1P84J

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EVKLQESGAGLVQPSQSLSLTCSVTGYSITSGYYWNWIRLFPGNKLEWVGYISNVGDNNYNPSLKDRLSITRDTSKNQFFLKLNSVTTEDTATYYCARSEYYSVTGYAMDYWGQGTTVTVSSAWRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2003-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p84J00
1KCLA 3IDGB 1YC8A 3ILPB 2VDKH 2R56L 3ZL4H 3WIHA 4RAUB 3SQBA 4G3YL 1LO4L 5DUBB 1JGLH 4G6JL 3NCYS 4JQVA 4MA7H 4K8RD 5FKAB 1WT5C 1JYNA 4YHNB 3O4LD 4OD3H 1I8MA 4O9HH 2EO1A 4IRJB 4PJEF 3ARGC 2OK0L 3QDGD 4NKDA 4JO1H 3VD4A 1NC4B 1OF2A 1A3LH 1A47A 2Z4QA 4XTRC 4H5SB 3P4NA 2Q3ZA 1K3IA 2VC2H 3LN4A 4G6ML 2GUOA 1QRNB 5C6TH 1CFVL 1I8KA 1AO7D 4L4TD 3EFFB 3KLSA 1TPXB 4NQCA 5ICYB 5HYJE 4MQXC 4K3HA 3FO2A 2Y5TA 2GK0B 4FZEL 2BNUB 3G6DL 1VADA 1DQLH 3VXNA 3NFPB 3V4UL 3P77B 4Y5YB 4PD4J 2R4SL 3VJ6A 1T1ZB 3MRQA 3RWEB 3T4AA 1TTFA 3SKNB 5BZDB 5CGYD 1A7PH 1MLCA 4YHOL 2WP3O 3TV3L 2IAMA 4MA8L 4F7TA 4HULB 3H6JA 4DN4H 4F9LC 3G08B 2E6JA 2NW2B 2IFFL 2BSRA 5FCUH 1VGEH 5SX5K 3U7AA 3ULVL 5FUCC 3FB8A 3RVVD 1RIHL 4NCDA 4Z78A 3M07A 5F1NB 4L8SA 4QCIB 5FO7B 3BZ4A 1JNLH 5T1KD 4GKSB 1MREH 2ERJC 2QQNH 5TGBB 2AGJH 4OB5H 3SGJC 1FNGA 1FO0H 2YS4A 4HZLA 4QRUB 2YN5A 4JVUA 1OTTD 2GTZA 2RCSL 1EIBA 5GS3A 4FQJH 4AIZB 2DQGH 4RGNC 1F6AB 2L4OA 4PJEE 1CXFA 2GTWA 3EDEA 3NA4A 3WV0A 2ZNXA 3D0VB 5EFIA 4M7JH 1CFVH 4RFNC 1ETZA 1A2YB 1I1FA 4KWUA 3P0YH 4U1MA 5T1KB 1FCGA 3QEGH 4JN1L 1T7YA 2OTWB 3SJVE 4OM0L 3IFPA 5ISZE 4Y5VB 1NAMA 3C09C 5ICXB 3QCUH 3RWFB 3QFDA 4JDVB 3ZDZE 4X7TB 3NZHH 4NN7C 1J12A 4EXPX 1R24B 4X8JA 3MRBB 5EU6A 1CL7L 3EYSL 3VRLF 5CCKH 2PW1B 2X9WA 2Q20A 3GSNB 1G7IA 3O11A 5E6ZA 3U7YL 4DN4L 2F54B 2A9NL 1A9EA 4UDTB 3FRPA 3U79A 4F9PA 2FJHB 3GRWA 2F8OA 1I7TB 4UU9A 3K74B 4M3JA 1NGWB 2WIIA 4LVEA 3UTPD 2A9MH 5F3BB 3UTTA 2A77L 4R4ND 3D3VB 1XGTA 1LK2B 1ZHBB 2WZPD 3BPOC 5DHYA 2VDNL 5DMIH 3O3EB 1KNOA 2F54D 2YEZB 5L6YL 1KLGA 3MA9H 1AGEA 4XPTL 4X6FB 5DSCB 4JRYB 5LGJB 4DKDC 4ZUWA 3MRNA 1ZAGA 4Z7WA 2YPKA 2WQ8A 4P59L 5D71L 5EB9A 3R06A 1UVQA 3R1GL 1KEMH 4AM0A 4OD2B 1I3RA 4Z7UF 15C8L 1FZMA 1XGRA 2C1OB 2FHBA 3MLSH 5K9OA 2HTKC 1G7JB 3VXRE 1LO4H 4NOBA 3MA7B 4JY6A 4XP1L 2ATPA 1IC4L 1HHHA 2LU4A 1CLYH 5J1AA 3BD5A 4O2FA 4RMTA 3RDTD 4OLYH 4YDIH 1YYML 4E9LA 1R3LA 2D9QB 4N0FA 5FYLL 4D0DB 1F8TH 4OLZH 3QWOA 4YQXH 3O3EA 4NO5B 5EIQA 4DW2H 3HMWL 3UAJC 4BH8A 2K7PA 1IAIM 4ODWA 1BLNB 4KGJA 1S7SA 5DVLA 2BDNH 4CUCA 3JV5A 4KK5D 1VACB 4RGOH 1FYHB 3QH3B 3D69B 3QJFB 2I26N 1DQMH 1G0YR 5J11B 3PWLA 1WBZB 1KC5H 4S10A 4V1DD 5HSFA 3DO7B 5KW9H 3HPLB 3TH4T 2J8UE 4HWNA 2NXZB 1WT5A 1HQRA 4LNRB 4OI9A 1JN6A 3EOBA 5E8DL 1M71B 1YEEH 2B1AH 4QTHB 5I76A 5DHXB 3QUXA 5DFTA 4F8QA 2XRAH 2GJJA 3ULVF 3GMNB 3W0WD 1B0GB 1NC2B 4YBLC 4LKCB 1UH4A 1G7QB 1ZA3B 2FDBP 2EH7L 2EDWA 2R29H 2RB8A 2ZG2A 4KV5E 3LCYA 2F58H 4QF1A 5C09B 1U8OA 3OAUL 1HDMB 1EUTA 5CJ8A 5I18H 3FQUB 1E4XI 3IDIB 4NQXB 4PP2B 1UM5H 1W72H 1RQ5A 1FFNA 2D0FA 5L0QB 4DVBA 4RAVA 4WHYG 1AC0A 1OCWL 4AIZA 5D1QC 4HKXB 2B7DT 5F8QC 4GRLB 3SO3C 3PIQB 4NKOB 3BI9X 3B3IA 4LK4A 5CMAB 1CXHA 5HJ3B 4BSWB 4ZPTB 4DZBB 4UAOB 1FNLA 4LEXL 1B6UA 1AE6L 1IFHH 5GRZA 1FYTE 3LS5L 1BGXH 1NFIB 1DUYB 2BVTA 5GGSY 3VXUD 3QDMD 1QBLL 2Q8AL 3SGJA 4UQ2B 3WKMH 5GGRA 5SWZA 2MFNA 5T5FL 1J1XL 1TCRB 5F96L 1DANT 3VXMA 2H26B 2VXUH 4RCAA 3TN0D 5J12B 3KPPB 3CK0H 4LVHC 1RUQL 4NUGL 4FXGB 2IAMB 3WUWA 2CDFB 3D18A 5BRZE 2BY2A 1HQ4A 5E8DH 5CS7A 1PZUB 1KJ2A 1T5WA 4HXAL 1A6PA 1A7NL 2ZSWB 3OJMB 3PWLB 2NXYD 3D9AH 1I9IH 3C6LD 2X4UA 4JPIA 5CINL 1MH5A 3OAYH 3S7GA 3OTTA 3S34H 3WO4B 1YUHB 2YD8A 4ZUVB 3EDFA 1X44A 4GMSL 5CUSL 5JIKA 5T1MB 4EOWL 2DQJL 3IDIA 4MDJB 1FNGB 4Y4HB 3S4SA 4QRTB 1NSNH 3REWA 1DUZB 5D2NC 4GSDL 4CVXB 5M7QA 1EH9A 3HG1E 4X6FA 3T0VA 3U9PL 3HZVB 3MRGA 3WHE1 2VZVA 4P57B 1G7QA 4P2RD 1EFQA 3FAXA 4CW1A 4F9PC 3CCHB 4YK4C 2D03H 3IDNA 5DJDB 2NY3C 3BE1L 1CGXA 1WAAE 1FQ9C 3O6FA 4NOFA 1XF3A 5I16B 3L6FB 4C56B 3GIVB 4XHQA 1CG9B 1MELA 2BFVL 1T20A 2VQ1B 1OL0A 2BMKB 1XGRB 2C1OA 1TZHB 2UZXB 1OP5H 1T80A 2NZ9C 3RY5A 4OD2A 4FQLH 4JVWA 1CFNB 4M48H 5I1CH 1JNJA 4RSVA 4GW1B 4GRMB 1OAZH 1CE1L 1CICB 5IJVA 4RA0C 5IVXA 1MHCA 2MTPA 2AJUH 4OLYL 4KRMB 1B90A 4WENB 4YDIL 5D7IE 4XP4H 2VLKD 4HUWA 3KPTA 3ZE0F 5CWSB 5IBLD 3MRBA 5INDA 5DUML 1WVZA 5EU7C 4TQEL 3BD3A 3QHFH 3PQYE 4LPTA 4OUOA 5EBWA 5TDOB 3MACH 1HWHB 3C09B 1QR1A 3IS1X 5CEZD 1MFDL 4C59B 1KG0B 5E5RB 3SDAB 1A4JA 4G9DB 5JXAL 4NCC2 2MSPA 5FAAA 4PB0H 3WIFB 2GSIA 4ZUUA 1F90H 3ECBB 1GZQB 4YZFE 1J10A 1GOGA 3ARZA 1Y18A 1TIUA 4OZ4B 5ELIA 5IP4A 2P8PB 4LCWA 4Y19D 2JK5B 2NX5A 4KJWD 3QUXD 2HG5A 2AKRB 4OV6F 4AH2A 3LN9A 4G8GE 3WBDA 2VE6B 5C08D 4ODSL 3G5YB 4H1LH 5FYKH 1DLFH 5FF6B 4GAJH 4U6XB 4P46B 1HILA 5GRVL 4H0IA 4P3DB 3GSWA 4DOHE 1UVQB 3D85A 2Z93A 3GMLB 4JQXA 4RBPK 1HQ4B 4G5ZH 5LXGH 2WNGA 2LAAA 5IFAL 4UTAH 4CL7A 1XGUB 4X98A 4NQSA 1RK0A 12E8L 2HTKD 3DVFA 4K7PX 3RL1B 4M03A 4XCNB 3WXVH 5A2FA 4PGEA 3DLQR 3NH7H 3EOBB 3ZKMC 1MPAL 3BD4A 3QUYD 1F4YL 3HFMH 2BNRA 4KKBC 1A14H 3D0LA 5DUMH 12E8H 3X14A 1KPVA 3WFZA 5E8PA 3VRJA 5GSRB 4TNVF 2Y06H 2GKIA 3DX8A 5I1KH 4BSWA 2BNQE 3TN0A 3TO4C 5F7EL 1UWGL 2N7AA 3LSOA 2GJZB 2DWEA 5E9DD 5IIEA 5TE6H 4MNHA 3OX8A 4I0PC 4HS6A 1JGEB 4U1GB 3FHQA 5I8KL 2HT4C 3OXRB 2NYYC 1NCNA 1P4LB 4LEXH 1JPSH 4JZNB 1U9KA 4DUVA 2FJGA 2I9TB 4MD0A 3HUJE 3CZFB 1T1WB 1LNUA 1NGYB 3QPQD 4R9HA 4YDVA 2G75A 1OP3K 3GNML 4G6AD 5K9KB 4PV9B 3U83A 1RPQA 2BVEA 3MNZA 4KVNH 1RK1B 2YUZA 4BFEA 1OP3H 3CK0L 4MCYA 1TJGH 3I6LE 4GAYA 1FIGH 3DUUA 5JOPD 3TJEH 3VXUB 5KSVA 2IQAB 3UJJH 3MOBL 3TT3L 4BZ1L 1LK3H 3KLAB 3PQYA 4G80A 3N1PC 4MGXA 5TH2A 4H88H 1BOGB 3WXVL 2BOBB 1QTYT 1DQDL 1Q72L 5F7HA 4YK4B 4HH8A 2R1YA 3E8UL 1D9KA 5LQBH 5T33L 1IAOB 1I9JH 1KLUA 3RY4A 3BJ91 3QPXL 4IMKA 1KNOB 3MROA 5I66A 4WCYH 4ZXBC 5CMAA 5DD3H 2XG4A 2DQUH 3Q48A 4U0RB 4U1KB 3VA6A 5TE6L 5E9DE 4KROB 5IVNA 3IT8D 1WCQA 2HAZA 3MRDA 4IDJL 1IEBB 4GKNB 1FAIH 1E4XL 2AJ3A 5GGSA 4IJ3B 3SE9H 4P46C 1X5HA 3EYUH 1T1ZA 1S7TA 3WNOA 5D2NA 4IOSD 4LMQE 4Z0XB 1IGTA 4U3CA 3HS0B 3HZKA 1SJXA 5KSBF 4JY4A 4XP9H 1SJHB 1T20B 2VQ1A 5T1LD 3S96A 2CH8A 4WFEE 1AQDB 1MLBB 1OAYH 3SBWA 3RUGA 3VFSA 5HVHB 3WO4C 5J3HC 3Q1SL 2QLVB 3LKSA 5CILL 4XP4L 4I3RL 4M00A 4UMGA 3SDXA 3LRSB 3MLWL 4O2CA 3MRGB 4E42A 3NCBB 4KMQA 1J88A 1I1FB 5BRZD 2IG2L 4R97C 5CSGA 3T65A 5AG9A 4M1DL 3S4SB 4K2UL 4DEPB 4M62H 3C9NA 4HAGA 1PVHA 3VXOB 4XNYL 3NIGF 1CGSL 2XWJA 3MBED 4X4YB 2VISA 3O4LB 4G6MH 1JZ6A 3I6GB 4IRJD 3SE4C 3W9DB 3FT4A 3H8NA 3HAEG 4NRZB 1ZT1A 1AGCA 1RZ8A 2AK4B 2Y6SD 1CGYA 3D39D 2XA3A 4JDTH 4DKEL 3ZDXE 3D2UD 2OJZH 1UZ6E 5KANG 2HKHH 3TGXA 3ULUH 4X80L 1NMBH 4FQXD 3FN0L 3S4SG 2A6DA 1M7XA 1HYSC 4B5EA 2R69H 4LIQE 3TM6A 4X7TA 3I3DA 4TULL 3HE6C 3KS0J 4N0YH 3T08A 2KPNA 2ZOLB 4RMWA 1OAYL 3MRIA 1WZ1L 3FQWB 2VNCA 5I73B 2MHAA 3AGVA 1MJUL 4LRIA 4XBGB 1FZKB 4OBRA 4KKCD 3ZDYF 2WBKA 4HPOL 5IWLA 3VXMB 1DTUA 3S35L 1U8IB 3NTCH 3SGEI 5D1XB 5B39B 4RMSA 1N4XH 4P5TD 4N5EC 1P84J 4RZCB 3ARTA 1AJ7H 4CMHB 5CBEB 2P8LB 3LPFA 3NACL 3GKWL 1XF5A 4FS0A 3SY0B 1FVEB 3X3GL 2HRLA 3LSOB 1JV5B 2R8SL 4ETYA 4M5ZL 4N9GA 3WS6C 4HW6A 4XPHL 2WBJD 3LEVL 5D2NE 3TO4A 4ZO9A 4LSTH 4Y2DC 3S36L 2R0WL 3MRRA 4S1SH 3N85H 2PW1A 5D9SB 1N59A 2ICEA 1S78D 3ARUA 4KK9D 2HTLD 5BV7H 3VA2C 4D0CA 4ELMF 5EZJB 5IF0B 3PV6B 1WISA 1RJZB 3KDMB 1L7TL 1XGPA 6FABL 1DCLA 3GJEB 1HIML 1AP2A 1CI5A 4LSQL 1BQLL 3PDGA 3SOBL 3NCEB 1MCRA 3WLWC 3MSPA 1DQDH 1Q72H 2IADA 2LVEA 3HNSL 4TVPD 3SGKA 5DK0B 1Z9SA 2EIDA 2XY2A 1MNUH 3T3PF 1F3RB 1CU4L 2LE9A 4YHKL 4ZS7H 5D7KE 1BQLH 3DUSB 3SOBH 4WU5B 4X99B 4JZJA 4U1NA 4KAQL 2DF3A 5LCVL 1OPGH 4JFDB 2F8VA 1CFQA 3TCLB 3LRGA 4WFFD 5D7SH 1ZLVH 1SM3L 1D6VH 4MS8C 1N5AB 4H20H 3GBML 1DLFL 5HDQL 5AZEH 3H7LA 4AYFA 1HNGA 2IPTH 4WO4C 1XGQB 5HVFB 3OWEA 2R0LL 1M7IA 2O93L 1KGCE 4KXZH 4H0GA 2ZJSH 4XMPH 1FG2B 3GBMH 2X05A 4AENA 2A73B 1KPRB 3QCTL 5CEXA 2ZOKA 4NQDD 3UBXI 5KVDH 2MKWA 1I7UB 4G42B 5MEQA 2XN9A 5JW3H 3E2HC 1K4DA 1UACH 4LLQA 4G9FE 4HAFA 2HRPH 2OZ4L 1CZ8L 2DD8L 5KS9B 4GW4B 3TBTA 5INDB 3W39B 4XI5C 5C0GA 2F5BL 5IR1A 3GIZH 1F4YH 4X98B 2UWEE 3VMNA 4ENED 2APWA 3NOIA 3IDUA 4YE4L 1FV1A 4N90D 5DSCA 3A67H 1IC4H 3E3QE 4QYOB 3NA9H 1CT8B 3QNZA 4PREB 3VFPA 5JHLL 3WL9B 4POZD 4X5WB 4ZNCD 5HI5C 2M26A 3MRMB 3MYJA 3C8DA 2WINB 1DBKL 2R0KL 5HGDB 1JWUA 3GSNH 2O5XH 5I1GH 3OAYK 1OTSC 1OAQL 4PBWD 2FJFB 2I24N 1KJMB 4PP1D 4Z77B 1YMMD 1R0AL 5I8KH 2MCG1 2RCSH 5D93B 1U8PB 3DOSA 5CGTA 1LE5A 4NQCE 4IRZL 1GVIA 1H8OA 5E8OA 2BC4B 1NJ9B 1Z6JT 3MXVH 1XR9A 4I3GA 4XPGL 2IPTL 4YAQA 3V7AG 4QOKD 2CKBA 4X6CB 4NNPH 1A6ZA 2AJYL 1WTLA 1WCBA 4Y4FB 4G7VH 5CEZL 4JG1H 1LP9F 5C07D 1YMMA 5EWIL 1C5DB 1QEWB 2I60H 2C1PB 4GJTB 2YOCA 1IC5H 3RWJA 4HWZB 4U1IB 5IT2L 4PRAA 4M61A 1BIIB 4UILL 1OWRM 3MNWB 4R3SA 4OZGB 5LKNA 3M1BB 5DQ9B 1HWGB 3GIZL 1DN0B 2ARWA 3GSNA 5GSVA 2QSTA 5CJXC 2R29L 5HXMA 2AEPL 3QIWA 4FQXB 5IROA 4EI5C 4MAYC 5ALBL 2EDFA 4R4BB 3B9KB 3BWUC 4XGZB 5DHVA 3UPRB 4P2CG 2C3HA 1J05B 3OKMB 1NC2D 2R9HC 3CDYA 2AP2A 3VGAB 1QFWM 4YFLF 3LB6D 3MOQA 4TUKL 1S9KC 3G9AB 4PRHE 3U0WL 5KTEH 1C16B 3U36A 2Y72A 4AIOA 4XPTH 3HZVA 3EJJX 3VXSD 1Z5LB 4P4KD 3REWB 3BVNA 4KDWA 4KKNA 1M1SA 3DECA 4GXUM 5GXBB 1HI6A 4OV5A 1QR4A 2XQYG 2W9DH 1T89A 3QPQC 4IHOB 1FN4A 4LHUG 1LEGB 4CDHA 3O8XB 1NGQL 4D3CH 1OTUD 4EXKA 3UTPE 4AM0B 4AJ0A 1F13A 4MJ5A 1E4KA 3ULUF 3B2VL 3MRLA 4F2MA 1XIWC 3QFJB 4JFFD 4PJAE 3BGFC 3DGGB 5FCSH 2XT1B 3JTTA 1KCSL 3SPVA 1YN7A 2DM4A 4HEME 3T0AA 4NWTL 5I1EL 1AGFB 2HLAB 2HFGH 3TT1H 5MI0C 5I76B 2G2RA 4TUJA 2EYRB 2VDLL 4XP5H 1HZHH 4P5MA 4Q74A 2PF6A 5IQ9A 3VD9A 5CGYC 5DJ2A 5D72L 1E27B 3GK8H 3U48A 4JM4H 4KPHH 4HIXL 4UT9L 4P9HL 5LJYH 1ADQL 1NCTA 3C2AL 4WWKB 2Q8BL 3PWNB 3QFJD 1GPOH 2EDNA 1MF2L 1FGVH 1IBGH 1WUNT 1ZHNA 5HJ3A 3CC5B 5AWNL 1JNHB 4LQFH 5IEHA 2QEJA 3KPQB 4KVCH 4D94A 1I7RA 4LKXB 3PIQA 3CDFA 1FNAA 1G7IB 3QEGL 4X6DF 3QIBB 1MJ8H 1NMCB 1CF8L 5C92A 1HHJA 4XB8A 5BQ7B 3VDBA 4PPTA 4K9EH 3PDOB 4X7EC 1E28A 5JR1H 4U2YA 5GQBA 3SGKC 1T7ZA 3PP3H 3QJHB 5I75C 4OCWH 3X13A 4G7YL 2ED8A 5CSZB 4NBYB 3V0WL 1JPFA 4BM7A 1NAKH 2CDEB 2MQCA 1HSBB 1U93B 5JIIA 1I1CA 4ZDHA 2ADJA 1G6RL 3TVMC 1IC7L 1ORSB 3RJDA 3NCCB 2QADC 3OB8A 3AREC 1BQHB 3WHXA 5F1IB 3QULB 3O2DH 3MLPA 5HHQB 3NCJL 4WGVB 1E6OL 1YA5A 1ZTXH 5FDYA 4O4YH 3S97C 5FCUL 1HK6A 5E4EB 2FX7L 4D2NA 4PJXA 4WY7H 1NBZB 3I9GH 3MJ9H 4MMXC 4Z9KB 43C9B 2D7TH 4C83B 5F3HA 4XPBL 2FYYB 3IETB 4NC1C 1ZEAL 4LAQL 1PGRB 1D3CA 5I1HH 2CGRH 3BKJH 3O3UN 2YPVL 3O45A 5DD6B 3C6SA 4N5UA 3CC5A 3WN5A 4M43H 5AD0B 2UVFA 1I4FA 5IK3B 3SCMA 4MS8D 2ARJA 3I2CL 3MV9E 3G08A 2WM0A 1R5VB 4NNPL 5FO9A 4ELMA 2DN7A 1IC1A 1Q9WA 5I8EA 5IR1B 3KYMA 3MXVL 4BYHA 1S7UB 5HYQA 2C4FU 4HX1A 1JNNH 4RISH 5IOPA 5FYLD 3IYLW 3MRJB 1Q0XL 3O6FB 5I16A 4BFIB 4HXAH 2ZUQB 4XBEH 1R5IA 2J6EL 3ZT6A 5SWSD 5J8OA 2BVOB 4KTDL 2C7UA 5D7JA 1NANH 4PJ7F 3QIUC 4JE4B 1R3JA 1DBBL 1ITCA 3MNVA 2DLHA 5KOVC 5IT2H 3MZTA 5C08A 2WAHA 1P6AB 4YHMH 2XZQL 1C5BH 4BUHA 2P5WA 3MV11 4IIQB 3P0GB 1VFAB 4L29B 2NY5C 5C07E 4J6RL 4JPKL 5IFJB 2OTPA 3FN3A 1KIRB 2NNAA 2DQCL 1ZT7B 1JNHA 1KJVB 4NBXB 4WU5A 4ZAKC 4L3EB 2FR4A 1FBIL 2F53A 3VFVA 1DE4B 4Y4HD 3BE1H 1KLUB 3B5HA 1NGPL 5HHOB 3RNKA 1YQVH 2ZCHL 5JORA 5BS0A 3B8SA 1FBIH 2OZ4A 3MRPB 4JJHA 4OI7A 3TZVB 4L3CA 4HK3J 5CSZA 3STLB 3WDJA 4CVWA 2VR9A 5D8JH 3MA9L 5C0ND 3T0ED 5D2LE 1XCTB 4EVNA 3X11B 5SWZB 2IAMC 2O61B 3MNVB 1FYTA 4ETQB 5IQ7H 1B3JA 4P23D 3CNKA 5FUZL 4XNZB 3QDJB 4NWTH 3DGGA 2HJFB 5D7KD 5HTSA 5IB1A 2CLVB 4BFIA 1T89C 2VDLH 4XP5L 4M4RA 3RWJB 2NY0C 1LO0H 1VFBA 1ADQA 5EU4A 2XOTA 4Q6IB 3WXWH 5K9QG 1IAKA 1NEZB 4G3YH 3ABZA 4U3HA 1WFNA 2BSSB 5I71C 5GPRA 5JW4Q 1TFHA 1MWAH 4W70A 3P77A 4Y5YA 2WBJA 3PL6C 3LZFH 3B9AA 4XVTL 4MNQE 3VFMA 4N68A 5F70A 3RUGF 1FE8H 2FH8A 5CIPH 2NY7L 3L5XH 4QF1B 4WHDA 3VD5A 1SVZA 2P7TB 1KUMA 3QEHB 5L7XL 2EDJA 2NNAB 3OHXB 5GGQL 4J2XA 3G5XB 2RFXB 3FQNB 5EC1A 4KI5F 1UCBH 3RHWF 4U7SA 1P7KB 2VZTA 1J1XH 3QG6B 2XQYK 1I7ZB 4ODSH 3G04B 4PJBA 3PHQB 4PJ8C 5CZKA 4Z78B 2QV2A 4TSAH 2XKUA 1MFEL 1G9NC 4YXHH 4PJDB 2HLFC 4AY0A 3I02B 2DTML 4OGAC 4FQXC 5C0RL 1EERB 3QDJA 1VESA 1QFWH 1ERNA 3RTQB 4ETQA 3V6OA 4Y19E 2H3NA 5H8DA 4UTAL 5B8CC 4Y4KD 4I1NB 4PG2C 5DJ6B 3LQZB 3WEXB 1D7FA 1KJ3L 4KXZI 4Q2ZB 1QO3B 3SKNA 2W9EL 3KYNB 4PJFF 4L3CB 1GC1L 4QHUA 4YAQB 5DZNA 3QUZA 3GBNH 3VWKB 1QSVA 3MXWL 4JR9H 3JXAA 3UJIL 2ORBH 5DFVC 4LKXA 3D39A 4ZOBA 4XBGA 4NN5B 5HGAA 3D2UA 4XNXL 2NZIA 1MCFA 1JVKA 4LCWE 1ZHNB 4NYLB 3SGEH 2JELL 4CNIA 2AV7A 4I3SL 1V8HA 4FQJL 1GOFA 1UZ8B 2NW3B 2JJSC 1D5MB 5D1ZB 5FYJU 2AQ1A 2J4WH 4LARL 4GBXD 2EYTB 2XKSA 3BH8A 4GT7A 4M7JL 3HB3C 3FCTB 3WFDH 1AE6H 1G9MH 4APQA 3Q0HA 2VDKL 5IVXB 4HFUL 1NC4D 3ARQA 3JWDH 4KK6D 1CXEA 4CKVX 5T1DH 3MOBH 1Z2KA 3EYOB 4MA7L 3I3EA 3MRLB 1TJGL 5DRXB 3QWRD 5DJ6A 4NDMB 2APFA 5IHZA 3MOAL 5JXAH 5CLTA 1IM9D 5CIPB 3BZEA 1WZ1H 3VD7A 4Y89A 2ZP0T 4PRPD 1MOEA 3SO5A 1YY8B 4CBPA 3OGOE 5FK9B 1H3TA 1HHIB 4WW1A 1QKZL 3VG0L 2G60H 2EDYA 1RIUH 4YIQB 4H25B 3TZVC 1NH6A 4HC1H 2QR0A 4KZDH 2BVQB 5A16A 3IDMB 1U8NA 2R4RH 3CJJA 4PG9B 1QSED 1N0XL 3CDGB 1J18A 3G6AA 5GISH 5D8JL 5EOTA 4JKWA 2PXYB 3BGAA 3UDWA 3VXMD 5EU6E 4U6YB 4EUPG 4ZS6D 1ZHLB 5C7XL 4PRIE 5D1XD 4WUUD 5DMYA 2GIYA 4NZRL 4KJWC 4LSPL 1D5IL 1S3KH 3GSQA 1R3IL 1YEJH 3L5WB 5DGQA 4ONFL 4HHAA 5IFHL 1HSBA 4LCWD 4Y19A 4ZTPH 1NQBA 1FFOB 1OAXL 3O2DL 4NWUH 3TZVD 1DQQA 1NEZG 5C6WH 2FSEA 4LLYB 4G9FB 1JHTB 3T8XA 1RZKH 3WDIA 5TFSL 1CR9L 3VGDA 4LHUD 3TVMB 4RFEB 4XBPB 1MRCL 4NWUL 4PJGE 1YEKH 1B0RA 2CD0A 3MJ8A 3D39E 5ACMA 1AGCB 1RZ8B 3HI1B 4FNLH 3D1MC 4Y7MA 1WZKA 3E0GA 4GOSA 3LMJH 5I30H 4DGVH 3RIFF 3HC3L 2C26A 3RGVA 2VLJA 4ZSOB 2BDNL 1UWXK 5ABDE 3P0VH 2FO1A 2Z8WC 3K8MA 4OFYA 1T7VA 3FFDB 2NY6D 4P2OC 5F93C 4HDIB 4PRDB 4Y16C 4LGPB 4LPXA 5JPMB 4JFDD 3MNZB 3RPIB 4WUKH 1ZLUK 3MRIB 5DJCA 3C60C 5MEOB 1WBYA 5FGCB 4X7FC 1KBGL 5HHMB 4TRPL 3UO1H 1LE9A 3U7YH 5BXFB 2IANE 1IGYA 5F7KC 4BZ1H 2H9GA 3ZKMD 2NY5L 1LD9A 2W9EH 2IQ9H 2PO6D 2XFXB 1C5BL 5LXGL 3MRKB 1QRNE 2Q3AA 5B39A 1U8LB 4ZAKB 4PLJD 4P4KA 1T7XA 1CDBA 4WTZA 1BVLA 3A67L 2HG5B 2AEQH 4L8CA 4Z0BL 3K2UL 2XQBL 3TPKA 3QWRA 1GZQA 3DVGB 2EXWD 1IGMH 2J88L 1GGUA 2X1XR 3MMEB 4JZJB 4DCQA 1KPUB 4QNPE 4JQXC 3EDJA 4KI5D 3QXVA 4YBQD 2ZCLL 1A7OH 3VXTB 3LEVH 1BJMA 1D9KD 5A2LH 4Y5XC 4U1SA 2HYMA 1H0DA 5B22A 4FQ2H 4NGHH 4CVZA 2KQMA 2IADB 3RVVC 5C0GB 4EIZC 1KIQB 3F62A 3GSWB 4I4WA 2NY4C 4EDXB 5HHPB 4BSVB 4JG0H 3TIEA 3BW9A 5C0IB 1YYMH 5D7LE 3QSKB 4PUBH 2E7HA 1JBJA 4KDVA 5I1IL 4UQ3A 4WI5A 5EZLA 3IB4A 1MIML 4EEEA 2VN4A 4J3OC 3T65B 3AFLA 3E6HB 3GSOA 2XWTB 4GXVH 1JGLL 4G6JH 3JV0A 2B2XH 1ODAA 1UKSA 4X6DB 3SE3C 1MIMH 3N0PB 4LPUA 4KQ4L 3QDMB 4WUUE 5AZEL 5C0AB 4LQ1A 4XCCH 2A0LD 3JWOH 1JGEA 2BHYA 3V0AC 3VXME 3RWCB 5IIEB 1DQJA 1RU9L 1CD0A 5IEHB 4X0KA 3HR5B 4NO2B 3LKOA 4K3JH 5KANI 1NDMB 4LCCC 4OF5A 3N9GL 1ZS8B 1NLBH 3TBVA 3V6ZA 4JJ5A 5MI0B 4JN2A 1BEYH 3TFKD 2Y6SC 3C8KB 5IM7A 4FXGA 5E2WH 4PLKC 1BFSA 4ZTOL 2NLJB 4WEMB 2XN9B 4Z7QF 5KJRH 4OKVA 1N3NA 4AL8H 1QOKA 5EPMA 2AJUL 4MLSA 2WUCH 5EU3B 2Q86A 5IGXH 4D9QE 2ICWI 1T6WA 2R23A 4LP4A 4P57A 1A1MB 5KSAC 3KR3H 2J7LA 3UJIH 4IMKC 1I7ZA 5TFSH 2AJXL 5IEKB 5JXEA 3Q1SH 4YEEA 5D72H 3LV3A 5I15H 4PRID 1MRCH 3PWVA 2RFXA 3FQNA 4UIKH 5DQDH 5T3XE 1P6FA 5B3JE 4PJCE 5E94B 1JTPA 4GO6B 1N5YL 5CKAA 4QXGL 4PGBA 1NFDF 4BQ8A 3GUTB 4RNRB 4AT6A 4JKLA 1OHQA 1RUAH 3JV4B 4GKZB 4Q0XH 4JFFE 4HUXA 4O5LL 4QXUH 2R0WH 1FFRA 4FABL 4IM8A 3B6SA 1PKOA 4XNQB 4LMQI 2NTSP 2VJXA 4RRPG 3TBWB 5IV2B 3HMXH 4OIIL 4U6YA 3S8WA 3SDDC 2DKUA 2P47B 4TSCH 3MRJA 2XN9E 4XCNA 3V0VB 1A3RL 1IEAB 1PD6A 2H32B 4N0CC 2JJTC 3QIBD 4Y4KC 1KN4H 2DAVA 5D7LA 4LVNC 5BJTB 4MA8H 3MUZ1 5C0DA 3C6LA 3R8BB 4WW2C 2PKDA 1BIIA 2X10A 3BSZH 5ANME 4HUNB 4ELKB 4Q9BA 1CGVA 3GMPB 2AJZA 2HH0H 1NCCH 5B21A 4FQQB 5I17B 4HIHB 1TZIB 4CMMB 1MPAH 4GAGH 5E4IA 4UT6H 4TULH 1Y0LA 2Z91A 1GRWA 4N0YL 4FXKB 4G8GA 1XAUA 4LSSH 3OQ3B 5BS0B 5SX4I 1RVFL 2Z35B 5HYJB 2AV1B 1AQKH 3GIVA 4DVRH 2J8UF 2FBJL 1P7QD 4X6CE 1G9EA 4BUGA 3C9NB 3LV3B 2EDQA 4N0UA 3BO8A 2K1MA 3HPJA 3WE6A 4ACPA 5A43C 1JF1B 3H9HB 1KJVA 4OIAA 5C09E 2ZCLH 5I73C 2W9DL 1JHKH 5FGBA 3O2WH 2X4RB 4NKDB 1B4JH 3V5HA 2GT9A 2BFVH 1I3GL 4ZUSA 5F1IA 3RZCB 4Z7UA 4OAWA 1S7VB 2BRRL 4APQB 4ZPVB 4NQEA 3DV4A 4Q6YA 1NMAH 4QHMB 5L6YH 1YUHA 1FHGA 4ZUVA 5T1MA 4Z18A 4G43A 4LPYA 3VMPA 1I3GH 5IMLA 2KBGA 3QHZH 2IMNA 1WBXA 1TNMA 2P42B 3EGSA 2R56H 3U4BL 4MNQD 5F9OH 1R3HB 3D6GA 4HIHA 3ZKQD 2PR4L 1LK3L 5DGRA 3SDCC 4P4RB 2HVKA 3EYSH 3P9MA 1YMME 4Z76B 1EZVX 3SDXF 2FEDD 3W39A 4V1DB 4ZO6A 1TVBB 4YFDB 2KZWA 2VDMH 2Q76A 4Y16B 5DVKA 4WNQB 4S1RL 5F9WC 4WIQA 1WZLA 4NFBA 2DTSA 4WHTA 3NABL 1MHEA 3UPAA 4LSSL 1CS6A 3HUJA 2XWTA 3W0WB 2R1YB 5DMIL 1GGTA 1E4XH 1S9WB 2QBWA 1SJVA 1JWMA 4JFFA 3RU8L 5F72S 3GSXB 2HT4D 4W4OA 1KYOK 5C9KA 3DIFB 2BSTA 3CFDA 4WTZG 3SE3A 1DEEB 4FQHB 3WFBL 1CFTB 2FRGP 4ZQKA 3BWAA 1R24A 4HWBH 4JFZL 4XVSL 4A6YH 5ADPH 1IQDB 3OB0K 4S1DC 2FWOA 2BSED 2GEEA 4M93C 1RK1A 3PGDB 3QUZD 1VGEL 1INEL 4WO4B 3FMGH 4YBHA 3T09A 1KTDB 5A1AA 3V5HB 1SYVA 3GMNA 2EDKA 2CMRH 5HHNB 3REVB 3CLFH 5JHDA 1MJ7L 2ADIA 5KJRL 2BY0A 2DQHH 2F5BH 3ULVH 2F19L 2NY3D 1LO0L 1TMCB 2YBRB 2P44B 3KPOA 2YSSB 4LCCA 3U36B 2YK1L 2VDML 1GXEA 1JGUL 3UC0L 2VDOH 4FFVC 4JRXD 4X9HA 4PJFA 1UH2A 3UPRA 3VW3H 2CLVA 2C5DC 3C2SA 2IPUG 2A0LC 4RMRA 1Y6KR 2HFFB 3D18B 4HWBA 5EO1B 1YNTB 5JIHA 4HLZH 4MD5A 5DRZA 2BNRB 2NPLX 1U58A 5CFHA 4LOUD 2OSLB 3S98A 3RWIB 1ONQB 3PQYB 3R4DA 5FV1L 4BFBD 2E8YA 2XACC 4MZ3A 5ETUB 1X5YA 4R4FL 1X7QA 5GGRB 2X1WL 2CKNA 1NGXA 1RK0B 3AM8C 4JKPH 1B88A 3KLHC 1PG7H 3C08L 4NN7B 5J1AB 1NAML 2V7HB 3FQWA 3PGDA 1TNNA 1IKFH 3M8OL 3ZYZA 1PQZA 3CXHK 2XRAL 3FO0H 4WV1A 4M7ZC 2D7NA 4BSJA 1V7NH 5BOZG 1G7LA 1YPZB 3FFCE 3SDDA 4DVRL 1MJ7H 4C56D 1U3HC 1KCUL 1T3FA 3PXJA 4UILH 3DVNB 1MRDH 5F7WC 5DJDA 5GZND 4HS6B 4LDOB 3ALWA 4MNHB 5CZVH 3D69A 4P2RA 2E6PA 3AVEA 4H25A 1JWUB 4AEHL 4JFYB 1QSFA 5J57B 3VXTA 4D9QD 3VWJD 5HY9A 5DD5L 5JPNB 1N2RA 4XCYB 4C57C 1BLNA 1UT9A 3DXAB 3WIIH 3NIFE 2Z9TA 3KXFE 3IFOA 3PHOB 4YWGH 1T2XA 3KYOA 1EV2E 4OCWL 3IGAB 1I3VA 1RUPH 2XXCB 4LOUC 1A22B 4YGVA 5IKCB 1G1YA 3NGBB 5EO0B 3WFHB 4YDKL 1A02N 4I9WE 2VIRA 5IMMA 1U3HD 4NNXB 4CU8A 1CK0H 3ZE1F 5FGBC 3IKCA 3UBXG 4F33A 1WWWX 2VQTA 4HWZA 3U0TB 4CVZB 3EOAB 5BJTA 3TLRA 2HMIC 4WWID 2F9BT 3B9EA 1R3KA 4UIMA 3IVKA 5C8JA 3KXFB 1CLYL 2B20A 4U6HB 1Q94B 4IS6A 3CFJA 4UQ2A 5EOQL 4XC3L 1JYVA 4NO5A 4S1QL 3ZT5A 5C07A 2VE6A 4XRCB 4Z0XA 4CNIB 3ISWA 1U36A 5H94B 3CDCA 1ETZB 4PJFE 2FB4L 5EFIB 5EOQH 3QCVL 4YJZL 2VKXA 4EN3B 3UTTE 3CLEH 3SBWC 3DJ9A 5E94A 3U9PH 4GRLA 1IAIL 4Z5RA 1G7JA 1D6VL 2O5YL 4JN1H 5DURB 4MAUL 1MFBH 5D7LD 2JCCE 2X4UB 1J11A 1U2CA 4KJYA 3IDGA 3I85A 5F1KC 2PTTA 1XGPB 4YWGL 3NPZB 4PB9H 4RX4D 4JB9L 3BRDA 3DURA 5JTWA 4AZ8A 1YNLL 1YZZA 1YDPA 2FLBT 2MOVA 4G6KH 1M7DB 4Z7OF 1N64L 1P5VA 1KLGB 4P99A 3UMTA 3I02A 5CP3A 1M05B 1JF5A 2IPKB 4KI5E 4Z8FL 1HN1A 3RVUC 1XCQA 4P5TB 5GZOC 1KPRA 3MLRH 3I75B 2EDTA 4HQQH 4K7FA 3EO1B 5JORB 1EAPA 2UWEF 2VZ1A 1XF3B 1KJ3H 3DVGA 3QQ9D 3O2DA 3D3VA 3K4DA 1HOCB 3SKJL 1ZSDA 5ERWA 5F6HI 4LRNL 3MACL 4PGCA 5F7UA 3EKCA 4ZD3H 2DBLH 1XF1A 4K55A 4MJ2A 2V7NA 5DJZA 3NCJH 1TTGA 4XX1G 3GUTA 3B3IB 1OGAE 1FL5B 1NBYA 3AXLA 3PNWB 1RSFA 4KU1A 5ESVA 3NBNA 1A3QA 1NCBL 3MLTA 3ROOA 4U1HA 4ZD3L 3QUYA 5KSUA 4LHUB 4ZUTA 3I6LD 4RGNE 1Y6MR 1MCJA 3QEQD 5KAQF 1FNFA 4G9FA 4QWWD 3LS5H 4HV8A 4PJ5D 4YHPA 4L5FH 3FB8B 2ATKA 2JJWA 3QQ9C 4M7LT 3G9VA 2Q6WA 5F7FA 3D3VD 5IB1B 3OV6A 3R0MA 4OQTA 1ULVA 4E5XA 1K5NA 1KIUA 3WFCH 4KHXL 1GGYA 4HIJA 3QDJE 1A1NB 3BQUD 3V6OE 1K6QH 3DV6B 4JREB 3X11A 4BH7B 3QUMA 3JSSA 5HHPA 3KPSA 4EDXA 1XFPA 1MY5A 1PSKL 1N8ZA 2R2BA 5ALBH 1M05A 3DUHA 1D9KC 1P7KA 2VABA 3OAZH 4JEGB 1CL7H 5CCKL 1XR8A 4N8VB 5L2KA 1U8QB 5ESQA 5AUMB 5MEPB 1VKXB 1NFIA 1T7WA 1WTGT 1DBBH 3ALXA 4QRPE 1LEKB 2GJ6B 2NY1C 3VFGH 3PABB 2Z93B 3GMLA 4H88L 3QXAA 1XF5B 1WJ3A 1XZ0A 5GSVB 1K2DB 2QKIB 3DROA 4OSUH 2BOCA 2XIDA 3MMEA 4L4JA 4G6FD 1P4IL 3PWPB 2F8XC 2BZDA 1L0XA 3BDYH 1MI5A 5E99H 3P2TA 5HI3C 3FQXB 2VLKA 1X4YA 2AV7B 2OXGA 5FFLA 4FZEH 1SVCP 3J8F7 1N6UA 3OBAA 4DTGH 3EO9H 5GRUL 1NUFA 1JZ8A 3QXDB 4YHLH 3VFTB 4I8DA 1OB1A 4JZJC 5C7XH 3MV7E 4LLDB 2DICA 3EIFA 1NC2A 3HS0A 3N50A 3ZYOA 3DNKA 3OKEB 2V2TB 1E6JH 4NZUH 5FB8B 3TF7C 1SJEA 3SDCD 2EKSA 43CAA 1S5HA 5C2BL 2ZCKL 1CDJA 3DYOA 1I8KB 2DLEA 5IB5A 1R3KB 2OL3B 4H8WC 4KTYA 4HJGB 3GDBA 5ISZB 2I5YH 2Y07L 4EI6B 2Y5EA 4PRHA 4PJ5A 3MXWH 4JR9L 4NKIH 5BRZA 1ADQH 3BPLB 5DMGC 2HLFD 4JRYA 1WICA 5FA3A 1AGEB 4DQOH 3PWPA 3AAZB 5FGRA 3FT4B 1EDQA 3OKDA 3GI9H 1C1EH 5I66B 3D2UB 2VLRA 1NMCC 3RWGB 5KVFL 4PRPE 1V3KA 1PG7W 2GJ6A 1LEKA 3P73B 1JGVH 5E7FA 5FKPA 2D7PA 4F57L 3EOTL 5B8CB 4PR5A 5GIRB 3G5VA 1ZLWH 1CWVA 4BZ2H 1N2RB 4XCYA 4XPGH 1MEXL 3JV6A 1CCZA 2HT2C 4LSUL 1T04A 3OMZA 3H42L 5TDNB 3HG1A 4D9RE 5FB8A 5CEZH 1VFOA 1PKQA 2VAAA 2WWMC 4IRSA 1AGFA 1MFBL 4O2FB 2FIKA 4QRTA 2YA2A 3DI2B 3EO9L 5GRUH 2GFBA 5EBMB 4HPYH 4S1DD 5D1QB 2YD4A 3FRUB 5IUSA 1KC5L 4FG6D 1JTTA 5L0QC 4AIXA 3H9SD 1FFPA 2D7OA 1AQDA 2Z8RA 3MJ6A 4G8GD 5HI4D 3V0VA 5JDSB 1LO2H 4GRLC 3SO3B 5GS1A 1RZIB 4PRIA 1LNUB 3KPSE 4LFHG 5T3ZE 4HUMB 5D2LF 2ZKHL 4PLOB 3S34L 3ARRA 4FFWD 3H3PL 3DHJA 2AXGA 1BMGA 3EJYC 3QWQB 5IVXE 2E7CA 5D7IA 4MA3B 3O8XC 3VMOA 2A77H 1G1CA 4GG6B 4GRWB 1G6RB 3NGBC 3UEZA 2FYYA 3GHBH 4TOYH 2V7NB 4NJ9H 4XVUC 3TN0B 3ARDB 4KUZH 2PCPB 1OOAA 4S2SA 4YEFA 1WQVT 4PG9A 3LN4B 3MFFA 1JI1A 3QQ4A 3QXTA 1ZSDB 5ERWB 2VDRH 1JPST 1CDIA 1CIDA 2VLJE 2DQGL 3RHWK 3ARSA 5LGHL 1BJ1J 3HZMB 1QUNA 3STZA 3KPSD 4JPVL 3RIFK 3ARFB 4X5LA 4NHCH 5D9SA 3L3JA 4NT6A 2X1OA 4OCYL 1X3DA 3B8YA 2Q86B 4HK0A 4MA1C 3KVQA 3PWUB 3BIBX 1L7IL 1ZGLP 5D71H 4JHAH 2ICCA 1T4KA 1JPSL 1TQCC 4LSUH 2WWMD 3JZ7A 4XAKE 4Z7OE 4KHXH 4DKFH 2DJ4A 3MUHL 3JTSA 4NHCL 4QT5A 1S9VA 1QBLH 3P4LA 3VXUE 3DO3A 1DSFL 3HCVB 3PJSA 3S36X 4QTIL 2YD5A 3HNTL 2R2EA 4GAYB 2AABH 4PTTB 3LDBC 3ESUF 4MNGE 2DMKA 3BIKA 1HCFX 1SQ2N 3QFDB 2IH1B 3IFPB 1T0MA 4Z7VB 1CDUA 4I2XB 3JUYA 4YHIA 2OK0H 3G5YA 4NPYA 4J6RH 1QFUL 3O3AB 4HKJB 5BV7B 2QQLL 4ZODA 5HYSG 1UQSB 4U3XA 4KI1A 5GHWH 1PX3A 4YHML 4PJEA 1J8HB 3P4MB 1MJUH 3HZMA 1KELH 3LDBB 2Q1EA 1J8KA 4XRCA 3I6KB 4APQC 2BVYA 2O26U 3MO1B 3GHBL 1HHKA 3C5SB 1VFAA 1F45A 3OKMA 2RAMA 1IVLA 1S9WA 4OZFG 4GQ9H 4XWOD 1DQLL 1T1YB 3W0WA 4YHNA 3F12A 3S37X 3W2DL 3OZ9L 4GW5A 5E8PB 5DJXA 3C5JB 1B4JL 2LVCA 1DVFB 3DSFH 4LU5L 1DFBL 5IQ7L 3V5KA 3TC9A 3HAEB 4RGMC 1J9CT 5C2BH 2VLJD 4XAWH 1RMFH 3RL1A 4PBVC 4OT1L 1K8DB 3MRPA 3UROR 5CILH 4F15C 3LB6C 1EVTC 2DQDL 4DOHB 3VXNB 4O4YL 4LRNH 2QQNL 3GJFH 3GI9L 2F53E 1DR9A 1H8NA 2OX5A 2XNAA 4HZAA 4K2UH 1TVDA 1KB9K 1IM3B 2P5EB 1ZOXA 1U8PA 2ZUQC 3VFNA 4NQCB 5IFJA 4OUUB 3GJFK 4NCC1 4YXLL 5E8NA 3O9WC 1SMAA 3B43A 4LLMA 4PY7B 2YA0A 3H3BC 2AI0L 3QG7L 1J8HA 3AU1B 3IAQA 4IOIB 4K3EH 4R8WH 1IGFL 4EUPA 3S37L 2XG5A 5C3LD 4FABH 3QRFM 1BAFL 1BJ8A 3HC0A 1UCBL 3MV7D 1ZKAA 4PRAB 4JFPB 2V9RA 4X80H 5C0JA 1H3WM 1DL7L 1S8DB 2A2QT 2V7HA 4O5LH 3ARBC 4JDTL 1EK3A 5HYEA 3ARVA 1BAFH 3KYMB 4P9MH 3THML 2ICES 1AKJD 1TZIA 2A9NH 3O3BA 4G6AC 3O9WD 1X5LA 2EICA 1GGIH 5ANMB 5IVOA 2HJKA 3LKNA 4AMKL 3C6SB 5FO8A 1GH7A 5J1TC 3Q5YA 5DC9B 2NMSA 1TXKA 5EC2A 4TTGA 4HMEA 2ZUYA 1SYSA 4POZC 3V7AE 3VE0B 1INQA 3NCMA 1IAMA 2JE8A 4P5KA 3RGVB 1LMKA 2X41A 4N8VA 4KKLC 3WKNA 5L8LB 2C3XA 3BKYL 3QQ4B 3MFFB 3KWWB 1WC7A 5FOBA 4OUUA 3VFNB 4JO2H 2EH8L 2FX9H 4U1MB 4UI2A 1RIVL 3MV8B 3KPLB 2XA8H 4ALAL 1DQTA 4XTRD 1QG3A 5E00A 1P7HL 4PYHA 4JFEE 5EUKB 5CP7B 1TPXC 2V2WA 5GS1C 3CXDL 1Z5LA 5I74B 1OVZA 4QHLA 3REVA 1SMOA 4PJCB 3Q6FA 3FB6A 3T0EA 4R96B 3GI8L 2ATKB 2DQFB 3HI5H 4ZFFA 1NANI 3CGTA 3JTTB 3SPVB 3MPCA 2RJMA 1VGKA 1UXSA 1P69B 1CE6A 1LGVA 3ZE1E 5GJSL 1A4KA 3LN5B 3MUGA 1SY6H 4WWKD 1AY1L 1T5WB 3T0DA 5C08B 2LFGA 1FFPB 4MJIB 4UT7H 4BH7A 1XF2A 3QEQA 4N5ED 4L8DA 4NM4H 4U0RC 4CN1A 35C8H 5EIIA 4LASL 4F33B 4RBPH 2DWEB 4YC2B 3PQYD 5ANMA 3T3ME 5DD1L 5K59F 2IAND 4NQED 3G6AB 1OAUH 1RULL 5CEYB 1FH5L 4UNVA 3L5XL 5I1EH 5ACZB 2X4QA 3SKMA 1OWWA 4WWKA 3H9ZA 3EZJB 3ZHDA 3LS4L 5FYJD 2X4SB 3RNKB 3S6CA 3ELAT 3KPMA 5HHOA 1EXUB 1FZOB 1NCWL 1J8HE 2HN7B 1QA9B 4N0UE 5ITFA 3MGTA 5E2TL 4PGEB 1EHLH 5SWSA 4TVPL 4Y5XA 4D9LH 4I48B 4X4XA 4XVJH 1OT2A 5D7JD 1DBAH 5KSBB 3IJSA 4OLWH 3A0OA 5C0AE 3M1BA 1QSEE 1CGWA 4TUOA 3L3DB 1BOYA 3CSYA 5DRXA 4KVCL 3JWOC 4KTEH 1FVDB 3S35X 3QI9C 4PLKD 1CDCA 1EO5A 43CAB 1SJEB 1NGQH 4D3CL 1S9VB 1FRGL 2H2PC 4X5WA 1X5IA 4Z7UE 1DDHB 2W0PA 3RIAK 1CGTA 3BXNA 4HIEA 2WP3T 1PYWB 2ZPKH 2XI9A 4TQEH 1OGAD 2CKBB 4AH2B 2V2WB 4FFZH 4TPRH 2D7MA 5JQ6L 2R2HB 5DJAA 5C0IA 3V5DA 1H3XA 2A83A 1V3LA 5GZOD 3AB0C 3L9RB 3W9EB 2M8XA 2DIJA 2AK4D 5EORH 2FBJH 3FB5B 3OXSB 1WC7B 2W07A 2DS4A 4XNXH 1EO8H 2D0HA 5SX5H 3GK8L 5AD0A 5D4QA 2X9YA 4MD5B 5D96C 3BKMH 2YKLL 1LEIA 1W0WB 3VFWB 2EE2A 4BA8A 5DJXB 1W8NA 2W0LA 4OCXL 5DTFB 4KKAC 4R7NB 4W4NA 3T04D 1JK8A 4EUPB 5SWSB 4C83A 5DMJB 2D0GA 4NNYA 2HVKB 3PG2A 2I9LB 4M1GL 4F3FA 1FPTH 2V6HA 4U1IA 3KYNA 4I9WD 3WMSA 1P2CB 5JDJA 5ACZA 2AXFA 4MJ6B 1Q94A 1TZHA 1G6VK 4ZS6C 4DAGL 4K9EL 1QFOA 4U7MA 4ZFOL 4UTBH 3PP4L 5C0CB 1K5NB 4QXUL 5FYJH 1U3ZA 1G9NL 2YRPA 2AJVL 2AW2A 4HIEB 5GRVK 4P0DA 1Z9LA 1J86A 4O58H 4PJHA 1H9VA 5GRWA 3BH9B 1I9RH 5ECJE 4EBQH 3ALPA 4TNWF 4ZS7L 5C0EA 5SV3A 3O4LA 1IZKA 1BREA 3RFZC 1NSNL 4HQQL 5E1AA 2ZUSA 4PJCF 1CFQB 3TCLA 5L2JB 3IFOB 4JFDA 5BVPL 3DXAA 2RIKA 5SWZD 1I1AA 4P5TC 3BPCA 4Y5XB 3Q3GA 1EJOL 5CJOL 4U6VL 1PEWA 1XZ0B 5E00B 4POUB 3STZB 1FV1B 5IW3A 4X7DC 2H6PB 4G8IB 3WJLC 2AK1H 3MZGB 1X4ZA 2QQKH 4XCEA 3PL6D 1W0VA 2YZ8A 5F3BA 5IB5B 1ZLWK 4GW4A 5E5UB 4LSDA 1A6TB 1YPZE 4M9OA 4PJGB 2JCCF 2NXZC 4QOKA 5JZ7C 4E41B 5KZCD 1L0QA 4XNQA 3BESR 4ZAKD 1YDPB 4DAGH 3SE8L 2YPLA 3H0TA 1OB1B 2IH1A 1NMAL 1FYTB 4RAHA 4F8TA 1BFOA 5B38A 1OARH 1DANU 3LN5A 5JHLH 2N7BA 3F58H 5TE7H 3BKCL 2BHUA 3FO2B 1EFXB 4XCFH 3LQAC 2NTFA 4XC1L 4DZ8B 1I9JL 2XZQH 4PJ8A 1BZ9B 3DROB 5J89A 4PJHF 1UM6H 4P23C 4HIXH 5IBTH 2GTWB 3MV8E 5CZXC 1LE5B 3TBYB 3IU3B 3C87A 3E2HB 5IHLB 4Y4HC 1JF1A 3H9HA 3OGCB 3B5GA 3RWHA 1FP5A 3SE9L 1F58L 5IHBA 3PXHA 3QUXB 5JR1L 3S5LG 3BT2L 1KV3A 3T2NH 5JMOC 3Q2CA 1NEUA 5T5NG 4RWHA 5IF0A 2IQAA 1J0JA 1NUNB 3TIEB 1DQML 3CX5J 3ZKSD 3C5ZB 3DRTA 5KG9A 1CICA 1VA9A 5IJVB 1BFVL 2OL3L 4UV7H 4Y4KA 3FTGA 1JIBA 4YR6B 2YXFA 3QJFA 4HF5L 5BMFL 4HJGA 4I3RH 3TYFA 1FVEA 4OLUH 5FM5O 1MCBA 4JO3L 1F4HA 2GI7A 4MNGB 1IILE 2G5RA 4JFOA 2HFEA 3DI3B 1HILB 4BJLA 5DK2A 2DQIH 3QI9A 1SJHA 3S3JA 1NCUA 4PJAA 5ACLA 5FF6A 3I9GL 3QUYB 4WJ5B 3AMLA 3WN5B 1BBDH 1RFDL 4OFYD 4J3SA 3VXOA 3GSRB 2VR5A 2DM7A 2CRZA 2BXYA 4Z6AT 5DJZB 5F3HB 4L8CB 5EUOF 3P9LA 4KHTL 2A74B 3OSKA 1UM6L 5ISZD 1J1OL 5FXCH 1YJDC 2C3VA 1WF5A 4I13B 4OFDA 3SDXB 4M8QB 5DJ8B 4YBLB 5B3JF 4DKEH 1ZLSL 3BW9B 4HC1A 4L5FL 1IGCL 4P4KC 5DFWH 5J06A 1ZLVK 2G5BA 4UTBL 1I8IB 2XN9D 3MLZL 4AEIH 3NMEA 1ORQB 1DVFC 4LSTL 1UENA 3BP4B 2EO9A 1I8LC 3O3AA 4HKJA 1A1MA 4Z7VF 5DUBA 1KN4L 2NY2C 3KLHD 2VLRD 3U0TA 3DURB 4ZUWB 5C70A 3KJ4C 1ZT1B 4I77L 1KB5L 4ODTL 4PG2A 1BFVH 4UV7L 5JO5B 1A8JH 2QADD 4HUUB 4GRWF 1KJ2H 4UV4L 3TNMB 4EI5D 1RVFH 2AV1A 1R5WB 5BVPH 2HMID 3S35H 2PXYD 4NQVA 2FECI 3D3VE 4EQ2A 4YHKH 4L1DA 4YX2L 3F12B 1KN2H 2AQ2A 3UXFA 2VLRB 1FGVL 4K23L 3D9AL 1RFDH 3TBYA 3PWJA 4NUJB 2Y7QA 4S0SD 4D9LL 5ILTH 3SY0A 3ZT7A 3FZUC 5SX4H 4KC3B 2NY2D 4YX2H 1BQUA 1P4LA 1U42A 4JKKA 3SDAA 3HNVL 1TJIL 4IMLB 2EEAA 4P59H 3U6RB 4X8JB 2Q7NA 1U8IA 5HYJA 3KLAA 4G80B 3QUXC 4PB9L 1OGAA 1MRFH 4PTUB 4MSWA 3B4NA 2WMPA 2UY7A 4JM2D 5HGHA 5D7IB 2CSPA 3VH8B 5F89B 4H26B 1OD7A 1NFKA 1ZT4A 2PYED 3I75A 1RZIA 2E5EA 3L1OL 4PRIB 4P5TA 1KB5A 2J6EA 3SE8H 4QOKB 1A1NA 4LGRB 2EDHA 4OCLC 5H2BB 5ENWA 5K33A 2D4DA 3LQMA 2NY6B 4HJ0D 5E2VH 5FYJE 2ENSA 2D7TL 3K46A 4YHPB 2VZUA 1S7RB 2J12B 2NY0B 3GMMB 4WI9A 1TETL 4L8SC 1KN2L 4WI2A 1CXLA 5DVNA 5E56A 4ONGH 1IGJB 1JUFB 4JLRB 1RZJL 3ROLA 1NCAH 4MD4B 5E0QA 3ORJA 1UKTA 1T66C 4X4ME 3P73A 5H35A 4DVBB 1RZFL 1VFMA 4H1LG 4X6BA 4XMPL 5F7DA 3EYFB 3RGHA 2KDGA 3S88L 3LKQA 3BYYA 1JNNL 4RISL 5HYSA 2R0LH 3WJJA 1KIRA 1Y18B 5E1HB 5HGGS 4PRHD 3ZDXF 2J6EH 2YWZA 4P4KB 4XHJC 2I60L 5HGHB 3K1KC 3QDAA 3VFOA 4O00A 2LTQC 4C56E 4EDWL 1FG9C 4L9LA 4OFKA 1CDGA 1LE9B 2VL5A 5IM7B 4QHNA 2XZAL 2HFFA 5EO1A 3RKDC 3OX8B 1DBKH 2R0KH 4WEBH 3BP7B 4NQDB 3RNQA 3CX2A 1DLHA 2ORBL 4TOYL 5ITBL 2KL6A 4JFFB 1CR9H 1U3JA 5LGKA 4J1UA 4GG8A 5F9DC 1RZJC 4Q9CA 2VLRE 3L5HA 2W0FA 5IWLC 3O6FC 3VXQA 3AC0A 4U0QB 3G6JF 1TENA 2MNUA 5K9JH 3GHEH 4GRLD 1BM3L 4XMKL 2X70A 1CXIA 5L9DH 3K81A 3LPGA 4MNQA 1AHWB 1HINH 1RZJH 3CFKA 3T77B 4ISVB 4KQ3L 4EKXA 1UXWA 2DLGA 5LBSL 1KTDA 2CIKA 1DUZA 5E5MB 5H37G 4CVXA 4FTVB 4IJ3C 3QAZC 2VMFA 1MHCB 2UWEA 5C0DB 1BBJB 4GW1A 2H32A 3C60D 5KS9E 1MSPA 4OGYL 3LRHA 5DQJA 4R4FH 5DWUL 2CRMA 5F9JB 1MHPL 3FT3A 4OQTH 3FHAA 4BSVA 3FOLB 1AI1L 4YZFF 3S3SA 3P30L 4HCRH 3CZJA 3VFOB 5KSVB 3TBWA 2EE9A 3PP3K 2K9UA 4MB3A 2UUDK 1NBVL 5HHOD 2UVEA 3TA3D 1PZ5A 4OGYH 4HWEL 5ID1A 4Y8DC 2I07B 5CUSH 3U1SL 1A7NH 1HKLL 1J0KA 3TFKC 1PEZA 3DETC 3ZE0E 4JM4L 1AD9B 1KELL 3OHXA 3LOWA 1UEMA 4X4XB 2P7TA 3VI4E 3HPJB 3WE6B 1FNEA 3MV9B 2P48B 2YZ1A 2DQJH 5CBAB 3ROLB 3L3IB 5TF0A 2F53D 5J3HD 3QRGL 3JBG7 1JFQH 4NRYA 1AXSB 1U91A 3QIBA 4J3TA 1CFSB 3B2UC 4Q2ZA 5JW5A 1D5BA 3MV01 5CGMA 2DI7A 2EH8H 2FX9L 5ESVB 3PE9A 5BOPA 4P2RB 2CK0L 3CVIL 1QLFA 2HKFH 5B38G 5C0FB 3TYGL 4MXVE 4NNXA 1A9EB 2CRIA 5D6DC 1ACZA 1RU9H 2J8UA 4GQPH 5DJ0A 3VGEA 1RUPL 1R3HA 5J4MA 3QDHA 2NXYB 1DVFD 1DFBH 1NAKL 3GBLA 2D4FA 2X7LA 4WHYH 1QVOB 1D5IH 1T83A 4M7KH 4QHMA 5IMOA 2G2RB 4TUJB 4E5XB 2AS5M 2F58L 4PGDA 3W11C 2VWEC 4DUXA 4KJPC 4U05A 3ET9F 4P2RE 4JFXB 2UY6A 2IBBA 4MXQC 5JXED 5E6ID 4I0PA 5I1DA 3HN3A 5MHSE 2NR6D 1U92A 2YK1H 4JDZA 1I1YB 4AT6B 1CD9B 4JCMA 3U6RA 1JZ2A 2Y07H 5FM4A 5CBAA 2PUQT 3CLEL 3DBXA 1D5MA 4WI7A 1V3MA 2NW3A 3E1F1 2Y7QB 4U7KA 4XVUD 2AI0H 4XH2B 2EC9U 2BVUA 3C6LC 5H94A 2E7BA 4H26A 3SDYH 3H2WA 4KKCC 5FKAA 4OIBA 4FMKA 3HLAA 4PV8A 1L4IA 5HYFA 2C3GA 4L3ED 5FM8A 2AEIT 3LKNB 1TQBC 3TJHD 2DLTA 3B9KA 2IPKA 2IGFH 1ZA6A 2X7LB 1W8OA 5F6IC 1BECA 4TSAL 4HUVA 3EOAA 4YFLI 3THMH 2BVQA 4KMTL 3SJVB 1LDSA 4KRPB 2HVJB 4OJFL 1U6AH 3G6JB 3UTSD 4PRNB 3CH1B 3SCMB 2FHCA 3MLYL 3WIHH 3O81A 4NRXB 3LKOB 5CJXA 2FL5B 1QLEH 5DDHA 3HFML 5F7EH 5CZVL 3U0WH 1ED3A 4AG4H 4AEHH 1W0WA 3VFWA 2C4XA 4DKAA 5K9JL 1JNLL 1ZEAH 4JHWL 1BD2E 2CXGA 3DV4B 4ZPVA 2C3VB 1ZGLA 1CQKA 1TJIH 1CLZH 3IDNB 4NC0B 1HSAB 3UTSA 4QCIA 5FO7A 4KZEH 4RDQG 1QD0A 4X7SH 3SDCA 2CLZA 4ZMAT 3EO0A 3LQAL 4LKCA 3GO1H 4G9DA 1A4JB 2A6KB 5LAXA 3VGHA 1K8IB 4W6WB 2X70B 2CUIA 3OG4B 5I6XC 1REIA 4R4NC 1RMFL 1PX4A 1AXIB 1MHHA 1MLBA 4N8PA 5IFHH 5EN2A 3FO9A 5CWSA 3T4YB 2BRRH 4ZFOB 1RV6X 4NRXA 1Q8MA 3KPNA 2OR9L 1QYGH 4MWFB 3GMPA 3ZDZF 4WW2A 3LIZL 4PJXE 4CVUA 2FLRT 3FONA 4GFTB 4D8PB 5I8OH 3QYCA 1HXMB 4OD3L 3LH2L 4PD4K 4EN3D 1S5IL 1TZGH 2UYLA 5FYLH 2PXYC 1RURH 3TT3H 3FB7A 5ICYA 3HUJB 3IGAA 1KPUA 1HIMH 1EJ6A 3LY6A 3BH8B 3VGBA 3BAEH 1MUJA 2EYTA 3RTQD 2MQ0A 4YDJA 2DJSA 3MV9A 4N0RA 5JLZA 4WNQA 4JPKH 5L7XH 5LQBL 2NY4D 3L9RA 4ELME 3ZHKA 2B2XL 3GMMA 2EKJA 4GMSH 4UB0H 2W0FB 1AD9A 1JPTL 3N1FC 4ODHL 1WEJL 3FTGB 1AFVL 5A2JH 2QTEA 2YN3A 4QRSA 2HLAA 3H9SE 3L5JA 4JB9H 3VXRD 5D1XC 1CXKA 3U46A 4G5ZL 3FOLA 5E2WL 4I2XE 2B4CL 2FGWL 4K3JL 5FUZH 4JPIB 4JFEA 1FNSH 1KTKE 5DK2B 5GGTH 4WU7A 4Y2DD 1UB6A 4G6KL 3NZ8B 3KJ4B 5IW6B 2E9BA 1CE6B 5DO2D 3HCVA 1XGYH 3RBGA 2HVJA 2V2XB 1H3UA 4LLVA 1IQWL 4K8RC 5GGTL 1F5WA 3JVGA 3G5XA 4NZRH 1FSKC 2Z8SA 1ZHLA 2YUVA 1IMHC 1CIUA 4PJXF 4RRPA 1C8PA 1T1WA 3ARPA 4MD0B 2H1PL 1FZJB 3O0RH 3LZFL 4DN3L 5EBGA 1F3DH 1BZ9A 3EJZD 1W0VB 2E3VA 3PWPD 4LBEA 3GRWH 2QQQA 4KFZC 1YNTA 4XPBH 3F7RA 4YE4H 4ELMB 3T4AB 3KHQA 5EORL 4JLRA 4JAMB 1WFOA 3D87B 3NABH 3MLVL 4NO3A 2NX5E 1YEGL 1SEQL 1GGCH 1SYSB 2EYSA 1GHFH 1JK8B 2DYPD 3UBXA 3NAAH 3TA3A 5HYIA 1MCHA 1G7PA 4ZOEA 3KLDA 5J6HA 4OZIE 3HI6H 1KB9J 1OM3L 4M93B 1AXSA 1FFNB 1MIEL 4WUUA 3BIAX 4E0RB 2NTFB 2FSEB 4X6DA 3M17A 5FYJL 5MERA 2YUXA 1BZ7B 3OJDA 4Y5VA 5E70A 5DMKB 2IMMA 2V5TA 4Z7VE 2MHAB 5GS2D 3EZ8A 35C8L 4TNWK 4R96A 1NMBL 2DYPB 4ZG1A 1BQHA 1DL7H 3VD3A 5IW6A 5D1QA 4KUCD 4V2CB 4P3DA 3QR2A 1BWWA 4HF5H 4NN5C 3EGSB 3RY6A 5BMFH 4PGBB 1I1AB 5CINH 1YEHH 5GRYA 4A2MA 3GKZA 5IMLB 1LO3H 2WLZA 3UTZB 2A1WL 2IJ0C 4QNPF 3F7YA 5MENE 3RJQB 3GM8A 4DGYL 4NYLA 1S7VA 4GS7C 1EHLL 3GBNL 1MQ8A 1TJHH 2FIRT 4KRPD 1Z3GH 2ERJB 3KNBB 3VXSB 3TEUA 2KH2B 3PWJB 4GG6E 1DBAL 4JVPA 4ISVA 1F3JA 5GS0H 3VWKA 5F7NC 1C7SA 5CJOH 1VERA 3QIUD 4OZGE 1N0LA 4MQ7B 2X4SA 4PY8J 1KCKA 2ZNWA 2ESVA 3ARED 5CSBA 3PWNA 1OLZA 4UUJB 4KMLB 3WN5C 3RX8A 2P5WB 1Z9MA 2F5AH 4MXWH 1R3LB 5FGCE 3RL2A 4Y8AA 4ZO8A 4HHAB 3OF6D 4CMMA 4EZMA 4WW2B 1F97A 3KPNB 2B5IC 3CFEB 3U4AA 1KIPB 1YN7B 3LKSB 2B0SL 4R7NA 3VFRB 4NKQB 1PG7L 3C08H 5GJSH 4GUPA 5EN2B 1PY4A 3AREB 1FLRL 1OARL 3EYVA 3D5OF 1A7QH 5CHNA 1T1YA 3DRQA 5TDPB 3DTXA 1KIQA 2DLFH 3LKRB 3QUKA 1U95A 5I0DA 1B2WL 1NGZB 5C0NC 5MEOA 4CW1B 4IBLT 3U30C 1J0ZA 3BGMB 4JFDE 5D7SL 3AS2A 1CU4H 1HZHL 1QLRA 2A74A 3BAEL 3QULA 2Z8VC 1NFDB 4GKZA 3O4LE 1WAAF 4KRPC 2FH6A 2QHRL 1YEFH 4LHJB 2ZG1A 5ILTL 3GSRA 5DUPH 3IRPX 4OZIA 2WW8A 5SV4A 1C5CL 4OCMC 4AEFA 4PRPB 1MCDA 5GS0L 1NBZA 5DT1H 5F71A 4Q6IA 3RWHB 2VH5H 4ODUB 4HWBL 4JFZH 4XVSH 3TO2B 3VH8G 4YXHL 3CMOH 3HAEH 4MNGA 4WUKL 4XB7A 3TYFB 2OL3H 3LEYH 4NQDA 2XPGA 4QEGA 4CADB 1CF8H 1CLOL 4QT5B 3C6LB 1OAXH 4WWKC 3IS0X 5EBLA 3UO1L 4XHJD 5CEZE 3RP1A 1XF2B 5C86A 3KPQA 5A40E 3I50L 3IJHA 2PW2A 2WSKA 1JZ3A 5HPMA 3OR6B 3L3KB 2HN7A 1WIUA 3CFCH 1EMTL 2GCYB 5ICXA 5DR5L 1IQWH 2AJSL 3D25A 2O5ZH 2XWBA 3L5WA 2FHFA 5T1KA 4TVSa 5BO1H 3NA9L 3BDXA 3BN3B 1R0AH 5KSUB 3V6FB 3EFDH 5D1XA 4KK8D 1XR9B 2CIIB 1A14L 1CD1A 1K85A 3KR3L 4IDLA 4K94C 4ODXA 32C2A 4NM8L 1MREL 3F8UB 1ROWA 1P4BL 3GFUA 4KHTH 1EXUA 1FZOA 4ZNEA 3U9UA 1HKFA 1UWEL 3QDGB 4M7LL 1HDMA 5JQHC 3K8LA 1XIWA 3FQTB 3ZMRA 2XTJC 3HI1A 3KHOA 3LHPH 4FQPA 5FECB 3ZTNL 4OLXH 3RTQA 3F5WB 2UUDH 5EU3A 3U4BH 4LIQH 1ZHKA 5BS0D 2P24A 2X4PA 3MGOB 1QYGL 4WGWB 3PF2A 1TTUA 1UADC 3VU2A 4AMKH 3BISA 3MC0A 5EWIH 1KB5B 4N1CA 1FFOA 1AR1D 1IGIL 1QSFD 4F80A 4OIIH 4PJGA 1NPUA 5I75B 2Q87A 4H1LA 4NSKB 3V4PH 2GYSA 4GAFB 4PRBA 4PGZA 2VISB 1CBVL 1MRDL 4S2SB 4AENB 3KG5A 3ARDA 1LEGA 3GMQB 2HH0L 3U30B 4KZDL 5EUKA 2FR4B 1ACYH 4UZGA 3V6FA 1FC1A 4HH9B 1N6VA 3L7FB 4OKDA 3QDME 5CP3H 3U2SB 3SKOB 2VUYA 4MAYB 2OJEA 1ITBB 1TJHL 4N90E 2BSSA 3VFGL 1HHKB 1S7WA 1BHGA 2VTFA 3N1QC 1RI8A 2IALB 3OJVC 1FAIL 3IDXH 5TE4L 2B5IB 1UWEH 4RA3A 1ZANL 3OKOA 3O9WB 5DLML 1CK0L 2B1HL 2X40A 1H15B 1FFQA 2EIZB 4NQDE 5FGSA 3RVWD 1CE1H 1ORSA 1OAZL 1BWMA 3BXNB 4FQ2L 4NGHL 2X09A 1IL1B 5K9OB 1A6WL 4YHLL 1I1AC 1W2KT 4UT7L 2YD6A 3RL2B 2QJDA 9CGTA 2FO4A 3MLUL 1BVKB 2ITCA 5HHME 3RDTA 2P5WD 3T1FA 2PYEB 4KPHL 5IB3B 4ZXBA 4OI8A 1II4E 1T2QL 4WFFE 4J23A 1NDGB 3QIWC 4R90L 4MAYA 4OGAD 4BKLA 1GGBL 2G5BB 3IKKA 5DD6A 3BP5B 2Z0BA 1O7SA 4XCCL 4JO1L 3AAZA 3AS1A 3RVTD 5E24E 3VFUA 4HEPG 3FFCA 4MDIB 3C8HA 5DJ8A 1GIGH 2ICWB 1NGZA 4FFWC 4M6ML 4PS4H 5I1JH 3QRGH 1FE8L 2R2BB 5IHUL 2BY3A 4MJID 2FJHA 5KSAD 4LCYB 3QA3A 5DMGD 5FUOL 5GRXG 3MJ8B 3UTOA 4HT1H 3TV3H 5ESAA 4LLDA 2SEBB 5ITFB 4RFEA 4XBPA 5I1JL 3NN8A 3N9GH 1OAKL 4QHUB 2FECL 1YQ2A 3O9WA 5J7CC 3GJFB 3M8OH 3QNYB 3CVHL 1DQQB 4JANA 1SHMA 3QNXA 2H3NB 5JOEA 4APQD 5K93A 3L3KA 1X5KA 1RIHH 1N64H 3ZTJG 1GAFL 1RZ7H 4FQ1H 4IHOA 3VRIA 1LO2L 1XH3B 3O45B 2X5PA 2YWYA 5FM5M 3VCLA 4XMLH 1AH1A 1AD0A 2H45A 4ODXB 4HPOH 4Y88A 4JO2L 2Z31C 2JIXA 4KROD 4DQOL 2AJXH 5IROC 1TCRA 4TVPE 3HMXA 1P4BH 3OAUH 2DBLL 3QEUA 5IBUB 2EXYD 5CJ5A 3Q5TA 3HE6D 2R1XA 1QSZA 1I9EA 4R26H 4Z95L 5DQDL 1FORL 3NIGE 1LP9B 1MCPL 3FFCB 3L5IA 1AC6A 3DYPA 3WLBB 1YNKH 5I19L 3OKLA 1JP5A 4OF0A 3NFSH 1J1OH 4NN6B 2PO6A 2WUBL 4R26L 1EPFA 2J1KA 2BX5A 3GB7A 2VXSL 4CJ0A 4HSQA 2B8OT 4Y0GA 3LRSA 4O2CB 3PWUA 1UFUA 4J7RA 1T0MB 2OJZL 2VDPH 1AI1H 4OZHF 1KFAH 2B0SH 1K6QL 2K3TA 3BUYA 2FO4B 5F96H 1D5ZA 4LRIC 1E4WH 4PTTA 4N8VG 3U1SH 3WFCL 4RZCA 3PJSB 4P48A 4HS8L 4M1CC 5TQ2H 2EE6A 1TCMA 5FV2A 5A2KH 5BZWA 5BQ7A 4JM2C 3RVUD 1B6DA 4DFIA 1UM4H 5C9JB 2H41A 4PJCA 3KYKL 3CU7A 3QEHA 4YQXL 1MFNA 2A6IB 2VLMD 3DSNA 3VG9C 3V7MA 4U1LB 3KPLA 4BELD 1JFQL 3CUPA 2HTLC 1MJJB 5DD0L 1P2CA 3BGMA 1EZVY 3WS6A 3ZE2E 4HGWA 5JLZB 1PW3A 4NHUA 5D6CA 3SCMD 1CICD 4MQ7A 25C8L 5DT1L 2N1KA 2HJLB 4OCRL 4GMTH 2P4AB 1GL4B 4OGXH 1FORH 2R4SH 3WO3B 3VXSA 2Y36H 4RMUA 3QO0B 1P84K 5J56B 3ETBF 3IAPA 4LVOC 4DEPC 4LLVB 2VZ3A 5KOMC 3MNWA 4R3SB 2D03L 1YNLH 4P3CL 5J6GA 5BVJA 1E6JL 4FTVE 4ODBD 4PJXB 3C5ZC 2DMCA 1W72A 3ARDC 3RIAF 1UH3A 5JOFA 4NO0D 3L95A 2ZG3A 2P5EA 2ADGA 4XNMA 5JQ6H 5F9WB 1JJUA 5KVDL 4A6YB 5E95B 4OZIB 1JTOA 4N8CH 3FRUA 4YHZL 3HMWH 5TF1L 3TPUB 3T2PA 4YO0A 2IG2H 5HY9B 3EYQC 3L1OH 1T1XA 1S7UA 3HNSH 3RPKA 3BPNC 4OM1L 1VENA 4NRZA 2HFGL 3TT1L 3QHFL 4F7PB 4XMKH 4NO0B 3UC0H 5GGTA 4K94H 5AAWA 4NQEE 1T66D 4XXDB 5E8NB 3RUGB 3VFSB 4LCUB 3T3PE 2FD6L 5DEZA 1ED3B 4X5XB 4PJBF 1AGBA 1JPTH 3R8QA 3UBXB 1JI2A 4LLUA 1VKXA 4YHIB 1QA9A 3B83A 2MCPL 2HJKB 1F2XK 4OFIA 3NZHL 2ZUVA 2LQRA 4PJAB 5L8KB 3K7UA 5C71A 1X5AA 1XGTB 1QO3A 2VXUL 3SJVA 3CH8A 1I85A 2VR4A 4AQ1B 1FNHA 4FZ8H 4XXCA 5FDWA 1ZA6B 3WS3B 5HPMB 2VLME 1QRKA 3P40A 1SEBA 1FO0B 4YBQC 4CMHC 5KVEL 1K4CB 4K3DH 3GGWA 3CVHH 1U8KA 7CGTA 1F02I 3MV7A 2OP4H 5E8OB 4OLVH 4OZHB 3O4OC 4Y2DB 1BQSA 5D7JC 5HVHC 3UTSB 1J5OH 3D85B 3TBSB 3ES6A 3TIDA 1XGQA 3IRZA 3ARGD 2R2EB 3CMGA 3QG6A 4L4VB 4MJ5B 1IZJA 3ARBD 5C3TA 2P49B 1CLZL 2VLKB 3FQXA 3PV7A 4NO0A 1AJ7L 2DQFA 1RZGB 3PGFH 1LVEA 1KULA 4X7SL 5KZCB 2Y06L 2FCBA 4PJEB 1YY9C 2DQEL 2ZSWA 4HXBL 4MB4A 5F97E 3S37H 1D9KB 3IXTA 3QISA 3VXSE 3INUL 1F6AA 3D85D 2GJ6E 3O6MH 3G6JE 1CTNA 2GSIB 4ZUUB 2ADFH 2R1XB 4HFWB 1BZ7A 3OJDB 3MLSL 2Q8AH 5MENB 5JOFB 5T1DL 1OLLA 5TGBA 4L4TB 2FZ3A 4OZFA 4GKSA 3BZ4B 2AJYH 3A6BH 4C58B 1PG7X 2P5EE 1M7DA 4OM0H 3DMMD 5DRZB 3F58L 3V5KB 2I5YL 1KIPA 5F7YC 5ID0B 2J8UB 4E41E 1RURL 4FQCL 1NBYB 3AXLB 1YYLL 1SEBB 2XZCH 4MWFA 4UBDD 3ZLQC 4MCZB 2DBJA 5MEND 2DJUA 2P5WE 3OJ2C 1DQJB 4N1EA 4UT9H 1MLCB 1Q0YH 2YRLA 1MCCA 5FKPB 4JCLA 4RGOL 4RDQF 4RAVB 3CUPB 4YDJB 4F7EB 5E6IC 5EU7E 4ORGA 4X99A 3OPZH 1LWRA 4PS4L 3BKYH 1QRND 2A9ML 2EC8A 1FH5H 5CP7A 3MJ7A 3MLTB 1RJYA 1Z3GL 2AEWA 1RIVH 2QSQA 3DMMC 1WGOA 3LS4H 1OGTB 1A7RL 1B4RA 3HC4L 3NIDF 4OSUL 4Z7WE 4JRXE 3W82A 5F1SA 4LLMB 4PY7A 2V5SA 1PZ5B 2VAJA 4LSPH 1MCOL 5JW3L 5DEFB 1CZ8H 3HE7D 3OKYA 4WU7B 2QADB 2CKBH 5IESH 4ONOA 1MQKH 3BP5A 5IFAH 3S5LB 5EU6D 2DLIA 5IJKC 1HH6B 3WIHL 4ZOCA 3VFTA 3U7WH 3MBEB 4LCWB 2JJUA 3WFHA 3STBA 4X6EA 5L8JB 2JF1A 1D5BB 4PBXA 4JPWL 3SQOL 2H26A 1OP9A 4YPJA 1I7UA 4G42A 1MCIA 5CEXB 2OXHA 4QLRA 1U58B 2A73A 3QIBC 2GSGA 1P53A 3LMJL 3KXFA 3MRHB 4P9HH 1K2DA 3C2AH 2IC2A 1AGBB 4FOMA 4Y1AB 5HGBB 1FVCA 3W81A 2ENYA 3MLVH 2EDEA 2HJLA 2W91A 5IMKB 4R8WL 1J0YA 1YEFL 2WUBH 3ARGA 3OR7B 2FD6H 1JMZA 3P0YL 1BOGA 1A7RH 5T5NF 1RUQH 3P11L 4H1LB 4PJBE 1U95B 4H8WH 3IFNL 4FMFA 4GAJL 5TDOA 5C8JB 3WHXB 4HIJB 3H9SA 3VFRA 1EA9C 3BFOA 2V2TA 3L3OA 2H2PD 4H0HB 2P24B 2X4PB 2DYPA 1ZHKB 3RZCA 3DX7B 5ESAB 3MLRL 4I2XA 3WNKA 3FJTA 4TRPH 1JHLL 2XZZA 2FEEL 2Q7YA 3FO1A 4CN6A 3O6KH 3IDYC 2WIMA 4ZFGL 5HI5D 3RWIA 5LVEA 3U7WL 2E7LA 2VXVL 4HBCL 2BMKA 4PR5B 1BF2A 5GIRA 3N1MC 3K2UH 1AIFA 4F7EA 4ODVH 3U46B 2W38A 3DVIA 3BEVA 2Z35A 1E6OH 3FQRA 4HWUA 1ZV5A 3DO7A 32C2B 4F9LA 4Y4FD 3MBXH 2XTJB 1PJ9A 3WFEL 5J12C 1I1YA 1NL0H 5DD5H 3MCLH 3BP6A 2R4RL 4GQ9L 4WW2F 4KH2A 1UWGH 3BDYL 4UDTA 2XTLA 3BN9C 5CD5C 3RGVC 3ULVD 3B5TA 3GHEL 1C7TA 4PJ9D 5LBSH 4B7IA 2CK2A 2ADFL 4ZFZB 2X4QB 3SKMB 4MQXD 1WLHA 4PJAF 2KKQA 3RZCD 1NL0L 4U1NB 3T2OA 4PYGA 3BDBA 3WSQL 1WFTA 1HINL 2BOBA 1X7QB 4U1HB 1EFXD 5SWZE 1BIHA 4OZFB 4R4BA 5KS9F 3B9KD 4QRRA 4V1DA 4JG0L 4MA3A 2R8SH 4LSRH 3QEQB 2VKWA 5I1IH 2IF7A 5ID1B 4F2MB 5DJYA 1ZS8A 2EEBA 3AM8A 1RUKH 1HKLH 3O0RL 2KUTA 3WUWB 3EAKA 4P46A 3BWAB 1MWAA 4O58L 5E8EB 5JNYA 1A1OA 3NPSB 1F8TL 1FLRH 1T2JA 4PJ9C 4U1KA 4Y16D 1H3VA 2GY5A 3PWVB 2J3SA 4QHLB 3GSXA 4HK0B 1I9IL 4ONGL 5C6TL 3V4VH 2GK2A 5AWNH 3ARFA 2CIKB 5E5MA 1QLRB 1FL5A 5DUPL 1CICC 5GHWL 3MJ9A 4S1RH 1RHFA 1FJ1B 3AMKA 4QY8B 1NKOA 4I0KA 1O7VA 1S9XA 3JUZA 2XTJE 4JAMA 5IBTL 1BD2B 1MCOH 2D3VA 5C0CE 4G7YH 2CR3A 3DV6A 5EULV 4J4PD 2KQNA 1ZT4B 1DEEA 4FQHA 2Z91B 1KT2B 1MCQA 5J1SC 4G6FB 3VFPB 4KDTC 4D9RD 5FYKE 5F88A 3MRQB 3MGOA 3EYUL 2Y4SA 5IW1A 3V6BR 4Z8FH 2W1NA 1MFEH 1FRGH 1EMTH 1CQYA 2NCMA 3CFJB 3T1FB 1KACB 1KXVC 2GK0A 4OLVL 3MUJA 2I9TA 4X5XA 3CU1A 3I50H 4OT1H 2CPCA 4LHUA 3OKEA 1UM5L 1W72L 4F37F 4R97B 4F7PA 2BC4A 3B6SB 2XQBH 4M8QA 1H8SA 1E4JA 4NIKB 2ZUTA 3WNPA 4OCXH 4M6NH 3HE6A 3QXDA 1HSAA 2V9TA 4XVTH 2F19H 3OG6B 4GXUN 5INCA 4P9HC 4XH2A 3O4OB 2QSCH 5HGBA 4TNVK 2DWDB 5M94B 5F7DB 1F90L 3F7YB 4KJQC 4HKZB 2R1WA 3MA7A 4JY6B 5I1GL 3BX7C 1QZ1A 4F57H 4K7FB 4XWGH 5E2UL 2V17H 4R2GC 3EBAA 2L7UA 4LVHB 4HH9A 4P3WA 5JO5A 4Z7QE 3T3MF 1TVBA 5DRWA 1F42A 4V1DE 4BQ9A 2NZ9D 4Y1AD 4NUGH 4JFXA 1IKNC 4PJ5B 4YHYB 2NX5D 4NM4L 5AUMA 5MEPA 4V2BA 4HPYL 3WKML 4PJ5E 2GT9B 1VFUA 3HMXL 4PUBL 5IW1B 5EG6C 5T5FH 2BK8A 3X3FH 5CD3A 4QRQB 1EGJH 3BPLC 3MV9D 3S5LA 3MRFB 1IM9A 1ND0B 5D93C 4M1CD 1IL1A 1GJIA 1B2WH 4PRPA 4ODVL 3F6LA 3HUJF 4OJFH 3ESVF 1I9RL 3X3FL 2WWKT 2VLJB 3TBVB 3V6ZB 1GGIL 5T33H 4OGZA 5KSAA 2HFTA 5D2NB 3VXQB 4FXKA 3Q6GL 4G8GB 2Q6WB 1FLTX 2NY6C 1X9QA 4Z7WB 1NFDA 3P9LB 5C0FA