 3F7PC 3RDTC 5MI0C 4OUUA 4HS6B 5DT1L 1A5FH 4HGWB 4PLKC 5F71A 1MNUL 2YD1A 1RJLA 2LV4A 2VSDA 4LARH 1L7IH 5CGYC 4RWYL 2IADB 1RZ8B 4GKSA 4POZC 4KU1A 2A6JA 2LABA 1E4JA 1NKOA 4X9HA 2FD6L 4P5MB 4QEGA 4P2OB 4K23L 5MEND 4QRTB 2DRUA 1EHXA 3VFSB 2HYMA 5BW7A 3DETC 1TLKA 5IGXL 4PJAE 2QHLA 1II4E 4N0FB 2AV1B 3C6LC 1UKSA 1ZT4B 5T3ZL 2OTWB 1R3IL 1X7QA 4IS6A 4R7DA 1A4KB 1RJZA 3M45A 1T6WA 1ZLSH 4QF1A 4CAGA 3R06A 4AEFA 5JXAL 1GGIL 1MI5D 5EOTB 3KLDA 4O9HH 2E9WA 1TQBC 2C5DC 4M6OH 1T3FB 2EXYD 4NJAL 1F4YL 3TCLB 4RA0C 4OCYH 2HFFB 3C2SA 1NAKH 4I2XB 3LQAL 4FQQB 4ZDHB 5JXED 2CGRH 3L95B 4QTIH 3IDJA 3LAFA 1FV1B 3DIFA 5D7SL 4WGVB 5F7KC 1VGEL 1K2DA 2I60L 4YXKH 4OLUH 5D1ZB 2PTTA 4PLJD 5KSBB 1MJUH 5DJ2A 3MLSH 1WC7A 4M7KL 5I1LA 3QHZH 4QY8A 4WO4C 2R69L 1AO7E 2X5PA 4PJHE 3Q6FA 3B8SA 5DF0A 3CMOL 1INQB 3NIGE 1OAZH 3WNMA 1BGXH 1SBBA 1OP5K 3N1FC 1EA9C 3OGCB 4LIQE 4YHLL 4JQIH 3LD8B 1FIEA 5KSAD 2O5YL 3O3AB 1NAMA 4LCIL 3HE6B 3MRGB 4GUPA 2X10A 2JIXA 4KQ4L 3DYMA 1AQKL 5DMGD 1BZ9A 1G7MB 1KT2B 2IQAA 1W8OA 2AK4B 2NPLX 5K9JH 3ARFC 4YFLI 3D87B 4U1GC 2EZ0D 1TZGH 3EGSA 3HAEA 2LAAA 3ZE1F 1M7IA 4DOHE 5FK9A 2W38A 3VFMB 2YS4A 5E94A 4MMZC 2CMRL 1JPST 3ARWA 3WN5B 4CN1A 5GS1B 2D7QA 4YGVB 4JAMB 1SYVB 1P1ZA 2B7DT 1YZZA 5FA4A 1CBVH 1T1WB 2GHWB 1AGDB 3EO1B 5MP6L 5INCB 3TN0D 3FB6B 5JW3H 1UXWB 4P48A 2X4TA 4U7MA 1T0MA 1NGXA 2IH3B 1QYGH 5KVMC 4WTZG 1J0JA 1F4XL 3F5WA 3BGFB 5HHMB 4NRZA 3MLYL 1Z6JT 5GPRA 2OP4H 4X98B 3HPLB 3RVUD 5DS8A 2ZG3A 4HIHB 2BSSB 4Z8FL 4M4PA 1NUDA 4NQEE 1RMFL 3BMWA 3X3GH 5FO8B 1A6UL 2ICEA 1BLNB 5LBSH 2HFEA 3EUUA 4NRYA 4P3CH 4U1NA 1MY7A 4O2FA 1JTPA 3NZ8B 2DJUA 3OKEA 1I75A 3ARGD 4HHAB 4LASL 5E5RB 1OAUL 4D9LH 8FABA 3D85D 3CUPA 3P4OB 4A6YH 1DSFH 3BH9B 1ZT1B 2FO4B 2O5XL 2B1AH 1H3XA 2NCMA 4WW2B 2VXVL 5I15L 4KGLA 5JDJA 3HE7C 3SDXB 4X4YB 4HH9B 1IGFL 3GMLB 1XF3B 5EOQL 5IFHL 1O5DT 3WHXA 5SX4I 4HKJB 4PJ8A 5IROC 5EN2B 5FKAA 2CUHA 4I5BA 4HIEB 5BS0B 1S7TB 3LS4L 1LO3H 1JNNH 4LCYA 3F7VB 5FYKU 2AQ3A 2A1WH 1VEPA 3T0EB 3O41B 3T0DA 1UYWL 1JP5A 1YEGH 3HZYB 1JHKL 3WUWA 1PZUB 2X4QA 3IJHA 5A3ID 4S1DC 3BN9D 4LQFH 4O51A 5E4IA 3FMGL 1EHAA 1S5HB 5LAXA 2VZ3A 4W70A 5D2LB 5T3XE 1MJJB 4N1EA 2ESVE 1UB5B 2HH0L 3Q0HA 1CR9L 2XKSA 3SCMA 5BXFB 3BUTA 4HS3A 1OWRM 3SBWA 3O45A 3TO2A 5HI3D 2J6EL 2Z91A 3KJ4B 5EZLB 4FQIH 1TTGA 1M71A 2HWZH 5C6PB 1I4FA 4LCCB 2AI0H 3ZTJH 4TRPH 1DL7H 3H0TB 5MERB 3BKMH 3EDDA 4F80A 1P7QB 2BVOB 5D6DC 3ESUF 1N0LA 4FXKA 4KQ3H 4GW5A 3ZYOA 5FOJA 2N7AA 4PRPB 5EUKB 3PDGA 4JLRB 3UPRB 5GJSL 1JZ2A 1I8KB 3VXUA 35C8L 3V4PL 1KPUB 3W39B 3HI6L 2HT3D 3QSKB 3MLRL 1FGNL 4HWBA 4KVCL 1HQ4B 4RMRA 4ISVA 1P53A 1X5KA 5GRYA 2RCSH 1FLTX 2P8MA 5I1HH 3WYRA 1U8IA 3JVGC 4UDUB 3QCVH 3QRGL 3MZGB 4Z7WE 1QR1A 4K7PL 3AUVA 1SVZA 3G9AB 2XACC 3MJ9L 4GXUM 5HDQH 5BMFH 4P49A 3KXFE 1YC7A 3ZHLA 2XY1A 3IRPX 4EOWL 3UTTB 1LO0H 4K8RD 2QQKL 3VWJB 4FQ1H 5ICZA 3IDNB 3IDUA 3O11A 3H9HB 2O61B 1CVSC 3DMMD 4XX1G 4YDKH 3QUYD 3GSNH 1UENA 3T0AA 1CT8B 4L8CB 1YNTA 5AD0A 4HZLA 3IFOB 3E6FA 4YAQA 2VZVA 5FEBA 2W65B 4WHCA 5DJCA 2IH1B 4PJXA 5GS0D 5F96H 4UDTB 1YECH 3FO0H 2NXYB 1CS6A 2VLME 3JWDC 4FQJH 1GZPA 4H1LA 4X6CF 5C07B 1U8QA 5E6IB 3S4SG 3ALPA 4ZO8A 1CL7I 3CVHB 2MJWA 2DWEB 1JHTB 2W60B 4DTGH 1GHFL 3H3KA 4PJIF 4J2XA 5DEZA 2D3VA 4M5YL 3T2QA 3U79A 2X09A 4DUXA 2CLZB 5C6TH 2PYEA 1MLBA 1B0WA 1ULVA 3DBXB 4K9EC 4AM0B 4XXDB 1IAKB 3RZCB 1IC5H 5FGSA 3KPLB 5IV2B 2MTPA 1MCPL 3C5ZB 1IEHA 4DZBB 1KJMB 3V5DA 2NY7L 1QHPA 4TTDC 1TMCB 5CAYB 1RIVH 2KKQA 4UMGA 3VFGH 1DQDH 1RZGA 5HYJE 4IDJH 4HCRH 1U8OB 1GOGA 4ODXB 1TCMA 4IIQB 4ZAKC 4ZUTA 2MMXA 2AS5M 1CI5A 4L29B 4WY7L 5C08A 3PP4L 3P9MB 2C7UA 5SX5K 2X4UA 4D0DA 2EDTA 4HGMA 3U0TB 4QRPB 1QPPA 2AV7B 2JELH 4WUUD 1HXYA 3CFBB 2C1PA 4G8EA 2E6QA 1QNZH 2YZ8A 3KPQA 1CE6B 1Q9OB 3FONB 3P0VH 3RA7H 1T1XB 3PL6B 5E00B 4HX1B 1A0QH 3TFKC 4LU5H 3BP5B 2MQ3A 1KCUH 1KB9J 1IGMH 3GFUA 2Z8SA 2GW5A 4P46D 4CGTA 2VQ1A 5FM8A 4KZDL 4NQDD 2CO6B 2QKIA 3KPSE 4HEPG 1S7WA 4M1CC 3U82B 3WS3A 3U46A 1WUNT 4U1IA 4UOW1 4P2QE 4PRIA 1BREA 1ACZA 3L3JB 1M6OB 3VMOA 1YNKL 3TBWA 1H3PL 3TA3D 4AK1A 1IBGH 2ZWLT 2K1MA 1U8KB 5GSVB 2YMXH 1OP9A 2NYYD 6FABH 2N56A 2PXYA 3OF6D 5JIIA 1K4DB 1RU9L 4W6XB 2IQ9H 1Y18B 3JBG7 5H35A 1QHOA 2XFXA 1D3CA 1L6XA 3IU3B 4NGHH 4TSAH 2PR4H 1UCBL 4UT7L 4Q2ZB 3CFJA 4UV4H 3VXSE 4OM0L 1DQQA 3SE8L 2RGSA 4Y5XA 1FH5L 1NANI 2PYFA 2BCKA 3IDMB 2XTJC 3P4LA 5F7MC 4X8JA 4O2CA 2BHUA 4RGND 5I66A 3AROA 4ZNCD 4ERSH 3C09C 1J1XL 3ZE2F 4P2OC 2DQGH 3VXTA 2GFBA 2C1OA 1YEIL 5JOPE 1K85A 1BJ1H 3GSXA 5E8DL 1BJMA 4BSWA 4LHUD 1YEDA 4XPAL 4PGCA 4XNMA 2I07B 1CTNA 1T83C 3FQTA 4RRPG 2A83B 2VDNH 4G3YH 3GJEB 4NJ9H 2IALA 1KJ2H 1WBXB 4MAUL 1CLOL 3F8UB 1I8IB 3UYRL 5KZCB 1JWUB 1NC4A 4FHBD 2PO6A 3QPQD 3BSZL 2A6IA 5I73B 3MV9A 2X7LB 4HKXB 3KPRB 4UTAH 3G6DH 1HHJB 4FMKA 5KAQG 3P3YA 3WIFB 1MWAH 1HI6A 3V0VB 1KEGH 1ZLVK 3LRHA 3QWOB 1K8DB 3ARDB 4YEEA 3NCEB 5EO1B 2P49B 2Y7QA 5CJQH 2VZSA 3GSQB 1KFAH 4P9HC 4WI6A 5T1DH 1I9IH 1QRNE 1S9YB 3GHEH 3BWAB 4YHKH 5ADOH 3W9DA 2NTFB 1V7NL 5DQ9A 4HC1H 4WU7A 5DD0L 1I3GL 2X4SA 5E0QA 5E2TH 1EJOH 4U7SA 5LGHH 4PBVC 5EU4A 3O4LD 2X4NA 5HVGB 3OR7A 1NUFA 4PY8I 2WUBL 1N6UA 4YDIH 1LE9A 3JTTB 4E9LA 1Y6NR 3MBED 4L3EA 1T7ZA 5GGTH 4C56E 1OGAB 1RURL 3OAZK 3BFOA 3JV6B 5IMKB 1FVDA 5HYFA 3W2DH 3RL1A 1LO4H 4J1UA 1AIFB 3QIUA 3CJJA 2BOBB 4XVSL 1BMGA 4PJHA 4ODWA 2AP2A 5L8KB 4F7EB 43C9A 3HMXH 4UIKH 3QIWB 2ADFL 2W59A 5I71C 4OV5A 2GAZB 2VYRE 15C8L 2VR5A 2QQLH 1R0AL 1ZA3B 4O02L 3DX6A 4MJ5A 4M93C 5EU6D 1JN6A 5GS1C 5I16B 3RY6A 4MAYB 3L3HB 2DLGA 1XIWA 2EE9A 5E1AA 4AT6A 5JA9A 4R0LC 4NO0D 2GJZA 5DRWA 3O4OB 2KH2B 1BIIA 1C1EH 2APFA 1MF2L 1RFDH 3O6LL 1PBYA 3G08B 1DR9A 1N8ZB 4P23B 3KJ6L 2NY0B 1MEXL 2ZPKH 1MQ8A 5BVPH 4J3UA 1FE8L 1YEEL 4EI5C 4YHPA 1BD2E 5D96B 3SGKC 5IJKA 4Z5RA 3QUXC 1QLRA 5DHYB 3BGFC 4I18A 1VPOH 3HTLX 5E9DB 4BQBA 3GO1L 2FCBA 3OAYK 1HIML 3KWWA 4QOKD 5FUZH 3SPVA 2YRPA 3RL2A 4AL8H 1EHNA 4LSUL 2JJWA 1PD6A 1OAKL 1GPOL 4CUCA 2QR0B 4OD2A 5BOPA 3ETBF 3BZEB 1IE5A 5TE6H 1G6RH 1TZIA 3VFUA 3NCYS 3RVWD 3VGBA 2VDRH 5ISZD 4F37F 4IJ3C 3MRMB 4S1RL 5EZOL 4XP1L 2FYYA 3F7RA 3ULSB 1DE4A 3WKNA 2R0WL 1I8MB 1KIPB 2LU4A 4KH2A 3RRQA 3G5VB 3EBAA 5DEFA 4PJAF 1ZVSA 5HYSA 3L3DB 5DJ0A 1Z3GL 2NY6B 1ZV5A 4RWYH 3AREA 3GSRB 3QIBD 2WQRA 5CUSL 4XAWL 5BQ7B 5EOCH 3EHBD 3QDGA 4OI9A 1YUHB 1TNNA 2MCPH 3ROLB 3SQOL 2J3SA 3DYPA 4Y4KB 3UP1A 2EE6A 2VL5B 5T3ZH 3JWDL 2LQRA 1R3IH 4V2BA 2QSVA 3K74B 4RAUB 4PRAB 1E4WL 4JFXA 5F7EL 3THML 5JXAH 4XVJH 1LE5A 2WWMD 1NMAL 2UY6A 4MD4A 3TBSA 3OV6A 4JANA 3CFIC 1B0GB 4P2YA 4PJ7F 4RX4D 4XPHH 5KN5A 4K9EL 2X05A 3LQZA 1KBGH 2YK1H 4NJAH 3FT3A 1CICB 1F4YH 2XXMB 1PAMA 1EV2E 4G42A 1DUZB 1QLEL 3FTGA 1CG9A 3LQAH 2VAAA 2CKBB 4TOYL 5AZEL 5D7SH 2FWOA 3W0WA 1KB9K 1OD7A 2I60H 4IMKA 3MROA 4LSRL 5EIVA 3RGVB 4GKNB 4CVZA 1HSBA 4PB9L 4FG6D 4G9FA 4JQXC 4N5ED 3I3DA 3VDBA 2OMNA 2M1KA 2R69H 4RBPK 2P24B 1UM6H 1F8TL 2WV3A 1IGYA 2GTWA 4X6DB 3RVVD 4P3DA 3BKJH 2XI9A 1U6AL 1TXKA 5CZKA 1VEOA 4A2MA 3IYLW 1FVEB 5BVJB 4NZTL 5IQ7L 2O5YH 5GZNC 1ITBB 3E3QC 1F3JA 4MZ3A 1U3YA 4K2UL 4RAVB 4LCWE 2CDFB 3CFEB 3C87A 4KQ4H 3C6LA 4I2XE 1AQKH 2NLJB 3PXHA 3BW9B 5JO5A 2IFFL 5C0GB 2XQYG 1LMKA 4X4MA 1NEUA 4N0RA 3UDWA 3NH7H 3FFCA 2V5RA 3QNYA 1U8PA 3VRIA 2ZUQC 5I19L 4LLQB 2CKNA 4Y5YA 3VWJC 1CGVA 3OB8A 5GQBA 3QP3A 3PWVB 1EBPA 2EC8A 5I8CB 1XCTB 3UX9B 2ATPA 4AQOA 1CLZH 5DJDA 5EO9B 2G5RA 1AE6L 5MP6H 4MJ6A 5DD6B 4EIGB 4YX2L 5B38A 4CNIB 4KK6D 2ZUUA 4WO4A 3SKOA 4HV8A 2XRAL 1T1ZA 1IAMA 2NXYC 2F19L 2OL3A 4G6JH 1PY9A 3MLYH 5IIEB 5DLML 4JY6B 3HZKA 4HULB 1RZIA 4MXQD 4Z8FH 2CXKA 4XI5D 2N4IA 4NDMA 5JPNB 1P84J 4JFEB 1H5BB 3TWCL 1G7LA 2GJ6D 5KVFH 4FQCL 1WZMA 1GYAA 4RNRA 4RISL 2Y5TB 4JHWL 4JZNB 4LASH 2EYTB 1BVKB 2BOCB 1OAUH 1RPQA 3HZVA 3ARFA 3BX7C 3G5ZB 4KKLD 4R2GC 3P4NB 5DFVD 4LFHD 3GMPB 2Z31C 4QHUA 3QQ4B 1R5WB 4NO2B 4DK3A 4X6BB 1H9VA 3B6SA 4CDHA 4X80L 1IC4L 2D31A 5HHME 4EN3B 3OXRB 4M3JA 2FGZA 5EOQH 2J5LC 5K9KB 2JJSA 2HLAB 3O3BA 4P9HL 1FFPA 2EICA 3GMNB 1KPVA 1ZHKA 5CP3A 3VGEA 3LS4H 3STBA 4PY7B 4GO6B 4GG6A 4ZUSB 4F9LC 3OKOA 5CEXB 3C5SB 4Y4FD 1JHKH 3RWEA 4YC2C 4U1KA 2HTLD 5HYJA 2NNAB 4IOFD 5AZ2L 3LEYL 4JY5H 1Q9KB 4JE4B 1Y6MR 3FMGH 2FL5A 2W1NA 3Q5YA 2XIDA 4ZO7A 4PUBH 1IT9H 4ORGB 5L7XH 1VFOA 2FZ3A 2YPLA 2XT1B 1I9RH 4FFVD 1CR9H 4W6YB 3S7GA 3C8KB 4PJGB 1ZTXH 2V7HA 3VXMD 1FORH 1RUPL 2VLRD 3NOIA 5J1AB 4JY4A 1IGIL 4NN5B 4LSPL 3RGHA 3KPSA 5BS0E 1BWWA 2ICWI 4U1MA 4MQSB 5D5MB 3T0EE 3D39D 4N8VB 5LWYL 3ARTA 4MXVF 1J0IA 2VZOA 4P2QA 5C0JB 3OX8A 1CXKA 3HE7A 4L4VA 5GJSH 5T1LB 4MCZB 1OPGL 1U8NB 5KG9A 4CU6A 4PJ5B 2ILLA 1V3LA 1MVUB 4YIQB 2CRYA 3MRKB 3HI6H 4LPTA 5D2LE 5EC1A 3MLRH 5JXEC 1FGNH 4KVCH 5D1QB 1ZKAA 5DI8A 3FRUA 4MD5A 1ZGLA 4X6EA 3BH8B 2DLTA 4MSWA 2H2SC 3QUKA 4URTB 3D5OF 1G7IA 1MAML 1BVLB 5HHOB 4CBPA 1MCWM 4HSQA 3S3JA 4JFPA 3MJ9H 2AJVL 5MEPA 1I3RA 2NX5D 3VXSA 5SWSE 3I6KA 4I9WE 3P2TA 3KPNA 2DWDB 2HJFB 5I8KL 1DP0A 1A6TB 5KSAC 3CDGA 3PIQB 4PV8A 1AFVL 1WZLA 1MHHB 3WCYA 1HINL 5E56A 2P5WD 1JGDB 1A1NA 4O58L 3SDCD 4PTTA 2AEQH 5FM5O 1R3KB 1JRHH 1QSZA 2DL9A 2X44D 4JM2D 5DMGC 2R29L 3FQUB 4XCYA 1CIUA 5C8JA 4PJDB 3U4EA 3QQ3B 1G7QB 3GMOA 5D93B 2EZ0C 5B8CB 1A6ZA 3FN0L 1G7JB 3PHOA 2EDHA 1MCHA 2NXZB 4G6AD 1CGYA 3O6FB 5GGUA 2BNQA 4FQ2L 4NM4L 2R23A 1YYML 4RDQF 3QDJA 1KELL 5KOVC 4JG1H 4NWTL 3VI4E 4QYOB 1JUFB 1D9KD 1T0NB 1K8IA 4G8FB 2BMKB 5MEOA 5T3ZE 3UTTE 1OM3L 1GHFH 1QEWA 1GAFH 4JFDB 3H9SB 2CIIB 3HFML 5DD1H 5DEGA 5EO0B 1EEYB 3TN0C 1GIGL 4XCEA 3WSQL 3VXQA 2RFXA 1MCPH 4MS8C 3IDYC 4MDJB 3L3OA 4PTUB 2YN5A 5I6XC 2D0FA 3TV3L 3BAEL 1K5NB 5EFIA 5F1KC 4WFFE 1ZS8A 2CLVB 4M7JL 1EX0A 4LK4A 3ULVH 4X7TA 3NFPB 5T1KB 1W72B 3LRSB 4MA1B 5C07E 2FIRT 3PP4H 2J8UB 5I76A 3TGXA 5E8EB 5DK2A 3TT3H 3MLXL 3QFDA 3OKMB 4HF5L 1KGCE 3RIFF 3BHBB 1T6VN 3BYYA 4EBQH 3QDMA 3ARGC 3R8QA 2DTSA 4JO1L 5I1EL 1QR4A 3GDBA 4JM2F 1JGUL 1QO3B 3SGEI 1MH5B 2NY0C 3WL9A 4AMKH 3HUJE 3WIIL 1BHGA 1YPZB 3TBYA 2R1XA 3MRCB 4FQXA 4YFEA 2APXA 3ARZA 1KTDB 7CGTA 5D7LB 1NFDE 1QBLL 3QEQD 4YZFF 1AGBB 4LVOC 4KI5E 4YH6A 2DJSA 5ENWA 4GH7B 5GRJL 1V3KA 2HFTA 2AJ3B 4U33A 5ESAB 3QFJE 1PX4A 1H3PH 4FNLL 3MUGA 4U2YA 3RKDD 2R9HC 4G43B 1NFIA 1TJGL 2XG5A 3R1GL 3BRGC 3L6FB 2MWCA 1FNHA 3GIZL 4N0CD 5A3IC 1HXMA 2H32B 1Q94A 4GRLD 1BD2A 1VFUA 4KKAD 3S36L 1DQML 1A9EA 5L9DH 3U9UA 3K4ZA 4XZUA 5D1XB 5AUMB 2FR4B 1A3RL 5CEYB 1QSEB 5F6IB 4I1NB 4K3DL 1JF1B 1YN7B 1YN6A 3FN9A 4BZYA 1FNEA 2NY6C 3SE8H 2P5EB 1ACYL 2V2WB 2ZP0T 3N1GC 2PF6A 5F88B 1P84K 3S96A 2X4OB 2JB6A 1F58L 4R90H 3LKRA 3MNVA 4WW1A 1IRAY 2X2YA 5HXMA 1BM3H 5DGQA 1YEIH 4X83A 3CX5J 2VR9A 5D2NB 1CCZA 4RAHA 4LSTH 1KIRA 1DZBA 5J0BA 3VE0A 2ATKB 4P9ML 4LLAA 5EG6C 1QFHA 3ZDXE 1E6OH 1EXUB 1FGVL 2HT3C 4YE4L 4Z0XB 3SEPA 4H8WC 3HG1B 3KYMB 3WFDH 1KEML 3PNWB 1IJ9A 5FYLL 2BHYA 3Q5TA 4G7YH 5EUOA 2ICWB 1PKQA 4PRDA 3TPKA 3LN4A 4TQEL 3WNNA 2EIDA 1FL3A 3V6FB 4FQHB 4HJGB 3WO3B 4DVRL 4YK4C 3MRJB 3BRFA 4HS6A 1I3GH 3VGDA 3IFNL 5EULV 1U8HB 4HGWA 4K8RC 3WHE1 5FECB 4AH2B 2VC2L 2R1YB 4FZEH 4ELMF 4XNZC 1RZ8A 4EDWL 5HDBF 4PRNB 4LLMB 2WUBH 3QUYC 1G7PA 3B83A 5TFSL 4P5MA 1A47A 3IJSB 4P2OA 4QRTA 3VFSA 5IB5B 1RURH 3VH8A 4N0FA 5GS0C 1ZT4A 2AXFB 2OTWA 1T83A 2EDEA 1A4KA 1H0DB 2O93L 5L2KE 1IAIM 4KTYA 5J13B 5FOBB 1T7VA 5ACMA 1FQ9C 5EOTA 2G9HB 1HSAB 2EDWA 1BWMA 15C8H 2JIXD 4OBRA 1YNLL 1WZ1L 1R0AH 2NW3B 4O02H 1DUYB 1QFWM 3VFRB 4BUGA 3TCLA 3H9YA 2WBJB 2HFFA 3CFCL 3PWUB 4I2XA 2KZWA 2FJFB 3DTXB 3IJYB 3L95A 1FV1A 3S3PA 1A9BB 1MF2H 2H3NB 5ALBL 5E6YA 5KSBA 1KULA 1FFOB 3QUML 4IRJB 3R8BB 1FE8H 4ZFGL 3DWTA 4OFIA 2KUTA 2HTKD 4WI9A 2IFGA 4XTRD 1INQA 4OQTL 3JUYA 4OIIL 4POYA 1JNLL 3IFLL 1IAII 4JFHE 3P30L 1F45A 3OGCA 1KN2L 1HIMH 4H5SB 4WHTB 2UYLB 2GI7A 5C09B 3IAQA 1H5BC 3HE6A 3MRGA 1OAKH 2WP3O 3ARUA 4PP2B 5E7FA 1GPOH 4ZSOB 3WIHL 1MUJB 1G7MA 2W0FB 4PJFB 1KT2A 5D7IB 5DJAB 2AK4A 1DANU 5EZOH 4XP1H 5IT2H 1YY8B 3KGRA 2FBJH 4M03A 4YHIB 3GUTB 3HR5B 2E7HA 2NY3D 1T5XA 3FAXA 3VFMA 1Z3GH 4ZTOL 3TA3C 1Q0XL 1NGWB 3WN5A 1EZVY 4X7DC 4ETYA 5GS1A 1H15B 1U2HA 2DIJA 2BVPB 5CUSH 2ZG1A 4YGVA 1XR9B 1SYVA 5IR1B 1BPVA 2DKMA 1CFTA 4PRHB 5EBLB 4KROB 4RIRB 4NM8H 4NKOB 1T1WA 3EO1A 4XCNB 5HD8D 2FEDD 3SQOH 2EDRA 5INCA 5H2BB 5FHAH 5B4MD 3UTQB 1UXWA 4AY0A 5IESL 1IL1B 1WV7T 4Q7DA 2IH3A 2M8XA 3SGKA 3EJYD 2HVJB 4PJ8D 3HMWH 1NMAH 1A7PH 3HPLA 4TNVK 1EVUA 4NT6B 3I6LD 4Z7VB 4RGNC 1XH3B 1TZHA 5F72S 3BISA 4HC1A 4HIHA 4Y19B 2BSSA 4Y4HD 4QHLB 4TYUA 5BO1L 3BMVA 3CMGA 4QCIB 3KR3L 5FO8A 1CXLA 2CH8A 2W0PA 4E41B 2HT4C 5CBEB 3CK0L 3VXRE 1U93B 1U92B 5EU7C 1CU4L 1F6FB 5AZEH 3NZ8A 3T65B 3ULVE 5KANI 4OCRL 4LSRH 4HHAA 5HPMB 3A6CH 2APWA 3O6MH 3VU2A 4D0BB 1UA6H 4PB9H 3SCMD 1VA9A 3P4OA 3OKNB 1ZT1A 3BH9A 3M8OL 2FO4A 5B3JE 3MRIB 3L3KB 1F8TH 4WW2A 3MV11 4Y5VB 3SDXA 4X4YA 3GIVB 2UZIH 4HH9A 5F44A 4YHNB 1FG2B 3WFEH 3GMLA 4FP8H 1U6AH 1XF3A 2X1QA 1NDGB 4OV6F 1JGEB 2DQCL 4HKJA 4OLXL 4UTBH 4YO0B 5EN2A 3VFNB 1FG9C 4WUKL 3TH2T 3U9PL 4HIEA 5BS0A 1YDPA 1S7TA 3MV01 4L8DA 4XVTH 1UFUA 1F2QA 1W0YT 3F7VA 3T0EA 1CL7L 2P8PB 4ZG1A 5KTEH 3O41A 2HMID 3VXUD 3HZYA 2A6KB 3QRFM 4DN4H 1N3NB 2PTUA 5IVZB 4AENB 3LMJH 5CGTA 5F9OH 1W72H 2GT9B 1AY1H 1QKZL 5I19H 2VXTL 1S5HA 3TJEL 1DEDA 2QADC 3CVIL 1FL5B 1Q8MA 3FOMB 4LLUB 4IRZH 5D2LA 5DDHB 4OFKA 1MJJA 4F7MA 1C5DB 3OKLB 1TJIL 2DM7A 1UB5A 4MNHA 3NFSL 4X6DE 4B0MM 5BXFA 4ODTH 3MBEC 4N5UA 1TQCC 4PJEF 5EZLA 4GMTH 3EZJB 1N5AB 4NQUA 4LCCA 3CX5K 3IU4L 1JF6A 5MERA 1AE6H 4XNQB 1B4RA 1C16B 5D93C 1P7QA 1P6FA 4YX2H 1U91B 3IDIB 5IBTL 5HGDB 4ONFL 1I1AC 3IDGB 1UZ6F 3AM8C 4XX1E 3OKKB 4PRPA 5EUKA 1GRWA 3CSYB 3VDCA 4Z76B 4JLRA 5GJTL 3FQXB 4QNPF 1NCBH 4ZXBB 1I8KA 1HZHL 2AJYL 1KPUA 1R5IB 3S88L 3W11D 5DLMH 4J6RL 4L1DA 4NC1C 3PUCA 1T89A 1FL6B 1HQ4A 2NW2B 1NMBL 4U6XB 3SDAC 4XC3H 1Q0YL 4LPVA 5DXWA 4KVNL 4S1SL 2IAMB 2YC1B 3T3ME 5E7BA 1Q38A 3X13B 1SY6L 4Z7UE 1I1RA 5CJOL 2H6PB 4ESKA 3DI3B 2ARJA 4H8WL 2PYED 5E03A 1YQVL 3I50H 1OP3H 1IM3B 3RVTD 3UTTA 1A02N 1SYSA 4WFEE 3VWJA 1HDMB 4X80H 5C0CB 4JRXE 1IC4H 4MQXD 3IDNA 3O2DL 5B22A 3CSGA 3H9HA 1J7VR 4BFGA 2O61A 2B5IC 5MENB 4WHDA 2G2RB 1GL4B 4P9HH 3RUGE 2XN9E 1CT8A 3STLA 4L8SC 3IFOA 1O7SA 3ZHDA 1WEJL 4K8RL 3MLTB 2DQHL 2IH1A 3OSKA 1X6NA 2XZAL 4KKCC 3UXFA 1CK0L 5IHBA 4KJWC 5C08D 2AJUL 4QRSB 4UDTA 2XNAB 3LEYH 2EEAA 2DQTH 1X5XA 2VDPL 4L3CA 5DR5L 1CD0A 2NY4D 5E6IA 4ZYKB 1URLA 3QIBC 3CVHA 3WNLA 5IW1B 1JHTA 2W60A 3B9DA 5JPMB 5DUPH 4LHUG 1T03L 5GS0L 2CLZA 1NGZB 4OLVH 3IGAB 1PEWA 1C5CL 4AM0A 1NBVL 3JV4B 1RUPH 4JFQA 1IAKA 3RZCA 3B2UD 1MCDA 1IGIH 2CR3A 3KPLA 4K3GA 5IV2A 4LSPH 5IOPB 3C5ZA 3TEUA 3O9WB 4WCYL 4TTGA 2DOCA 1Z9LA 1Y0LB 4PRID 4LRNL 4DZBA 1KJMA 5TQ2L 2WWMC 2Q3ZA 5D1XC 2ICES 3D0VB 2XZCL 2ZUYA 1GGYA 4HXBL 1A1OB 4O2EB 3WJJC 1U8OA 2EDBA 4ODXA 4IIQA 1A1MB 4ZS6D 4L29A 3PHQB 1QQDB 2PXYD 1B4JL 3U0TA 4QRPA 4EI6B 3KPTA 4LF3B 1KN4L 1CE6A 1Q9OA 5E00A 4F9LA 4N5EC 2C3HA 2ZJSL 3BP5A 4HEME 1D6VL 2H9GB 2M26A 3UPAA 3ARPA 4BQ6A 3VRLF 2AJVH 4YXLL 3RVVC 2NY1D 2XKNB 4M43H 3S3SA 5GISL 4OGXL 1BZ7B 3EAKA 4ZOEA 1I9EA 3NCYP 5C0DB 1D5MA 5I8KH 5F21B 4JB9L 2XWBB 3BI9X 5M94B 4MNGA 3L3JA 1M6OA 1AFVH 1OAXL 1HINH 3CNKA 4LDLB 4MLSA 3UYPA 2NR6D 4U6HB 3CLFL 3VI4F 3SKNB 2GSIA 2Q87A 3HRPA 2R29H 5GSVA 1U8KA 1YEKH 3VMNA 3U0WH 3RWJB 2HT2D 3MRDB 3O2VL 3BKYL 4UINL 1NC4D 2PO6D 4JFFA 1TENA 1K4DA 1AHWB 3MV9D 1Y18A 2DBLL 5BZWB 1EEZA 4J7RA 2VNCA 4NM4H 2EE3A 2W9DL 4X9IA 5MEQB 1JPFB 3IU3A 1KELH 3T2PA 3LV3B 4Q2ZA 4OZHF 1A6PA 3EYSL 3LEXA 3IDMA 1X5GA 2BDNL 1OM3H 3MOAH 1E4XI 4B7IA 4Y1AE 4OF7A 3HFMH 1J8HE 3UAJD 5GGSB 1MFDH 4NO5A 2NY2D 1IQWL 1NGQL 1U0QA 4WV1B 2B1HL 5J3HD 2I07A 1C12B 4XP9H 3WSQH 1CQKA 2D7TH 4GXUN 2A83A 4KK5D 1S7XB 3NBNA 1IGJB 1BJ8A 3WIHA 1LDPL 4KKNA 3TV3H 3BAEH 1I8IA 2Z93B 4L3ED 1JWUA 3T4AA 3WDJA 5KSUB 2X7LA 4XP6H 4HKXA 3KPRA 3HUJF 1IKFH 1HHJA 2ADGB 2BNRB 3QIUD 3ES6B 4XHJD 3WIFA 2WBJC 4R7NB 1T66C 1NFDF 1KACB 3MLXH 5B21A 4ZOBA 3QWOA 1K8DA 1T22B 3H9SE 5EO1A 4XCFH 4YHMH 2SEBB 5I1EH 4XPGH 4AIZA 4MB4A 1F00I 1JGUH 4KKLC 4TNWF 3GSQA 3B9KB 4G5ZL 2ZCKH 3DXAB 1S9YA 3BWAA 2NTFA 3WIIH 2QQNL 1UB6B 4P3WA 5JW4M 4KHXH 4I77L 3ZT7A 1CLCA 3FCTA 1XIWD 2DQUH 4ODSL 5DURB 3K4AA 1VFBB 1RZFL 4KKBC 3RWIA 5GRJH 4OCSH 5I9QC 3GEWB 2VLKB 3JTTA 2FGWL 2I5YL 1CVRA 1FFNB 1OGAA 4K3JL 1EO5A 2J8UE 2VL4A 1TJGH 3CDCA 5IMKA 5EZIL 4GS7C 5LCVH 3VJ6B 4HJJL 2HTLC 3GIZH 2WANA 3LOWA 1AIFA 3OB0K 4Q9BA 4KTDL 2BOBA 3S36H 3KVQA 1DQMH 4JKWA 3S35L 4OB5L 5C1MB 4HUWB 4F7EA 4KUCF 4OF6A 1A7NL 5IK3B 3BPNC 1A3RH 4TUJB 1YPZE 2FBOJ 4PJIB 2CSPA 1XCQB 2Q7YA 4XPFL 5D7LE 1ACYH 1ZA3A 5DC9B 3RZWA 5TF1H 4I48B 5I16A 2OQJB 4MJ4A 3T2NH 1HYSD 4JJ5B 4MAYA 4UQ3B 4GJTB 5TDOB 5D72L 3L3HA 2K3TA 1A7QH 1N64H 4JHZA 4UQ2A 4WI4A 3BP6B 1EIBA 5FKPB 4U1LB 1BZQK 4PJ9B 1N8ZA 4P23A 3ARED 5D71H 4XWGL 5ADPL 1J0YA 2YA1A 4Z95L 1S7VB 2ADIB 5CKAA 2Q1EA 5BV7B 3GBML 5DHYA 5ELIA 5GRUH 4E0RB 3QDGD 5E9DA 1FGVH 1PZ5B 4OLWL 4RGMB 3ULUD 4EVNB 4JPVL 3IXTB 1PG7H 1T2XA 4HBCL 4MNQB 1T7YA 4P2RE 3DMMB 1FAIL 4U0RB 3CC5B 3H7LA 5EORL 3IS0X 5FYLH 2E8YA 2Z35B 1PQZB 4MA7L 4B5EA 5E99L 2QR0A 3BZEA 3U36B 1ZHNB 3WEXB 3FJTA 3GJFA 4DVRH 1MIEH 3ULSA 4GG8B 3D9AL 1KIPA 1S7QB 3K81A 5FGRA 1HHIB 1KG0B 3IFNH 3MYZA 3G5VA 1H8OA 3V6OA 4WWKB 3L3DA 4Y5VC 3TH4T 4B50A 1SVCP 1H3WM 3ALWA 3W0WD 4FTVB 1DBAL 5F89B 3ZE0E 1A6VH 3M07A 4F57H 5FYKE 3NFNB 3MA7B 4TSBL 4G9FD 5BQ7A 1LEGB 5IB3B 4GBXB 5T3XD 1YUHA 1RSFA 3OAUL 4JZJB 4PLKD 3QI9B 5I1GL 3ROLA 4Y4KA 2EDKA 2VL5A 2AQ2A 4DN3L 5IMLB 3CFDB 4XC1H 3SE3A 4RAUA 5E2WL 4PRAA 1FJ1B 3BESR 3J7HA 1U36A 2LVCA 4FQLL 3DETD 1B0GA 4JRYB 5DHVH 2G75B 3C6LD 1WZ1H 1PVHA 4O4YL 3NABL 3PWLB 1DUZA 3FFCD 5KW9L 5DJYB 3PWJB 1FC2D 2CKBA 3C2AL 4KMTH 1CWVA 5F93C 3E2HB 4LFHG 4QWWD 3RGVA 3TF7C 4GKNA 4OUOA 4X7EC 5ALBH 4LVNB 3DURB 3QUMH 4HLZG 2P24A 3A6OA 4ZFGH 4S1QL 4OM1L 4W4NA 4X6DA 3SJVB 4ZXBC 2IANB 4OIIH 3PWPB 2GCYB 1JYWA 1JNLH 5DD3L 5F7NC 2FEEL 3P30H 3GRWA 1KN2H 5DFTA 1FVEA 2GTZB 5BVJA 1ED3B 3PXJA 4KRMB 2WUCH 4WO4D 1TFHA 3WFHB 4RAVA 1A64A 2CDFA 3CFEA 3SO3C 1JPSL 3FQNA 3G5XB 3HHRB 1M7DB 4R3SB 3BW9A 1EHLL 2W0LA 3JWOH 4X7CC 2QTEA 4ORZC 2DLEA 1SJEB 3SGJC 3UBXG 1VADB 1C5BH 4PIRF 4RMSA 1XF4A 4JREC 2VLJB 4G6KL 5J9PB 5HHPB 1W0WB 3D3VA 3HCVB 1EJ6A 3BOVA 4LLQA 1PX3A 1JZ7A 1IKNC 1QZ1A 3LIZL 1MHCB 5K59E 3DRQB 4ZTOH 2A73B 1CFBA 3PWVA 2VLMD 4OFPA 5I8CA 1IAOB 3ARFD 1XCTA 5EU3B 2P45B 4RDQG 5LGJB 1RZ7L 4HUXB 4N0CC 2FNBA 4GRLC 1FNGB 5EO9A 4KKAC 4F9PA 5C09E 5DD6A 4UI2A 2FO1A 4CNIA 2VDKL 4LSQL 3JXAA 1TITA 4ZSOE 4XBEL 4YUEL 3GB7B 4MCYB 3QXAA 2XPGB 1DDHB 2Z8VC 3WUZA 3ULVF 5IIEA 2C3WA 4HMDA 5IVXF 1KENL 4JY6A 3OXSB 5B3JF 3KPOB 1BFSA 5BO1H 2JB5L 1LO2H 3BEVA 3LPWA 3KR3H 5JPNA 3MV8E 4JFEA 1H5BA 4YEFA 2HG5B 1CXIA 1FVCB 3DVNB 2QV2A 1H8SA 1FPTL 1CU4H 1JZ3A 2Y5TA 4JZNA 2EDDA 4OCRH 4PRHE 3O9WC 2EYTA 1BVKA 2YPLD 3CGTA 4H88H 2LTQB 3UJIL 1A6WH 3G5ZA 3UJJH 1ORSB 3M8OH 3CXHJ 5BW7C 2XWTB 3P4NA 4HK0B 1WGOA 3GMPA 3KYNB 1YMHB 3QQ4A 1R5WA 4NO2A 4X6BA 4EJ1C 2WWKT 1IARB 1X6LA 3O2WL 4HUUB 4EN3A 4S0SD 1RIUL 3OXRA 3MUHL 2DYPB 3KPSD 2BJML 5CLTA 4DCQB 5K9KA 1LO5B 2HLAA 3P0YL 5FFLA 4Z7VE 2ZKHL 3GMNA 3U9PH 4R97B 1QSFD 4UT9L 4U0QB 4ZS7H 4ZUSA 2FH6A 2C4FU 4L4VD 3HE7D 4E41E 1DLHB 3AAZB 3C5SA 3D69B 2FECL 1QFOA 4CW1B 4QHNB 4PJAB 2IWGA 5IB4B 1OTTC 4ZUVB 1Q9KA 2EKJA 1KCKA 3MGAA 5E2UH 3TJEH 3CVIH 2EIBA 4TUKL 2JJTA 4ORGA 3OPZL 3I2CL 2V2XB 3TC9A 4GAFB 4NOBA 4HUVB 1JIBA 3EO9L 3NFSH 5A16B 2H26B 1KOAA 1I3UA 3ABZA 5AYUH 3C8KA 4UBDC 5GRVK 2GSGB 3HRZB 4GG6F 4PJGA 4NCDA 5ANMB 4BYHA 1G7HB 4S1DD 3DVFA 2ED7A 2Y06H 3GBNH 2A9MH 2HKHL 1IEAB 5J1AA 4BA8A 3WXVL 1MLCB 1NCWL 3LVEA 1NEZB 3IU4H 1ZE3C 4Y16B 1XF2B 4CVXB 4NWUH 1DQLH 5D5MA 3H3BC 2R8SH 2F5AL 1FO0L 4N8VA 4ONFH 3SKJH 5A2LH 1JWSA 5CINL 1I7ZB 3D2UB 5C0EB 1C8PA 4PJ7B 5C0JA 4RGOH 3U0PA 4RRPA 5T1LA 1AO7B 1U8NA 1HZHH 1FLRL 2X4RB 1UWGL 4PJ5A 1SJHB 4J6RH 1MVUA 1XR8A 2WIMA 4OCMC 4YIQA 5TE7H 3MRKA 3UJTH 1VEMA 4ZOCA 2PW2B 4HUNB 5D1QA 3NGBB 4RFEB 4RQQB 3ELAT 4M61B 2BNQD 1YEJH 2APVA 3BH8A 4PV9B 3BZDA 3QDJD 4HS8H 1BVLA 2AK1H 5HHOA 4DFIA 4F15B 1SY6H 1CFQB 2IG2H 2X9WA 4WFGD 4Y7MA 5CJOH 5ACLA 5C9JB 5DMKB 2HTKC 3U6RB 1XFPA 4RMVA 2H8PB 2VXQH 3FAWA 4RSVA 1N6QH 2VDLL 4JPWL 5FGBA 3SDYL 1FZJB 5FYLE 2OZ4L 2HJFA 3QO1B 1CGXA 1A6TA 2ICWJ 5K9QI 3PIQA 4OF5A 1MHHA 1T5WB 1JGDA 5F7DB 4OZFG 2COQA 4HPOL 1IFHL 2EDLA 1CDGA 1T20B 1IM9B 1R3KA 1RAMA 2Q76B 3MRNB 3FQUA 4HXAL 3MFGB 1K6QH 4OF0A 4PJDA 3QQ3A 1G7QA 3IDXL 1FSKC 1WEJH 4K8RH 2VDMH 3B9KC 5B8CA 1UQSB 1NBYB 4OLZH 4CJ1A 2XZAH 5BRZE 3O6FA 1I1AA 1IC7L 3RIAK 5JHLH 1ZGLM 2AJUH 3AM8A 4J8RB 5D7KD 4M9OA 3NPSB 4QYOA 3QDMD 5ITBL 3FQRB 4LLVB 1JUFA 5DWUL 3EO0B 5DR5H 1T0NA 4P5TB 4G8FA 3AS1A 2BMKA 5ILTL 3V4VH 3TIDB 3QWQB 1WVZA 2I27N 2VKWA 4JFDA 3H9SA 4JFZL 5I1JL 1T03H 1A6AB 4XRCB 5GS0H 5EO0A 4JGMA 3SDAA 1EEYA 5HD8C 5IFJB 1HILA 3V5KB 1C5CH 1NBVH 4FQXD 5TGBB 5JW4R 2X41A 3WJLC 4P59H 5MENE 2HRPH 2Y23A 4WCYH 4MDJA 4PJ8C 4LRNH 4PTUA 1AXSB 5TQ2H 1WITA 3TO4B 2W9LA 3KPPA 4NYLB 4UNVA 4HUKB 1K5NA 3H3PL 3ZE1E 4XGZB 1AP2A 5JNYB 2CLVA 1RQ5A 1MI5E 3V6ZB 5T1KA 3N1MC 3B8YA 3LRSA 2J8UA 3FFDB 1NLBL 3GK8H 5E8EA 2ZSWB 4YNYB 3SE9L 4Z0BL 3BHBA 4TTDD 5IBUG 4DEPC 2MKWA 1KN4H 4L8SA 1VESA 2EDJA 4YR6B 1QO3A 2XWJB 1MCOL 1D6VH 5KVDL 1MH5A 3SBWC 3MGOB 4BQ8A 4G80B 2PUQT 1YPZA 4WNQB 4YXLH 5CD5D 3RQ3A 3NIFF 3MRCA 5C3TA 3PQYB 1KTDA 1MAKA 4OGXH 3LHPH 4G6ML 1TPXC 3D18B 2Q86B 4K7FB 1AGBA 3B3IB 4JB9H 4NKQB 5KAQF 5J1TC 1MCJA 3TFKD 1MQKH 4R4BB 2AJ3A 3HS0B 5ESAA 4YDJB 2ESVB 2CDEB 2EXWC 2X9YA 5J12B 3BKCL 4ZMAT 4IHOB 2HMIC 1S9XB 4G43A 1U8JB 4M1CD 3L6FA 2PW1B 4ODBD 3O2VH 2H32A 3BKYH 4UINH 1NCNA 1JCKA 2P1YA 3O6KL 4Y2OA 4LNRB 3UC0L 4PP1D 3ZT5A 1EGJL 1CN4A 1DFBL 2DBLH 3GMRB 5D1XA 5AUMA 1D5ZB 3GNML 2W9DH 4K94H 2FR4A 5CEYA 3EOBA 1D6EB 1QSEA 1JF1A 1YN7A 1YC8A 5A1AA 5KVGH 3T4YB 3HAEG 1INDL 2P5EA 2V2WA 2HJKB 2M2DA 2VE6A 2BDNH 5F88A 3VD4A 1FN4B 2X4OA 1S7SB 4OZIF 1KB5H 5CWSB 3BQUB 1IQWH 2R1WB 1NGQH 3QI9C 4KRLB 4ODUB 4FS0A 4D3CL 1IAIL 1P4IL 4ODVH 3CSBA 1ADQH 2B1HH 4N1HB 5D2NA 1T04B 3VG9B 3F12A 1WCBB 3S5LG 4Z7WB 1LEIB 1FYTD 2YSSB 2G5BB 2ATKA 1RJYB 1G1CA 3W11C 2IPTH 4KPHL 2EDXA 4P2OD 1EXUA 4MA3B 4YHOH 4NQCB 2B4CC 4W68A 2JJVA 3HG1A 3KYMA 1PGRB 1QP1A 3PNWA 1KYOJ 3CZFB 3KS0H 2ICWA 1MFEL 3CFKB 4MWFB 3QEHA 5J8OA 1GGCL 1ZHBB 2OSLB 2IPKB 4D0CB 3V6FA 4FQHA 4XP4L 1UM4L 5CKGA 4LVNC 1BECA 2FIKB 3RAJL 5FM4A 4HMEA 3RVTC 4XT1C 1W0VB 4QGYA 1KCRL 1U8HA 4WTXA 5FECA 4AH2A 3TYGL 3QAZB 4M5ZL 4MQXC 5I18H 2R1YA 1QD0A 2LAGB 2EYSB 4H25B 1RZFH 4PRNA 4LLMA 1CFVH 3EKCA 4XB8A 1UCTA 5I0DA 3OKYA 2FHBA 3IJSA 1JGVL 1YEFH 3NMEA 2I5YH 5IB5A 4OCNC 1S9KC 1DEEB 3BWUC 5F9WC 2FX7L 4HJJH 2AXFA 1N6VA 4KTDH 4C59B 4OB5H 3TT1H 1JZ5A 1P4BL 2NY4C 2H1PH 4F33A 3TNMB 1M1SA 3WUWG 2APTA 1IGCL 3U1SL 2KPNA 3HE6D 1HSAA 1ZOXA 2J12B 4LKCB 3VCLB 4XPFH 1Z2KA 4N8PA 5CJXA 3QCTH 3VWKB 2NW3A 1PYWB 1DUYA 2K7QA 1JMXA 3EFFB 3MMEB 2F8XC 2AK4D 2WBJA 3P77B 1JZ4A 2VUOA 1YYLL 2V7NB 3B2UC 3GI8H 3DTXA 2FJFA 1TETH 3IJYA 3PWUA 4NZUH 3HKFA 1GGBL 4OLEA 2BY2A 2AW2A 2X4PB 1RUKL 5JIKA 1NAML 1A9BA 4ZNEE 5D8JH 1MHEA 2H3NA 4JN2B 2GQHA 3BD3A 2NX5B 5ADPH 1FFOA 5KS9E 4IRJA 4QTHB 1EBAA 4QXWA 3RU8H 4Z95H 4H0HB 2UWEF 4ZS6C 4X6CE 2PXYC 3BVNB 1PFCA 3LS5H 4OLWH 5IW6A 3JV0A 3L7FB 5I1DB 2P5WB 4TNVF 4HKZB 4NN6B 4H5SA 1FZKB 4PJIE 4WHTA 3SDCB 3V0AC 1FAIH 4OD1L 1NBZB 2UYLA 3RWDA 5EORH 5C09A 4XMLH 1U3HC 4UAOB 4OZGE 4M4RA 2D4FA 3HA0A 4MA7H 1KTLB 4PP2A 4XPBL 2VXSL 3QUXD 4Y5XC 4ZSOA 1RVFL 3ZE0F 2W0FA 5ECJE 4PJFA 2ERJB 2YOCA 5D7IA 2WLZA 3IS1X 4M6ML 2AKRB 1YY8A 2DQEL 1NMCC 4YHIA 3GUTA 3AGVA 3HR5A 4QHKI 1I1YB 1KIUA 1D9KB 1J18A 4MDIB 1A7BA 4K07A 1KC5L 4AEIL 2NR6C 1NGWA 2A74B 1DBAH 5SV4A 3MRRB 1H15A 2BVPA 1PKOA 3ZT6A 1XR9A 5IR1A 2R4SL 4KDWA 4O00A 4PRHA 5DJ6B 4R97C 1B6DA 3OAUH 4RIRA 5EBLA 4LLYB 5I1GH 4NKOA 4XCNA 3LH2L 2E9JA 5H2BA 1P7KA 2NY5C 5FGCE 1GC1C 3UTQA 1IL1A 5E2WH 4HIXL 4FFWD 2HVJA 3FL7A 5DO2D 1OF2A 2XQBH 3DNKA 4E5XB 4NT6A 1UKQA 1Q9WB 4FQLH 3WKML 4Z7VA 1XH3A 3T0ED 4Y19A 4ZD3L 3VFPB 3ZL4L 1MIML 2UY7A 4QHLA 4CN4A 4PGBA 4UT6L 4O4YH 4QCIA 3NABH 5IKCB 1AXIB 4F58H 2HJLB 4E41A 4L1HA 5KW9H 5J3HC 5CBEA 2OJEA 3C2AH 1Z5LA 1H3TA 1U93A 1U92A 3T65A 4A6YB 5EH1A 4UB0H 2IGFL 5KJRH 2EYRB 4D0BA 2RQ8A 1JK8B 2PNDA 4Q0XL 3OKNA 1N4XL 3ARYA 5C0BB 5J7CC 3MRIA 2E6PA 3L3KA 4S1QH 2KQNA 4OM1H 4Y5VA 3K2UL 4NCC1 3GIVA 3BXNB 1FG2A 4KRPB 4NO3B 5CSGA 4XHJC 3KDMB 5DD3H 5K9OB 1LP9E 2J7LA 1NDGA 3FRPA 1P7QD 1LK3L 4X4XB 4KZEL 1JGEA 4YO0A 4P4RB 3OG4B 2J4WL 2FHCA 3VFNA 1U8LB 2GUOB 2DLFL 3P4MB 4PRPD 2FATL 3MACL 4AG4H 3K1KC 4WUUE 3X14A 2P8PA 3IRZA 4C56B 4WI7A 3U30B 3ZSTA 4AIOA 2A6KA 4F15C 1N3NA 5IVZA 4QRRB 3T0VA 2B0SL 2V2TB 3RY6C 3DO3A 2GT9A 1P69B 4ELMB 3FOLB 1MRCL 3O8XC 1XIWC 4NOFA 5DQDL 4N90D 4G6KH 3FOMA 4NQDE 5GZND 3BPOC 4FXGA 4WEBL 4LLUA 5DDHA 3GSWB 4UUJB 1C5DA 3OKLA 5B39A 3LIZH 4YWGL 3MCLL 5J11B 2WINB 3G6JE 4PLOB 1OWWA 4I18C 4J3WA 1RJLB 4POUB 1DBKL 4XNQA 5DTFB 4LHJB 1C16A 2D7NA 1DLFL 3MSPA 3VWJD 1ORQB 3W5MA 1A4JB 3QEUB 1U91A 2VDKH 3IDIA 3DARA 4LSQH 4YDLC 1V3JA 3LKOB 4XBEH 5HGDA 3IDGA 4YUEH 4J3OC 3OKKA 5HYQB 3N85L 3EJZD 3FQXA 3QULA 4ZXBA 5F7YC 4UV7L 3TM6A 1R5IA 4N0UE 2VLJE 3ZYIA 2X42A 3AC0A 1KENH 2AEWA 1KYOK 1FL6A 4KXZH 5DZNA 3EOTL 1VHPA 1HHGB 2IEPA 2JB5H 4WFFD 1XT5A 3V52H 4JFOB 3ZKXC 3P0GB 1ZLWH 2NXYD 1CFSB 3AREC 2IAMA 1Q9LB 1FPTH 2MPAL 1W8NA 2YC1A 3PHSA 2MSPA 3X13A 5E6ID 5I1KL 1CLYL 1B9ZA 4KJQD 3UJIH 1GVIA 2QHRL 3A6BL 1KGCD 4PJBE 2B4CL 3MBXL 5EU7E 3CXDL 3PGCB 3H2WA 5DUBB 3ULUC 1IM3A 2F15A 3DIFB 3QEGH 4LDOB 3RZCD 1HDMA 5C0CA 4MB3A 1RIUH 2PTTB 2IPUK 1X9QA 2D0HA 3C5ZD 4TUOB 1CXFA 3P0YH 2K9UA 3IXAB 2ZKHH 4X8XA 7FABL 5DHXB 4KI5D 1MREH 4M3KB 4M6NL 3ZLQC 2JCCF 3DX7B 4UT9H 3EYOB 3S34L 3FKUS 1HWHB 4IRSC 4PYGA 1E4XL 4Q9RL 3P9WB 1P9MC 4HLZH 4HAFA 2IJ0C 4QRSA 4KI1A 2XNAA 2F5BL 3TVMB 4KDVA 1LGVA 1OSZB 1WAAF 1FFQA 4QRPD 3MFFB 1FIGL 3MJ8B 3B5HA 4IMKC 3OPZH 4CMHC 4ZYKA 3QH3B 4R9HA 3VI3E 2MOVA 3WO4B 1MOEA 2YPKB 5IW1A 4Z7OF 5JPMA 3EO9H 2VN7A 3O4LE 5TE4L 1KF9B 1XEDA 5EWIL 3QXWA 3DECA 1R3LB 1NGZA 2YD7A 3IGAA 3EGSB 3JV4A 1M7IB 2HKHH 3WNKA 4NKIH 4R26H 5FK9B 3DGCR 1NCWH 5C2BL 5L88H 5DC0A 5GGVL 5DJ8B 5IOPA 3O9WA 4RMQA 3QUZB 5IB2B 3BDYH 1Y0LA 5JR1L 3L3GB 3WXWL 4YDVB 5FA3B 2F5AH 1FO0H 5CINH 1A1OA 3R0NA 4O2EA 1DBML 1UWXK 3S5LB 1A1MA 3HC0A 3X17A 3PHQA 1V5JA 3UDWC 4NNXB 1QQDA 3X11B 4YFLF 3H9ZA 3OHXB 5I1IL 3MA9L 4JFFD 2B39A 2R56L 3NCJL 4EI6A 4F7PA 2I9TA 2FX8H 2EDYA 4V1DD 4QWWC 3BQUC 4Y5YC 1XZ0B 4B41A 5ANME 1YQ2A 2O26U 3LCYA 2H9GA 4LCWB 3ZO0A 1X4ZA 1T2QL 3QNZA 4FA8A 2AJXL 5GGQL 1XF5B 3MODH 3I6GB 2H2PC 2VDLH 1BZ7A 3SDYH 3C60B 1UZ8B 2OZ4H 4JDVA 5C0DA 4O2FB 2R0LH 2XWBA 5IHZB 2H2SD 4HJ0C 4PJ7E 1F11B 5DK0B 4BZ1L 4PJCE 3KLHC 2D7PA 3T1FB 4U6HA 4HPOH 4QOKE 4YHYC 1IFHH 1WISA 3N9GL 3SKNA 4IOIB 3MCG1 4HXAH 5KZCD 3MRDA 1PDKA 1HKLL 1UADC 3IDXH 5BCAA 2OJZL 5GGRB 3KLAB 5ID0A 1I9JH 1OQXA 4LGRB 5ISZE 3KPRD 1TCRB 3EYVB 1IC7H 2FB4L 4U1SB 3WHXB 4FABH 4MHHI 5MEQA 1JPFA 2IF7A 2ZUVA 4I5BB 3LV3A 5DD5H 2UVFA 5ITBH 4DQOL 4RFOH 1YEHL 4DKAA 4Y4HB 2IMMA 4J12A 3I3BA 4PJEB 5HYSG 5ILTH 3WUWB 4JFZH 5I1JH 2BK8A 5C7XH 2AAVA 5FO9B 2B2XH 5GGSA 4M7LT 2NY5L 4P5KB 1GC1L 1AGEB 3AXLB 3HB3D 2VZ1A 1C12A 4Y0GA 1KJ2B 2DM2A 1R3HB 2JJSC 3L5JA 3SCMB 4OGAC 1S7XA 3O45B 4G7VL 4JFYB 5HSFA 2DTMH 5E4EB 1FBIL 3QDHA 2Z91B 2AJSL 4Y2DB 3H3PH 5CLWA 4L3AA 2Z93A 4Q6YA 1OGAD 5HHNA 1CFNB 25C8H 1MWAB 5KSUA 1B3JA 3QCUH 2ADGA 2BC4A 4MS8D 2BNRA 1NLBH 3ES6A 1ND0B 4R7NA 5E2VL 2XA3A 3SE9H 4GW5B 2FDBP 4H20L 1S3KH 1T22A 5EA0L 1X4XA 4DKEL 1WIUA 3Q1SL 1KJ3H 4Z78A 3B9KA 1MCOH 3DXAA 3RP1A 5KVDH 1D5IL 3EYUH 1AKJB 1UB6A 3DX9A 3LKPB 3I75B 2BSTB 1RUQL 5DVLA 4OT1L 4MAYD 4G6MH 5I8EB 4NUGL 3FN3A 4OTXH 1XGPB 1VFBA 2VWEE 4LIQL 4QLRA 1BEYH 4OFDA 4P23D 2NY0D 2RJMA 3BZFB 5I30L 4ZTPL 2VLKA 2EC9T 1KLGA 3BKCH 4ZNEA 4QT5B 4JDZB 5CSBA 1N59B 3WJLA 1MHPL 4LPYA 3VJ6A 5E9DD 3BPLB 4JHBA 1RZKH 4G9DB 5ICZB 3T3PE 3MJGX 2BNUB 4HUWA 1EGJH 1F90L 5IK3A 4TUJA 2H45A 2UUDK 4XBPB 2R9HD 3QO0B 1XCQA 3PQYE 2VXUL 4ZFOB 5HVHB 5IMOB 2XOTA 3MJ7B 3OJ2C 4PB0L 4LLWB 5D70H 4OZFH 2HFGL 4I48A 1MCBA 2OQJA 2VSCA 4JJ5A 5TDOA 1NSNL 3WD5L 1LEKA 2P7TA 3BP6A 5FKPA 4U1LA 1IAIH 4PJ9A 3JV5A 2NY6D 1XGQB 1OP5H 4QRQB 4MXWH 1E28B 3TP4A 4WGWB 5CEZD 2XZQL 3H8NA 5LG1A 5LVEA 4KAQL 4NRXB 1S7VA 2ADIA 3GHBL 1QFUL 5B38G 4E0RA 5C71A 1QFWH 3BGAA 2V17L 1PZ5A 2EDFA 5SWSB 4EVNA 5IM7B 3IXTA 4Y4KD 2E7LA 4MNQA 3K1DA 3O0RH 1JL8A 2HA1A 3DMMA 2AABH 4U1HB 2OMBA 3CC5A 2DQDL 3MRLB 1G6RB 1MJ7L 2Y1VA 2Z35A 1PQZA 2ORBH 3TBTB 4PG2A 1MFEH 4JHAL 4HWZB 4X99B 2EC9U 3DGGA 3DLQR 4ZUTB 3U36A 1ZHNA 3WEXA 2GJ6E 2A2QT 4XP5L 3ULUL 4XP4H 1A7OL 2BHZA 4NHUB 3L5XH 4GG8A 2AVGA 1S7QA 4U31A 3V4UH 1FDLL 4MXVE 1HHIA 3KYOB 4XAKD 5IEKB 1B2WL 4WWKA 1KXQE 4M5ZH 2MCG1 1MFCH 4WTWA 2X1OA 3U4AA 2A38A 3HI1B 2QLVB 4GKZB 4NP4H 1RJCA 4TPRH 4FTVA 2GK0B 2UZXB 3RGVD 4NQCE 2YZ1A 3NFNA 3MA7A 4U6TA 3ZTNL 1LEGA 5IB3A 1WWCA 2QKIB 4GBXA 4JZJA 4OKVB 4X7SL 3QI9A 5DJXB 3RNQB 2VH5L 2FX7H 1WQVT 3CFDA 3NZHH 3O3EB 3QJHA 2LVEA 4DVBB 1FJ1A 5DMIL 4OZHB 1G0YR 3E8UH 2DI9A 1Q1JL 3FT4B 5ICXB 5L6YL 4MD0B 5T3XL 2Y72A 1UJ3B 3BGMB 5IVOA 2R0ZL 4JRYA 5KS9F 5J11C 3VFVA 4FQXC 1M05B 4EZMA 4L8BB 4X9GA 2XFXB 1HN1A 5DJYA 4BUHA 1AD9A 1F3DH 3PWJA 3VW3L 1GGBH 1JRHI 4KK8C 3VXME 3D3VD 2OTPA 3UMTA 1K3ZA 1NAMH 2VLRE 4HWUA 3OZ9L 1NCUA 3DURA 1G0XA 4I3SL 4DKDC 1I3VA 1DVFB 2BCKB 4IMLB 2NY1B 5I75B 4OZGF 1MSPA 1BAFH 1REIA 4G8GA 2OR9H 1JYVA 3C08L 1U95B 3D39E 3HUJB 1OOAA 2ZUSA 3SJVA 3HAEH 4N8CL 1MCCA 1B0RB 2IANA 3PWPA 2GCYA 3AU1B 1WLHA 2G60L 1HH9B 1NFDB 3PP3K 4J3SA 3VGAB 4PRBB 2WIIB 1N0XL 4IBLT 1JWMB 1E6JH 2GTZA 3VD3A 1ED3A 5K33A 2X1WL 3WFHA 3MXVL 3QFJB 1JNJA 3G5XA 4APQB 5CD5C 5FYJD 3MV9B 4R4ND 3UTSA 1SJEA 5EZJB 3VFTB 1VADA 4M6MH 4P4KB 1E27B 2DLIA 3MV7A 3MLZL 1KXTB 1VFAB 3GMQB 2DQEH 2VLJA 4MJID 5J9PA 2NX5E 1W0WA 5HHPA 3S8WA 3HCVA 4JFED 1AGFB 4KUZH 2D2OA 2OL3L 4GKOA 3S97C 1KC5H 2Y7QB 4AJ0A 1MHCA 4AEIH 2A73A 3MRBB 3CIQA 1J88A 5FXCH 5A2KH 3W9DB 5DQ9B 1IAOA 2DMBA 5EU3A 4BQ9A 5LGJA 2DMCA 2P5WE 5BJTB 4HUXA 2R4SH 1FNGA 1G9NH 1YMMB 3CD4A 4LARL 4PP1C 4K71B 4N0YL 1MCKA 1HCVA 3QDAA 4H0IA 4EN3D 2EE2A 4W4OA 2NZ9C 5EB9A 5C0IB 3TVMC 3GB7A 4MCYA 4HIXH 1FRGL 2XPGA 3DV6B 4M62H 1DDHA 1ZLUK 3QPXL 4YZFE 1MCSA 4ODHL 5CFHA 4LCUA 5ICYA 3CU7A 1Q72H 1C7TA 3ZL4H 2F9BT 3OXSA 1MIMH 2BSRB 3QIUB 3KPOA 2RIKA 1ZLSL 1MFAH 1U3HA 2Y36H 2HG5A 5L8JB 1FVCA 3DVNA 2AERT 2GIYA 1HH6A 3TNNB 3ZDZF 1WIOA 4O9HL 2EECA 1Y6KR 1LP9F 3HC3H 4HWEH 2IGFH 5IJVB 4M6OL 4TSCL 2CK2A 2CRZA 2ITCB 4MJ5B 4OCYL 4OGZA 4Q0XH 1N4XH 1NAKL 2X9XA 1NQBA 3BP7B 2XWTA 3ARBB 2HLFD 2CGRL 3KYNA 1YMHA 2ARJQ 4OCWL 2HT4D 1RY7B 1F4WL 3K2UH 4LOUD 4OLUL 5DK3A 4NKMB 4DGYH 3I85A 2DYPA 2AGJL 1MJUL 3MLSL 4DCQA 3OQ3B 1LO5A 4LVHB 1LK3H 2DI7A 4KZEH 4N9GB 4XPTL 2J4WH 2DLFH 4PG9B 4RZCB 1IILE 2BXYA 2OK0H 1OAZL 4NQVB 4RFNB 5D6CB 2R4RL 1BGXL 2P43B 1DLHA 3AAZA 3D69A 1RUMH 5IG7B 4CW1A 4PJ5D 3G6JF 4PJAA 5TDPB 2B0SH 5C0ND 5ETUB 1CYGA 4ZUVA 4AIXA 5DQDH 4OFYA 3WDHA 2YKLL 3AS2A 4GW4A 5C0BE 5L2KB 5D1ZC 2V2XA 3QEQE 4HUVA 2MKLC 5A16A 1N7MH 2H26A 5HHOD 4WEUD 1WT5A 3DSNA 2CO7B 3MCLH 1ZVHA 3HRZA 5DZLA 4MGXA 1TZGL 4PR5A 2JE8A 5TF0A 4HWBH 4EEEA 5AAWA 1D5XB 1IEAA 1MLCA 1ZVSB 2QADD 1NEZA 1DBKH 1HQRB 4Y16A 3EYFB 3V8OA 2D7MA 4CVXA 1DLFH 3LD8C 2BFVL 4NN7B 5SX5H 1EO8L 4D9QD 3HE6C 1I7ZA 3D2UA 3QDGB 5C0EA 4PJ7A 2A9NH 4ZFFB 4M8VA 3RIAF 4QRRE 4EIZC 1KSRA 3V79C 3DO7A 1T80A 4PJGF 1AO7A 1CBVL 4ELME 1OARL 1PLGH 4UV7H 2X4RA 1SJHA