1P84J

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
b'EVKLQESGAGLVQPSQSLSLTCSVTGYSITSGYYWNWIRLFPGNKLEWVGYISNVGDNNYNPSLKDRLSITRDTSKNQFFLKLNSVTTEDTATYYCARSEYYSVTGYAMDYWGQGTTVTVSSAWRHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
molecule tags Oxidoreductase
source organism Mus musculus
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2003-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p84J00
5HYEA 4ETQA 2EH8L 4RGMC 4JANB 1G0YR 1YEDB 3LD8C 3OZ9H 5DA0B 1GH7A 3ARBB 3VWKD 5D93C 4OZGF 1T04A 5GGSY 5HVFB 3D0LB 4JHZA 1IEAA 3HE7C 5T1MA 2APVA 5I1DA 4WNQA 3VGBA 1ES0A 1GIGH 5B3JF 4YDKH 3OJVC 3BD3A 4ZAKC 4XVTH 2WW8A 5TF1L 3U0PB 1XF5B 5C09B 1YPZE 1G6VK 2UWEB 1ADQL 5J13C 4L4VB 1LP9B 3WN5C 3DSNA 3E6HB 3MRIA 4ZOCA 2GITA 4R7NB 3F8UB 1M4KA 5K93A 2X1OA 1N3NA 5SWSE 4NUGH 1F3RB 5CEYB 4CU8A 5T3ZL 8FABA 4AM0B 5IT2H 4DUXA 1SQ2N 5KSVA 5CP3A 3VDBA 4UUJA 1VFAB 3O8XB 3WD5H 3SGEI 1HOCA 3SBWC 2V9RA 1CYGA 5ISZB 2E9WA 4KKNA 4PGBB 5I8OH 2P7TA 4J1UB 4WUKL 4W6WB 2J6EH 1QBML 2X1PA 1KPVA 2NY2D 1GGCL 3G6JF 4GRWB 1ZOXA 2HN7A 4Z7QF 3MODL 3CMOH 1FYTE 4KUZH 1BVLA 5IFAH 2H2PD 2X4OA 3PWPB 2IFFH 5LGHH 1J8KA 3KPRE 4C83A 2ADIA 2AJXL 2PW2B 5IWLC 5EZIH 4LVOB 5A16A 1DLFH 2Q8BH 5L9DL 3FAXA 1OSPL 3LDBB 1E6OH 3TIEB 5F3HA 3T0WA 4RNRB 4CKVX 4MDJB 1GPOH 2IADB 1OLZA 5HYJD 1U8PB 3EJZC 3U4EB 3DX8A 5F8QC 4KRPC 3VFRB 1OTTD 3DVFA 3T2NL 5D7IB 4YFEA 1G6RA 3HPLB 2EDJA 4P46C 3CMGA 1GSMA 3QXTA 1JTPA 2ICWJ 4JRXB 3VI4E 3AAZA 4PLKC 5ICYA 4PRIE 1ONQB 2W92A 3SCMB 3SGKA 2IH3B 1GZPA 3CSPA 1A6TA 3QIBC 3GJFH 4OCMC 1KB5B 3SGDI 2C3VA 4MAUH 4JE4B 3UP1A 1BZ9A 2X4QB 4MXWH 1BD2D 1WIOA 3GSUB 4G6AC 4POZD 1KSRA 4QRRA 4GG6F 2OS7A 4LK4A 2HVKA 2R2HB 4XC1H 3O6LL 1HDMA 5EOCJ 2Q6WA 4F7TB 3P9WB 4PJ7E 2V2XB 4X6CB 1RZJH 5E9DE 4UB0H 4EVNB 2BERA 3DX9A 2DS4A 4QCIB 1QOKA 3PHOB 1WZKA 4MX7A 2Q3ZA 3WCYA 5JW5A 1NGXA 3D39E 3MLVH 1KLUA 1NEUA 1DBKL 1DQLH 3VXRD 4LHUD 4HUMB 4MJ6A 4NP4L 3M17A 5F7NC 1VKXA 2LTQC 5E0QA 2ZUQB 1A6ZA 4NC1C 4R8WL 2R0ZH 4GLRH 5GRZA 3SKUD 3D0VB 3BN3B 2OI9B 4IDJH 3OAUL 5FXCH 1FP5A 5JDSA 5AAWA 1ZKAA 1HWHB 3ZL4L 4F7MA 3P2TA 4AENA 3ARTA 4QT5B 5EU7E 1N8ZB 4O9HH 4OJFH 1W72A 3MV7A 1KCRL 1QHOA 1DLHA 2ZSVB 5DLMH 3BPCA 2BSSB 4NQDD 5EZLA 1F3DJ 1PQZB 5JW4Q 5DJCA 2VDLH 1F97A 3QSKB 2DB8A 1UCBL 3S8WA 3VXSE 1LK2B 1UH3A 2XXCB 3D6GA 1IGJB 1NBQA 2F53A 5CGYD 4EI5C 2MMXA 1OWWA 4P4RA 3OL2A 1UG9A 1U95A 1L0YA 2R23B 4XP4H 5K9OA 4KQ3H 1JRHI 4NDMA 4TOYH 2AV1A 1MH5B 1EAJA 4PD4K 4Y16B 4DGVH 5FYJL 2VDMH 3NZ8A 4PY8J 5F8RC 2ZUSA 1KYOK 1MVFA 1EBAA 4PS4L 4WFHE 5IMMB 3O9WA 3A67H 4ZQKA 3ULSB 2EYSB 2DBLL 5HYJE 3FO9B 1JWUA 2KBGA 1S9XB 2PW2A 1T1ZA 4F3FA 4Y5VA 3SBWA 2O5XL 3IDUA 1CXEA 3O4LA 5AWNH 2PTVA 4FQ2L 3GJFB 5HPMA 5GISL 3VMOA 4BSVB 5JPMB 4QXUL 2ORBH 4ZSOE 3ZKQD 2OP4L 4JFQA 3VFMA 5D72H 3INUL 5C86A 4BYHA 2FX9L 4FQ1H 2VSCA 4ZOBA 2QKIA 1ITBB 1IAOB 2FBJL 1K8DA 2F54E 4WTZG 4WO4C 4Y1AD 2QR0B 3RGVB 4LCWB 4HBCH 4ENED 1J18A 1XIWB 4KH2A 2DYPD 1A9EB 4PPTA 1V05A 4KRLB 2A77L 3T0VA 3GSWA 5DJDB 2Y36L 3OKLB 2EIEA 4FXKB 5TPWH 5F9JB 1XGPB 4BSJA 2E27L 4HIHA 3MGTA 1ULVA 3BEWA 2W0FB 1XF5A 4JR9H 1FO0A 5D70H 1FQ9C 1U91A 5MENA 1INQA 1R3JA 4CJ0A 5F9AC 1B0GB 3W2DH 3QUXD 3ZE0E 3RI5K 2QHRL 1MLBA 4UOJA 4KQ4L 2JIXA 2G5BA 5EWIH 1LO2L 1MIEL 3S5LA 5CILH 5DFVD 3D18B 5F96H 3TT3L 4HMEA 1RI8A 4YDKL 3DGGB 5C0BB 5CHNB 4JHAL 2Y36H 3N9GL 1X6NA 2HJKA 4OQTH 5CMAB 2QEJA 5SWZD 3U36B 2P44B 4PRHB 1YC7A 3H0TA 4JKPL 1MCBA 3KWWB 3FRPG 5HJ3B 2JIXB 4IOFD 4DVRH 3QZWA 1UJ3A 1ODAA 1NFDF 5D1QD 2UY7A 3PNWB 1SYVA 2Z35B 1F90L 3TO4B 3IFPA 3VXUB 3ZL4H 5ADPL 2I9TA 3S4SA 1BFVH 5MERB 4HKJA 5D1QB 2EDNA 2PTTB 4HX1B 4YX2H 4E0RA 2ZPKH 4X5XB 4KU1A 2KDGA 4OZGB 4JCMA 5MEPA 4PTTB 4NQEE 2C3HA 2NY1D 1PY9A 1YUHB 3V0AC 2APXA 3GBLA 3NFPB 4M7LH 1IEBA 4AEIH 3ARDD 3NVQA 3RP1A 2Y6SC 3T0DA 3BP6B 2YUXA 1YQ2A 5F7KC 6FABL 4X7TB 2DLFH 4P46B 3WL9A 5DUPH 3GSXA 1GZPB 4JVWA 1Z9SA 4DGVL 3MGTB 3UX9B 3CD4A 3L5XL 4XBEH 4NZTL 4J3WA 4G6FB 3AS2A 3RTQC 3OHXB 3QIWA 1VDGA 1CE6B 4AY0A 1NANH 5E2WH 3VXNB 4O2EA 1LP9F 1BQLH 1P5VA 3FRPA 4WFGD 3L5IA 1FO0H 1CWVA 1CIDA 2OMBA 3LN5B 2VLKE 3KPRB 5FYLL 1OAXL 3KPOB 3MSPA 3QUKB 4IRJD 2XZAL 3FFDA 4UU9B 5EO0A 1AQKL 4LNVA 3A6CH 3RA7L 2A6DB 3UCRA 1X7QA 1NL0L 5E5MA 4OZHF 4KK6D 3ARFD 3CC5B 2LU7A 1T03L 1KIRB 4M00A 4TPRH 3GB7B 3NFSH 4NZUL 1TQCC 5IV2B 3TJHD 5F21B 2PUQT 1E4WH 1M7IA 1AE6L 4J7RA 4Y2DC 4IDLA 1U95B 3V52H 3U0TB 1CDUA 5K9OB 3FHAA 5FGRA 1KEGH 4JPKL 4X5LA 3QFJA 5C0FB 3MLYL 1KCUL 4GO6B 5A3ID 4OM1L 3HNTL 4AQ1B 2IFFL 1IGIH 1AQKH 5DEGA 5TE7L 2I24N 3U9PH 3EZJB 4YK4B 5J89A 3OAYK 4P46A 4JZJB 2F5AL 4UINH 4XZUB 3B2VH 1MH5A 3ILPA 1MF2H 2HFEA 1DQLL 3RWIA 4UINL 1JNNH 1IEBB 2COQA 1ITCA 4OTXL 3UTPE 4PGEA 2DQGL 4URTB 2MNUA 3MNWA 4HT1L 4M43L 5AEAA 3RTQD 4AT6B 4Q97A 3UDWA 5MEPB 4QKXB 4K23L 4C57C 3G6JE 4XNZC 2Z92B 3ZHLA 5IT2L 4PJHA 4M93C 1VADA 3MRFA 3EKCA 4HJGA 1UQSB 2H32B 1VCAA 2AJ3A 2VLJD 4GKSB 4DUVA 4HFWA 1GHFL 5CEZL 2Z93B 3WYRA 4N5ED 4BH7A 3VH8A 1MFCH 2V7NB 3RWEA 1TJHL 2IBZY 3Q6GL 1I8LC 3LKQB 5I1LA 1KLUB 4PTUA 1QLFB 4OT1L 1MQ8A 1U8NB 4J23A 4M6OL 4PR5A 3QUYC 1I1AB 1GYAA 1FVDA 4ZG1A 4P5TC 4JJHA 3I02B 2DQFA 2VDPL 3DX9B 4M8VA 5EA0H 1CDGA 1AC6A 1EFXA 3TFKD 3RWCB 1KBGL 2DL2A 1RAMA 4PBXA 1DEDA 1U8MB 1ED3A 3BQUD 2EDBA 4PRDA 4BQCA 1IGTB 2XNAB 1FBIH 1WWWX 1FL5A 2EDOA 1J0HA 3WHE0 1FPTH 3FT3A 3I6GA 2VN7A 1NCDL 1AFVH 5F1IA 4WEBH 5EG6C 2F53E 2DLFL 1OP9A 3KVQA 7FABH 5CEXB 4NUGL 1U3JA 4NJAH 2D7TL 3T8XB 1KJVA 5JMOC 4GRLB 1SEQL 2BVOB 4MHHI 1N0LA 4MSWA 5IKCA 4KZDH 2WBWB 3LVEA 3JVGC 1NCNA 5KZCB 4M7ZB 4GKNA 2BOBB 1NC2B 4NQDE 5DD0L 4PUBL 5MI0C 2MQCA 2DD8H 5E99L 4AEHH 1RK0B 5KVMC 1RULH 1MY7A 5AUMB 1PYWA 3QUXC 5GGTL 3BPNC 4KDTA 4LPUA 2NLJA 2B0SL 3OJDB 2FBJH 1MQKH 3UTQB 5B8CA 4Z76B 1BMGA 1B2WH 2NLJB 3DMMA 4U1JB 1RD6A 2EH8H 1LEGA 1R24A 3G5YA 4HZAA 5DJ0B 3TCLB 3GGWA 5HYJB 1ZGLP 4AH2A 4B53A 3QO1B 3QCVL 3WUZA 3KLHC 3KLAB 4HZLB 3MRRB 2FJGA 1AKJA 3QQ3A 4KWUA 5IQ9B 3CDGA 2X2YA 4KRPD 1FLRH 4U6HA 4M9OA 3GMQB 2C1OB 5BRZE 3L5WB 4WFHD 3V0WL 3GSRB 3IFOB 3OAYH 4KJWC 1ZLUH 5I30L 5DMJB 2P49B 4DW2L 4KTEH 2X4PB 4YHPA 3TJHC 3R1GL 1HOCB 1ES0B 4LLVB 4ZO6A 2J4WH 1C5BH 3VD7A 1PG7X 1XGUB 3RUGF 1CU4L 4NQUA 3E6FA 2L0DA 1C5CH 1KTDA 1BECA 1IC4L 5H35B 4BQ8A 5IB1B 1W8NA 1QA9A 3RWDA 3CZFA 3AXLB 5CIPA 4ZO8A 4RGND 5I8EA 4GAJH 1WCQA 1NMCB 5DMKA 3M8OL 2F8OA 3UMTA 1EEYA 4EN3D 4P2RE 2Z0BA 3TO2B 1YPZA 3DSFH 5GS0H 1EHLH 4WFFD 3VRLF 5IHUL 5CHNA 4XCYB 3RVTC 5JORA 3RWGB 2UWEE 3DRTA 3Q5YA 5E8EA 4WRLA 5DJ6A 4X9IA 5I1LB 4G6KL 3HMXH 4GJTB 5CIPB 5FB8A 3V2AR 1UKTA 5E2TL 1QUNA 3BVNA 2R0KL 3EFDL 4U6XA 1X5FA 3NCCB 3K8MA 2YRPA 1DCLA 2HVJB 3HFMH 4LSTH 4M7KH 1MLCA 4YBHA 4OZGE 2FEEI 1UJ3C 3W11D 2D0FA 4KTYA 3CXHJ 5BVPL 3QBTB 3OKKA 5AZEH 5HYQA 1I8LA 1EUTA 2FO4A 4KI1A 4MLSA 5BRZB 3E8UH 1A7NH 4PJ7B 4GW1B 2YR3A 5DD1H 5IB2B 4I0PB 4DN4H 3TEUA 3ZKNC 5DR5L 3V6OA 3I3EA 3ARQA 5I16B 2R56H 5I1AB 4F15C 3LQAC 4OLWH 4YFLI 1WT5C 1NGYB 3QHZH 3LEVL 4NJ9L 5AAMA 3ILQC 4LCCA 4EUPG 3CK0H 1SMAA 2EDLA 4GMTH 3N1PC 1UZ6F 4R90H 3VRJB 1HH9A 3K8LA 3JUZA 2VQ1A 4IOIB 1AGFA 2XFXA 3L5HA 1NGPH 2VLKA 1DJSA 2RR3A 4YAQB 3RVTD 5GGQL 1ACZA 3T0BA 2BVUA 3L7FB 4PJDA 2X7LB 4ONFL 5FYKH 3MMEB 1JTOA 1X7QB 2F54D 2VERN 4L8CB 3SDAC 2GT9A 3ARYA 4KZEL 1Y6MR 1UB6A 2FHBA 4C58B 3QULB 3K8KA 1QFOA 3MXWH 1AGDB 2VLKB 4ISVA 1MFNA 3CFEB 5E1AB 1I3RB 3HI5L 2EXYD 2EDEA 4B41A 2VNCA 4L4TA 1LNUA 4F8TA 2R9HC 3VJ6A 1RZIA 4K3JL 2F8XC 2YKLL 3KDMB 3KJ6L 4HIEB 2ITCB 4PJBB 2V6HA 2NTFB 3F58L 1VEMA 35C8H 4Z7NF 4RFOH 4HPYH 1UWEL 3OF6D 2CJUH 3DMMC 2DKMA 1Z6JT 1VFAA 2B0SH 3O8XA 4M5ZL 4ZSOB 5DI8B 2QHRH 5F1KC 4MSWB 3VI4F 5IKCB 5E6ID 3ZT5A 1QFUL 3ZE2E 4KJYB 5C0AA 4AK1A 5IHZA 1SM3H 5JNYB 3BX7C 2BHYA 2JB6B 5FEBA 1KCKA 4LHUB 1JWSB 2PW1B 2AJUL 4GG6E 5BQ7A 5HHMB 4D9QD 4K3HA 4WU7B 4WWKB 1U3YA 4PJ7F 1NGWA 5FB8B 4KY1H 4P5TA 3M17B 3I3DA 5F7WC 1H3UA 4TUKH 5IP4A 3EO1B 3X3FH 5E2VH 4OZIB 2YA1A 1T7VA 3LZFL 1A3RH 1BOGB 1JI2A 3BIKB 1NC4B 4OLVH 5IW1B 1FBIL 1RPQA 4OZIA 2AEWA 3U82B 3MRHB 3MOQA 3GIZH 5HHVH 3MO1A 4YUEH 4XP5H 5EWIL 2WINB 1P7QD 3SDXA 1BOYA 4NC2B 1TTGA 3X3GH 5KVFL 1A4JA 1HCVA 4JFZH 5A40E 1NCUA 3QEGL 4Z7WF 1KXTB 2BNUB 4F7PB 1SBSL 3QZWG 3GUTB 1DDHA 5CJXA 5ETUB 1R5VA 4OUUA 1YNTA 1EMTL 1TVHA 3KPSA 3FO0L 2W0FA 4LDEB 2JLLA 3MCG1 5HGAA 1LNUB 4OF6A 4XPHH 3EJJX 3OKLA 4FXKA 1MCLA 2JKXA 1MCPL 1ZSDB 4QHNB 4TNVF 3VWJD 3TESA 4ODSL 3QXVA 3PL6C 1WISA 5I2IA 1DUYB 1AQDB 5FGCB 5I0ZA 3QQ9D 1RZ8B 3O3AB 3QUXA 2X4RA 4XNQB 3C6LD 3HE6A 3VXME 3NPSC 1EPFA 4U33A 5HDQH 4PRPA 2L7JA 2P8MA 3DXAE 4HJ0C 2A6DA 1IAIM 2D9QB 3VG9C 4XH2B 3HC4H 5GGUA 3SO3B 1HKLH 3S37X 3ARWA 1ZWIB 1H3WM 5IHBA 5GGUB 2Y23A 5CZXD 3V79C 3MFFB 3CVHL 4PJDE 2J5LB 4PYGA 5ILTL 1WF5A 3TBTA 3V9FA 3Q1SH 3IDIA 3H7BB 3CC5A 4ZODA 1HKFA 3QIUA 4UAOB 2XTLA 2QQKH 1T7XA 4R6UA 3PABB 4NQDA 4V1DA 4LSSL 1F3DH 5JTWA 4XVUC 3PWJB 5J1TC 3IXTB 3GI8H 4PV8B 3ES6A 4P46D 1V3LA 2XFXB 1FL6B 4JG1H 1R3HA 4DCQB 5GS0L 1D6VL 4S1QL 1XT5A 3QG6A 4YXLH 2CKBA 4H8WL 5MERA 1FRGH 3W0WA 1JVKA 5AYUH 3HI1A 1D5ZA 1IC4H 1JNNL 2ERJB 5EBLB 4NQCE 1JN6B 1KJ2H 5T33L 4WI3A 5KSAC 1LO5A 5KSBE 3QIBA 4S10A 1SY6H 3ESVF 1CLOL 2Z8WC 2DYPB 2P1YA 3L3HA 4NC1E 3EGSB 2FCBA 1MHPH 1FVDB 1IGIL 1OAQL 1J05B 1P69B 2AK4E 1WBZA 4OD2B 4GW4A 4ETQB 5GSRA 1CXKA 1HHHB 4HGKC 2CIKA 3G5ZB 4LSTL 1J8HD 4M7KL 4C54A 1I85C 4U6XB 4YO0B 4UBDD 1XGQA 3AROA 5L8KB 4NHCH 4G3YH 1ZHLA 4XWOD 1IGYA 5IBUB 3VXPA 1S7QB 1YN7A 4O4YL 3QUYB 4R8WH 1T1XA 4N68A 3V5KB 4BFEA 5JQ6H 3D1MC 4HXAL 4HGMA 2BRRH 1BEYH 1XF3B 1U2CA 3WO4C 4OSUH 5GSRB 4FFVD 4HWEL 1EEYB 4OF0A 2JB6A 4RCAA 2DBJA 4YQXL 1OP3H 2WLYA 5DUML 5J3HC 1BVKB 2XZQL 4M93B 5FYJE 1S7VA 3V4PL 1T0MA 3R06B 4XNZB 4UDUB 1OGTB 4JKPH 2BVQB 1A7RL 4D0CA 3QI9C 1MFAH 5L2JA 5IGXH 2XI9A 4XB8A 1A0QL 3VRIB 1Z3GL 5L7XH 2R1WA 4ORZC 1JZ5A 3NCJL 5FYLE 5L88L 3SDXF 3LQMA 3T3ME 3AAZB 5L2KD 2OBGA 1L9MA 4WFGE 3JWDL 3MNVA 5I1IL 3EYVA 3O6FB 3JBG7 3P77A 1MCPH 3QXDB 1JFQL 1U8JB 3T2PA 5GS1B 1DL7L 5D1ZC 4HDIA 2NPLX 4OKVA 5FYLD 5IFHH 1HQRA 5ITFB 4EI5A 1KIQB 2CKNA 4HV8B 3WFHA 4LCCC 3BPLC 3RWHB 1UB6B 3PHQA 2Q86A 3VMPA 4QYOB 2IADA 3EDKA 4AH2B 1VA9A 1T5WA 4G6MH 4JGMA 1MJ7H 5CCKH 3U30B 1P84K 4HF5L 3MMEA 2FLRT 4LIQE 5INDB 5TH2A 2DI7A 2GJ6A 2IANB 2XWJB 3DRQA 1R24B 3G5YB 4HBCL 4U7SA 1F6LL 4Y7MA 4C83B 4TVPH 3I9GL 2AV7A 5FA3A 4PJAA 1D5BA 3L7EB 3UTQA 3BGMB 2WWKO 4CUCA 1WFTA 1HH9B 3PIQA 2VDNH 2B39A 2BDNL 5IW3A 1H0DB 3VXSB 2OP4H 4GRWH 1TZGL 3LIZL 5I73C 2BSED 1M05A 3SKJH 2X4RB 5D71L 3TA3B 5JXEA 1JF1B 4WI9A 1QR1B 3RDTA 3G5XA 4YLQT 1KG0A 1JRHH 5J1AA 3VRIA 2Y06L 1Q1JH 2O5XH 5FO9A 1ZSDA 1ZLVH 2I60L 1GHFH 2JJSC 4R2GD 1BQSA 1FGVL 2Q7YA 5ABDE 3I6LD 4K07A 1X6LA 4TSCL 1DBJL 1T0MB 3R06A 4Q2ZA 1A1MB 3CU7A 3VGGA 1FGVH 3DPBA 4HK0A 4OGXH 3PWLA 4JFYB 4L4TE 1QSEE 1XCQB 1BPVA 1YNTB 4XVTL 3OX8A 5C08B 5GS3A 1CG9A 1I9JL 3O3EA 1CICC 4DVBB 1IAKA 3IDJA 3WSQH 3GEWB 4MQSB 4K8RH 2HT3C 1UENA 4NZRL 25C8H 3LAFA 4YZFF 4OZIF 1A6ZB 3SE4A 4S1SL 1VFMA 3OXRA 3UBXB 3ZTNH 4HFWB 4NN5C 2GIYA 5DJ6B 1UH2A 4IOFC 4NN5B 4KKLD 2VZOA 3QJFB 2VXQL 5T3XE 3BIKA 1JHKH 2R4SH 4PTUB 3RDTD 5FK9A 1FNAA 1RUQH 5TE6H 1QLFA 5MENE 2FHFA 1MY5A 3IETA 3ZKMD 1X4ZA 2VXTH 3IDYB 2GFBB 4PJ5E 4ORGB 3HTLX 5F3BB 3TYFB 2X1WL 5D2NB 1I85A 1QLRB 4UIMB 5DHXB 2DM7A 1MWAB 4U1IB 4S11A 3HNVL 5TQ0H 4OLEA 3GMNA 1A6TB 4PJEF 1VADB 3UBXI 1KTRL 3MQIA 5DJDA 4PJCA 1X5XA 5C0AB 5C0RH 3ARXA 3BKYL 2MKWA 3CZJA 4UV7L 5SWSA 3IDGA 1I3GH 4PLKD 1ERNA 3EDFA 3ILPB 4TRPH 4PV8A 3O3BB 2NY0C 1ZVHA 4XCNB 5T5FL 3SDYL 5FGBC 3OPZH 2PYFB 1JTTA 4KUCF 3CU1A 1X9QA 2HWZH 3G5XB 3DVNA 1S9YB 3FCTB 5F6IB 2YA2A 2IH3A 5ESQA 1G6RL 4H1LH 1BFOB 2FZ3B 3W9DA 1R5WA 3MFFA 1BBJA 1MELA 3OKEB 2R15A 5DR5H 3WFDH 3MYJB 4JQIH 3S96B 1BF2A 2WQ8A 1D5XA 4ZPVA 2OYPA 3BZ4A 1MIMH 1AD0A 2V9QA 2A9NL 3QDMB 4J6RH 1U8KB 2AQ2A 4P2RD 4PRAB 2ZUWA 5GS1C 2EKSB 1G0DA 2VSDA 4F2MB 3F62A 3VXMA 3SJVA 1ORSB 4KRPB 3NGBC 3GSVB 1HQ4A 2VH5L 2HT4C 5IHLB 3U4BH 5BO1H 3S96A 1OGAE 4PJAE 1RUQL 4EOWH 4POYA 2QSCL 1EGJH 2EDQA 2HTLC 3ULVE 5CEXA 2VLKD 2FB4H 5ALBL 4BZ2L 4KDWA 2AQ1A 5FDWA 2UWEA 3KPSB 3O2VH 3FHQA 3LKNB 4WHTB 4NO0B 5FGCE 3EOAA 2Z31A 5CILL 3DXAD 1FAKT 5LCVH 1BREA 4L9LC 4MJ2A 3UPAA 3IXAB 4JKMA 1VHPA 3RY4A 1YMMA 5GJSL 3RQ3A 3NFPA 3IS1X 3G9AB 3EDDA 5EC1A 1CD0A 4H0GA 4NQED 1MJUH 2EIDA 1P4LB 2HA1A 4WIQA 4CU6A 1RU9L 2FNBA 4ZPTB 3U6RA 4HSQA 2R39A 3D85B 1QFWM 1X3DA 5I75C 4BUHA 2GFBA 2R0LH 3X13A 4NYLB 4OIIL 1YN7B 3VRLE 2ZCHL 4F37F 3DX6A 3H3PL 4QRPD 4P49A 3U36A 3ARBA 5D71H 3BWAB 4Z18A 5IBTH 2PR4L 3EO0A 1RZ7H 4HUNB 5KJRL 4M61A 1DLFL 1TITA 2Q8BL 3SE4C 1T89A 5JOEA 4N9OB 1CLCA 2ERJC 4PJHE 1CFNB 3EYSH 3T04D 3WNKA 1QNZH 5LGHL 1OAUH 5LBSH 3EYUH 2IMMA 3X13B 3V5HB 1QA9B 3RWDB 2D4FA 4G8EA 4WEUD 3VXTB 3ZKXC 4Z7UB 3NH7H 1NCTA 4U0RB 4ALAL 5KVDL 4P9HH 3C8DA 5E8NA 4NIKB 4GG6B 1ZA6B 1SJVA 2A73A 2VXSH 4OCRL 2QADD 4PS4H 1JV5A 3TYGH 4XI5C 1II4E 1RQ5A 1U91B 2D7NA 4PGDA 3VXRE 4OLUH 4RX4D 5F9JA 4Q74A 4ZUWB 3VG0L 1MSPA 2JJTC 5IVZB 3WHE1 5IFHL 4UAOC 5DVKA 3QEGH 3VWJC 1AIFA 3FN0L 4FNLH 2AEPH 1OTTC 1URLA 3VWKA 4ZSOA 5AZEL 2DQCL 3D25B 4FTVD 3ARGD 4Y4HD 4KJPD 5AZ2H 3EUUA 1UZ6E 1AO7D 1IM9D 4MWFA 2Z31D 4F2MA 4JFEE 4PBVC 1LEGB 4MNQB 5D1ZA 3ALPA 3LN9A 3MZTA 2QBWA 1AJ7H 4PB0H 3C60D 5DO2C 3UJIH 1KPRB 4X6CF 3O6FD 5I73B 1T1ZB 3QULA 2XA3A 1RK0A 3GM8A 4XCEA 2W65A 3PL6B 3X12A 1OM3H 1Q9LB 2XN9B 1VGKA 2VXQH 3V7MA 5LAXB 4ZXBC 1XGTA 3A67L 4R4ND 3VDAA 5EDXA 2QSTA 1LK2A 2OTPA 4EUPH 4HC1L 43C9B 4YH6A 3ARDC 1IT9L 3IYLW 2ZCKL 4ZOAA 4UDTB 5CEZH 3L6FA 4WHDA 4XXDB 3GSNB 4QOKA 4UT6H 3H42L 3ZTJG 3PV6B 4BZYA 5JXEC 3KYMB 5SWSB 2IH1A 1OCWL 3JWOL 1AGEB 4K7PX 4M6MH 1R3KA 5EC2B 3U0PA 4DW2H 4JGJA 4GG8B 3C9NA 3VXQA 4WNQB 2CMRL 1E6JL 3CFBA 3QRGH 4PJFE 2X4NB 1CK0H 2WBJA 5T5FH 4Z7UE 1A6AA 5C8JB 1CE1H 3LV3B 4RISL 2WWMC 3MUGA 3MV7B 1KPUA 5ICZB 1DLHB 4JHWL 3ZKMC 3DECA 1MVUA 5DRZA 1I8KA 3TV3L 3QJFA 3B3IB 3SQOL 3QPXL 3UAJD 4WWKC 4Y88A 3KGRA 2DM2A 1U8OB 5HVWA 5E4EB 2JTDA 4RX4A 3B2UD 4UQ2B 1T0PB 5C0NC 1KJMA 4WW2F 5K9QG 3FQXB 2VWEC 2D7PA 3NPZB 2K9UA 5KSUB 2EEAA 4QRSA 1S7SB 5D5MB 1DVFC 3RHWF 3SCMA 2N4IA 4I5BB 1FZMA 1C5DA 1FDLH 1I8MA 1FN4B 1DL7H 4HULB 1I3UA 5GRVK 3LEYH 1QR4A 3OPZL 2GSGB 1NUNB 2XWBA 2HRLA 1E27B 3ECBB 1E0OB 3GSUA 3TZVB 1CG9B 4LKXB 1A47A 4UTAL 3KPPA 4NSKA 1TNMA 5DDHA 5DJ2B 4A6YH 5C0DB 1IC5L 4MD0A 3TJEL 1TIUA 4HUKB 4I77H 1NKOA 1NCBL 1I75A 2A2QT 2EDTA 3HNSL 4XVJH 4E41D 1CBVH 2RCSH 3GKZA 1FNLA 4ZFFA 4ODXA 1UM4L 4CVWA 3L3JB 3QH3A 1IKNC 3LMJH 2DJSA 3TIEA 3WFCH 3O4OB 2VRAA 3TNNB 1P4IH 1JGLH 5IMMA 1J1OH 1J11A 5JHDB 2IFGA 4PG2C 1C8PA 1CT8A 2E9JA 4XCEB 5B8CB 2Q1EA 5GZNC 5A2KH 3QUKA 5D6CB 4DTGL 4TTDD 1IC7H 4JB9L 4ZUUB 1CLYH 4JFOA 4PJEE 4E41B 5CEYA 3IKCA 4JM2F 2Z31C 4JY5H 3RKDD 5DYOB 3LN4B 2AK4A 4KTDH 2ITDA 4Y5YA 4HF5H 1G1YA 4KROD 2BCKB 2RB8A 4XNXL 5DRXB 4KRMB 2PN5A 1JPGB 4O5LL 4PRNA 1NFDA 4L9DA 3C2SA 3ARBD 3VWKB 1YMHA 4HBQA 2OR8A 3RUGA 4I0PA 1JHTA 5I9QC 2V17L 2YXFA 1BVKA 2X70A 3QDJE 3ARDA 5HGGS 3GFUA 1UXSA 1F45A 4HCRA 3IB4A 4OM1H 1P1ZA 5JHDD 2P5EA 2YPVH 4YDIL 3U0WH 2NY4C 2IG2H 5M7QA 5DFVC 1CZ8L 4QRPE 3FRUA 3NIDF 1YEIH 5CWSB 1RVFL 1BFTA 1E27A 1F4XL 1ZHNA 1H8OA 2IQ9L 3D0VA 5F3BA 1HHGB 4ZYKA 1F00I 3HZYB 3PQYE 2CK0L 3VFUA 2QV2A 3GHBL 3S3SA 2CQVA 3ZE0F 4RGOH 5FF6B 1QSVA 5E8EB 2A1WH 4H8WC 4CU7A 4JN1L 1AGBB 2V7HB 5ERWA 5F70A 4L4VE 1IBGL 4RDQG 4Z5RB 2HKHH 4PP2A 1BAFL 1PX3A 2VABB 1RJZA 1J0KA 4MNGB 3MRKA 3VH8B 1ZT4B 3MV8D 3SDDC 1BZQK 3VFUB 4DEPC 2X4TB 1LO5B 1N26A 3V0VA 1Z5LA 1CIUA 3BGFB 5KSAD 4QWWC 2A74A 1NUDA 1JFQH 3HI1B 3OKMB 2HJFA 1NGQH 2JJTA 1RZFH 3ARUA 1WBZB 4YHMH 4IS6B 2FLBT 1EX0A 4CL7A 2CKBH 4PJIF 3SJVD 2ICWI 3OKDA 5HYSG 1XCTA 4MYWB 4LGRB 4DKEH 3JV0A 1Q9WA 5MP6H 2ATPA 5JZ7D 4Y4KA 5I8KH 4WW2A 1YMMB 4HJ0D 4XXDA 3MOAH 4ZFOB 4JPIA 3C60C 2BOCB 4K3EH 1BIIB 4OI9A 2ZG1A 1DFBH 4XRCB 4DOHE 1FFOA 1JGDB 5A2LH 4OD3H 1OT2A 4FRWA 3HNTH 4HKBA 4P9HL 1S9WA 4ZS6D 1UEYA 1F11A 5TDNA 3FN9A 3PL6A 3X12B 1ZLVK 4KFZC 1KELL 5FA3B 4UV4L 4JFOB 3FB5B 3KPRA 2DLGA 3WKMH 2BVYA 4YR6A 3FN3A 1MNUH 5BVPH 2R2EA 5TDPA 1CT8B 3EOYG 3AM8C 4NNPH 1NEZA 1KB9J 1NC2A 3X14A 3GMMA 1L7IH 5CJOL 3JTSB 3SQOH 1F58H 5FM5O 1ZT7B 2PXYD 3A6OA 2R2BB 5D2LF 4HH9A 3ROLB 4YDJB 4GRLD 4PREB 1TCRB 3K81A 4ZXBA 1N3NB 4F57H 3Q48A 2EIZA 3ZDYE 1EO8L 1KJ2B 2R69H 1B3JA 1MRFL 3O41A 4P5KB 1LDPL 5IROA 4QXTB 5E00A 3WJJC 4ZOEA 4NZJA 4YXLL 5J11C 4PRPD 2HAZA 4B50A 3P11L 1QPPA 4QF1B 4A6YB 2Y07H 4WJ5B 4BFIB 4KRNA 2J8UB 3HB3D 3U9UB 4MAYA 4NQEB 2B2XL 3V6FA 1PZ5A 3MRPA 2OTWB 2H45A 1IT9H 3C60B 3FONA 3FZUC 4P9MH 4QT5A 5K59F 3SY0A 3D3VE 5DK2A 1I1AA 2AGJL 5L8LB 5E9DB 3WIHL 4Y4FD 5GRUL 1LO4L 1EO8H 4I0PC 4X6CE 4QRPA 1B88A 5JOFA 3U2SA 3VW3L 4FQPA 3PNWA 1QG3A 3PQYA 2Z93A 3KPMA 1IZKA 2HH0H 1RJZB 4XP9H 3VCLB 3RBGA 3RWGA 3DYMA 1Q8MA 4XVSL 4NRYB 4HMDA 1MVUB 5DRZB 2NXZB 1RMFH 4JZJC 1QVOA 4MMZC 1B2WL 4G8IA 1JK8B 4GMSH 2MWCA 4L8SC 2YD5A 4LPCA 1XGPA 4X6FA 3CX2A 3KYNB 3GZKA 3MLXL 5I19H 4LCIH 2DQCH 2VOTA 5EN2A 3E6FB 4M7LL 4RFEA 2MJWA 1OAKH 4G43A 3P0YL 4I2XB 3NAAH 5EIVA 3HAEA 5HYFA 1ZHBB 5DT1L 2XT1B 4GG8A 3QHZL 4LOUD 1LGVA 1U42A 4JDTH 1I7TB 3HUJA 5FYKE 3HB3C 5JNYA 2OTWA 5FDWB 1DTUA 4TULL 5BOPA 3NFNB 2GUOA 4RAUB 1OF2B 2A77H 2PNDA 4KAQH 2A6IA 2OZ4A 1DBAH 1T83C 4ZS7L 1JZ3A 4O51A 4P3DB 4PJIA 5JOPD 3VDCA 5I76A 1WGOA 3HKFA 5FV2A 4Y5VB 5D7JB 3STLB 1BD2B 5TFSL 3PABA 1IGFL 3GMLB 4YUEL 4IRSB 1KIRA 4FQIL 2JF1A 5HYJA 1NQBA 5E5MB 5D7JD 4GAGL 4D0DA 2X7LA 1EGJA 3LQZB 4Q6IB 1U8KA 4XVSH 1YY8B 3Q6FB 3STZB 3MUZ1 2MOVA 3WNPA 1F2XK 1NDGA 3MREA 3BGMA 3FO1B 3OKNB 1G7IA 3MV01 4LPVA 4PREA 2YPKB 3JV6B 5F9OH 4KY1L 4OV5A 1E28A 3QFDB 5E70A 1E6JH 4L8CA 3CAFA 3DXAB 3AC0A 1GOGA 4XWGH 1S5IL 2LFGA 2AJUH 5CZKA 5SV4A 1HK6A 2AEQH 3BPNB 4JFXB 4IJ3B 1RZ8A 3O3AA 3T0EB 1VGEH 3AS0A 2VKWA 2H41A 3AM8A 3H42H 2UZIL 5JPNA 4XMLH 3QEQB 1RVFH 3DNKA 3IJHB 3O4OC 4MCZA 5KOMC 4LFHG 1AXSB 1LP9A 4PIRF 4WY7L 5GGVH 2CSPA 3P0VH 1MHEB 4NCDA 5F1IB 3ETBF 1MUJB 5HI4C 5DD5H 1R5VB 4GRLC 4OUUB 1F8TL 3NCBB 3RY6C 2A73B 5J6HA 1MLCB 5F7DB 3DJ9A 2DQTL 4UT7H 5IROC 1NBYA 2ZSVA 1I9IL 1G7HB 1A64A 1KN2H 3GKWL 3QIBD 5HYIA 4APQC 2R29H 2FO4B 3QNXA 3SGEH 1DEEA 5IK3A 4OZ4B 2XXMB 3O2WL 4R4BA 4Y2DD 5T5NG 4RWYL 4J4PC 5ADOL 3TPUB 1XGRB 1MAML 2BC4A 5I66B 1XH3A 1KCUH 3KXFD 2A1WL 3VXOA 5EOCL 3SO5A 4GAYB 4PG9A 4XGZB 4FOMA 3RFZC 3IDMA 4J6RL 2AKRA 4P5TB 1YECL 1UT9A 2DMCA 3DI3B 1S7UA 3BPOC 5JR1H 1HHKA 4TPRL 5EO9A 5JO5A 5E95B 3MLRH 1LHZA 4G6ML 1EXUA 1P4LA 2YWZA 4U1MA 3MJ7B 4F7CB 3H9HB 4ZUVA 4OV6F 5JXAH 5E2JA 1HNGA 1UM4H 4QTIL 3RGVC 3S36H 2VDQL 2VLJE 4M4PA 4OLWL 1T1WB 4X7DC 1F02I 3KLSA 2G2RB 3IXAA 3MLSH 3J8F7 4GXUM 5A2FA 5DLML 4JG0L 2DJ4A 2Z8SA 4LRIA 5JXED 5I1HH 3EYQC 4LLWB 5IIEA 4Y4KC 1EJOH 2Q76B 4WW2C 1KENH 1GOFA 5IBUG 1AGEA 3CVIH 2QQNH 5IEKA 2DQHH 4EDWL 4AEFA 5EUOE 1S7TA 3T2NH 5GGSA 5T3XL 5T1LA 4O2CB 1JUFA 2F19L 4TUOA 2G9HB 4CVXB 1NBVH 5C71A 2V5YA 5J56B 3RDTB 3WS3B 2Q8AL 3BT2L 4OIBA 2IANA 2XWJA 1OY3B 1ORSA 3ROOA 1GC1H 2CO7B 3D69B 2XTJE 5DVNA 1VGKB 5IHUH 1WICA 1MOEA 1CDJA 5HHPB 2W65B 2Y9RT 2V2WA 3QFDA 5IVNA 3TN0D 1FGNH 4G6FD 4OCNC 5KSVB 5IFAL 4WU5B 1I7RB 5E08L 5DHYA 2BSTB 5FKAB 4CRPA 4ELME 1LDSA 5KVEL 5A43C 1T3FA 2EH7L 2Y07L 3PHSA 4XCFL 4ZFOL 5I1IH 3SKMB 1IC1A 3MLUL 3GSNH 3HPJA 5HHOA 4WVRA 1CZ8H 5CP7B 5T1KD 4XNQA 1OP5K 3KPPB 1NGYA 2WUCL 4H1LB 5ID1B 3A6BH 2D2OA 2ZUVA 1YN6B 4QHNA 5T3ZH 4E9LA 3AY4C 1EZVX 4XI5D 2G2RA 4R7DA 3VA2C 1IFHL 1OF2A 4HEPG 4EJ1C 5E24E 5TE7H 5C09E 5D2NC 3G6JA 3VWJB 3AREA 5D5ME 3WFBH 2ZNXA 1UKSA 5I1DB 4MAYC 4FQHB 1YJDC 3V52L 1A5FH 1MWAA 4DAGL 2NXYD 3AS1A 5BV7L 3BVNB 4MJID 2C5DC 3IU4L 4J3UA 4S2SB 5HJ3A 3RY6A 3MYZA 3VXPB 3MODH 1UQSA 3D87B 4LSQH 3IDMB 3GBMH 3O6KL 5ANMA 2BFVL 1IM3A 1U8QB 1AGCA 4IRJB 3G5ZA 2H9GA 4N90E 4NGHH 1EXUB 5DGQA 5ERWB 5HI5C 1NC4A 2ZOKA 3OGCB 4QXUH 5ANMB 5JW4M 3MRGB 1R5IB 2DWEB 2DF3A 1MJ8H 3K80A 1QHPA 1OB1A 1UYWL 5JLZA 4L29A 4G8GB 4JAMA 1QFPA 4NO3A 4X9FA 2EE9A 3KPNA 1QBLH 2C3GA 4FZEH 3QNYB 3QDJD 4Y0GA 5E2WL 4NQVA 3MRQA 4PJFB 2CMRH 4KXZI 4J8RB 4FZ8L 4L3EE 1MCWW 3FFCB 3BMWA 5I75B 1P1ZB 1P2CB 2E7BA 1X5YA 3MCLL 4N9GA 1S7RA 1VB9A 4AG4H 4PGEB 3WEXA 5IR1B 2OTUB 3E3QE 5L6YH 1MREH 4K2UL 4RMWA 2ATKB 4D0BB 5D8JL 2A83B 5JR1L 2WUBL 4DUWA 2FD6H 1HI6B 3QXAA 4PJXF 3MACH 1OTSC 4YEFA 4P2OC 1JNHA 2N56A 4HZLA 2OR7A 3MBEA 3QWQB 1MUJA 4HS6A 3TYGL 4H26A 3TT1H 5EU3B 3QIUB 5CSBA 3QCTH 3ZDXF 1C1EL 5FIEA 5KOVC 4OV5B 1GGYA 3VFSB 4HUVA 4FFYL 4M6AA 3U0TA 3B43A 5D7LB 2OR9H 1N0XH 3HZVA 3FQTB 5F9OL 2LQRA 4DWHA 4N0CC 5D2LA 3QDJA 5GSVA 4P2OB 5D7LA 2OMNA 4PLJC 2MCPL 3TBSB 1MCNA 1FFQA 2NY1C 4RRPG 4O4YH 1R3LA 4YDVA 5FAAA 4BZ1L 1JZ2A 1JF6A 5D8JH 3ULUF 4QNPE 3BO8B 1NCCL 4G5ZH 2FJHB 2ADGA 1J0YA 3BFOA 4X7EC 4N0UE 5INDA 1IKFL 4QHMB 1A3RL 3JTSA 5F9WB 1IRAY 4KKBD 3ULUH 4LAQH 1AP2A 1UZ8A 1XIWD 1GGIH 4JFEA 5KS9A 5L2KE 3O0RL 5J13B 4AM0A 3BISA 2OJZH 2PXYB 1F5WA 1IQWH 1UKQA 1Y18B 1KJVB 5E03A 1NDGB 5GGSB 3UJJL 3VFTA 2C7UB 3MRDB 4AL8H 3P0GB 3FO0H 3PP3K 4NCC2 1XR8A 4LLQB 3D2UA 2FO1A 3C08H 3VXRB 1A6VL 4C4KO 1RJLB 2VITA 3DMMD 3IAGC 5DS8B 4EUPA 5D93B 2BZDA 3NAAL 1CDBA 1X5GA 2VJXA 3BIAX 1Q0YL 3MCKA 3T4YB 3DOSA 4IRJC 1TVDA 4NM8H 3RL2A 3VFNA 1FC2D 2HT4D 3LPWA 4YHLL 2D0GA 1U92A 1YEKL 3QEHA 4OCXL 1ZLSL 4P2RA 4IRZH 4QEGA 3VXSD 1MCFA 3IU4H 5HD8C 2DQFB 4GUPA 3H0TB 4ODHL 2KQMA 2H9GB 3IDXL 1YEDA 2VLRA 2NY0B 4F7MB 3K0WA 2CDEA 3C6LC 1K85A 4G8GD 4APQA 5C2BH 4XP9L 1QD0A 2QSCH 3FB8B 1DQML 5FUCE 1SHMA 4W81A 3HG1D 1DR9A 5D2NA 1CTOA 4Y19A 1B9ZA 4NN6B 1A4JB 1OAYH 5EN2B 1H5BC 2XYCA 3LRSB 3GMOB 3V0VB 2WINA 1CGSH 3KPNB 3OBAA 4OFYD 3CX5J 1AO7E 4AYFA 1A6UL 4G8IB 2MPAH 4TTGA 3QHFL 5DJXA 1YEFL 5J3HD 1VESA 3QDGA 4PG9B 1XF2B 2XICA 2AS5M 1LO4H 2GCYA 3A6BL 3ISWA 4F9LA 4LLDB 3QCUL 2ZUQC 4PJ8C 1ZV5A 5HVHB 5DK0B 3Q5TA 3U4AA 4LEXH 1LK3L 4KXZH 3N0PB 4FQJL 4ONHA 1S9VB 1NSNH 3RAJH 1IAIL 4LKCB 1LQSR 1NCAL 4ZO7A 2X4QA 2OZ4H 2XZCH 4FQJH 4WFEE 5GGRY 5CBAA 5CWSA 4LHUG 5IW6A 1N2RA 1EK3A 1UWEH 1OSZA 5C08A 5D70L 3RI5F 1N7MH 2P5EB 3O2VL 4QOKD 2EIZB 5DJ8B 4P5KA 1FL6A 3WIIH 1K6QH 4QRUB 5DD6B 1BX2A 4LRNH 3JV4A 1F3JA 3ZE1F 1IQDB 3PF2A 3X11B 4O9HL 3BSZL 2UYLB 2BY3A 5C9KA 1I4FA 2UVFA 3QDHA 3SDCC 4X4YA 2NTFA 4PB9L 1J1PL 3G04A 1CXLA 4G9FE 3TV3H 1XGTB 4X9GA 5EIIB 2VZVA 3TBSA 4JKWA 1JUFB 4TUOB 5E1HB 4PJGA 4Q6IC 1FFNB 3KAAA 3TA3C 3NPSB 2HFFB 3ROLA 4Z95L 4KJQD 2R2BA 3QB7C 4FXLA 4P48A 5D7JC 1GOHA 2JELH 5H37H 3RWJB 3ARRA 1ZT1A 2NY6B 4HKBB 4I3RH 1JZ6A 1M71B 3CGTA 2BMKB 2KL6A 5HSFA 2CRYA 3P0VL 1MFEL 3BZEA 1RURL 4NDMB 2WMPA 5I1AA 1KXQE 1RV6X 3K4ZA 2APFA 2BSSA 3VGAC 1CGVA 3QQ4A 4NBZB 1I3GL 4KJWD 1ZHKA 3P73B 2ICEB 2Y72A 4QHUB 1IARB 4LCCB 2ICWB 5GGRA 4I48B 2AEQL 1JGDA 2YD7A 3THML 4PJ9D 3VGEA 1PG7L 4Z7WE 2EC9T 3RVWC 5C0IA 1U2HA 1TJGL 5JDSB 2LAAA 3PJSB 1GGBL 4JQXC 1YJDH 4OAWA 4YPJA 4FQXD 3NCYS 3EYFA 3RWCA 5HGDA 2ZOLB 2BRQA 1K3IA 2DL9A 4XNYL 3B9KC 4X6DB 4RA3A 3ZT7A 3HMWL 5F1OB 4N8VG 4KVCL 5ANME 5C07A 4D94A 2WIMA 2P5EE 4M62H 4P0DA 2BFVH 4LSDA 5E8DH 1QLRA 4MB3A 4UIMA 5DC0A 5HDBF 1Q9OA 1TQBC 1U8HA 2M2DA 3AU1A 3FOLA 3GO1H 4OD1L 3FN0H 3QR2A 3RVXC 1D5IH 4MNGA 3MLWL 2FR4B 2ESVD 4CVZA 3QUZD 4FZEL 1W0WB 2VITB 4K7PY 5FUOH 1K4CA 1OTUC 3BZFA 1PG7W 3MCLH 1ORQB 1T21A 2F15A 3QDAA 4YFLF 3BUYB 1XCQA 1S9KC 3BP7B 2IPTH 4GQ9L 3MV7E 5IHZB 1S7XB 3QEHB 3HC0A 3WFEH 2QQLL 5BCAA 3LEXB 5I6XC 2LVCA 5E5RB 3REWA 3DV4A 4DN4L 4NKDA 3KPQA 1JZ4A 3RBSA 1DQDL 3PGCB 5ELIA 4G8FA 1N6QL 2AJYH 5IESL 4Y5XC 2XPGA 2NX5E 4MXVF 1F13A 1G7QA 2Q7NA 2H2SC 3ES6B 1IILE 1D9KC 3TBVB 4TUKL 1FH5H 4HKXB 2GQHA 4HWZA 3IFLL 5CZVL 3GHBH 3HCVA 1JNLH 4ZUUA 1W72L 3ZHDA 4LIQL 1NFDB 3NIGF 4F9PA 1DBAL 1S3KL 3UJTH 4YPGA 1ETZB 4JO3L 4DKAA 2Y4SA 3D69A 3T0EE 4PRAA 3MV9A 3VI3F 2J1KA 1FLTX 4IHOB 5EZIL 12E8L 1BQHG 1R3LB 2FJFA 2MSPA 1G84A 4AIZB 5H94B 4YHLH 5TDOB 4OKVB 4FP8H 3L9RA 4XMPH 3FQTA 5DTFA 3TN0B 1DQTA 4L8DB 4LHQB 5EUOB 1AR1D 2BOBA 3O6FA 3NABL 5JW3L 4NSKB 4LVHB 4WEMB 4HK3N 3WS6A 5FV1L 1KENL 1T6WA 4DKFH 4YHZH 4JFHD 3BDYL 3I6LE 1H3GA 2X89D 1VACB 4HIXH 4RAVA 1XF4B 1BIIA 3NOIA 5I71C 5D1XC 5T1KB 2YN5A 4ONHB 1S7XA 1CXHA 4PRBA 1I1FA 4MAYD 3WJJA 4OCSL 2KH2B 1A22B 1T1WA 2EO9A 4PJCB 1WV7T 4MVBD 2HJLB 4O2FB 3O9WD 3JXAA 1FNEA 2OL3B 3U7AA 4Y4FC 1DDHB 2BSRB 2B4CH 2CIIB 4FFWD 4MQXD 4GG6A 7CGTA 1RZKC 1AO7B 2AJYL 3K1DA 5JQ6L 4KHXH 2BNRE 5DZOA 4G8EB 4MXQD 1NBVL 2X4TA 3AS3A 2B2XH 3WFDL 2O61A 1NAML 2HLAA 5GHWH 4GAYA 1JI1A 4D9QE 3C6LA 2HRPL 5JLZB 1CFNA 4W4NA 1G0XA 1XGQB 5LWYH 3LSOB 5FECB 1C12A 1G6RH 3RX5A 3TA3D 3CK0L 1QKZH 1H5BA 2W9EL 4A6YL 4NO5A 4RZCB 2M1KA 4HWBH 4M43H 3DBXB 1CFQB 4ELMB 2NXZC 1ZHKB 3P73A 5J9PB 4IIQA 5INCA 3VGDA 2FD6L 1I7ZA 3CFBB 3KPSD 3ELAT 4TRPL 5LXGL 4OAWB 4WU7A 3QI9D 2D31A 2QQLH 2YD8A 1YNKL 4MD4B 1ND0A 5C0IB 1MHEA 1M71A 1A7QH 3IVKB 3O41B 2OQJB 2P24B 5IVXB 1DQJA 5JW4N 1WC7A 1R0AL 1GAFH 3N50A 4XPFH 1PZ5B 3MRPB 5F93C 4YHIB 1I9EA 3OB0H 4RMVA 2FGZA 5SX4H 1UGNA 1RIVL 2X05A 4LASL 1W0YT 2VXTL 4OM0L 5DURD 3QQ3B 1JGEA 4FS0A 1NJ9B 3JWNC 1HXYB 3D85D 1WFOA 5C08E 4GS7C 1MI5E 4M1DH 1MCCA 4F7EA 3DXAA 3VU2A 4L1DA 2UV3A 1BJ8A 1QBAA 3S35H 4N8CH 5F7YC 1TJHH 1D5BB 3L7EA 4FQXC 2H1PL 2VLJB 5HPOA 4PJCF 3CLFL 1FVEA 1MRCL 1SVCP 3QRGL 4EEEA 1YEJH 2FH8A 3J7HA 4JFDE 3P4OA 5LAXA 3ZLQC 5EU5A 4G42A 5T1DL 4HKZB 2JCCF 4QY8B 4JRYA 3MYJA 3BOVA 3VRJA 5HYSA 5DJ8A 5IEKB 2BY1A 4NM4L 3UYPA 4L4VA 3MNVB 4DEPB 4XPAH 3HAEB 3PWNA 4XNXH 2P43B 1CGYA 1DN0A 1ZA3A 2DQUH 4M9PA 1NLBH 1PQZA 1Z9LA 4G6JH 1ZS8A 4KGJA 1CDIA 1WFNA 4OF8A 4NKOA 4LCIL 3AVEA 5DMIL 2NY0D 3SDXB 3ZKND 1T04B 4LHJB 1PEWA 5GGTH 4PJFF 1E4WL 3TBYA 3RIFK 4KI5D 5EBMA 3LS5L 4M61B 1RZ7L 4PY8I 1UWGH 2JB5H 4R0LB 4GAFB 4R4BB 4OZFB 2Q8AH 4HQQL 4JY6A 5EOQH 3SKOA 2V9TA 3MGOB 3VXTA 3RHWK 1CD9B 5AWNL 1UJ3B 4UNUA 1FE8H 4ZUTA 1NGZA 1CXIA 1U8OA 2AEPL 3WHXA 4XP1H 3FKUS 3GMRA 2AKRB 4LPTA 1C7TA 3D85A 3BN9D 5DSCB 3S9DB 4JY4B 3QNZA 5FYKU 1HZHH 2RBLA 3BXNB 4WEBL 1IGML 2W07A 4K94H 3CSGA 2M8XA 4BFIA 4X7SL 2F5BL 2V5SA 3T4YA 2CUHA 5LWYL 3F7QA 2X4NA 1ZA3B 4GRMB 1BGXL 4H25A 5EFIB 4X6EA 4QF1A 4YXKH 1FE8L 2X09A 5F7DA 4A2LA 4LP4A 3INUH 2JE8A 5CIPH 1JGVH 2N7BA 3VFMB 5C2BL 5FHBH 3O4LE 3O9WC 5C7XH 4ONGH 1MFDH 2YUWA 4L5FL 1HNFA 1HQ4B 5DJZB 1EH9A 3MUJA 4P4KD 1BLNA 4LU5H 4PRHD 3PE9A 3F7YB 2A0LD 2KUTA 5F3HB 4X5WA 2P46B 4LEOA 4QLRA 3TNNA 1ETZA 1L7IL 5CJOH 5GRUH 3F7YA 2G5RA 4K8RC 3CFCL 3VFOA 4KPHL 5DYOA 2ADFL 4M1GH 1N6QH 2RIKA 4YHOL 2E7CA 5ALCL 2EDWA 5DEFB 1F4YL 4KQ3L 2IAMB 4U3XA 5FOBA 3NZHL 1KN2L 5FA4B 1J1XL 3HAEH 3LPGA 3TZVC 2OZ4L 2XZCL 1C08B 4MQ7A 4U6TA 3GSVA 3MV8B 3SDCB 5DJ2A 3H9SD 1H15A 2ED9A 1FRGL 2NW3B 5ISZE 5EB9A 3CCHA 1IGJA 5D2NE 4HGWA 3QUXB 5L0QC 4UUJB 3PHQB 5IMKA 2VR5A 4X6EB 1S7WB 3EHBD 2ZUYA 2IGFH 4UIKL 2AJZB 1EGJL 4DZ8B 3VMNA 4ZTOH 1P84J 2P47B 3CLFH 2FECL 3FT2B 1ZGLB 5C0AD 1FYTA 3MRMA 2GUOB 4RAUA 5A1AA 4YHYB 4HIIB 4LLYB 3EJZD 5ID0B 3D3VB 2PETA 1MCJA 4HS3A 4K9EL 4ZDHB 1T03H 43CAA 4L3AA 1IM3B 4HHAA 3BMVA 3I50L 3MV11 4HFUH 1HHKB 2QLVB 3TYFA 1A02N 4KV5F 2AK1H 4LQ1A 4U3HA 3TO4A 2YXMA 1WAAA 2GTWA 5C6PB 1K5NB 3D0LA 3HLAA 1TETL 3AREC 4LVEA 5BRZA 1FNGA 1HKLL 4YHNB 5LGJB 4JQIL 5IF0A 5DWUH 4YXHH 1QZ1A 3DLQR 1QRND 3G08A 2A6JA 1X5LA 2ADJB 3L5XH 1U93B 4YE4H 2EZ0C 2YMXL 1PJ9A 4G7VH 1OT1A 4N8VA 5SWZB 2YMXH 1K5NA 5EU7C 3GK8L 4NBXB 1A6AB 3BW9A 3RVXD 4AEIL 4WJ5A 1VKXB 2W38A 2DD8L 2XWTA 4KKBC 3D2UD 3U7YL 3FQWA 2H3NA 3S5LG 1VERA 4FQQA 1TPXC 5C0JB 4H1LA 4Y8AA 2CIKB 4HUWA 1TETH 4FMFA 1I8KB 3D2UB 4R96B 1R3KB 3ARDB 4JM2A 5K9QI 4HJJH 1S78C 1XGYL 3PWLB 3GSWB 3HN3A 3I50H 4M1DL 1JHTB 4X6DE 1I3VA 1YN6A 5CJQL 2WBJB 3V6OE 2CLZB 4XNYH 1D9KD 4HGWB 5HHPA 3IFNH 4NCC1 2VR4A 2VYRE 1HSBA 3TVMB 5EU4A 5HY9A 1LEKB 3AB0B 1AHWA 3LHPL 4PJ9C 2FBOJ 3LZFH 1DBBL 4PJAB 4E41A 3FO2B 4P2OA 4V2CB 2DN7A 5HPMB 5DEFA 3PWJA 2R0KH 3EFDH 3OJDA 4JB9H 3C8HA 2W60B 2EZ0D 3VFOB 3W2DL 3TLRA 2RHEA 4YWGH 1FCCA 4RNRA 4LRNL 4F7EB 4QRQB 4Z7WA 1F4XH 1BWWA 4M6OH 3RGVD 3WFZA 3TCLA 1IE5A 1F2QA 4GBXC 4UNVA 1CQYA 1U8IA 1BD2E 1WUNT 1RHHA 3RNQA 4DN3H 1KACB 2ZP0T 4CGTA 3F5WB 3NTCL 2W9EH 1I8IB 8FABB 2BVOA 1KGCD 5D2LE 2ATPB 1Q9KA 4EKXA 4U0RC 3C09B 1S7RB 4KK9C 2GITB 4R7NA 1CU4H 4N0YL 5ISZA 2OQJA 2P24A 5A3IC 5IVXA 3LB6D 2P45B 4U1MB 2M26A 2ILLA 4M1GL 5L88H 1V3KA 1DUYA 1FZOB 5BXFA 4G9FB 4PJ8B 2HT2C 4PGJA 4GH7B 3HE6D 1QKZL 1RY7B 4HLZG 4NGHL 2O5YL 1X5JA 2P5WA 4U1HB 5FUCC 3Q3GA 1G7LA 1ROWA 1RIUH 3FAWA 1JK8A 4LIQH 2LE9A 2DAVA 1VFBA 1D6EA 4XGZA 2ZUUA 3DGCR 5TE4H 1U93A 2HFGL 4LBEA 1AGCB 1E4XH 4IRJA 3BWAA 4MQXC 4N8PA 4YBQD 3MOBH 1EHXA 2HYMA 3HRZB 2WIIA 4TOYL 4QXGH 3FOMA 2HTLD 4XAKE 2VUOA 5JOPE 1SMOA 3N06B 3NFSL 3LH2L 4RGNE 4R90L 1NPUA 3FQNA 4R0LA 1XH3B 5GS0C 4JFDD 5HDBE 3TO4C 4EDWH 1CFSB 2JCCE 3ZKXB 1FDLL 4NWTH 2VZSA 4L9LB 4PJHB 4ZD3L 3BKCH 3DGGA 2MTPA 3G6JB 1E4XI 1TVBA 2UVEA 1JIBA 5F1SA 3O45B 5FF6A 1DQDH 4AT6A 4MAYB 1UA6L 3GIVA 5CKGA 3UYRH 5HXMA 1VEOA 3IJHA 5C3TA 1ZGLA 2CR3A 2APWA 4NOFA 4ZMAT 3CH1A 4JPVH 4RMRA 1FNFA 5T1KA 2HFEB 3LV3A 3MLSL 5C08D 2P42B 43CAB 3IDNB 3KR3H 1JWMB 1J0IA 3IFLH 5H2BB 1BZ7A 1UXWA 2CUMA 2NNAA 4R4FL 3EGSA 2NQCA 1HHIB 4JPKH 3UEZA 4DZ8A 4WV1B 4OLYH 4EDXA 4RMUA 2YPKA 2F58H 2J88H 2C3WA 1MCQA 2PYEA 4LVOC 1FJ1B 4FN0A 1SJHB 3OR6B 3LKSA 3GMMB 5ACMA 4LEOB 4NQTA 3EOBA 5GGVY 1FVEB 4BQ6A 3VJ6B 3O81A 4XP6H 1P4BH 5I18L 4OT1H 5F6IC 5DJZA 3H8NA 3C08L 4XPAL 5DUBB 2RFXA 3CFJB 2EDYA 1B90A 1SBBA 2VLRD 4D9LL 5HTSA 3WXWL 4PRIA 1RZGA 4UMGA 2QADC 4R97B 5F97E 3P9LA 5C9JA 4D9LH 1L6ZA 3WFEL 2DOCA 1C7SA 1SYSA 4TN9A 3GSOA 4PV9B 1A3LH 5T1DH 4MD5A 2EYTA 4G7VL 1NAMA 4D2NA 5D96B 3PUCA 2BK8A 4O51B 2YD2A 4P4KA 4KK5C 4XNUH 1D5XB 2BNRD 4LSRH 5HI4D 1IKFH 4I8DA 3HZKB 3LEXA 5D7SL 3V4UL 4WW2B 3JSSA 3LQAL 3LCYA 1CE6A 1MWAL 4P4RB 2I5YH 4H20H 5CEZD 1F4YH 5IVXE 3QG7L 1YECH 2PCPB 2WSKA 4R96A 3REVA 1F4WH 1I7TA 1TDQA 1Y6NR 2DQIH 1TZIB 1FG2B 2P4AB 4JDVA 3WDHA 5E8DL 4OFDA 4PFEA 4MCYA 4HS8H 5EO9B 3Q2CA 2CDFA 2CRZA 3WIFA 5DJXB 2GK0A 3CXDL 3LD8B 4HLJA 4LNRA 3WUWB 4P2OD 4HS8L 3KPMB 4R9HA 3U79A 4RGOL 1ZANL 1WAAE 3GMOA 3AU1B 3UC0L 3MRKB 4P3CH 3SKOB 1JZ7A 4OZGA 2C4XA 4NZRH 3HE7D 3BD5A 4QGYA 1CS6A 4OGAD 2PTTA 4HX1A 3VG0H 5IW1A 3SE3C 2H2PC 2W0PA 1IJ9A 2FX7H 3TF7C 3MX0A 4F7PA 4FG6C 5EU6A 3C5JB 4YHNA 2QHLA 2GJZB 2CLVA 3NN8A 2BNQD 5CLTA 1D5MA 1CFTB 3U2SB 2DIBA 4JM2C 3WN5A 5DHVA 5C09D 2X4SA 3DV6B 5E94A 2OI9C 5KSBA 4XPHL 5HI3C 3NZHH 4LEXL 4PP1D 4NKMB 1JRHL 1OQOA 4N5EC 4J12A 1J05A 1T1YA 1G7JA 4X83A 1UB5B 15C8L 5I1JL 4HLZH 1HE7A 3CFIC 4WUUD 4DGYL 4N0RA 5TPWL 3V8CA 4CAGA 1LVEA 3ZYOA 5GJSH 3IU3A 1NGWB 4FTVB 3HZKA 2FWOB 4WUUB 5FUZH 5TE4L 2X1QA 4HKZA 5I19L 2VISB 4G7YH 4LPXA 1CFVH 4U1KB 1LE5A 4F80A 2VXUH 4XP5L 2AJVL 3KDMA 2NCMA 4LP5A 4HWEH 5L2KA 2NYYD 3IJYB 2ZPKL 5B21A 5J0BA 4OLYL 4GAGH 1MJUL 3WIHH 1CICB 1J10A 2BJMH 3W5NA 5BZDA 1QSEB 1WZMA 2AV7B 2BSTA 5DXWA 5FKAA 1X5ZA 3DX8B 3VFRA 4XTRC 1G7IB 2ZCHH 2AXFA 2XN9D 4U4BA 4LU5L 3QO0A 1N6UA 5HDLA 4YXKL 4K94C 1AGDA 1F11B 3GB7A 3QO1A 1NMAH 4JZOB 4LSPL 4N1CA 4S1DD 3IDIB 5ESVB 5GRYA 4NQCD 1BD2A 4ZNEA 5B38G 3P30L 2W60A 2VDML 3C6SB 5TDPB 4IOIA 2CGRL 3SKNA 2D7MA 2AABH 1NGPL 5I0DA 4Z8FL 4QHLB 5DD6A 2VUYA 5EZJA 3UJJH 3L5JA 3K2UH 3DRQB 5EORL 3WNOA 1O0VA 3AUVA 1P2CA 5CGMA 2W1NA 1NBZA 4Y19D 4YGAB 4XX1E 2R1WB 2QL1A 3N1FC 2ARJQ 5IW6B 1NFKA 1Q72H 1S8DA 2AV1B 4LPYA 3WJLA 2BOCA 3LS5H 5ITBH 1K8IA 3CUPA 4MA3B 3U30C 4XCNA 5IG7B 1TPXB 3QXDA 1KCVH 2EDDA 2MCPH 4IOSD 1MCEA 5D7IF 1WBYB 5GGTA 3TO4D 1BBDL 3VGHA 3MXWL 2C1PB 3ARPA 5CP3H 3FZUD 4N8CL 5C0CA 3P4MA 1IAMA 1RIHL 2BHUA 2EXWC 2IBZX 4NRXA 4AENB 3FQXA 3ZE2F 3CVHA 2IMNA 1G9MH 2ZZUT 3LS4L 5GPRA 5KN5B 3S4SB 4JVPA 4OFVA 4PJXA 4UDUA 3BPCB 1S7QA 4ZAKB 5D6DC 2P5WE 3QXWA 3UJIL 1ZLSH 4UV4H 1TVBB 5DA4A 4OZFA 3LRGA 1U8LB 3L3OB 4ODVL 5IB4A 3I02A 3O4LD 2X44D 5GZOC 3CSBA 2DDQH 1EHLL 2PKDA 5F89B 5HHNB 3IJSA 4F33A 4MA8H 4XPBH 2QJDA 5IK3B 4ONOA 2I9LB 2ZCLL 1WITA 2P5WD 4P2QB 4UQ3A 1HDMB 3L1OH 4M6NL 1P9MC 4JDZA 4QRTB 2H8PA 3JUYA 4YHYC 5J57B 2ARJB 1HEZB 1T20A 2ENSA 1MCWM 3C87A 4MAUL 1FZOA 4XAKD 4XCYA 1OARH 2YRLA 2UY6A 4YGVA 4IIQC 4ZXBD 3UPRB 3IAQA 4I3SL 4LAQL 3UYOD 1JYWA 1F58L 3W39B 3MLZH 4X4ME 3T2QA 3T1FB 3LHPH 3JZ7A 3RTQA 1CGWA 5FYJU 1DBML 1ZLWH 5GHWL 1U8PA 3MRRA 4FFZL 3QG7H 4TNVK 1KB5A 4S0SD 3SQBA 2J7LA 3HR6A 2X4PA 3KPRD 4DAGH 3ROOB 4JRXA 5IBLC 3KYOB 1WVZA 4KKLC 5IBTL 2YC1B 4JN1H 2BDNH 3PL6D 2RJMA 4I3SH 1I1YA 2FJFB 2EKJA 1N64H 3MRJA 4OF7A 2LAGB 1AY1L 2O93L 5KBNC 1HN1A 1YY8A 3Q6FA 5D6CA 3STZA 3EYOB 4LQFL 3MV9B 1KTLA 2F58L 2J88L 4K7PL 3DHJA 4Y2DA 5AG8A 1A5FL 1F4HA 1YEIL 5TGBB 5FO8A 2F74B 1K9TA 2CGRH 1G9NC 3F7PC 4QNPF 2DM3A 5F44A 2YPLB 4MA1C 4JJ5A 3K1KC 5B4MC 3N1MC 4JRYD 1TZGH 1RFDH 4ZD3H 1HHJA 2NY2C 3D5OF 4MA8L 4XPBL 2HN7B 5KVDH 4Z7OE 1NLDH 3STBA 2D9CA 4S1DC 2GYSA 1Q94A 3KJ4B 4Z95H 4F15B 2HRPH 1WC7B 2I60H 7FABL 3DHMA 3IJYA 1MHCA 4YDLC 5LJYH 3L3GB 1YYLL 4TSAH 5KSAA 4P4KC 4GSDH 1CGXA 1KCVL 3HE6B 4M1CC 4DQOH 1MEXH 4FG6D 3P30H 2BVQA 3U1SL 2K3TA 1P4IL 3EFFB 4KK8C 4ORGA 1E4XL 1SJEB 3HC0B 3KYNA 4R4FH 3M1BA 2DWDB 2XKNA 5CSZA 1QRNE 5KVEH 1B6UA 3U4BL 3UPRA 4HWNA 2RCSL 3QA3A 1FZMB 4I5BA 4JEGB 5EA0L 5F7LB 1IFHH 3KPLB 4Z5RA 4L5FH 2GCYB 2C4FU 2ZNWA 2AXGB 3FB7A 5L8JB 2EIBA 1MCDA 4OZ4A 2AGJH 5IF0B 4I0KA 1QFWH 2WUCH 1L7TH 2HLAB 5ENWA 1V3MA 2ZOLA 4P5MA 3RIAF 2D0HA 1Q9OB 3QZWB 1YPZF 5C0GB 4XHQA 1CFVL 3HS0B 4NOBA 1FVCA 1CDCA 2CRIA 3FQUB 2A38A 1RUKL 1PW3A 3QI9A 3SE9H 3UTZB 3KHOA 2EDRA 5C0CB 1W2KT 3F58H 2V7NA 1AD9B 1I1AD 3DURB 1IEHA 1WBXA 2E6PA 3OAZK 1JN6A 3K4DA 4V1DD 2WAHA 2NXYC 3BUTA 3IDXH 1J5OL 4QXWA 1D5IL 1T4KB 4XMPL 4UI2A 4M03A 4W68A 3K4AA 5I9QB 3IAPA 3MV9E 3MPCA 2VAAA 5ID0A 5IM7B 3QJHA 4I18B 1JMZA 5HHME 1F6AA 3NCYP 3ULUL 2VLLA 2C7UA 4KHTH 2K7PA 3ILQD 2VE6A 4M62L 3JWDC 5K9KB 5FO7B 1Q94B 2DM4A 1E28B 1LILA 3K3QA 5I1KH 4V1DB 2Y5TA 43C9A 4H0IA 4WCYH 5C0ND 3ARZA 1FORH 5IQ9A 4KDTC 4OCXH 3TP4A 2E8YA 5IV2A 1ZT7A 4FQXB 4G3YL 1T0NA 4L3ED 1JF1A 5TF0A 1EERB 1G9NH 2XG4A 1QR1A 3W0WD 2NZ9D 3C5ZA 2DQHL 2ITCA 5GS2H 2R2EB 4QRQA 4YNYA 4XNUL 1PG7H 5EZJB 1TNNA 2FL5A 1MCOH 2XA8H 3D25A 3ZSSA 3JVGA 1EEZA 1KOAA 2YWYA 2X4OB 3PWPA 4NWUH 1A3LL 1FFNA 4KROB 2FX7L 2KPNA 3NCEB 2X89A 4OFIA 2I5YL 1QSEA 4G9DB 3FFCD 1N4XH 1K2DB 1EDQA 2YK1L 2D7QA 3VXNA 4PRPB 1C5BL 5DDHB 3C5ZB 3V4UH 3E8UL 1RURH 3FT4A 2P7TB 4Q9BA 3WXVH 4LLWA 1MJJA 3UC0H 1NJ9A 4XCCL 1U58A 5EO0B 5GRJH 5IWLA 2DKSA 3C5ZD 3QISA 5IVOA 5JXAL 1S5IH 3T2OA 1P7QA 3QUMH 3MA7A 1KEGL 2VB5A 3SCMD 3RGHA 1U9KA 1J87A 3C8KB 3KNBB 3LKOB 1G7MB 1T7ZA 4PRHE 4OLZH 1E4KA 3W39A 2XKUA 5DWUL 4YXHL 1PKQE 1RUAL 1DP0A 1RJYA 2NNAB 1EHNA 4WCYL 4YGVB 3SDDB 2MHAB 5C0CE 1EMTH 2QQKL 5CGTA 5FFLA 5CBAB 1KJMB 3DUHA 1UC6A 3GI9H 4JO2L 1T2XA 1F8TH 3V5KA 4LSUL 2DIAA 4DK3A 1IGFH 5T3XD 3RZWA 3ALXA 1A7QL 2DICA 1OVZA 3ZTNL 5HHQA 2GJ6D 5KS9F 4M1CD 3R8QA 2VABA 4RZCA 3GKWH 5DQJB 4LAJH 2NX5D 4OLZL 4X80H 3QT2A 1A14H 3RVVC 3TM6A 5DZNA 1C12B 5FGSA 4JHAH 4PR5B 1WSST 1TQBB 1UA6H 3CX5K 2EDKA 3P4NA 5M95B 3E1F1 3P0YH 3FB8A 1Q0XH 4DGIH 3B9EA 1IAKB 5I1GL 3G5VA 1MRCH 1R3JB 2VC2H 4D9RE 5E7FA 3V6OC 1ADQH 5JW5B 4TULH 5EPMB 1UYWH 3K74B 1VSCA 3R0NA 3WLBA 4RA0C 3QCUH 2X40A 1SM3L 3MBXL 2AK1L 4LARL 4YK4C 2PR4H 2OSLA 3QWOA 3MA7B 1ZEAL 1EAPB 2HFGH 4LNRB 3LKOA 1KLGA 4U6YB 1PSKL 3VFWB 2J3SA 4BK4A 1AKJB 3UTTE 1MQKL 2Z31B 5IMOA 3BSZH 4GQPH 5LBSL 1RK1B 3BAEH 3VGAB 3W82A 5B8CC 3HG1B 3VW3H 4WI2A 4BSVA 2AK4B 5JPMA 2R8SH 1RU9H 4JRXE 2ADGB 1PY4A 1JGUH 1KC5L 4R2GC 3MV8A 2J8OA 1G6RB 3HPLA 1U3HB 3BZDA 1TXKA 3QDJB 5GSVB 3CFJA 2D3VA 5TFSH 4MXVE 5E8PB 2EECA 2NY6D 4PJ9A 4BM7A 2HG5B 1PD6A 4ZUSA 4RQQB 4K9EC 4QHMA 1BJ1H 1MFDL 1KIPB 3B2UC 5DJ0A 4QYOA 1W0VA 1QEWB 3NA4A 4FTVE 3RVUD 2EDHA 4G9DA 4DGYH 3HA0A 2RQ8A 1G9EA 4Y5XB 3ZHKA 4JPIB 4GXVL 5C0AE 3BKCL 5K9JH 3W11C 3HUJF 4D0BA 1OAKL 3RKPA 2A6IB 3QJHB 1NSNL 5C0DA 2LU3A 4UT9L 1F6AB 3HG1E 2FEEL 4BFGA 3DVNB 3S98A 1QACA 3LEVH 4NJ9H 3SDCD 4S1QH 2F54A 2IPUG 4DN3L 4JRXD 1L7TL 1CTNA 1ED3B 5MI0B 4WUUA 1JGLL 4K3JH 4J3TA 2DJUA 1KC5H 1INDH 4M7ZC 4WV1A 3SGDH 3U1SH 5F1NA 4JO3H 5CJBA 3SGKC 5FO7A 4HXBL 1AE6H 3BP7A 4WO4A 1YY9D 5T3ZD 2AJSL 4PJGF 4JCLA 1L9NA 4K7FA 4HW6A 1ZK9A 2MQ3A 1TVHB 1U8QA 3FT3B 4U05A 3DIFA 4NFDA 5BS0D 2MKLC 3NMEA 5INCB 3EHBC 5FYJH 1X5HA 1G7PB 1AXTL 1OB1B 3GIVB 2YD9A 1ACYH 1NUGA 4G6KH 5C6TL 2HTKD 1FO0L 2I9LA 1K4DA 2BP3A 1MF2L 5IJKC 1CD8A 4HAGA 1KJ2L 4NKIH 1WQVT 3ZE1E 2W9DL 4DGIL 3QA3B 4NN6C 2EE3A 1FIGH 4NQSA 2AAVA 1W8OA 3CZFB 1KJ3L 2VLME 12E8H 3L3KB 2HWZL 1HYSD 5CD3B 4O02H 5C8JA 3OXRB 5I74C 4XZUA 2C26A 3DWTA 1WWCA 1G9MC 5DJAA 4XMLL 5ID1A 4EUPB 4O58L 1DN0B 5JIKA 4LLMA 2Y5EA 4CW1B 1FC1A 5D4QA 3GNMH 3S37H 3MJ8A 3IS0X 4LLUA 1RZIB 4LSUH 1P4BL 5DRNA 1QO3A 2GTZB 3GSRA 3IFOA 1C1EH 1WLHA 1I1FB 1NLBL 4ENEC 1YEJL 3IKCB 4FQLL 3CFEA 5E1AA 4K3DL 4LCWD 3X3GL 4EI6B 5KVFH 3QEUB 1MNUL 1OD7A 1XMWA 5FYLH 3GGWB 1IAOA 4Q9RL 5TH2B 3OMZA 1GL4B 3KLAA 3RIAK 3VXSA 4HAFA 5CJQH 3L7FA 4PJDB 5HGHA 3WNMA 2YD6A 3B9VA 3MLZL 5TDOA 2YPVL 4YDIH 4KKAD 5DQ9A 1MPAL 2CKBL 4U3CA 4AIZA 4XCCH 4S1SH 2V2WB 3OKEA 3C6SA 5EIQA 4LDOB 3DVGA 4PJBF 5DQ9B 2CR6A 3O3DA 2PYEE 4RIRB 4U0QB 5ESAA 1CDYA 4NN7B 1N4XL 1NANI 2DTML 4LKXA 1T0NB 4M48L 2R2CA 4HC1H 1SEBA 2E27H 5SWSD 2WWMD 3SKJL 2ADFH 3QDGD 4OCRH 3IRPX 1JMXA 3EDEA 1TTUA 2EXWD 5D1QC 3QIUC 1EFXD 1U3HA 3GI9L 2D7TH 1KPVB 3T8XA 4NQXB 4BH8A 1UVQB 3MZGB 4G80A 4F37K 4BSWA 3QIWB 5LXGH 3LKRB 3OJ2C 1HHIA 2VLLB 4RBPK 4NC0B 3HG1A 5BZWB 4Y89A 5HY9B 4E0RB 1RUAH 1JWMA 5E8OA 3R4DA 1RIVH 3T0XA 4JZNA 2DTSA 2NW2A 3RTQB 3E0GA 1S7VB 5I16A 4XPFL 1VFUA 1CF8H 5H8DA 4JY5L 3IETB 4Z7NE 1IEAB 1EFXB 4Z0BH 3HR5A 3SGJA 1U8HB 3FOLB 3ARFB 5J12C 2OJEB 1NAMH 4PLNC 1SEQH 3BHBA 1YNKH 2YHGA 3KYKL 3NACL 5DQJA 1AGBA 2V7HA 3EJYD 1T66D 1BQHB 4Z8FH 2P48B 4X6BB 4LFHD 3BEVB 4X6DA 5FHBL 5HHQB 4D9RD 1ACYL 4Y2OA 3UTTB 2HFTA 1FL3B 4LLAA 4RFNB 4L4JA 3BQUB 3DUSB 3SOBL 1KTDB 2Q20A 1P7KA 1T7YA 1HZHL 2C4FT 3KLHD 3RVUC 3SE3A 1A1NB 1AO7A 4WW1A 4BJLA 3FJTA 4YO0A 2BNQA 3OX8B 4M5ZH 4HIHB 4X7SH 4UTBH 3M07A 1JP5A 3D3VA 4HS3B 1B4RA 1UCBH 5F1NB 4NQEA 3C8KA 3L3IB 3QIBB 1MLBB 5JW3H 4ACPA 4M8QB 4ELKB 3GJFK 2DQJL 3GSQB 4U2YA 1A9BB 4OZFH 5E6YA 5KN5A 3H3PH 4UILL 1RZKH 4JZNB 3C9NB 3VXQB 1YEKH 1BJ1J 2FIKB 1IKNA 4U1JA 1J12A 3CXDH 2IJ0C 4NPYB 1YEHL 1UVQA 4NT6A 1KULA 1LE9B 3JTTB 3Q6GH 3BYYA 3HHRB 5FOBB 1S3KH 3O2WH 4N0CD 3U4EA 3EJYC 4ODUA 2C1OA 4R97C 1LO0H 4HUUA 4X0KA 3CDGB 3IGAB 2ICCA 3QIWC 4N0YH 3VXMB 2C3XA 4GKNB 1EHAA 1PSKH 2DI9A 5ICXA 3O6MH 3MXVH 3BO8A 2YZ1A 3UTSE 1MRDH 4M7JH 3VXMD 1Z2KA 2DQUL 5I2IB 1OP3K 4EI5B 5ITFA 1QRNA 4WI6A 3MNZB 2YEZB 4AZ8A 1U8JA 4PRID 4V2BA 3LQZA 5AUMA 4UZGA 4LSVH 3GI8L 4O2EB 2P8MB 3DO3A 5E2UH 4WV1C 4IRSA 1FZKB 1AY1H 1YMMD 1ZHBA 1O7SA 1MPAH 4JN2B 4HQQH 3BI9X 2BNUA 1DBBH 4L8BA 1F4AA 3S7GA 2X1XR 1V7NH 3HC3L 4EIZC 3BH8A 3IU3B 4ODHH 3O11A 5ACZB 2NY7L 3WMSA 4KMLB 4H5SB 2RGSA 4P3WA 4NRYA 3WJLC 5CUSL 5H2BA 4D3CH 1DBMH 3UROR 3EO0B 1XF2A 5B39G 5DJYA 4H25B 5EFIA 4FFWC 3IFPB 2HKFL 1BFVL 1QLEL 4GW5B 5GZOD 3QCTL 1Z5LB 3EW3B 2VDOL 1DE4B 1F90H 3WHXB 4P23D 4NO3B 4KK5D 1CFTA 4WHCA 3RVWD 4HC1A 4XNMA 4KV5E 1UB5A 4O58H 1N8ZA 1A14L 3L95B 3C5SA 3IJSB 1EFQA 2A6JB 4UIKH 5KSBF 5D7SH 2FHCA 5F7HA 1KFAL 3C5SB 4PJ8D 1U8LA 3L3OA 5IB4B 4DKEL 3HS0A 2DYPA 5D6DA 3WD5L 4JPWH 3FOMB 1KEML 4H88H 1FIGL 5I30H 4P23B 4NKOB 2J2ZA 1NBYB 4TUJA 1B0GA 4FNLL 4MB5A 3WUWA 5B22A 5BQ7B 2CDEB 4Z7VF 3REVB 4HHAB 4MB4A 3BEWB 1AI1L 2AI0H 4U1LA 3SY0B 5KSAB 4JDVB 2CK0H 1R3IH 1YEGH 1FNEB 2OL3A 2Z92A 3C60A 1A4KB 4LSSH 2XN9E 3WUWG 3LKRA 3D39B 2LTQB 1J0ZA 4XBGB 1TTFA 5ACZA 5I18H 5CAYB 5L9DH 3WDJA 3N1GC 1CLZL 1SJEA 1Y0LA 2E8ZA 3QIUD 1ZLUK 3ARGA 4ISVB 3NBNA 1QQDB 5J1AB 3C09C 3VFPB 2QR0A 2V2TA 3EYUL 3D48R 4ZS7H 4FQCH 4HXBH 3BJ91 2FECI 4WUKH 4PJBA 4P9HC 4RDQF 3VFTB 1PVHA 5JIPA 1BWMA 4HUUB 3L9RB 4X0KB 5DTFB 4PRIB 5FA4A 1QRNB 3UYRL 4Y4HC 4NN7C 2VLJA 4EXPX 5BV7C 2OXHA 1N5YH 5EU5B 3RDTC 1OAZL 1ZTXL 1L4IA 4MD5B 4UT9H 5JHDE 2FL5B 5HGHB 5FCUL 1A1OA 4OCSH 3ULUC 2B4CC 2JJSA 4X98A 1KB9K 2EE6A 3GRWH 3G6AB 2QSVA 4GXVH 3DROA 1HQRB 2CRMA 3GSQA 1AGFB 3DYOA 1X44A 4KPHH 1AIFB 1QSED 1Z3GH 1NCWL 5IQ7L 2XY2A 2FYYA 4X9HA 1BBJB 3BH9A 3MOBL 4EDXB 1CICA 3SDAD 4KHTL 2FIRT 2OTUA 3O6KH 2XQYG 4ZUWA 2FIKA 3MJ9L 3RAJL 5GZND 4FQ2H 3OJMB 5I1EL 4ODWA 3QFJD 1FFOB 2UZYB 2X9YA 4TSBL 1QPXA 3PG2A 3U46B 2IANE 2ZUXA 1U3HC 3SGJC 2XQBL 3REWB 5KTEL 2APBA 3L3IA 1RSFA 4L4VD 2IPKB 4J3XA 3L3DB 1I7ZB 4MJ4A 3D9AH 5JHLH 1W72B 4LGSB 3OB0K 3MO1B 1EZVY 3O8XC 5DK0A 4PTTA 5IB5B 3BPOB 1XZ0B 1OQXA 1YYLH 3F7RA 4TSAL 4XP4L 5CZVH 5I74B 3PGFL 1NCAH 5B38B 2E5EA 4XTRD 1X4YA 3VCLA 4FA8A 3UTOA 4U1NB 5E9DD 3WN5B 3MBXH 3HR5B 3VXUA 1T89C 1V8HA 3UTTA 3TFKC 5GGQH 1CFQA 3MROA 4LCUA 2GJZA 4C55A 5ENWB 4FMKA 2VC2L 1UM5H 5B38A 1CK0L 1PKQB 2AP2A 1JWSA 2BNQE 5E9DA 4OZIE 1A6UH 3HE7B 4YIQB 2P8PB 2H2SD 1M7XA 3DX7B 5E6IA 3OKOB 4MNQD 2HJLA 5DUPL 3ARBC 1G7LB 2CO6B 3Q3GB 2HVKB 1HH6B 5HGDB 1NDMA 2LABA 3BH8B 1K8IB 3CUPB 4MA3A 4RGNB 2GTWB 2R56L 3KG5A 3NCFB 1VFOA 1JGUL 4YHKH 4G5ZL 4WDIB 4RAVB 3DVIA 4MZ2A 5HHOD 2ZUTA 2XY1A 3IFNL 2AJVH 5E8OB 3VXRA 2MHAA 3TBWA 4U6VL 3MRNB 5CLWA 5L0QB 5J1SC 4MMXC 4Q58C 4Q2ZB 3DMMB 2P5WB 3GMQA 1RFDL 4I0PD 4R26H 2YPLE 3SDAA 1EEZB 5D5MF 4NQDB 5BXFB 1JPGA 2PO6D 3OAZH 4WY7H 4K3EL 2H26B 3UTSB 4GT7A 5FUOL 1R3IL 1YEGL 2ZSWA 4WFFE 1U8IB 3GM0A 2DLTA 5JUEL 3SJVE 2ZSWB 4WUUE 1Q0XL 3MJ9A 5E8PA 2GI7A 5MP6L 3QUML 2WV3A 2BXZA 2QTEA 1FG9C 1MFBL 3SDAB 5AZ2L 1I7RA 2CD0A 4IRSC