1P84J

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EVKLQESGAGLVQPSQSLSLTCSVTGYSITSGYYWNWIRLFPGNKLEWVGYISNVGDNNYNPSLKDRLSITRDTSKNQFFLKLNSVTTEDTATYYCARSEYYSVTGYAMDYWGQGTTVTVSSAWRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2003-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p84J00
2FX8H 3SDAA 3ZO0A 4R7DA 4OB5H 4ZTPH 3H2WA 1EBAA 2V2XB 5I8EA 1DQQB 2BCKA 5DRXB 4I48A 1Q0XH 1JPST 1A7OH 4WUUB 4YHML 1F4WL 4FFYL 1RZJH 1XGPB 4L4VA 5IR1B 2C7UA 2NXZC 4KZEH 5F1SA 2VXVL 3L5WA 1H8NA 4PLKD 2UZIH 1U42A 2CR6A 4RNRB 5CJBA 1A1OA 3ARBD 3D3VD 3NIFF 1MQ8A 1UCBL 2DQUL 3O81A 2HJLB 4KK8D 5GRJH 2E5EA 4TULL 4U7KA 4XBPB 2VYRE 2EDBA 2FX7L 2BY2A 3KXFE 5HHOA 2J4WH 1JHTB 4OBRA 3MRQA 5FK9B 1LK3L 3UZEA 3LD8B 4GRWF 1JMXA 1WAAE 4ALAH 1MRCH 3PV6A 4YUEH 3TYFB 3STZA 4B41A 2VLRE 1OQXA 3G5XB 5I8CB 2DM4A 5I74C 1WBYA 3RVXC 5DQDL 2UWEA 4OD1L 1BLNB 5GSRB 3MRQB 2AEIT 4EN3A 3QUZB 4IRJC 5HSFA 5DHVA 4YFDB 4RAVB 3TBSB 5FF6B 3TBTA 4HS6A 1RD6A 3SKOA 3BKCH 3WIHA 2R1YB 4ZUWA 3QI9C 1U95B 3VRIB 2Q8BL 1HHJA 1KPRB 1IZJA 2XRAL 4CU7A 5GGRB 4JHAL 2W60A 2AQ2A 1FYTA 4GXVL 2EDQA 5ESAB 3IKCB 2OZ4L 2R1XA 2V2TB 3HUJF 3VXMB 1UKTA 2Y5EA 4YO0A 3BW9A 2C4FT 4NUJA 1ZLWH 3FAXA 1REIA 5M94B 3OKOB 3GMNB 4PP2B 1XGYH 1N5AB 3FN0H 2XV6B 5E9DD 4ZUTB 1HH9A 5T3ZH 1H3GA 5HY9B 3ULVC 1KEMH 12E8L 5BVJB 2OYPA 4NJAL 3IFOA 3LQAL 4G8GE 2DQEH 5J8OA 4LSUL 1CR9L 1QHPA 2CDFA 4JDVB 1KJVB 3TVMD 3QFJD 3UTQB 4X4XA 5GS1B 4K8RL 4PJHE 4AT6B 2YOCA 5DLML 3QR2A 4X6DA 3GSXB 3RWEB 5C0RL 4MZ2A 3ZMRA 2HJKA 3GIVA 4YEEA 1CG9A 2CJUH 2HTKD 3ARTA 4MWFB 1QR4A 3T0EC 1PYWB 3PWVA 4NHUA 4WW2A 1UC6A 3BGMB 5EOQH 3WLBB 2ITDB 3U79A 1T1XA 1Z6JT 1BIIB 2OI9C 3BIKA 3OL2A 2E7LC 1ZSDA 4Q74A 4RMVA 2Y7QB 5E9DE 3GSRB 4B5EA 5I66B 4I3RL 2B2XL 4XGZB 4PY7B 5D93B 2VMFA 1XIWB 3PWVB 2MFNA 4NHUB 2OCFD 3SKJH 4F37F 2ADIA 2NY1C 5C0RH 3Q5YA 5ALBL 3ARDA 1X5KA 3KLDA 3DVNB 2VSDA 1ZT7B 4WEBL 5D6DA 1OARL 3VMNA 4QCIA 3ES6B 2VDRH 4QWWD 5L6YL 2EEBA 5I1AB 2WWKT 3QEGL 4QOKE 3VGFA 4RCAA 4GAJL 4XZUB 4P2YA 1YY8A 5HI4D 2NW3A 5B3JE 2JIXB 5MEPB 2X4NA 2VZ1A 4P46D 4HKJB 1SEQH 3KPLB 5HPMB 4ZXBD 4U1IA 4N1HB 1YMMA 1AI1H 3GHBH 1V3MA 2ADGA 5ALCH 4M7LT 1H8SA 4GQPH 3HNTH 1BVLA 2X4PA 2XKNB 1EO8H 3WE6A 5T5FH 4XBGB 4LLMB 4ODUB 2A6IB 3GSQA 4LIQH 4OLZL 4KHXH 3ALPA 1MFDH 4NJAH 2HKFL 4Y89A 3E3QC 5KOMC 1TCRA 4LOUC 4DGIL 4XNZC 3JV5A 3VWKB 3QO0B 4JANA 2IPTH 4X98A 4F58H 2X40A 5EIQA 2J8HA 1MY7A 2J6EL 5EU4B 3U2SA 4Z7VA 5C0IA 5HDQL 4OLXL 5I15H 2Y6SD 4DWHA 4JE4B 3EYVB 2WP3T 3QIUC 3EYOB 1QFHA 1G7MB 4RRPA 2HVJB 4KV5E 3LS4H 3SE8L 2X4UA 1HDMA 3W9EB 1FZKB 3BP6B 5SX4H 3UTPE 3V0AC 1HHIA 1EAPA 4S2SB 4I0PD 3D48R 4NBYB 1BGXL 2FYYB 4YC2B 4ESKA 5DYOB 1DN2A 4KUZL 2AXGB 5HHXH 3SHSA 2DTSA 2L7UA 4NC2B 1LDSA 1NLDL 5AD0A 5I1LA 1JHTA 5C07D 1NCCL 3WXWH 5HHPA 2ZUTA 3H0TA 1P84K 1I8LA 1CFVH 2MCG1 2DWDB 2EXYD 2ESVB 3ESUF 2YN3A 1OM3H 1S9XB 2OXGA 5EH1A 4OLUL 4WEUD 3SDYH 3SJVD 3U30B 3FB8B 2IFFH 2DLHA 4LVOB 2DIBA 1CDJA 4CVUA 1KIUA 4P2RE 2BXZA 1SYSB 4P2QA 4G6KL 3RA7H 3MZGB 3K1KC 1IGML 2VLKD 4Y2OA 1SBSH 4PTUB 2BNQB 5AAMA 3RVWD 3MBEB 4LHJB 1IT9L 3UBXI 1CQKA 1MHPH 1I3GL 1PD6A 1CS6A 3KYOB 4J7RA 5DRWA 5EN2B 5K9QG 5JZ7C 3SGJA 3IAGC 5CFHA 1KLGB 3FQRB 4GLRH 1NLBH 3JUZA 4M5YL 4U3XA 5F9DC 6FABH 1G9EA 5DFWH 5D9SA 1KFAH 3QQ3A 3VMOA 1H0DA 2H9GB 1XR8A 3WNLA 1LP9F 2MPAL 2J6EH 1A6PA 1D5MA 3BD5A 3RWHB 1PEZA 4XAKD 1X5JA 1N0LA 1JF1B 3P30H 3A6CL 4MCYA 3OB0H 2DQDL 4HH9B 4HGWB 1V5JA 4LGRB 3MLWL 5E6IC 3MRLA 3O8XA 3UJTL 1AGBA 4ZXBB 1JN6B 3VI4E 1J1PH 2P44B 1KXQE 5AYQA 5MI0C 2ERJB 3O3DA 2H2PC 5FO8A 5ICXB 1FNLA 3H3BC 5L2JB 4WUKH 4XPAH 2IFFL 1Q94B 5I75B 3C2AL 1JPGA 2R69H 3DO7A 1G7QB 4PJXE 4I0KA 3U83A 1UEYA 5HYJD 4M7JH 3GSNL 5GSVB 5C0AE 4OZGA 4NQSA 2YN5A 1AIFA 1IAMA 1TCMA 2DI7A 1OOAA 1WBXA 4Z0XA 1KEGH 3MROA 1FPTL 3MX0A 3VFOA 1VACB 4GRLC 4U49A 4OB5L 4HX1A 3P9MB 4QCIB 3HAEA 1RY7B 3K80A 3OB8A 1LEKB 1WFTA 1DBBL 1QVOA 2VUYA 3OKMB 3RWFA 5EN2A 4LF3B 3WSQL 3T4YA 4S1DC 2DQIH 1NGXA 3VXOB 4DOHB 4KRNA 2F15A 3IU3A 4C56D 3MRRB 2X1XR 2GCYB 3DGGB 1MWAB 4FP8L 3QUZC 4IRJB 3CFBA 3MGAA 3MRFA 3RUGF 3QFJA 4G9FE 2VDMH 4WEMB 3T0EE 2G75A 4LCUA 4DJMA 3KPSB 4UNUA 3FFCB 5K9QI 1IM3B 1H5BB 2E3VA 3VWJB 2BSSB 5AD0B 5I1LB 4LLVB 2AJXH 2DLEA 2Z91A 3MA9H 5C9KA 4EJ1C 1F4HA 3BKML 3TN0A 3IJHA 2W9EH 3AAZB 5GIRB 2GAZB 3GJEB 1MVUA 4HCRH 3TFKD 1QTYT 1KLUB 4FFVC 1A7OL 3KLAA 1S7UA 4PGBB 3GSNA 2FATL 3DARA 4YFEA 2DJSA 4UT9H 2YD9A 3O3EA 4EBQL 5DFTA 5HGDA 2B0SH 5IM7B 2QQQA 4U1GC 4PJIB 2BOCA 2I25N 3TA3C 3W81A 3ZE1E 4ZFZB 1F00I 1KJ3H 2E7HA 5HGDB 2BNQD 4LCWE 2WLZA 4I0PC 4EI6A 1ONQA 3RZCB 5CINL 3SDXA 4BUGA 4M6OH 2IWGA 4E42A 4UNVA 1JNJA 4NCC1 4LIQE 2QHLA 2BNRE 5LAXB 4PJAF 3IDMA 4W70A 5I73C 2XY1A 5HDBF 1YNTA 1LP9E 1Q9WB 1T21B 2SEBA 5D5ME 3L3OA 5DEFA 3MRGB 3OJMB 1FYTD 1R3JB 1J0JA 5KBNC 4Z7OE 4R4NC 3RVTC 1HOCB 4PRDB 4QOKB 5FA3B 2MNUA 3QFJB 1FL3A 5CD3A 2PYED 3BEVA 3DYPA 3T0WA 3V8OA 3WUWG 4TTGA 5ICZA 3RUGA 5EORL 1T22B 4WW2C 1TQBC 2DJ4A 1J5OH 1FNEB 1EEQA 1OVZA 1AGDB 3O4LA 3KPQB 1HEZB 1P7KA 2HT4D 1P7QA 4W4OA 3BN9C 4PTTB 1G6RH 3HAEB 1T1ZA 1AHWA 3VI3F 5C92A 1KYOJ 2DL9A 2C3HA 2O5YH 5DMGC 4K94H 3FQXB 5E8OA 3ULUC 4Y5YB 5F7NC 3WCYA 1SJEB 3IDXH 4GAJH 2CXKA 5GZOC 3T8XA 1U8PA 1PG7W 3IF1A 4NP4H 2CIIB 3O8XC 4OZIF 1CTOA 1XZ0A 2NXZD 5DRZB 4U1KA 3BJLA 1IC5L 2DDQH 3QIBC 3KPRB 3Q6FB 3TT3L 3JV0A 4M1GL 3UTPD 1JGDB 5DQJA 2YMXL 3RU8H 5FKPB 4U6HB 4BH7B 5SX4I 3RAJH 4LLQB 4PRHB 5JW4N 1MAMH 4PJCE 3MRKA 3QSKB 4PD4J 3NVQA 1NCDL 3DUUB 3PV7A 3KJ4C 3QWRA 1Q9OA 2FLRT 4P59H 1SEQL 4JQVC 3H9ZA 3IFOB 2VDLL 3HCVB 2H1PL 3SDAD 5I1JH 3REVB 3U9PL 4HFUL 3VWJA 2YUXA 3G08B 1RIVH 1V7MH 3T04D 3VFWA 4V1DD 4PV8B 2C4FU 2R2HA 4XMKH 4YNYB 4CU8A 3KLHC 4HUVA 2M8XA 4JFYA 3BVNB 5BW7C 1JMZA 3ARQA 3G6DL 4J4PC 3BH9B 3CSGA 3QIUA 3QDAA 4JM2C 1E4XL 1AD9A 4ZPVB 2QJDA 2GCYA 5K59F 5DRNA 1S8DB 1YPZB 4DGVH 4U1KB 1ZGLA 3RZWA 4M6OL 1MFEH 3U9PH 5B22A 2VR9A 3JBG7 4D8PB 2I60L 2FR4A 4LF3A 4PJ5B 5IB3B 4OGYL 1MEXL 4UMGA 1HKFA 2C3XA 4M7LH 5CILL 2DQJH 3QQNA 5TE4H 3HPLA 4LCWD 1UJ3C 2G5BB 1P1ZA 1GHFH 1KULA 2IANA 3I6LE 3U0PB 2MHAA 4UT7H 3D18A 2A6JA 1JPFB 5EC1A 4HK3N 3X3GL 3TBYB 5EO1B 4NGHH 4HIXH 1IGCH 1ZHKA 3QEHB 5C0JA 5D7JD 4OQTA 3ETBF 4U6YB 1YMME 2CRYA 4DGIH 2UZXB 1FYHB 2M2DA 3ZE0E 2GSGB 4Y4FB 2E9JA 3TT3H 4QEGA 4QRRE 1G7HA 2HTLD 4K94C 3ULUH 5CIPH 2A6JB 2D7MA 2VDNL 1IAIH 1I7RB 2MKWA 5BRZA 3QXWA 4CDHA 1QSED 1EXUB 4JO1L 1YC8A 1ZA3A 2EDDA 4JLRA 1FBIL 3DTXA 4DN4H 4EI5A 4QRTA 4QF1B 5FA4B 2EYTB 2P8PB 4XWGL 3QYCA 3GHEH 4L29A 1BGXH 1ZGLB 4L29B 4N0RA 2Z92B 1K8DB 4HZAA 1QEWA 1PZ5B 5I8EB 1T5WA 5DRWB 3K4DA 3TO4C 4PD4K 1ONQB 4XMKL 4CW1B 3SE9L 1A4JB 5AG8A 1XGPA 1RIHH 2PXYD 2W0PA 2YMXH 2NY0C 4XPGH 2WAHA 4WI9A 1IM9A 2ILLA 1RU9H 1WTGT 1CFQA 4TSCH 3JV6A 4K3DL 3UJIH 1IKNC 4TNVF 5C08D 3NA4A 1WQVT 2ICWJ 2UUDH 5KAQG 4DVRH 4PGCA 1CN4A 1MHHB 5I8CA 2D0GA 1JE6A 3MOAH 3SE9H 4X5XB 3WHE0 4M7LL 1LQSR 5CILH 1R3LB 4YHLH 4EUPA 4HXBH 5GGSY 4F15B 3IDNB 3O6MH 1T1WB 3I3BA 1RZIB 4YDKL 2BVPA 3TC9A 4MDIB 3PWJA 2ADJA 1RIUH 4C55A 1ZLVH 3V52L 5IB1B 3IDIA 1AQDB 1YPZE 2HG5B 2YSSB 2UZYB 4DCQB 4KC3B 2C3WA 2AEQL 4Y4KD 5E5MA 3HZVB 1P5VA 3OJVC 4D0CB 5C0ND 4F58L 4GG6B 1YEKH 1NBVL 5BS0B 5IHZB 5IT2H 2BOBB 3O9WB 3BGMA 3KPMB 5F70A 1R5VB 5E4IA 1L6ZA 1ROWA 4WRLA 4PTTA 1EFQA 1JGVL 1I7TA 1KPUB 4Q9BA 5IEHA 4GW4B 3MA7A 4WHYG 4L4JA 2CLZB 1C12A 4FN0A 1XFPA 4QHNA 1ORSA 1AXIB 3OQ3B 4IMLA 2W38A 3SKNB 2NY6C 2OTWA 1WT5A 1FZJA 1NBVH 4IBLT 2VN4A 1U8QA 3ZTJG 3PHOA 1E28A 2IG2H 1ORQA 3L3JA 1A14H 4YHIB 4NNXA 4MLSA 3QEQA 4IRSB 3B9KA 5FO9A 5L2KD 5KG9B 2MOVA 4JQVA 1ACYL 4GXUM 4JFOA 1INDH 3D2UD 4LASH 4QHUA 3SJVA 2X4SA 4DTGH 5B8CB 5C09D 3CMOL 3VWJC 3CCHB 2FBJH 2EIZB 2J6EA 5GJSL 3FQXA 4WU5B 1U95A 3V8CA 3TN0D 4BSWB 1OL0A 1Q38A 2XWBB 4JO2L 4PJ8D 1HEZA 4N8PA 1U3ZA 3I2CL 4QT5B 1T3FA 5I1IH 3GGWB 1FCGA 5CZVH 4MB4A 3EDEA 3G6JB 1GOFA 3DV6A 4YDJB 3BHBB 5CD5C 1E6OH 3GRWA 4KRLB 5C9JA 4NFBA 2B1HL 3PGCA 5IFJB 32C2A 4KUCF 2A6KB 4KMTL 1B0RB 3RTQD 5FA3A 4C58B 3WFDH 3HE7B 5IJVB 3T1FA 4L9LA 43C9A 3QDHA 1IFHH 1HINH 4U05A 1LP9B 3IRPX 1P7HL 4LLUB 4UDTA 3ARUA 4HUWB 4LVHC 4DFHA 3VRLF 1FGVH 4X6DF 4K94L 1I1FA 3H0TB 4GS7B 1JNNH 3NIGE 2GFBB 1AHWC 3HZMB 1QR1B 4N0CC 1L4IA 1A0QH 3ARSA 4ZFOA 5JTWA 4JFHE 1NUDA 2BVYA 4EN3D 5I1KH 2A83B 4JO3L 5E8NA 3QHFL 5D71H 3UJTH 4IMKA 1BVKA 2GSIA 3C5ZC 3SO5A 4PJIA 1E4JA 1YEFL 2O93L 2HFEA 3HI6L 4G8FA 1BECA 2DKUA 2ID5A 4CU6A 4FXKA 5CKGA 5C3LD 1LO3L 5DK2B 3G04B 1MJ8L 5GGRA 3TCXA 4PRID 5SWSB 5FGRA 4JZJC 1F3JA 3O0RH 2VXQL 4XC1H 5ESVA 3VXUD 3GI9H 2R4RH 3T77B 4GH7B 1TZGL 2H45A 1HE7A 1ORQB 4LSRH 2P7TB 5GRUH 1RZJC 1JK8A 4PREA 3QEUB 1J1XH 1CLYH 1M6OA 4DFIA 2DJUA 3OG6B 5KSVB 3MRCB 3PWNB 3J7HA 4TRPH 3UBXG 4UDUB 4XBEH 2WANA 1MFCL 3FOLB 3GO1L 1MJ8H 35C8L 5F9OL 4Z7UB 2VC2L 1R3IH 3ULUL 3KPLA 4HFUH 2WBWB 1PLGL 4CJ1A 3BH8A 1W72A 2OXHA 1ULVA 3BAEH 5JUEL 1OTTC 3BD3A 3DMMD 2WUBL 4K3EL 4K3JL 3R1GL 3X13B 1IC7H 5I66A 3PP4H 2VQ1B 3L3IA 3TJHC 1JWUA 2PKDA 5D2NA 2QEJA 2C7UB 5DHYA 2GITB 2YBRA 2EYRB 3SPVB 5GS0H 1F3DJ 1I8LC 4M9PA 3C8HA 4PJ9D 5TDPB 2YK1L 5HGBA 4S1SH 4UV7H 5FEBA 5IWLA 1INQA 1X9QA 3BDYL 1W0WB 5LGHH 3FO1B 5JXED 1DE4A 1T2QH 4OFVA 4ZOAA 4XWOC 3S37X 4WDIB 1BQHG 3C5ZB 5C70A 1VSCA 3QP3A 5ESVB 4KUZH 3CVHL 4X4YB 2PYEA 1UXWB 4Y4KA 4PP2A 1RK1B 3QDGB 1KCVH 3PNWB 4RISL 4DAGH 2YZ8A 2OSLB 2DMCA 3D0LB 5D5MB 4L4TE 1OW0A 2Z35A 3JTSB 3PDOA 1TETL 3ZYOA 1B3JA 3L1OH 1TPXB 2VZ3A 3E0GA 3C09B 4FQXD 1SY6A 3PXHA 1J05A 5J9PB 3CFKA 5FCUH 3GMPB 1CGSL 3FQNB 1T83C 2GITA 4PG2A 2ICEA 2VE6B 4JR9L 1PLGH 1KN2L 4FFWC 4JO4H 4KI5F 2F58L 4TQEH 5E4EC 3T2OA 4P5MA 3CXDH 1PZ5A 2XA8H 1J0IA 1FV1A 4EOWH 3HZKA 4Y5XA 4RMSA 4Y19B 2NR6C 4MA7L 4PJEA 3VRIA 4D9LH 3EGSB 2PR4H 1SYVB 5DJAB 2J8UA 4YWGL 1F8TL 1LP9A 5EFIB 1JYNA 4U0RB 1GGCL 5C09E 1G7HB 1K8IB 1ZLSH 4P46C 2R2CA 1N3NB 4XCNB 1FO0H 3O4LD 1CTNA 4BK5A 5GXBB 4OGAD 1JRHH 2W0LA 5KSVA 4RISH 4DAGL 1BJMA 5CIPB 3ESVF 4JPKH 2BVQA 2DWEB 3QUMA 5ACMA 3LKSA 1NANI 4I0PB 3LB6D 3T3MF 3WKMH 5DD3L 2V2WB 5HJ3B 2HN7B 3P4NA 1CIDA 2DQEL 1S8DA 1UWGL 3PJSA 1ZSDB 4CMHB 5JHLL 1TXKA 1M7DB 2QV2A 5TF1H 3B5HA 3S97C 1DANT 4G8FB 2DTML 5GS2H 5SWZA 4R26L 3OAUL 1JZ3A 1X5XA 4LCCA 5E03A 3DI3B 2BCKB 3LEVH 2V9TA 3SN6N 1QBMH 4QRPD 4NQDA 5D1QC 3W0WB 1EUUA 4OD2A 4RZCA 3VFUB 4XRCB 5A3IC 2WSKA 5T1DH 1I4FA 4YBLC 1W72H 4PJXB 1S7XA 2P8LA 5KVDL 1G7IB 2HFTA 5DJYB 2QADD 3PHOB 2C1PB 3MLZH 3UYRH 3VXSA 5FGBA 5D7JC 3T3ME 5ETUB 5JMRA 4YK4B 3ARGC 3BP5B 4WGVB 4OJFH 1BF2A 2RJMA 4XI5C 2Z91B 4M7JL 4GJTB 4KHTL 3BPCB 3TA3A 2H3NB 4PRPD 3U7AA 3QDJA 4WWKA 5C71A 4D0BB 2W92A 1A6UH 3ZHKA 3FFCA 1NCBL 3OKNA 4PJ7E 4MAUH 2W9DH 1VCAA 1DEEA 3V6OE 3RWCB 3OXSB 4IHOB 1M7DA 2W60B 3IGAB 3FCTA 3WO4C 3SPVA 4OF8A 2DM7A 4X99B 2A9NL 5GHWH 1AY1H 2JB6A 2BXYA 3RY6C 4M7KL 4PRIA 3H9SD 2VZUA 4OQTL 3ULVE 2GI7A 1KCRH 1OM3L 2WBJD 5CJ5A 1GIGH 3IF1B 1MI5E 4XNQA 5ISZE 2ED7A 1AD0B 1NKOA 3L95A 2DQIL 1P69B 4YAQB 1MFBH 4NZDA 3PGFL 4XAWL 1LK2A 1XF1A 2VSCA 4XPTL 3F58L 1UWGH 4GBXA 3TPUA 4L1DA 1RZJL 3L7EA 3QAZB 3HC4L 2VZTA 1JNLH 3CXHJ 3KPRE 5IMLB 4OZ4B 1MIML 4PB9H 2GJZA 1P4LB 2VKWA 4GW5A 5HVFB 2R0LL 1WGOA 1KCSL 3UTZB 1UT9A 5I6XB 3FOLA 5C86A 3KPPA 1UG9A 1ITCA 1TJGL 4KTDL 2C26A 2WK2A 5HDOA 3MLRH 4P4KD 1AGBB 2CIKB 5D6CB 2AJ3A 1JWMB 4P2QE 4R4FL 3UTSD 2QSCH 1A3RL 3FL7A 5JW4Q 2F54A 5J6GB 3LV3A 4YDVB 3HNSL 3SO3C 2BRRL 3ZZ1A 5E00A 3EOAA 1TVBA 2R4SL 4Z0BL 5C8JB 2X09A 3KHQA 3MLSL 2DD8H 3GMOA 5F3HA 4KMLB 1MY5A 2J7LA 4PJFB 4Z6AT 1DQQA 3N0PB 4WFHE 4J2XA 5J9PA 1CGVA 1X5LA 2LVCA 3DIFB 4RGMB 4FXKB 5EOCL 4EI5B 5GRYA 4MD5A 2WIIA 1MREH 3UC0H 5KSBE 2DOCA 3Q48A 1LNUA 3IXAA 1ADQL 1EEYA 2R2EB 3LPWA 5D2LA 2CRMA 2GT9B 2Q3AA 2PCPA 1XGQB 2BSTB 3I50L 5EUKB 4GG6F 3ARRA 5GZNC 4U3HA 3RWJB 1CD1A 3MLTB 3L3GB 1S5IH 4OLEA 1ES0A 3LN9A 3QRFM 1QPXA 5H94A 2K7QA 4MNQB 3GSNH 3O8XD 5I8OH 1DR9A 3VI4F 4XC1L 2DL2A 3SDDD 1AO7E 5HHOB 1QLRB 5T3XE 2XZCL 4OAWA 3ZDZF 5GIRA 3KYMB 1OAKH 3KXFA 5HHOE 3FO1A 3STLB 1OWRM 2MQCA 2F8OA 3K46A 3VXUA 3IDGA 3GB7A 1NBYB 1OQOA 1UKQA 4JG0L 1RHHA 4QXWA 1FLRH 2WIMA 4I77L 4Q9RH 5EU6A 3KPSA 2PTVA 2XZQH 1J12A 3G5VA 1U8KB 4LRNH 3QHTC 1MH5A 5I0ZA 5FHAL 5INCB 3U46A 3CFCL 3MCLH 4OI9A 2YD4A 5TDNA 3ZTNL 4A6YH 5FECA 1CLOH 3VD3A 5KVFH 3RL1B 4O02L 4JFFE 4FOMA 1G6RB 4HX1B 4S1SL 2MTPA 3NTCH 3TV3L 2HVJA 2KL6A 5BZWA 1S7RA 1IT9H 4LLDA 4QHLA 1GSMA 5GSVA 3VXNA 2NLJA 4IRZH 5DTFA 4KAQH 3Q3GA 1GCFA 2FO4A 1HYRC 5INDA 5EU4A 2J4WL 5ISZD 1EBPA 3VFTB 2YA0A 3DXAB 1F5WA 3LPGA 4MHHG 1J18A 5DJ6A 1T80A 2P8MA 3P0VH 5C09B 3P0GB 3DUUA 1KJ2H 5HI3C 3UTSB 2JJTA 1NMAL 2BVUA 5DJ8A 5F6IB 3QEUA 3ULSA 3B9DA 2P7TA 5IK3A 5IW6B 4L8SB 1UADC 4HIEA 2H32A 2P8MB 5C09A 4L8SA 3MMEA 4Y4FD 4UUJB 4XXCA 1EX0A 5FCUL 4TNWK 1BJ1J 4G6FB 4JHAH 1KN4H 4Y19E 3RIFK 2QLVB 5DHVH 3AFLA 4K8RD 1CD9B 4GBXC 3P11H 3LEXB 3W9DB 3L7FB 1AD0A 4TVPH 2PR4L 3V0VA 1OGAD 4WU7B 2A38A 4J3XA 5INCA 2Q76A 5L6YH 3LOWA 2HP4A 4I77H 4S1QH 1IEHA 4FQCH 4KI5D 1KN2H 3T4AA 4K3HA 3VXSD 1GL4B 1AD9B 1G0XA 3IGAA 3UDWC 2GK0A 4OD3H 5I6XC 3HZVA 1HH6A 1HWGB 3CDGB 4P46A 2ZCHL 1HQRA 1EK3A 2Z93A 4O2FB 3B6SA 3RZCC 4PJAA 4FQXC 3LMJH 4UQ2B 4TVPL 1M71B 1FE8L 1IL1A 4Z7QF 2B5IB 5C0DA 3THMH 3O3AB 2VZVA 5BV7B 5J7CC 2JIXD 4NM4L 5EO9A 5HYQB 3VXUB 1FH5H 1IGFL 2H3NA 4OZFB 2PW2A 3T0DA 4WW1B 4KV5F 3VH8A 1FJ1A 4HJ0D 4GAGH 4LSQH 3ZKNC 5DJ0B 4JDVA 4P3DB 3CUPB 4RGOH 1LO4H 4K71B 3NCEB 4M43H 3KYKL 4LCWB 3OR6A 1LNUB 4DKDC 1T66C 2EDNA 2FX8L 4NKQB 1OP3H 4W6WB 4PJFA 2YZ1A 5AAWA 4R8WL 4OLVH 1I1RA 1MFCH 3BKJH 1BBJB 1EEYB 1H5BC 3TNNA 2EYTA 2DIAA 4OGAC 1NAMA 5DWUL 1AE6H 1ZT1B 1K8DA 5IQ7L 5A2FA 3DBXB 3GBLA 2O5XL 4ONFL 5CJQL 2OL3A 4IOIB 3L1OL 4I8DA 4APQA 1VERA 5IIEA 3Q1SH 4XVTH 5DJDA 1U3HD 3VCLB 3TEUA 5IHLB 1T20A 1DBAL 2G75B 4P4KB 4KHXL 3DRQA 1CFBA 1Y0LA 5EO1A 1Q1JH 3U7WL 2NW3B 4G5ZL 3DMMA 3SKNA 3TYFA 4NQVB 4Y4FA 2O5ZH 1LD9B 2IBZX 3CXDL 4Y7MA 3M8OH 4NT6A 1JZ8A 3CZJA 1T20B 2CMRL 3EDJA 4OZFA 4I18B 2IALB 1L7IL 1EDQA 2F53B 3QIUD 4JHBA 1N64L 1G84A 3MRNB 2HKHL 3IDJB 2MKLC 5DT1L 1N4XL 3FN0L 4G7VH 1OPGH 1FZOA 4XP4L 4KROC 4HUUA 1FNGB 3AS2A 2XFXB 1CBVH 1CZ8H 2NXZB 4JGUA 3MROB 3QO1A 2ERJC 3P3YA 3FO2A 1OGAE 1OGAB 2BY3A 3K81A 4HKZA 5C0AB 2QBWA 3UJIL 5GJSH 4UAOB 3NCYS 4AEEA 1XIWA 3PGDB 5DWUH 5JXEA 1E4KC 4X99A 3HKFA 3EDKA 5C2UB 2HYMA 2NXYB 1CD8A 4R90L 1NBZB 4L3EB 1JPSL 1MCOH 3HHRB 1S7QB 15C8H 2BOCB 4YQXH 4WI6A 5EC2A 1L0YA 1GC1H 2WMPA 4X5XA 4OAWB 1RJYA 3MODL 1KEML 3N85L 2JLLA 3QUZD 1GPOH 1H0DB 3FB7B 4PJCA 1JPTH 2RQ8A 3UTQA 1MF2H 2ENYA 4X4MA 5MEQA 3HS0A 1MRFL 4OF5A 4LQFL 2VDNH 4OV5B 1OTSC 2QQKH 4TPRH 2PXYB 3RJQB 2HJFA 3ROOA 1BM3L 3W39A 3WS6C 3ZE0F 3PWPA 5A2KH 4ZPTB 3B2UC 2H6PA 4Q6IB 5DC9B 1KC5H 1RJCA 5EZJA 1A5FH 2YBRB 3HC4H 1WVZA 3PXJA 3PGDA 4OT1L 5DRZA 1VADA 5CD5D 4OCRH 4AL8L 1VFUA 1ZVSB 3NIDE 5DJXB 3RI5F 1MCPH 3RGVA 1V3JA 1AHWB 1U92B 4ETQA 4FQLH 1KF9B 3HG1B 2CK0H 1GGBL 2FLBT 1OAXH 5IJKC 3GHEL 4S11A 4AEIH 3UEZA 2OK0H 4PJGE 3GM0A 1NJ9A 2XZAH 4X0KA 4Y5YC 2A77L 4LVEA 1RFDH 3GBNH 2VXQH 1JZ7A 3MUHL 3O3DB 4E5XA 3SQOL 4R96A 1IC4H 2DQTL 3HC0A 3N06B 1HHKB 4JM2F 4OFYD 1Q9WA 1T21A 2VDPL 2FGWL 4ZXBA 4KDTA 5D7SL 4OZHB 3RP1A 4OCMC 3TPKA 2VO5A 4FXGB 4MNGE 3KXFB 3SKMB 4KZDL 4HBCL 4GAYA 2F74B 1S7SA 2EYSA 3HG1E 3VGEA 5E1AB 3W0WE 4NQEB 3MA9L 5JQ6H 1TQBB 3C60D 2OK0L 3WKML 1H3WM 5SWZD 5KSBA 4DEPB 2AK1L 4X8JB 3WFCH 3RIFF 1E6OL 4X7DC 1OP3K 2V2XA 2NLJB 5E70A 1MQKL 2NY7H 4Y16C 2EDYA 3QPQC 4XCCL 4AG4L 4KKBD 4AL8H 3PDOB 4IOFC 2NX5E 1IQDB 2COQA 2R2EA 5JDSA 5C0BD 3V6ZA 1GJIA 3KPOB 1OSZB 5EG6C 4OZFH 3G9AB 4HDIB 1ETZB 1IJ9A 5AYUH 2K1MA 4Y4KC 9CGTA 2CDEB 3KPTA 3QG7L 2ZUQB 4HK3J 3GSOB 1XF5B 4PR5A 3ZE1F 3OGCB 5FYJU 3LKOA 5AZEL 4YGVB 2DKMA 3GB7B 4MD0A 4C59B 1KEGL 5DZNA 4X8XA 4YXKH 4M6NH 2XXMB 2NTFA 3KDMB 4PJAB 4X4YA 3V5HA 2FJGB 1A6VL 3P73A 1J0ZA 4JHWH 5EO9B 3SQBA 1P7QD 1DBML 5DMIH 2WUCH 2N7AA 4P9ML 1E6JL 5A2IH 3Q0HA 4RQQB 2AV7A 1FLTX 3U7YH 4LNRB 5F1OB 5E2TH 5I73B 4QGTA 4HPOL 2XRAH 4Q97A 4YHMH 3O41B 4NRZB 3IB4A 3WFCL 4AEHH 4HH8A 4YXKL 1RQ5A 2VDKL 5E8OB 4G43A 1VACA 2BVTA 4GQ9H 1WUNT 3P4NB 5J57B 2GT9A 1S9VA 2PW1B 3EYOA 4NO5B 4KZDH 4QT5A 2HT2C 3V4UL 1P7KB 4NC0B 3MREA 3U2SB 5DS8A 4M62H 2AQ1A 2ZJSL 3DVGA 2WQ8A 4BZ2H 1OT1A 5I18H 3KYNB 1FFOB 2B39A 3QO0A 1UB5B 2F53E 2FJHB 4RIRB 5B21A 2AV1B 2BSED 4FQ2H 3C5JB 1IAKA 2VKXA 4U6XB 1TJHH 4FTVE 3MRCA 1KJ2B 1NSNH 5IVZA 4UV7L 4MMXC 3TN0C 2D9CA 2GEEA 1YMMD 1OSPL 4POUB 5DJYA 5I19L 1JTPA 4PJDF 4DGYL 5TQ0L 5DLMH 4ZUUA 1JYVA 1R3JA 4PJ5E 1PKQA 2NY1B 5I1HL 4KKCC 3VG0H 3MLRL 3O9WC 1BFSA 3NFSL 1M6OB 1CK0L 5ADOH 3QUXB 1A6TB 5DD0L 3IDMB 4U1LA 4TOYH 1WLHA 4HUKB 3PL6D 2JIXA 1ZA6A 3EYFB 3WJJC 4PJ8B 5CBAB 3KS0J 1B0GB 1B4RA 2Q6WA 3RRQA 3D69B 3ZDYF 1FVEB 3RVXD 1N5YL 3LD8C 1G6RA 1MAJA 3R8QA 4XP6H 2IAMB 2BP3A 2O5XH 3EKCA 2VJXA 3NH7H 4S1RH 2E8YA 5SWZE 2AJVL 1T0MA 2LV4A 3SY0A 4G6JH 5LKNA 1CL7L 4TSAL 2JB6B 3LHPH 4E0RB 4E41D 5BS0A 4KROB 5M95B 3NFNB 4UV4L 1J5OL 3QUXC 3F8UB 1I3UA 4OLXH 5I15L 5C08E 1I7UA 1UJ3A 5GGUA 3SJVE 5EBWA 2YPVL 3ZL4L 1YNKH 4YZFE 2XXCB 1NPUA 2EE2A 3CIQA 3EO9H 2J8UB 1EJ6A 3K4AA 4OZGF 2AAVA 2YXFA 3OMZA 1JZ5A 5F9JB 2IQ9L 3ARED 3S4SB 5FO7B 3MXWH 4K71C 3WV0A 4RFEA 5I1GH 3VD4A 1QFWM 5TE6H 4QLRA 2G60H 1N3NA 4O2EB 1AE6L 4ONHB 5HD8C 3OXRA 1TFHA 1HH9B 5I0DA 2MCPH 4DGYH 4MD5B 5C0FB 1DSFH 2C1OB 3NCMA 2X2YA 1WFOA 1OPGL 1KCLA 4H26A 3LRHA 4G8IB 4O02H 3MV7E 3P9MA 2DQJL 4OI8A 2PCPB 4DN4L 2CO6B 4JG1L 2EDHA 2WV3A 5D1ZD 3RVVC 1WBXB 5D6DC 5E08L 2OSLA 5FGSA 1ZV5A 4U0QB 5F9OH 3LS5L 3D3VA 4YHPB 4PJHF 4JKMA 3TF7C 4U1NB 2FHBA 5DD6A 4MHHI 2ICWA 1NLDH 3CFKB 4JKLA 4DQOL 1YQ2A 4ZYKB 4L8BB 1EAJA 1A3LL 2IBZY 1U41A 3MRDA 3KWWB 2XACC 2JB5H 3MRDB 4JAMB 3THML 1A8JH 1GGYA 5HI5D 1V8HA 3NCCB 4M3JA 3OTTA 4KRPD 1CBVL 1J8HE 5F1KC 4B50A 4I3SH 1C08A 3TPUB 2NZ9C 1C5DB 1WITA 2ATKB 5TFSH 2GIYA 2H9GA 2Z8VC 1F3DH 3RPKA 3WDJA 4HKJA 1FNAA 2J12B 1N7ML 4AMKL 4HIHA 2BNRB 5HYJA 1YUHA 4XNXL 3C5ZA 3WBDA 5EIIA 3NPSC 1D5XA 3MXVH 3W0WD 3ZKQD 1JGEA 1TQCB 3FOMB 4E41B 4FQJL 1RMFL 3RWDA 2ADFL 4HLZH 4PRBB 4OUUB 4WFHD 5FKAB 5DS8B 3W82A 4C83A 4F9PC 4WO4B 5B3JF 4LARL 1BVZA 4AIXA 1U36A 2BJML 5E6ZA 2EEAA 4FQIH 4NKIL 1ZANL 5LQBH 5KZCD 4NDMB 4XGZA 1NGQH 2N7BA 4ZFOB 2X89D 4JR9H 2A77H 3V95A 4D0CA 2ZUQC 1FORL 4WO4A 3WLWC 4NQXB 2PUQT 5KSAD 2OZ4H 4WENB 4HUXA 5FUOL 3HB3C 4MSWA 2FBOJ 1FFNA 1PW3A 1RPQA 2J8UF 4YWGH 5HHMD 3CFEB 3DLQR 1MAML 1S7WB 3D0VB 4L9LB 4NQCE 5GGQL 3VXRD 43C9B 3JSSA 1UJ3B 1WT5C 2XWJB 1RZKH 4KGLA 4GUPA 2YD7A 3N9GH 2VNCA 1MCIA 3BP5A 2F5AH 4KGJA 2OBGA 3SE4A 1KJVA 1CDBA 3CLEH 4KI5C 3B3IB 1D5IL 2FGWH 2RGSA 3PWNA 4IDJH 4YHKH 3S34H 5I1EL 2P5WB 3Q1SL 3IJSA 4XVTL 4Z7WF 4NKMB 1KCRL 3LKPB 5IB4B 1I9JH 3ARVA 2JELH 1CLZL 2WW8A 1GGBH 1HNGA 3MLVH 5KSBB 4PGDA 2CIIA 5K93A 1A7QH 4H8WH 2CMRH 2DQGL 4NCDA 5HI3D 1GZPA 4MXVE 3TBTB 5FF6A 2IQAA 1QKZH 1ZA3B 3BWUC 1SJEA 3QCTL 2ZG1A 2BSRB 1W0VA 1TIUA 2UWEB 2UWEE 3QFDA 1Q9KB 5HDQH 4JZOB 4XTRD 3SDYL 4PJXF 1EVUA 1TQCC 3QUKA 4N9GB 3TYGH 1NMCB 3B9EA 3HE7A 4WFED 5IJVA 4PJEF 1XGTA 3PL6C 2AEQH 5E7FA 4ZFOL 1FP5A 1GGIL 2W9EL 4NQVA 5EUOE 3C2AH 3C5JA 2NY6D 1U92A 4GRLD 1FL3B 1IGMH 4H20L 5DGRA 5F9JA 4QOKD 4N0FA 4QXTB 2YKLL 2D7OA 2V5RA 4XB8A 1U3HB 1YECH 2NTSP 2YWZA 4LHUD 4L8CB 3SE8H 1OP5K 3NTCL 2H41A 3ZLQC 3QH3B 1SY6L 1VGEH 1AGFB 4U1MA 1G6VK 1D9KB 1N4XH 4R0LA 2Q8AH 2Z31D 2X6MA 2NY2B 2ZUUA 4WTZG 1FBIH 4TVSa 2DQFB 3GI8H 2PO6D 3P4MA 3KPNA 3IKKA 4LPWA 5IVXE 4DVRL 3FCTB 1UB6A 3E6HA 5JW5B 1X4XA 3QUYD 5IB5B 5CHNB 1Q9LA 5F7WC 2ITDA 1BBJA 1LEGB 1KACB 4WW2B 3FQNA 4M8VA 2Y06H 5CS7A 4GBXD 2IEPA 5CGMA 2GSIB 3EUUA 3H7BB 3QDGD 1HHHB 5KSAA 3I6KB 5C0CE 2D9QB 4XPBL 3WN5B 4KU1A 2LU3A 3L9RB 3GMQB 3MGTA 3F65A 4D9RD 2VXSL 1K3IA 3F5WA 3EO1A 4LSVH 1IM9D 1HCFX 2OTWB 1CD0A 2NY3B 3TO2B 4DK6A 4JM4L 5ID0A 1MHHA 4BQ8A 3RUGE 4R4BA 1UWXH 5BVJA 1S78D 3QUXA 1NFIB 1KLFA 3CFCH 3MA7B 2P8LB 3S5LA 5FV2A 2R8SL 4UOW1 4ODTL 4HLZG 4OD1H 3BIBX 2FWOA 4V1DA 1U2HA 3O3AA 2ZSWA 1I85A 3TNMA 3ZKMD 3X3FL 3GSVA 3LSOA 4HT1H 4LVNC 3ECBB 1VFOA 3QPXL 4KK6D 1YYLH 3IFLH 3MRFB 3LQAH 3QDMD 5DJCA 1K5NB 5IF0A 1QLFA 2XZAL 1VKXB 1QA9A 4KMTH 1C5BH 3QT2A 3E2HB 1J88A 2P43B 4IS6A 4HKXB 1OAQH 4PRBA 1J11A 3L3KB 1P4BH 2R56L 4HW6A 2R8SH 2AJYH 3MRIA 2ZUXA 1I1AC 1OGAA 4HKZB 4JKWA 4OTXH 5C1MB 3KPQA 3L3DB 4P4KC 3W9DA 3BOVA 4Y1AA 5JPMB 3X13A 1AIFB 4GG6A 4NNYA 3VWJD 1D9KC 1X5HA 3MRMB 5L0QC 1C1EH 4OCWH 4K7FA 1U3YA 5FUZH 5I17B 1QD0A 1BZ9B 1VGKA 2UYLB 3GMMA 4P2CG 4HJGA 3L3OB 3EJZC 1XCTA 3BPOB 3B2VH 4XBPA 5EU6D 4HAGA 2IMMA 4IIQB 2DBLL 4LKCA 1HOCA 4PRDA 4QOKA 1MCJA 3V5DA 3CVIL 4G8GB 2V17H 4KDVA 5DEZA 2AXFA 1R5WB 5L2KA 5MENB 4TN9A 1J86A 1AQKH 4UV4H 5T3XH 2IAND 1FGNH 2X4QB 3V5KB 1BVKB 3MJGX 3QPQD 2ED9A 5FYKE 4CMMA 4R7DB 2HH0L 2YHGA 1JF6A 4I5BB 3UC0L 3NA9H 1G0YR 1UM6L 5IHZA 5T1LA 4GXUN 5IBTL 2X1PA 5TDNB 4H0GA 2B7DT 3FZUC 4K07A 4LPCA 1T7YA 1QSEB 1NGZA 3QXAB 3TO4A 4Z7WE 4Y5VA 4PJHB 3I02A 1X6NA 5KVGL 5DJZB 1MFAH 1UQSA 3QDGE 5I8OL 1PAMA 5FUOH 4F9LC 1BFVH 1R24A 4MNGB 4BUHA 5CUSL 4N8VB 4N90D 5T1DL 3MRHB 3HA0A 1RVFL 3OKKA 2FX9L 32C2B 3HR5B 4ZG1A 2B4CL 3CZFB 4P9HL 4E5XB 3N85H 3T1FB 3FFDB 2FJFB 1A6AA 4LCUB 4F7CB 1AGCB 5HHNA 2APBA 1KB5B 2AKRB 3OAYK 5F1IB 4J12A 2W0FB 4KHTH 4MAYB 1NMAH 1CICA 3PDDA 5E4EB 4JVUA 1JCKA 2X1QA 4JFHD 1F11A 3X12A 4JY5L 2W0KA 1OTSD 4OLZH 2Q76B 3CCHA 4X9GA 2VLRB 5T3XD 4QY8B 5C0IB 3V5KA 5E8EA 4JGJA 5J0BA 2Q86B 1K2DA 1I75A 1BJ1H 2HFFB 5J12B 1BOYA 5J3HD 4H8WL 1LVEA 2YD5A 1D9KD 4JANB 4QRSA 2XN9E 4NWUH 2ZUVA 1BQSA 1JL8A 2CDGA 4K3JH 2OR7A 3SE4C 3EOYG 2R4RL 2B8OT 2YPVH 3RJDA 5SWQB 3PGFH 2A2QT 4XAWH 5JIHA 4YDLB 4HIEB 2DIJA 4CN6A 2DBLH 1NUFA 3S5LB 4TUKH 5EULV 5ITBL 1RIUL 5DK3A 3I75A 1NFIA 3O8XB 4R3SB 5D9SB 3QRGH 5BOZG 2PO6A 5GS0L 3L5XH 4LSQL 3D1MC 1A7PH 4KDWA 4HPYH 2D2OA 3O6FC 4X9IA 3S37L 3NIFE 1CIUA 3HUJE 2EIDA 5MEOB 4M8QA 3LQMA 4X7EC 1WIUA 4HWNA 4UQ3B 4LEXL 3GEWB 5BV7L 4ERSH 3I85A 4LCYA 4QY8A 1PSKH 4NKOB 4LLDB 3RNKB 5A16A 3CVHB 2B1AH 4NPYB 2LAAA 3D85D 3KPMA 1NCUA 4G43B 1WTLA 4PTUA 4Q9CA 1KB5L 3L5XL 3ZE2E 1OLZA 4APQD 1MAKA 3KLAB 3TBVB 1DQLL 5EU3B 1S9KC 2E7LA 5TF0A 2ICCA 1P6AB 1YZZA 3ARGB 4HMEA 4JRXB 3O4LE 4PJ9A 5C6WH 5FOBB 1HCVA 5BQ7A 4ORZC 1P9MA 3HR5A 5C6PB 1YNTB 1T7VA 4P2OA 1R3LA 2B4CH 2C4XA 2Y9RT 1T0PB 4LU5H 2AXGA 3CSPA 3JV6B 3EBAA 4HFWA 5ETUA 2RFXB 4E42B 3OHXA 5TFSL 3AS1A 4G80A 3BP6A 3V2AR 4CNIA 1YN6B 1MIEL 4WFFE 5IFHH 4NYLA 5DEFB 4FQJH 3Q6GH 1NCAL 1YYML 5I1DB 4EXKA 3BP7B 3D69A 2BSRA 3K74B 4CMMB 4LHUA 2JF1A 4F9LA 1T03H 3BT2L 3MJ8B 3QNZA 4QGYA 3MUZ1 1R0AL 4XP1L 1AI1L 1KIQB 2R1YA 4ZUWB 2P8PA 4N1CA 4XCYB 1RZFL 3DVFA 2FL5A 2ZUSA 4QXUH 3MLWH 2I9LB 5DHVB 4YFLF 1HINL 4YH6A 1OGTA 2XYCA 1GGCH 2OP4H 5JQ6L 3PABA 5J13B 5F7EL 1ZHKB 2Z4QA 3QEHA 5C0JB 2VL5B 3TCLA 1EFXD 3U0TA 5IUSA 5F7YC 4LSSH 1DLHA 2DTMH 4NQCA 4H1LH 3RGVB 1F4XH 1BZ9A 2D3VA 3FQUA 4E9LA 3RDTC 1N7MH 4AMKH 4MXQC 4Q0XL 4U1HB 4OZFG 5IW3A 2WLYA 5BO1L 4XP9H 4F7PA 1J1OL 3U4EA 3QCVL 3QI9B 3DROB 4JB9L 4P57A 1DLFL 2ITCB 4RGNE 1Z9MA 4ZTPL 3N1FC 3VFGH 2VB5A 1I1YB 5CEXA 4HXAH 1BQHA 3UTTA 3UP1A 5CEXB 2C9AA 4QTHB 5H8DA 4N90E 2AK4E 2VLLB 5E94B 5E2UL 3S88L 4LVNB 5JMOC 2PXYA 1U8KA 3SKUD 5ESQB 5SWSE 4PY7A 2PYFB 1S7TB 4CDGC 4QRQA 4PLKC 5BV7C 4M5ZL 3LVEA 1BIIA 3BH9A 4L3EE 1MHCA 2P47B 3LRSB 4M6NL 3OBAA 3MNZB 5IESL 2J5LB 3L7FA 3NFPA 1KJ3L 2EEDA 3SDAB 2D31B 3MV8A 4G9DB 3AM8A 4OM1L 4NQSB 1R24B 3GI8L 4MNGA 4QRPA 2FEDD 5E5UB 1ZS8B 3SGJC 3MLUL 3UX9B 3WN5C 1IE5A 3NMEA 2PN5A 5KN5B 1WAAA 3OX8B 4OQTH 1J8KA 4PB0H 4W4OC 1Q9OB 2DBJA 1JGDA 5DQJB 4H20H 5HHMB 2QHRL 2VLKA 4FNLL 4YDLC 4PJGF 2K7PA 4P5KB 4YLQT 1HI6A 1TJGH 3D87B 3C8KB 2QADB 3NH7L 3KWWA 4S1RL 3MBXH 3TA3D 3O3BA 2A1WH 4BSVB 1NCDH 5DK0B 3CFBB 4ONGL 3EZ8A 1JF1A 3RQ3A 4ENED 3DUSA 2OR9L 3ROLB 4JQXA 4QHMB 5ESQA 1QRNA 1KCVL 4HUUB 1QSFD 4N5ED 4KPHH 2R23A 4GKZB 4HC1A 3WKNA 3BKYL 3KJ6L 3Q3GB 4LLYA 3OKLA 3HMWH 5F7DA 3DTXB 3TESA 1I1YA 4FHBD 4Y4HB 1E4WL 2D4DA 3U9UA 1CICC 3MOBL 3MBEA 3HUJA 4Y1AE 3IDYB 5J11B 2OZ4A 3NZ8B 1CLYL 1MELA 1CGSH 1JTTA 1FAKT 2Z4QB 5F8RC 1NDMA 1YNLH 1OCWH 1QOKA 1WC7A 4KH2A 5BJTA 2LU4A 1W8OA 5I17A 1WC7B 3BGFC 2VXTH 5TQ2L 4OZ4A 1MFAL 4MLIA 1WCQA 2Y07L 3O6FD 3STBA 5BQ7B 3V7AE 1Z3GH 4AG4H 3D39D 3FRPG 3M07A 2AVGA 5L7XH 1OARH 4K3GA 1P9MC 3L5HA 3STLA 4NM4H 2ESVA 1RULH 4ZFFB 2LAGB 3HN3A 4FZEH 1IC7L 3E1F1 1UM6H 5H2BA 3U4AA 5HHPB 1D5MB 4JVPA 5HYEA 4JFFD 3B9VA 2FIKB 3BKCL 4JRXD 4PRAA 4EXPX 3WFHB 4OCWL 2CLVA 2EKSA 2NZ9D 4MJ6A 4QNPE 3T65B 3D85B 5IEKA 4XHJD 4IS6B 1KXTB 2VH5L 5E2TL 4BH8B 1AKJA 4W4NA 3QJHB 4MXQD 1WBZA 5EBLB 1DFBL 5E8DH 4LHUB 4P3CH 1FL5A 4KVCL 2HKHH 4EZMA 4OGYH 4NUGL 2LTQB 1EA9C 1BVLB 1F58H 4YNYA 4H26B 1MRDL 5DD1H 4D3CH 4N8CH 3M17A 2X4QA 2BJMH 1FH5L 1IGFH 4ZS6D 3SCMD 3GMLB 1F13A 3P0YH 3QUXD 4P2OD 1XF4B 1I8IB 4H1LG 4Y8DC 2I5YH 2F9BT 1UZ8A 2FB4L 3MFGB 4X7SH 1QBLL 2BY1A 1CE1L 1IAIM 4IOSD 5JNYA 3LN4A 1VFBB 3OG4B 4OCYH 3L9RA 1HILA 4M6MH 2Y36H 5IFAH 1QQDB 5BMFH 5JOFA 1AR1D 3F62A 4K9EC 3M45A 1DBKH 4S1QL 3JWNC 4FG6D 2IPUK 4DW2H 3ULUD 2GY7B 1KCUH 4Z7NE 3CFDA 3QQ9D 4OUOA 1WWBX 3F7RA 4Q2ZA 3EAKA 5MEPA 4KY1L 1KJMB 4PY8J 4NO3B 3IJYB 4Y4HC 3FJTA 1MRFH 1TZGH 5DFVC 3AM8C 5C2BL 1D6VL 4WIQA 2IC2A 1WAAF 4ZOCA 4TULH 4HG4J 1TTFA 1T1ZB 1JGEB 4UIKH 4F7PB 3S96B 5B4MD 1DL7H 3L3IB 3VMPA 4JY6B 2EDJA 1I1AB 4BSWA 5JDJA 5GS1A 3VFOB 4UINH 4Z0XB 3WNPA 1MLBB 4LCIL 5B8CA 3MLPA 4OFDA 1KUMA 1G7QA 3FFCD 1OY3B 3VFSB 4LGSB 2G9HB 3VFPB 1VA9A 3FRUA 3FT3B 1MCOL 4J6RH 2OQJB 3P0VL 4JRYA 4PY8I 3LN5A 4JFFB 5MENE 5SV4A 1FG2A 3AS3A 4ZYKA 3LS4L 3MRGA 3OKOA 4PP1D 5JOFB 2RR3A 1JGLH 4XVSH 3QFJE 4G9FA 3T0EA 1YMMB 4K23L 1PSKL 4IDLA 2ZCLL 2R1XB 5DZOA 3HZKB 4Y5XB 2QQNH 1GGIH 4OIIL 1D3CA 3O6LH 1GC1C 1X5AA 2BFVH 3HE6A 4NBZB 5CZXD 3UTTD 5HI4C 4FQIL 4Z5RB 3ET9F 3WDHA 3UO1H 4U6VH 5HY9A 3K0WA 3GSUA 5GGVL 1KG0B 2HLFD 4AEFA 3KYKH 3BZFA 2NR6D 1MH5B 5CP7A 2P5EA 4R6UA 4Y88A 2BOBA 3O3EB 3V0WH 5MEND 1X3DA 5CEZD 3V4PH 1RZ8A 5CP3H 3BIKB 3O45B 1I1CA 3LKRA 1UB6B 3F7QA 3MV01 4YR6B 3SOBL 3FB5B 5C0GB 4Y16D 2HWZL 3BIAX 3PG2A 1YEHH 3JWOH 1RV6X 1MCNA 1JFQH 5E7BA 4GRMB 4JDZA 1G7JA 1PQZB 3QIWB 3QCUH 2E7CA 2KZ1B 4XP4H 3QNXB 4G3YH 4YFLI 1SJXA 1VGKB 4QKXB 3S9DB 3RWIB 1MNUL 3MACL 4J3OC 2M1KA 5DYOA 2YD6A 2QKIB 1OAUH 5M7QA 1MIMH 4FFVD 3PV6B 1ZHBB 2F8VA 1IC4L 2DQTH 5EWIL 1ZK9A 3ULUE 1HSBB 1NH6A 4GKSB 3CFJB 1NQBA 3GKWL 5I2IA 5CEZE 1CFQB 3WUWB 1IKFH 1RK0A 4OCNC 2HTKC 5ANMA 3C6LB 5F3HB 2GY5A 1RZGB 2YRPA 4WU5A 4JO1H 2QQNL 4PRHE 2FD6H 2E9BA 4LU5L 1BJ8A 1B4JH 3CDCA 4QHUB 2ICEB 2UV3A 2FECI 2J1KA 4JQXC 2I9TB 4HUNB 2DLFL 4HS6B 1TVHB 2R0LH 4QRTB 1JP5A 4U4BA 2BMKA 1YEJH 3HRZA 5CEZH 4RMTA 1CU4L 2EIBA 2GJZB 4XMLH 4H8WC 3VXUE 1HHKA 4NN6C 4X7TB 1ZAGA 3ZDXE 4ZUUB 1YEDA 2R0KH 3U0WL 4QHNB 5T1MA 3U30C 3C5SB 3QQ3B 1NJ9B 1S9WB 5HPMA 1FO0L 1FVDB 3ES6A 5CZKA 1EHLH 4Y4HD 2X5PA 4LLAA 1TJIL 1LWRA 4JZNA 1RUPL 3D5OF 5GRUL 2D0FA 3S37H 2AJZB 5KVFL 4KK8C 2PNDA 1F11B 3PWLB 4ZAKD 3X12B 3U1SL 3V6FB 4JM2B 5AUMA 1KBGH 1U93B 4KK6C 2X05A 4PBXA 5FV1L 5IHUL 1ED3B 3MLYH 4GSDL 1T1XB 5GRXG 5H37H 1S9VB 5B39G 5A40E 2BHYA 4RFOH 1YPZA 1Z0NA 3GSRA 2VLLA 1WV7T 2GJ6A 1L9NA 4OT1H 3QIUB 2X1OA 3NIDF 1EGJL 3JV4A 1DEEB 1G6RL 2P5WE 4JY4A 1SM3H 3T0AA 5F1NB 4K8RC 5JOPD 2FIRT 1QRKA 4OSUH 2DMBA 3KJ4B 5JNYB 1GOGA 4YGVA 3MBXL 1A4KB 1CFSB 3PIQB 4OKDA 3QQ4B 3S3PA 5HYFA 3MGTB 4NRYA 5E2WL 5MI0B 4FQ2L 3CMOH 1U8MB 4PGJA 3MRPA 1NGZB 4NQCB 1JNHA 2AQ3A 4KJQD 5H94B 3RTQC 5J1AB 1IAII 5ID0B 2R0ZH 4XRCA 3HTLX 4Z95L 5HBBA 1XF5A 4PR5B 5T1KB 4TTDC 4PLNC 4WHTB 3S36X 3B2VL 1GIGL 1VFAB 5CJXC 3BQUC 3ORJA 3VU2A 1SEBA 5JO5B 1I7ZB 4HGMA 1T1YB 2EH8H 5ABDE 1BBDH 4BQCA 1YEFH 4L4TD 1NCAH 1YYMH 3QUMH 1MI5A 1A9EB 4NBXB 1KT2B 2BHZA 3C6LD 3WFHA 5F9AC 4NHCL 3MV11 4UTAL 4DKEL 1S7SB 1DP0A 2EYSB 1AKJB 5BZDB 2I26N 1GXEA 2QTEA 3NPZB 4Y5YA 4TVPD 2A6IA 4HF5L 5IBLD 4JFOB 4YBQC 3BP7A 1I9IH 4MJ2A 1FZMA 3R06B 3V6OA 2A1WL 5ICYB 5LWYL 1Y6KR 2G2RB 3FFCE 2A0LD 4OQ1A 1UH2A 5I30H 1BX2B 4XXDB 3AREA 2RHEA 3QDJE 5L8LB 1ZHBA 4TOYL 1MJJA 4W68A 1BEYH 4ELKB 1IC5H 1KTRL 4TYUA 1A6WL 2FJHA 4RMUA 4ELKA 3D18B 1A7NL 1FFNB 1HXYA 3S4SA 3G9VA 1VEOA 1MREL 1ZT4B 2I07B 2ZNXA 3SQOH 4AYFA 4U6YA 4TUOB 1J7VR 4BJLA 2F54D 3BXNA 1CVSC 1ZWIB 4JFQA 4OLWH 2V7HB 2NNAA 2P5ED 1CE6A 4FABH 4HIIA 2H2PD 1H8OA 2EIEA 3BX7C 4ZAKA 3OZ9L 3LH2L 3RL2B 4YHYC 3BEWB 4QHMA 3W5NA 2NY4C 4Q6IC 3ARDD 3UPCA 5E5MB 3RZCD 1FO0A 1B2WL 1GGUA 2BNQE 4HWZA 5K9OA 2J88L 4TQEL 4HWEL 4FFWD 4HBQA 1LDPL 3MV8D 4ZNEE 4ZPVA 5EZJB 3B8SA 4PV8A 4KKCD 1KPVB 1PX4A 3CX5J 1T1WA 4R8WH 3H9YA 2NX5A 2YC1A 1A64A 4JVWA 1HHGA 4FQQA 5LJYH 4ZUSA 2VAJA 1XIWC 1YEDB 1D5BB 3Q2CA 2ARJB 4ZO9A 1KTLA 2H26B 3REWA 5HXMA 4N5UA 5T3XL 2HWZH 2ARJA 4X7CC 4NNPH 5E5RB 3DETC 3T08A 3KXFD 4XCFL 2VLJB 3ZTNH 2PW2B 2AJUL 2XWJA 5L0QB 3PF2A 1MJUL 2NMSA 3W0WA 5IK3B 1FG2B 5IW6A 3O6KL 4HIJA 5HDLA 3O3UN 3HAEH 4R4ND 4WTWA 3PQYA 2J8UE 3RX5A 3C9NB 3IETB 1K4DA 1YYLL 4FFYH 3ZKND 4U6HA 1J8HA 5FUZL 4BH8A 1UA6H 3TZVC 5FKAA 1MI5D 1I3RB 3L3HB 2PYFA 2XFXA 3QB7C 4AEHL 3DXAE 3BN3B 2V2WA 2Q86A 25C8L 1D5XB 3WUWA 3FO2B 5DI8B 2QQKL 5IBLC 1BD2B 4RAVA 5T5FL 3V0VB 4JFDE 4Y2DD 2VDQL 2BVQB 3UMTA 3SKMA 3GZKA 2OMNA 1QFPA 2IH1B 1UGNA 3VRLE 2X70B 1NCNA 3C6LC 4OZGB 1JGUH 2V9RA 3EFFA 1CL7H 4TSAH 3TZVB 2UVEA 4OKVA 1JV5B 1BZQK 3ZDZE 2XNAB 5EZIL 3VI3E 4G6ML 1FC2D 1FORH 3RWIA 1A7RH 2VR5A 4WWKC 3BAEL 1A7PL 5IOPB 1B88A 2NY3C 3DURA 4JKKA 4PG9B 1I8MA 3H8NA 5GS3A 3UO1L 5IB2B 1TMCB 4G42A 3ARFD 4GKNA 4YHKL 3K2MC 4JZOA 1YY9C 1DL7L 3FO0L 1MCLA 2G5BA 1QFUH 5BVPL 5D72H 5BMFL 5F7EH 4KK5C 1ZVHA 2HRLA 4MD0B 5C0AD 4HV8A 5C07B 2QR0B 2EO9A 5EZIH 1ND0A 3QWOB 3WIIL 5J1SC 1A02N 1IGIL 5EBMB 4P5TA 1TJIH 3SDXF 5CJXA 4Z7QE 3ELAT 1HKLH 4HWBH 4I4WA 1IGJB 3B43A 5KOVC 3NZHH 1ZVYA 1RZ8B 3BRDA 2E9IA 1NGWB 3WHE1 1M7XA 3B5TA 4K3EH 5D7IB 2RAMA 1VPOH 2KKQA 4GFTB 1QBML 2D03L 5ANMB 2XWTA 5CP7B 3T3PF 3W11C 4PPTA 1WBZB 4MD4A 4PJDB 1F45A 3L6FB 3FTGB 2XPGB 1N6UA 2A6DB 1ZTXL 2XICA 5JOPE 1DANU 2IPUG 1NEZA 1A7RL 2W91A 4X6EB 2D7QA 3QDMB 1F2QA 4JN1L 5I71C 3KLHD 3O2DA 3GK8L 4UQ2A 5F3BA 1KIRB 2ED8A 4YDIH 4HAFA 3GSWA 5F7HA 3O4OB 4QNPF 5CCKH 2JJUA 4IIQA 1B0RA 1KJ2A 1BFOB 1EH9A 1V7NH 4FQXA 1IAKB 4U6XA 4QRRB 1HH6B 1QYGL 3HC0B 4Z76A 1CQYA 4MZ3A 2LE9A 4L4TA 1QFOA 3LN5B 4RAHA 3KYNA 7FABH 5FUCE 3D2UA 3QNYB 5ERWA 3WFDL 3MJ9L 1MJ7L 1JUFA 4NFDA 5EOTA 3QUYA 4OZIA 3GK8H 4ELMF 1A3LH 2X4OA 1CXIA 5IW1A 4U0RC 3MXVL 5GGSB 1FIEA 4M4PA 4XVUD 4M4RA 5L8JB 3U4EB 2I24N 4PJ8A 4JY5H 5CBAA 4NO3A 3OKLB 2NQCA 4NN7C 4OCXL 2DM3A 5HYJB 4L5FL 1P4IL 2IALA 1KG0A 3LEXA 1Q72H 4WCYH 2X9YA 1B0GA 1T0NB 4MJ4A 1L9MA 3HPJA 3VXTA 3OPZH 3NCJH 4XCCH 3S35L 1A1MB 4XHQA 4ZO7A 4H5SA 2JJSA 4NSKA 5CEYA 3INUH 1RUAL 1DUYA 1YECL 1FZJB 3OGCA 3HE6D 3HPJB 1WCBB 4EVNB 3MLXL 1NFDB 5JXAL 3OJDB 1C8PA 1C12B 3GMLA 3MRLB 4ZOBA 4AK1A 4XB7A 4N8VG 1MWAL 3VFVA 4M7ZB 3N9GL 5FXCH 4XH2B 5E2VH 4RDQG 4U2ZA 3BGAA 5D1ZB 2C1PA 3E8UH 3MV9B 3DX6A 4P5TD 1T89C 3QHFH 1TITA 4ONOA 4WO4C 4NQDD 5EBLA 2H2SC 4LDEB 4OFPA 4ENEC 5D7KE 4G7VL 1S7TA 3SGDI 4ZS7H 2AI0L 4L4VE 1QFWH 1CGUA 1XIWD 4IRZL 4CNIB 2FD6L 5IW1B 4NHCH 3FFDA 3P4LA 4UTAH 1Q9LB 5F89B 1KJMA 4NKIH 2BVPB 2M26A 4PYHA 2D0HA 5H35B 2HVKA 4F33A 3TWCL 5HJ3A 3TIDB 1T5XB 3RY6A 5F3BB 4UILH 4CJ0A 1P7QB 3MYZA 5FGCE 5FOBA 1EEZA 4J1UA 5E56A 4YQXL 1YJDH 5GGUB 1RUQL 2VAAA 4URTB 1FNFA 4U1GB 4KJWC 2A9ML 2NTFB 3KDMA 4ONGH 4F33B 3VA6A 4HDIA 4KWUA 4GRWH 3BKMH 4GG8B 3U82B 1AY1L 3MRBA 3UPAA 3NGBB 3SE3A 3UAJD 1CDYA 1B90A 3MJ9H 3S5LG 1RUAH 4HHAB 4Y2DC 1J1XL 2DM2A 4LEOA 4XPBH 3RVTD 4GKZA 3OR7A 3QZWA 4HD9A 3VXMD 1FVEA 1AGEB 3I84A 4ZTOH 1I9JL 1FL5B 3BJ91 1ZE3C 3BMWA 4JZJB 5T1LD 3U9UB 2ATPA 3VWKA 4XHJC 3EYQD 1INDL 4FQCL 2AERT 2FZ3B 3MQIA 4GAYB 4IMKC 1A6WH 1QBLH 2UWEF 1JHLL 4YBQD 5CSZB 2GJ6D 5JHDB 5FA4A 3ROLA 1R5IA 2MWCA 1JYXA 5E00B 1YEEL 1Z0MA 1MFNA 5SV3A 1K6QL 1HYSC 3NPSB 2Q8AL 3QXDB 4GW1B 3S35X 2HT3C 3F12B 5TJWK 2ZP0T 2GK2A 2IAMC 4LMQI 8CGTA 1IAOA 3UTSA 2WINB 3QUYC 1ZS8A 3EYSL 4HZLB 4N0CD 1XCTB 4IRSC 3CX5K 4RIRA 3SGEH 2RFXA 4XCFH 5KN5A 5TE6L 2WQRA 2UYLA 3HMXH 1MQKH 2NY7L 3DYOA 1ZEAL 3QQ4A 1S7WA 1RJZB 4M93C 3WFEL 1N5YH 2CUIA 1S9YB 4LFHG 1LEIA 1M71A 2VISA 1IFHL 4RGNB 2R2BB 1QRND 4EQ3A 1OF2A 3UDWA 3X14A 3MO1A 5E6IB 3EHBD 3ARWA 4KKLC 5CLWA 3VE0A 5DI8A 5C6TL 2V6HA 3BZDA 2Z31A 4KUCD 5D2NE 1VADB 4JFYB 1MCSA 3KG5A 2OLDA 5IB1A 3IYLW 5FYKH 1MFEL 2ADJB 3DOSA 1T89A 3WUZA 3OXSA 4IHOA 4PJ8C 3RWCA 5F7FA 4KVNH 4O5LH 4U1JA 3RWDB 4AQ1B 1F4YL 2DQCH 4Z7VF 5JIPA 5D7JB 4AQOA 2VL5A 2XZQL 5JR1L 1TTGA 1TNMA 5IVXB 4ZQKB 1UWEL 1WWWX 2CDEA 4PJHA 2FATH 5I1GL 1WSST 3GBMH 3BKYH 3KJ6H 4GW1A 3K4ZA 4ZUTA 2ICES 2G2RA 1WCBA 4EVNA 2FYYA 3EDDA 1RIHL 5FM4A 3TCLB 4M43L 3QG6B 4XCYA 4Q6YA 5DXWA 2XZCH 4NSKB 2XQYG 4HMCA 4C56E 4KFZC 4CUCA 1JWSA 1U8IA 4MCYB 1FFPB 3ARFA 3IVKB 2Y5TB 4FABL 2ATPB 5HHXL 3KPNB 4L8DB 3LPFA 3EFDL 4R7NA 1HXMB 4BQBA 4EIGB 5GGTH 5KW9H 1MF2L 1B6UA 4LEOB 1NGQL 1QZ1A 3N1GC 1QUNA 1RUML 4NQEA 1YY9D 3QO1B 1UH4A 1DQLH 4H1LB 5JW4R 3PJSB 4HMDA 4JZJA 2DQFA 4AM0A 4OZHA 1H15A 2NY5C 1AGFA 4NZRH 4I0PA 4ACPA 3MJ9A 5D8JL 3DJ9A 4P2RB 3K2UL 3O4LB 2A83A 3AREB 4Y1AD 4NOFA 3MRPB 5BJTB 3TJEH 1ACZA 4LBEA 1SQ2N 5F96H 1AP2B 1FNHA 1UH3A 4IRSD 3IXTB 5I1CH 1IEBA 2I5YL 4XP5L 4GKOA 1JPFA 1U6AL 5EC1B 4BA8A 1KTKE 4XZUA 1PGRB 1PJ9A 3RY4A 3UAJC 3TIDA 3QFDB 1NDGB 2XG5A 3HFMH 3GHBL 1JK8B 1V7NL 4RFNB 3VCLA 3A67H 3L95B 5CSBA 1K8IA 5I16B 3LHPL 5ENWB 1NEUA 1IGTA 3L5WB 4WI3A 4Y0GA 3HLAB 3U0WH 4XVJH 3P77A 3CC5A 1P6FA 1SJVA 1KT2A 1KC5L 3RVVD 1HK6A 2AP2A 4GRWB 4Y16B 1RZKC 4OD3L 4KKLD 4F9PA 4F3FA 3OKEA 3PGCB 4P2QD 4PLOB 3UTSE 5SX5H 1PFCA 3E3QE 4NKOA 2X7LB 1R3IL 3E8UL 3GFUA 3S34L 5I1EH 2VDPH 3IS1X 2XKSA 3RPIB 2Y6SC 1U8NB 4I2XE 2EC9U 1RIVL 1V7ML 2P5EB 2FX9H 1J05B 1HYSD 3EHBC 4NZUL 4YHOL 3CFIC 4Z7VB 5GGTA 1WEJL 4POZC 3MLXH 4JCMA 4P59L 4LMQE 3S3SA 4AT6A 3O11B 1PY9A 4JFPB 2OM5A 1U0QA 5C8JA 2F19L 4PJBF 3QIBA 1WZLA 4ZUVB 3TJEL 3CK0H 5DD5H 1J0KA 3QEQE 3MV7A 3GSQB 5E2VL 1N64H 1U8MA 2YRZA 4GUPB 4QXGL 4M1GH 4W6YB 4MA8L 1ZLVK 1J9CT 4E41E 1NL0L 4G9FB 3T0EB 3I50H 1GYAA 4MJIA 1MFBL 4PJ9B 3N1MC 2AABH 3R0NA 4HLJA 2VDRL 3UTZA 3DURB 1S3KL 5KVEH 1I8MB 1MLCA 3QISA 1S5HB 1E4XH 2OQJA 5FM8A 4F7TB 3ARGA 4DUWA 3RY5A 2V2TA 3EYQC 1RFDL 3GBNL 4YGAB 5EU7E 4DOHE 2J3SA 2AV1A 5BXFB 1RAMA 5I9QB 2Z0BA 1A22B 1AO7B 1NC2A 2LQRA 3LQZA 3OPZL 1CGXA 5IG7A 2Z9TA 4KK9D 3LEVL 3VFMA 1RK0B 5JPNA 3PHSA 2APWA 3A6OA 4N68A 4LCYB 1TETH 4L8CA 4JDTH 3MR9A 5C0CA 4ZD3H 4YJZL 3DPBA 3LQZB 5D70L 3QZWG 4HCRL 4UUJA 2X4OB 4ORGB 4O51A 5EO0A 1KXVC 1ZGLP 3WD5H 5EWIH 5KTEL 2IGFL 2OMBA 1UZ6F 3DV4A 2V5MA 4NN7B 5HGAA 1LO0H 3AXLB 3CGTA 2X44D 3NCYP 1IAOB 4Z8FL 1QRNE 5IGXH 1PYWA 4S0TD 1KIRA 2VLJD 1L7TL 5IFHL 4N8VA 2BVOB 2XTJE 5CGYC 4TPRL 4HS3A 2B1AL 3BDBA 2A6DA 1I8KB 4KTEL 4OZHF 3JTTA 1PEWA 5IHUH 1VFBA 2QSCL 4BZYA 1FV1B 4HQQH 5JW4M 1M7IB 4UBDC 2VXTL 5TQ2H 3LZFH 2X9XA 2NY5L 1KTLB 2H26A 4IMLB 4BELD 1NSNL 2V5YA 4Z77A 3ZSTA 3SCMB 1G7IA 5ISZB 1MI5B 3ZKSD 3BP4B 1X6LA 4AJ0A 5KS9E 1K85A 2R0WH 2C1OA 4YE4H 1NMBH 1MCPL 4HT1L 2DMKA 4YHZH 2XWTB 1INEH 4OV6F 1RU9L 5GISL 4JG0H 3MBED 4ONHA 1MCBA 2XA3A 2Y1VA 5FM5O 1PVHA 5E8PB 3O2DL 1PG7L 1OTUC 2A9MH 1C7SA 5GGRY 2VC2H 1N6QL 3E6HB 3TM6A 5JW5A 1WISA 3L5JA 1NCWH 4ISVA 1B2WH 2GAZA 1H3TA 3TO4D 4JM4H 3OSKA 4Z7WA 3SDXE 2XTLA 1MIEH 3VWKD 2NY6B 4KQ3H 5CSGA 2VDOL 1PQZA 2NY0D 3U1SH 5HYSA 4XT1C 4QRUB 3D39A 2KQMA 4F57L 4N8CL 4QXUL 4MQ7B 5FYJE 3ARYA 2FX7H 4B7LA 3VFSA 3HE6C 4G42B 3QPXH 4MVBD 3RWJA 3AB0B 1NLBL 4M5YH 4XCNA 4D9QD 6FABL 3BSZL 1X44A 1BF8A 5GRWA 2NW2A 2Y36L 5IFAL 3UPRA 4J3SA 3ULVL 3LKQB 2B4CC 4XX1E 5F88A 2HJLA 3TYGL 5I8KH 2LU7A 2A73A 4O00A 4P9HH 2CGRH 3S6CA 4H1LA 1QLFB 4PBWD 5D7LD 1T7WA 4UTBL 4U1LB 4PGDB 3CDFA 3LKNA 2Z92A 4IJ3B 3BE1L 5BOPA 1KB9K 5IVOA 2CIKA 4Z7UA 4PB0L 4PFEA 3QEQB 5FO9B 5J56B 4XP6L 1KELH 4NUGH 4ZMAT 3LV3B 2H6PB 4Q6IA 4YDVA 5IT2L 3S4SG 5F7LB 4HULB 2EDXA 3QCVH 1CFNB 5A1AA 1A2YA 3G5YA 5BRZB 4H0IA 4HUVB 4NZTH 3G6DH 3QIWC 3L5IA 2CDGB 3O2DH 5KANG 1ZHLB 5F93C 4C4KT 3VXTB 4HJGB 4UT6L 5DO2C 1TVHA 1JNHB 4M6AA 5GGVY 4OGXL 1OAYL 1XR8B 2XY2A 5ECJE 5I1AA 4YHPA 4R4BB 4PJXA 3I6KA 1I4FB 1CXHA 3JWDH 2H1PH 1CFTA 2P42B 4GQ9L 1MHEA 4QRPB 2R9HD 4NNYB 2VN7A 4M02A 2JK5A 2RCSH 1OD7A 4F2MA 4NN5B 3CU1A 3C6LA 1IEAA 1I1AD 4G8EA 3PQYD 5C0CB 3U6RA 1KSRA 1G7PB 1VESA 3QA3B 1X4ZA 3DSNA 3F7PC 2BC4A 1DLFH 2IBBA 2NW2B 3MBEC 5JPNB 4NO2B 5D8JH 4DCQA 3D85A 3W2DH 4NIKB 3DNKA 2EKSB 4HKXA 3TLRA 2Z31B 3ULVF 3QIBD 4K8RH 3IJYA 4HSQA 2B2XH 2EE9A 2EDRA 4R2GC 5SX5K 5E6IA 2Q7YA 2XA8L 1WIPA 3EW3B 2HG5A 5DDHB 5D71L 1GAFL 4UOW0 2KDGA 4UILL 1ZXQA 2D7TH 4X6CE 3LB6C 5EOQL 5DUBB 8FABA 4X6EA 2Y72A 4JPVH 1OP5H 1G7JB 4XWGH 3U36A 5T3ZL 2DB8A 2XTJB 1G9NH 1YQVH 1NDGA 1TPXC 3ARGD 4UI2A 3VG9B 2JJTC 3L6FA 1KN4L 2VXSH 4YR6A 1ZLUK 2BDNL 2DI9A 4KVCH 2LTQC 3BW9B 4CGTA 4E0RA 4WEBH 3UTOA 3GMQA 3UROR 3VXMA 3OKDA 2HT2D 5FDWA 4PREB 4PBVC 2X4TA 1QO3A 1E27B 2D7TL 1UYWH 3PP4L 1N5AA 3PWPE 2FEEI 3RX7A 3P4OB 4U1SB 4Y5VC 3TT1H 1AR1C 3T65A 2BNUB 4KZEL 4L8DA 1LE5B 1E0OB 2EIZA 5CHNA 1JBJA 3LKSB 2DDQL 2VLMD 4OGZA 1FDLL 5ALCL 4LPYA 2APFA 1A9EA 3O6ML 4R7NB 4UU9B 1RVFH 3H3PL 3MZTA 3ZHLA 5IP4A 5D1ZC 4ZFZA 2FSEB 1HQ4B 5CCKL 4Y4KB 1CLZH 3EO0B 4Z7UE 5DD1L 4PLJC 4D3CL 1CDHA 4NRYB 5MP6L 2XNAA 4Z7VE 4ODSL 4K7FB 1HSAB 5I18L 3I3EA 3NCBB 1A6ZB 1CGWA 4Q7DA 3VXPA 4Z18A 3IXTA 4P3CL 4NO0A 1D5IH 4P2OB 2VAAB 2VZSA 4UIKL 1ZEAH 1NDMB 1N8ZB 5HYQA 1MNUH 3AUVA 3MACH 3TGXA 4WTXA 3I6GA 3RVWC 4MSWB 4DEPC 1T4KA 1DQMH 1NANH 1T04A 5FDYA 5IG7B 5LAXA 3EOBB 4WVRA 3UBXA 2WWMD 4NO2A 4OIAA 4ODSH 2HKFH 4RNRA 5B38A 2FB4H 4U3CA 4MB5A 1QA9B 3WL9B 3O41A 4NRZA 4HG4K 5L88H 3UXFA 3A6CH 1RUPH 1MEXH 3V6OC 3RIAF 2Z35B 1AQDA 1MOEA 5FYKL 4F8QA 1DEDA 4OLUH 1EFXA 5TGBB 1MCKA 4UQ3A 2CXGA 1C5CL 3ROOB 1B9ZA 3VDAA 4NZRL 1BWMA 1YDPA 3UYRL 2GTZB 3SBWA 2N4IA 1A6ZA 2DD8L 2YD8A 3CNKA 4MDJB 4X7FC 5FYKD 3GM8A 5E9DA 4WNQA 4RMQA 3JTTB 3BRFA 3CMGA 3ME0A 3FB6A 1MPAH 3EO0A 2ZOLB 3IAPA 4JPKL 5EUOF 2AJUH 4OD2B 4PV9B 3IDUA 1KOAA 2YD3A 5TE4L 3QAZC 1DE4B 4XPFL 4AH2A 5JXAH 3WNNA 4JREC 3F12A 3R8BB 3S36L 1U8QB 2G9HA 4P23C 3DX8B 4LSVL 3IKCA 3KHOA 4KKAC 2JJSC 1ZANH 5LQBL 1ZLSL 5C0BB 1YN7B 1AGEA 4R90H 2CRZA 2NNAB 1ZHNA 1PG7X 4U1SA 5KVMC 3UTTB 1N2RA 1PKOA 2CUHA 5GISH 3X3FH 2CLRB 3OAYH 2IAMD 2ZKHL 2AABL 1Q8MA 2R2BA 4W6XB 4NT6B 1DBBH 3OR7B 3KLSA 1FNEA 2GJ6E 4LDLB 4M48H 3CSYA 3WIFA 4OZIB 2DF3A 1CZ8L 2OP4L 4OFKA 3X11B 2D7NA 4RMWA 1XF3A 4KRPB 1GPOL 3BEVB 4MQSB 1SYSA 4MQXC 5DJ2B 5DUML 5I74B 1P2CA 4RWHA 4MQ7A 2X4RB 4HWBL 1L7IH 3MJ7A 5ITFB 5C7XL 4UIMB 3JWOL 1SM3L 2EZ0C 3C5ZD 3OAZH 4XNMB 3OAUH 2ZOKA 2FCBA 3PP3H 4EOWL 3QHZH 4XNYH 3V6BR 3BMVA 3FMGL 1FZMB 1NCBH 4KTDH 1P1ZB 3ARXA 4X83A 4GMSH 1MFDL 4PLJD 4TSBH 3V0WL 4CADB 2XN9D 2APVA 1RI8A 1I8IA 2YWYA 3MV9E 5IV2B 4HK0B 2H8PA 4KDTC 2ZSVB 1SJHA 4WI2A 4LSPH 3MUGB 4YHNB 5E6ID 3BP4A 5K33A 4DZ8B 2HJFB 3W39B 5LGJA 3FHQA 4YXLH 4DZ8A 1DQDL 4P5KA 1TZHB 4TRPL 4ZO6A 2EICA 5C0FA 3DIFA 4EIZC 4I4WB 4PYGA 2APTA 1JZ4A 1C5BL 2J2ZA 3HNVH 5C08A 3GMOB 3VXQB 4BFIA 5JHLH 2C3VA 4FTVB 4LSPL 1KCSH 2NY2C 2ZG3A 3U36B 2A74A 2VR4A 3ZYJA 3FB8A 4JLRB 2F54B 4L1HA 5J6GA 4JFFA 2J8OA 4JRXA 1J1OH 5DDHA 4LKXA 5DMKA 3ZKXC 3B4NA 5E99L 2A6KA 3NFPB 4P46B 1NFDA 4L3AA 4J1UB 3ILPB 5D70H 3AMLA 5F7KC 4WUKL 4XPAL 4YDJA 1T5XA 4JRYB 3DVGB 2CD0A 5DHYB 3HI1B 4G6KH 1MRCL 4LOUD 4P9HC 5JLZA 3D9AL 5EOCJ 3DRTB 3PL6A 1XEDA 3KNBA 4WHYH 4P4RB 4POYA 3JWDC 2RCSL 2IADB 1HHIB 3RAJL 3VFMB 4A6YB 3NBNA 3HPLB 1M1SA 1S9YA 3MR9B 5A16B 3RNKA 3E2HC 5EIIB 3ZTJH 4LLYB 2AEPL 35C8H 2R0KL 2IAMA 2DYPD 2YSSA 4GSDH 4R3SA 4RQQA 5MEOA 1A6AB 4P23B 1IARB 3ALXA 3HMXA 3HI5H 5EA0H 1LO0L 2WINA 5D2LE 3BWAB 2VXUL 5BRZE 2YK1H 3OWEA 1HZHL 4LKXB 4S10A 5DMKB 3G5YB 4DUVA 1F6FB 4DZBA 3OB0K 2DQCL 5GRJL 1NUGA 2BX5A 1RULL 4QHKJ 4IEFB 4QRRA 3Q5TA 4G9FD 3T0ED 1EVTC 3T2QA 4O58L 5DVOA 1Q0YL 4KK5D 1HILB 2V5TA 4LCIH 2D4FA 3CVIH 3MXWL 3EDFA 2XIDA 2L0DA 3ULVD 2EDLA 4K2UH 5KVGH 3C8DA 5KS9F 5DC0A 3LKOB 5IQ9A 4ZUVA 3V6ZB 3RWHA 4QRSB 3MLUH 1S7RB 5D4QA 3WXVL 1YEIH 2EO1A 3NACH 5EC2B 3LRGA 3C6SA 5I76B 5AZEH 1DFBH 4I0CC 1RURH 1A9BB 5JUEH 3PDGA 3V4UH 2DI8A 1D6VH 5L9DL 1FQ9C 3MNVB 1ZMYA 3VFUA 1QFWI 3F7YB 1LO5A 1OB1A 4PP1C 1RJLA 4XVJL 3CH8A 2YUWA 4LFHD 5TH2B 1IGCL 5ITBH 3S8WA 1VGEL 1HSBA 1U8NA 3C2SA 4MNQE 5GGSA 5E08H 5D7IA 2AXFB 5MENA 3VDBA 3QI9D 4QTHA 5KW9L 4OI7A 3U7YL 5DZLA 5IB5A 4MDIA 4NQED 3ARDC 3QNYA 5E2UH 3S88H 3DYMA 2W07A 1DSFL 2MQ3A 3RTQA 4NWUL 4F7EA 4GAFB 4ZAKB 2I60H 4LDOB 2PXYC 4LEXH 4IOFD 3ZE2F 1DCLA 1MCEA 3D39B 4YIQA 5JIIA 3MRNA 1HZHH 4M61A 1NGPL 3GIVB 2BNRD 5DD3H 3OJ2C 4ODXB 2VUOA 1K6QH 4PJFE 3K2UH 3D39E 4BKLB 1I7UB 2X4RA 3BPLC 4Z7WB 2PO6C 4HJJH 3RTQB 4QWWC 2HVKB 2QADC 3SDCA 5CBEB 2W9LA 3LKRB 3VJ6B 5DJZA 3FAWA 1AP2A 3PABB 1QSZA 1XGQA 1OGTB 2R0ZL 2Y23A 4Z95H 5EDXA 2OI9B 5CWSA 1DQJA 2HMIC 3T2NL 5C2BH 1OSPH 2FL5B 1VEMA 5HYJE 5D7LA 2GTWA 1F6AA 1JZ2A 4MNHA 3O9WD 3W11D 1QSFA 1JF5A 4HGKC 5KS9A 1AO7D 1NGWA 1N6VA 2JTDA 3IS0X 1BD2A 1U3JA 3M8OL 2O61A 1VENA 4NC1E 4OF0A 2PO6B 2R23B 2NYYC 4RSVA 4X6CA 5L2JA 4WY7H 3TP4A 2R2HB 4KI5E 4G7YH 3VXSE 2Y5TA 3HS0B 4HWEH 2F5BL 4JPIB 3TBSA 4KQ4H 3PWUB 3L3JB 2R29L 1FVCB 4EDXB 1Z9LA 2HA1A 3MCKB 4LLMA 3FRUB 4ODUA 3AY4C 1UXSA 3P9LA 4FS0A 4M9OA 3VD5A 4GKNB 4AIZA 4K7PY 4GG8A