1P84K

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
107
structure length
107
Chain Sequence
DIELTQTPVSLAASLGDRVTISCRASQDINNFLNWYQQKPDGTIKLLIYYTSRLHAGVPSRFSGSGSGTDYSLTISNLEPEDIATYFCQHHIKFPWTFGAGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 15
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2003-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p84K00
4FFYL 2Y7QA 3TV3L 2YPVL 3DX8A 2UYLA 1N5AA 2NY6C 5D1ZD 1GGUA 4XP1L 5DYOB 5C09A 1K5NB 3OX8B 2IEPA 4UV7H 2AGJL 5F3HA 1XR8B 5IQ7H 3A6BL 2LVCA 1LEKB 1BEYL 4G3YL 4QRRE 3L3KA 3VWKA 5GS0C 3WS3B 3OAUH 1CFSB 5GZNC 2HTKC 4YXLH 2Q86A 2AJYH 5ICZB 5DJ6A 1MHPL 3BN9C 4MCYB 3MLUH 3QFJA 2B1AL 5I66A 4PGDA 4HH8A 2VLKA 4OLYL 5JMOC 3ZSTA 4XWGH 2K7QA 5LBSL 1LK3L 4PREA 2BRQA 3C5ZD 2EE3A 5DGQA 1CGSH 1FH5H 3HHRB 4CU6A 2F54B 3BQUA 1ZLUK 5F7YC 5DZOA 3LB6C 3DROB 1XF4A 1FO0L 3VGGA 5TQ0L 4P5MB 3T77B 3H2WA 1OVZA 4J2XA 3KPNB 4WIQA 5JO5B 5KAQF 5FKAB 2AKRA 1R3HA 1M7IB 3M17A 3MV9A 1MCSA 1S7XA 1VERA 5C7XH 1KPVA 1KIRA 5B38B 3OKDA 1T5WB 3VFVA 2B7DT 4FQHA 1NMAH 1ORQB 3LH2L 4JFYB 4JLRB 1EHAA 8CGTA 1JMZA 4HG4J 4AEIL 4OZIB 3CFCH 4G5ZH 4HLJA 1NGXB 1T2JA 1H8OA 3CZJA 4CVUA 1WSST 1ZGLB 3UO1H 2NX5B 1MCRA 1Z5LB 3FB5A 2ERJB 2MQCA 3D5OF 3VD5A 5J11B 1OB1A 3DLQR 3P0YL 4NYLB 4XH2B 5IW1A 1D5MA 2J88H 2JB5L 1CL7H 4ZO7A 2YZ8A 5J89A 5T3ZL 1ZWIA 3Q5TA 1SVCP 5FUZL 5B3JE 4Y5XC 5I8CB 4AT6A 3B4NA 5INCA 2D2OA 4NWTH 4WFFD 4AG4L 3KR3L 4DEPB 3DUSB 1I8MB 2AK4E 3VU2A 4AH2B 4B53A 3GBNH 1MI5B 4Z18A 2JB6B 5SWSD 5JPMB 4WI3A 5TF0A 3S36H 3JV5A 1FZJB 1ZV5A 4L5FH 4FS0A 1D5ZA 1XF5A 5BV7B 1I1AB 4KROC 4HWEH 3MBXL 3BKMH 3X13A 4CNIB 1FNSL 1KSRA 2HKHH 4I77H 5ANME 2BC4B 5ALBH 3EYSL 5FCUL 3V8CA 1AD0A 5GGRB 2H6PB 4MA8L 4JN2A 3QXTA 4LSRH 1RUKH 1G7IB 2XPGA 4E0RA 4HKZB 3IRPX 5I2IB 3PL6C 1NQBA 4WNQB 1NCAH 3WNKA 3FO0H 3O6FC 4NM4H 5TDOB 3DMMD 3P4MB 3FO2B 2Y72A 4S1QH 2ZJSH 1QHOA 3QT2A 2KL6A 3STLB 3O2WH 3PUCA 2C4XA 3OXRB 4I0KA 4IMLA 1OGAD 3PXHA 1D9KD 3QCUL 3FO1A 1BM3L 1I7RA 3MRMA 2OR9H 2CH8A 5C0AD 2X6MA 2ARJA 3WHXB 4UDTB 1IBGH 3P30H 4JKWA 2P8PB 4F2MB 3EFFA 4JAMA 3O3AB 2EYRA 4KGLA 5HYSB 2BVEA 5I73C 1JGLL 2HJFB 5EUKB 1BWMA 3CFKA 1CICC 1L4IA 5KANI 3RHWK 1DVFA 1MJJB 3IGAB 4RWHA 1UZ6E 5KVEH 1S5HA 1AE6H 4MD4A 4G6KH 2VAAA 4N0YL 3ZE1F 5I1HH 4U1SA 4M03A 3RNKB 4K94H 3CC5A 5JHDA 2ZUTA 4L4TB 2O26U 1KNOB 1X5AA 3SGEI 1SBSH 2JE8A 3QUZD 1MAKA 1U58A 2J6EA 3TNMB 1IGFL 4KK6D 3K4ZA 2FJFA 3EOBA 6CGTA 1G6RB 3GSUA 2BVTA 4MNHA 3P3YA 2NY1D 2VXSL 2EIZB 4PRPA 5D7SH 4R4FH 4O2CB 1TJHH 1QPXA 5D7JD 3UZVB 1JGUH 5T3XD 3QCTH 4GLRH 5F9WB 1KJMA 4BQ8A 2OI9C 2ZCKH 4LAJH 3MLZH 1D6EA 3GSVA 5F6HI 2WP3T 4L3CA 2W92A 4NQDD 4Z7VA 4NBYB 5FB8B 3BJLA 4LF3A 4LARL 4HUVA 2VAJA 2DBLH 3WXVL 4LEOA 3H9SB 4PB0H 2R69L 5IHUL 2VXTL 5EFIA 5ID0B 5F1IA 3T0VA 5E6IA 15C8L 1SJHB 4I13B 2P48B 1CFNA 4EN3C 3RVXC 4QRQB 4R2GB 3ZT7A 3VD4A 5BZDA 2DI8A 2VN4A 1DLFL 5F9OH 2P5EA 5IT2H 5GSVB 1M05A 1OARH 3RVWC 5IFJB 1EAPB 4HJJL 2X09A 3SDAB 2FLBT 1KTLA 3BD4A 3PWJA 4KKBD 1A4KB 3FQXB 3REWB 3OR7B 4DWHA 4PJXF 4MCZB 2A9ML 2XT1B 3WS6C 3QDMD 1KLUA 1DN0B 5K93A 4DN4H 2CDEB 3DX6A 3QQ4A 5J1TC 1SEBA 4OJFH 5CMAA 4Z7UF 5I9QC 5EU5B 3STZB 5CJ5A 4HC1L 1T2QL 1TCRB 5K59E 1LDSA 4MD5A 1A5FH 4H20H 3O9WA 2ADGA 4GW4B 1J8HA 1KGCD 1P7QB 4LLYA 5DEFA 5IHZB 5FO9A 3HC3H 3MRFA 4JFZL 4JRXB 5IIEA 2I5YL 2AAVA 3O4OB 5EZJA 3B9EA 1I4FB 1OGTA 5HDQH 2CJUH 1P2CA 2CLRA 3S8WA 4FQ1H 3PWVA 3EO0A 3OF6A 2VYRE 3B9AA 1RIHL 3VRIB 1QQDB 2HJLB 5EU6D 3IXAB 4HK3J 1WZKA 4ONGH 2FH8A 4M61A 3FKUS 2E6PA 4QHMB 1HHGB 5BRZA 5E4IA 2YD4A 4U1GB 4HS8H 5FO8B 3TN0A 4P5TD 3RBGA 3ZDXE 3RVTD 4BQ6A 1JFQH 1IAMA 2ZUQB 2FL5B 1JNLL 3FFCE 1AD9B 4M7JH 2JJSC 2VLRB 1IMHC 1OP9A 1PW3A 1N0XL 3L3DB 1HYSC 4YPGA 2I26N 3ZKNC 5AZ2H 3PV7A 3FN9A 4TNWK 5D5MA 3VWJA 4RFEA 3DHJA 1EAJA 1AGDA 3OZ9L 4OZ4B 1M7DB 3C2SA 1XCTA 3P9MB 3U1SH 5HYJD 2W07A 5CWSB 1A6AB 3V6ZB 4XNQB 3MUZ1 3HMWL 1MRFH 4PY8I 4GMSH 4XMPH 5IFAH 3CVHA 2WINA 3ARFA 2G60H 4D0BB 4YJZL 1MLBA 2CR6A 5DT1H 5I1JL 5KSAB 4KJPD 1I7UB 1ZHNA 1RURL 1WBZA 3BUYB 2V7NB 3EJJX 1XF2A 4GAYB 4MJIA 5EU7C 1NANI 1ULVA 2GJ6D 2YKLH 1IGTA 5IJVB 1A3RL 3LQZA 3S35X 1R3IH 5E24E 4HGWB 3MLTB 1DLHA 5HGHA 1HQRA 2VZTA 3O6KH 4DW2L 1FN4B 5F7FA 4XPGH 1NAML 1L7TH 5C0IB 4FZEH 1FLTX 3S37L 3Q6FB 1Q1JH 3QI9D 2R4RL 4UTAL 4EIZC 1YEDA 1IM9A 3LS5H 1YZZA 5C0BB 5C3TA 1SHMA 4E42A 3AMKA 1CGWA 2DWDA 3U7WH 1ADQL 2YOCA 2BDNH 3GUTB 3VFMB 1T0MB 3RKDC 3TA3B 1BVKA 1CFTA 3QUXA 5DK0A 1INQB 4KMTL 1T1YA 4ZDHA 4TPRH 2V2TB 4LVEA 3VDAA 1I3GH 1EO7A 5EZLA 4KGJA 5L8KB 1MY7A 5DWUL 1U95A 3V9FA 4ALAH 4N0FB 4YBHA 5I18L 3QIBA 1EHLH 1KN2L 3RZCD 3GMRB 4OZHB 1WCBA 4M93B 4U0RB 2P4AB 5T1LA 2VITA 4RGMB 2AXFA 3H9YA 3IB4A 4PRAB 4JFEE 4M7KL 3RUGA 3IFNH 2CRIA 2DQGH 5BCAA 3FFDB 4M1DL 2V5TA 2CKNA 3VGEA 4YHOH 3RL1B 1JPFB 1MRCL 4L4VB 5D2NE 5EA0L 2NY5L 2P5WD 1JZ8A 4DVRH 3SKJL 3ARSA 2DQDH 2V9TA 4XP4H 5MENB 3B83A 4OGAD 4OD2B 4UI2A 2NY5C 4JKLA 4ZUTB 2YK1H 3MOAL 3IRZA 4OIIH 2GJZB 1CVRA 4Q9BA 3KYNA 5MEPB 5EO0B 4OKVA 1O0VA 1TJIL 1RIUH 4RX4D 1Q72L 3U46A 1QBAA 2D7QA 1FAIL 1KB5L 1CF8H 1KCVL 1A7OH 3BRDA 3NABH 1KEML 1H8SA 4U6HA 4MB5A 2Y7QB 3DX8B 2UYLB 4NGHL 5ISZE 1N5AB 1QSVA 5HHOD 3L9RA 2J8UA 3Q5YA 5KW9L 5C09B 4Y8DC 2EH8L 1AGEA 3KJ4B 5F3HB 5F9DC 4ZMAT 5GSRA 3QQNA 3WCYA 3L3KB 4I18A 3VWKB 1V3KA 2Q86B 1VEPA 2BHYA 5DJ6B 3TVMC 2Q8AH 3BSZH 2WW8A 5GRJL 3C60C 4PJFA 1U8QA 2IH3A 3MRKA 3QFJB 3SE3A 5I66B 4PGDB 5JLZA 2VLKB 3T4YA 3GKZA 3CVIH 1KELH 1MCCA 2COQA 4K3JH 3BIAX 4PREB 1GC1H 4KKAD 1KTRL 4U7KA 3Q0HA 4POZD 2H3NA 2PETA 2YS4A 4CBPA 2WBWB 3BQUB 3O2VL 2BHUA 3T0ED 1L9NA 1MCLA 3E6FA 2VR4A 1XF4B 3JXAA 4UTBH 2E7BA 4M7LT 4LMQE 3NZHH 1MCPL 3X3FH 4L29A 4EQ2A 1B2WL 3VFPA 2AKRB 1R3HB 3M17B 3AS3A 3MV9B 3RTQA 4P59H 1S7XB 1XCQA 1KPVB 1KIRB 4OZGA 3OKDB 1GIGL 3VFVB 2HKFL 4FQHB 3GBML 1E4WL 1LEGA 4LP5A 5E99L 4BQ9A 4CDGC 3OAYH 3MREA 1IAKA 3E3QE 4MNQD 1MFAH 1QRNA 4J3TA 4C83A 5C0RH 1WQVT 2XTLA 1VSCA 3K3QA 3FB5B 5I6XC 2GAZA 4WO4C 2R1XA 1OB1B 4IMKC 5IVNA 5IW1B 3CH1A 1D5MB 3CXHJ 4OQTH 1ZWIB 4J12A 3QRGH 4NP4L 5D6CA 4EIGB 3OSKA 4U6YA 1QKZL 4AT6B 4C56E 4OLVH 7FABL 5INCB 3A6CL 2O5YH 3MLVH 5DUPL 2XZAL 2HLFD 2XQBH 4U7SA 5GHWL 3W0WA 1ZAGA 3WNNA 5C2UB 3GK8L 1YJDL 5L9DL 4XWOC 2DDQH 3TJEH 2IALA 5TE7L 2V2WA 1D5ZB 1XF5B 1YJDC 2NXYB 4FXKA 5JOFA 1EUUA 1CN4A 2YHGA 3QWQB 5MHSD 3X13B 4PS4H 4G8GA 3KPLA 1LDPH 4Y1AD 1OAYL 3D85A 4XZUA 1DBBL 1AD0B 4JPVH 2N4IA 4IIQA 1YEIH 1BFOA 4JN2B 3T1WA 4KY1H 3DX9A 4E0RB 2XPGB 5E2TH 5CJQL 4O02L 5CBEA 3L5XL 4GMTH 4Y2DA 1CBVL 3SE9L 1R3JA 2QTEA 5AYUL 3BDYL 1ZHBA 4MJ5A 1J05A 2FCBA 4UNTA 3ESVF 5HDOA 1J0JA 4IMLB 3MRCA 1HHJA 4XHJD 5T33H 3FO1B 1I7RB 3MRMB 1L7IL 3CFDA 2ARJB 2EC9U 3CX5J 4CMHC 1FYTD 3QIWD 3VI3E 4WCYH 1HOCA 3KPQA 4PRHE 4QRSA 3EFFB 4JB9L 1ZT7A 3IJYA 2EDYA 4JAMB 3RVVD 2WUBH 2EYRB 2NW2A 4C4KO 4HG4K 3QUMH 4G42A 3QQ9C 2HH0L 3CFKB 3EYFA 4ZO9A 5AAMA 2A0LD 5CEZE 3BVNA 4F7MA 4CUCA 1T0NA 1F4YH 1DVFB 4ZO8A 4ZUUA 5DUMH 1EEYA 5TF1L 2ZG3A 1S5HB 3O2DL 4MD4B 4QLRA 1M4KA 2WLZA 4QCIA 4NUJA 5DD0L 2VAAB 4UV4L 4UQ2B 4U1SB 4WI9A 3HNTL 3BE1H 4H1LA 3CC5B 5JHDB 1KXTB 5FYLH 3OKLA 4A6YL 2DKMA 3AREA 3ARBA 2UUDK 4JPIA 5FFLA 1Z0MA 3ARPA 4Q9QL 3O45A 1U58B 1MF2H 3W2DH 2EDLA 1MNUH 2FJFB 3EOBB 1EVUA 3GSUB 3VRLE 4TN9A 4MNHB 4LCWD 1OCWL 4PRPB 3RGVD 4N1HB 3SGJC 1AQKH 4R0LC 3TO4D 1QFUL 2YRZA 1IKNA 5C9KA 1KJMB 4FFYH 2DKSA 2D7NA 2YPVH 1JZ3A 4R3SA 3NAAL 4MWFA 2H2SD 1D6EB 2FJHB 3GSVB 4L3CB 2DL9A 4HS6A 4Z7VB 4WV1A 3L5WA 4XP1H 3V52L 4LLQA 4JY5L 4LF3B 2Q76A 5GGTL 4HUVB 2AGJH 1H8NA 3A6BH 4LEOB 1BEYH 2X7LA 5EFIB 3C09C 1F3DH 4FFVD 5F1IB 2VUYA 5E6IB 3WBDA 1MHPH 2ADFL 4WHDA 4WUUD 2AXJA 3S97C 1CFNB 3AC0A 2B1AH 5BZDB 4OLYH 4NFBA 1NC4D 2P5EB 3ILQD 1WV7T 1M05B 3ZDYE 3EDFA 1IEAA 2ED9A 3HAEH 5T1KA 1OQOA 3QEQD 5LBSH 3WNLA 1KTLB 1LK3H 5GS1A 2Y6SC 1YY9C 3PWJB 4Z0XA 1JGEA 4OV6F 5JIPA 4PJ9D 4OFPA 1KLUB 4DKFL 3DX6B 3QQ4B 1ND0A 4PLNC 1SEBB 1FO0H 5CMAB 5FM5M 5HI4C 5TQ0H 2XN9E 1SJVA 4XCFL 5DS8A 3VRJA 1S5IL 2O61A 3DPBA 2BY2A 1YPZE 1JIBA 4MD5B 1J88A 4J3UA 3B5GA 3O9WB 2PW2A 1HIMH 2ADGB 1J8HB 3LH2H 1CD9B 4LLYB 5DEFB 4K3DL 1UWXH 3BKJL 3ULVL 3DNKA 5FO9B 4AEIH 1NFDF 2W59A 3I6LD 3L3OA 4G9FE 2ICES 3MRFB 3LKQA 5IIEB 5EZJB 1UT9A 1VDGA 5FYLD 5KVGL 3EIFA 4MD0A 2YD9A 1AKJD 1TDQA 3GHBL 2X4QA 4HBQA 1OGTB 1S9VA 5CZKA 1P2CB 2CLRB 3AM8C 3MJ9L 2D4DA 4APQC 3PWVB 3EO0B 4OB5L 1G0YR 3P0YH 1J1OL 2G5BA 2JB5H 1U2CA 1X5XA 5T3ZH 3LRHA 5FUZH 4M61B 5CD3A 4WEBL 2X9WA 4P2QE 4GAGL 4PJBE 3UTSD 3HC4H 5BRZB 1P7KA 3GMMA 1FIEA 3PQYD 2J12B 3G6DL 3KR3H 3EDDA 5EIQA 3NIDF 3TN0B 3FAXA 1YQ2A 1B0RA 3D48R 1M7XA 1C7TA 3H3BC 1W0WA 2VZVA 4Y5YC 2VXVL 2E27L 2EDDA 2HT3C 1NEUA 2F19L 4BH7A 4YPGB 5JTWA 4WTWA 4H8WL 2KKQA 5D5MB 3VWJB 2OLDA 4RFEB 5KOVC 3MBXH 4BFIA 4P2CG 1PZUB 4H8WC 4UOW1 1FNSH 4Q9CA 1A1MA 1XCTB 1AY1H 3EYSH 4H1LG 5FCUH 4JHBA 1BF2A 4KI5E 5SWQA 4P4KD 2QSVA 4MA8H 3MOBL 3CVHB 2AJSH 2WINB 1CR9H 3ARFB 4NQEE 4NZTL 1MLBB 3M07A 3LKRA 1ZHNB 1WBZB 3TBWA 3CSYA 4X80L 1XF2B 1KCRL 4XBEL 2FRGP 1RVFL 5KS9E 4TQEL 4MJIB 1X44A 4TTGA 1GL4B 4HUMB 1IGTB 1BD2D 3SDDC 1GCFA 3LQZB 4NN5C 3DVIA 5KSBE 3W5MA 1DLHB 5HGHB 1HQRB 1RQ5A 3EYQD 3QCUH 1BM3H 4E41E 4TVPE 5JDSA 3IKCA 1A3QA 1TVDA 4FNLL 1Q9OA 2BOBA 3V4UL 1WCQA 5DRWA 2XYCA 1YEDB 1IM9B 4E42B 2M8XA 1T7VA 5GRUL 3UPAA 1K9TA 2DWDB 1JGLH 5E1HB 2NXZB 1QRKA 5D7LD 1DE4A 4RAVA 4GBXC 1BVKB 1NJ9A 1CFTB 3QUXB 5DK0B 1T1YB 1B9ZA 4ZDHB 3RY6C 3MZGB 3O8XA 2DD8L 4PGCA 3S5LA 5EZLB 4YNYA 3CDYA 5DI8A 3PHOA 1DBKL 4N0YH 1U95B 1JHLL 1MCWW 2X5PA 3KLAA 5IK3A 4HLZH 2RFXA 3QIBB 5FV1L 3QO0A 1RJYA 2C26A 1P7HL 4PJIE 1WCBB 5T3ZD 2WP3O 2QHLA 5T1LB 2VITB 3EOTL 2AXFB 5JZ7D 2IPUG 3RUGB 2XTJE 5DTFA 4XTRD 3MMEA 1CE6A 3K1DA 3UBXA 3DSFL 4B50A 5BV7L 2UVEA 5SWZA 4Y88A 2VXSH 1C8PA 4L3EE 1EDQA 4G7YL 5EOCL 5JXEC 5H8DA 4KROD 1X5ZA 3T4AA 3I3DA 1NLBL 5GGVL 4ZTOL 3KYNB 1WFNA 5C08D 2G9HA 4OKVB 4PJCE 4Z8FL 5DD6A 2WLYA 3N1GC 3U46B 3EUUA 4LQ1A 2AERT 2R23A 2ZUYA 3MV8D 4LARH 4G6AC 3HUJA 1X7QA 3UCRA 4U6HB 1N59A 3WXVH 4NUGL 2R69H 1QLEL 3G08A 5IHUH 4GQPH 2VXTH 4LRNL 5C0JA 5KVDL 15C8H 3L9RB 2J8UB 4ORZC 4F58L 1CFVL 1HSBA 3TNNB 1AGEB 1A6TA 3HNSL 4FQIL 4JFDD 2QQLL 3MUHL 1J7VR 4U1NA 1DLFH 5GSRB 2X41A 4I18B 5K33A 3KPRE 4HJJH 3SOBL 1PG7X 1ETZA 4GXUN 1RHHA 4PJFB 1U8QB 2B5IC 2IH3B 2PXYC 3I75A 3MRKB 5F44A 5JLZB 2A9MH 1DUYA 3BH9A 2FO4A 4ZAKA 4K3GA 3T4YB 1BX2A 1O7VA 5IW6A 4NHCL 4YC2B 3JWNC 4MXQD 1FGVL 1X6NA 5EC2A 1PD6A 2X2YA 2H3NB 1FL6B 3CZFA 4HC1H 3UTTD 1FYHB 1T2QH 1ZVSA 4K7PL 4QEGA 2D9CA 1KV3A 5CGYC 1URLA 3E6FB 3UJIL 4KPHL 4L29B 4JFZH 4FTVA 2YD2A 2I5YH 3VFPB 4CVWA 3RTQB 1RU9L 1XCQB 3NN8A 4PJAE 4OZGB 1JF1A 1T7XA 1EPFA 4LMQI 1LEGB 4NKDA 2GI7A 5BS0E 5J1SC 2GEEA 1RIHH 3MREB 3ULVF 1IAKB 3VXMA 5EU4A 1JPGA 1G9ML 2IWGA 5LG1A 4ZNEA 5FGSA 1QRNB 4OTXL 4NZDA 3N50A 4C83B 4NPYB 3K74B 1G9MC 2NMSA 3WIHL 1YUHA 2GAZB 4NCC1 4JPKL 2R1XB 3RJQB 1QFOA 2P1YA 3CH1B 3SDXE 4JO2L 4X7TA 3EYUL 4D0CA 1YYML 3GEWB 1U2HA 4G8EA 3MYJA 1A64A 5D6CB 5C0GA 1JNLH 4KC3B 1BAFL 4U6YB 3TGXA 3QDGA 3I3EA 3TZVD 3QUYC 2DIAA 1N0XH 2L7JA 2EXWD 3V4PL 3C9NA 4P46D 1UVQA 4NO0D 3O3EA 1PY9A 5TGBA 3R8QA 1IEBA 2P8MA 3W0WB 3OZ9H 5D2LA 3SGEH 3M8OL 1KOAA 4MVBD 3CU1A 4X6DE 2YUXA 4NQCD 2OL3A 2OZ4A 2V2WB 1UZ6F 4FXKB 3TC9A 5JOFB 2PF6A 5ECJE 1NGPL 2DM2A 1GVIA 5IEKA 3GO1L 5FM8A 2EIBA 5I1GL 3UTPE 3S98A 4K07A 5I1JH 4G8GB 5K9QG 2VH5L 3KPLB 4XCCL 1I1FA 2AJVL 4M1CC 1G7MA 5TDNA 3JWDL 1RURH 3UBXG 1XEDA 3D85B 4XZUB 1EEZA 4LNRA 4N0CC 4IIQB 3VGAB 1E4KC 2EYTA 1BFOB 3BPNC 3MNVA 5D6DC 3DX9B 3EOAA 3JWDC 1RIVL 1LO4L 1A3RH 5D2NC 1ORSA 4MS8C 4UINL 5CBEB 2PR4L 4DW2H 4Y16D 4J3OC 1NAMH 4Y2DB 4PPTA 4M4PA 4QXTA 5J57B 3S37H 1R3JB 4N8VA 5JW3L 3QXAA 2R4RH 4UTAH 1ZHBB 4MJ5B 1J05B 4QOKD 3UEZA 3MRCB 1HHJB 3BKCL 1ADQH 2BVPA 3BIBX 3DXAD 2VL5A 3OWEA 5ESVA 3CFDB 4EI6A 4OZIF 1HOCB 3KPQB 4PJGE 4KMTH 5H94A 4QRSB 1U91A 1HYRC 1ZT7B 3IJYB 1E0OB 5DWUH 3OKEA 4G9DA 2NW2B 5HGBA 4G42B 5I18H 3EYFB 1RUQL 3NTCL 4G9FA 2MMXA 3BVNB 4NBXB 3GJFA 4WWKA 4F7MB 1KN2H 1T0NB 1R6VA 4S0TD 2YD8A 1G1YA 4ZUUB 1EEYB 2EO1A 4QCIB 1OPGL 5I1EL 4M7KH 1NCNA 4HFWA 3NCFB 1U8JA 4M1DH 4WFFE 1R3KA 4H1LB 3CXHK 5EA0H 2NY5H 3OKLB 4U6XA 2NY3C 4AEHL 3AREB 3ARBB 3SKJH 1VGKA 4JPIB 4R8WL 4D9RD 2K1MA 1BQLL 5SWSE 1R5IA 3O45B 3MOAH 4HJ0C 2E9JA 1QSZA 4Y4HC 4NKQB 2R9HD 1MAJA 4ZS6C 4GQ9L 3C6LC 1CXHA 4HCRA 4KQ4L 1Q72H 1FAIH 1KB5H 3GSXA 1KCVH 1YMHA 3VA2C 1CIUA 3RWFA 4M6ML 1KEMH 3R06A 4PJ8A 3HPLA 4GG6A 4NGHH 4R3SB 4NNYA 1JZ6A 4MWFB 3DX7A 3GSWA 5BVPL 5FUCE 4HS6B 4WV1B 3L5WB 1ZTXL 1T83A 4Q74A 5KW9H 4LLQB 2EH8H 2J8HA 2HWZL 4EI5C 4U2ZA 5IVXA 2Q76B 1I7ZA 3KLHD 1MEXL 1XIWA 4NN6B 3E3QC 5DXWA 2X7LB 3KYKL 4DOHE 1OGAE 4B0MM 3MXWL 3WJLC 2QLVB 2VDKL 1FBIH 5GRJH 5C0AE 1G7LA 4KRNA 4X8JA 3VGFA 4WJ5A 4NBZB 1EMTL 4JQVC 3DV4A 1IEAB 5T1KB 3UDWA 5GS1B 2CXGA 3H42L 5IV2A 2XKUA 5E03A 4Z0XB 5FGRA 4MNGE 1JGEB 3O2VH 3ZDXF 5ACZA 4WRLA 1ND0B 2CO6B 2F53D 1LK2A 4Q58C 4Y4KA 1MCPH 1F42A 1B2WH 2A2QT 1VGEL 5HGAA 2YD6A 5DS8B 1T4KA 2MSPA 3VRJB 2EC8A 2BVOA 5C0ND 3ZTJG 1FV1A 2O61B 1NANH 2DLTA 1GIGH 1FORL 2HKFH 2PW2B 3GBMH 1E4WH 4KJQC 1RUPL 5E99H 3QULA 1QR1A 5J9PA 3HE7A 4V1DA 5C07A 2LU7A 3ARDD 3L3OB 3QHTC 5JOPD 1MWAA 2Z31C 3LKQB 3L3GA 1F3JA 2OS7A 4Q6IC 4MD0B 1PQZA 4L8DA 5MI0B 2X4QB 1S9VB 1NUNB 1HH6A 1NMCC 5T3XE 4N8VG 4JO3L 2G5BB 2IPUK 2Z8WC 1X4XA 4X4ME 5CD3B 1BZ9A 4NP4H 4O51A 4NQDE 2R0LH 3TCXA 1P7KB 3GMMB 3QIUC 3A6CH 2ZG1A 2E7LC 1DQJA 4GRWE 5DUPH 2XZAH 1B0RB 5CZXC 1CU4L 5GHWH 5I15L 5C0CD 2DQFA 2QADB 4PRIA 4HWBA 1LD9A 3MROA 3GK8H 1YJDH 5CEZL 5CLWA 4BH7B 5L9DH 4PP1C 1VB9A 3O3BA 5TE7H 3D2UD 4JG1L 1P6AB 4W4OA 3TBSA 4BFIB 1UXWA 1A1MB 2J3SA 4YUEL 4NO3A 1OAYH 4KHTL 4DZ8A 2Q3AA 1QSFA 3PWUA 5SWQB 2PTTA 3WKML 2A6KA 3HTLX 5E4EC 3QDME 1BBDL 5CJQH 4OT1L 4BUHA 2Y9RT 4O02H 1F58L 5HPOA 2W60A 3BAEL 3L5XH 3LKRB 4ZQKA 1HNFA 3A6OA 1U8KA 1NL0L 3TBWB 4M3KB 1CBVH 3SE9H 3CSYB 4U4BA 4PLKD 1ACYL 3BDYH 5AYUH 3ULUL 4LVOB 4K2UL 1WISA 1YY8A 1KGCE 3QP3A 2BXYA 5JDSB 3ROLA 5L2KD 1L7IH 3IKCB 1UWEL 1KIUA 1Q9OB 1EERB 2BOBB 3QFDA 3WSQH 4ODWA 2PO6A 5F9AC 4JB9H 1PEWA 4EBQL 5DRWB 3PWPD 3BZEA 1OTSD 4HKJA 3VFTA 3JVGC 4MAYC 3SO5A 3B6SA 2HH0H 1H5BA 1DE4B 4RAVB 2FH6A 1NJ9B 5D1QA 1VADA 1X4ZA 5EU6E 5IW3A 3E6HA 1GHFL 2YN3A 4X9GA 5TF1H 3O8XB 3VFRA 3TM6A 4WGWB 4PGCB 3S5LB 4YNYB 3O2DH 1BVZA 5DI8B 3PHOB 5DD0H 5F9JB 1F00I 3VG9B 4UV4H 1UH4A 4R7NA 3KLAB 4TSCL 5IK3B 4WWID 2RFXB 3HNTH 3HZKA 5E2UL 3QO0B 1RJYB 2B4CL 4HHAA 3KAAA 1KB9J 3B9KD 3QNZA 4A6YH 5FA3A 5GS3A 4ZYKA 4KMQA 3G9VA 4Q9QH 1A6WL 5DTFB 1XR9A 3MMEB 1CE6B 3UBXB 2WIMA 3DETC 3KLDA 2X70A 5SWZB 5D1XD 1OCWH 4XWOD 2NCMA 4RMWA 3K1KC 2LE9A 5IB5A 1QFUH 2R29L 4BSWA 1DDHA 4OQ1A 5I8KL 4EUPH 3TYFA 5HYJE 1ACZA 3T4AB 3T8XA 1XGRA 3VDCA 5E5UB 4YHKL 2G9HB 2P24A 3NAAH 5IGXL 4R90L 5DD6B 5GGRY 1EXUA 5A2FA 3AAZA 3HE6C 2ITDA 3V52H 4X6CA 2YPLD 2R23B 4OSUL 5E0QA 3JSSA 4JY5H 1IGJA 3KLSA 3HUJB 5GGTH 3LQAC 1X7QB 1N59B 4WU5A 3VXRA 4J23A 4H26A 1VFOA 3UPRA 3DURA 3G08B 3NH7L 4OCMC 2GJ6E 5C0JB 3D3VA 4YFLF 1KBGL 3MBEA 4ODSL 3QPQC 2AABL 2IAMA 5E8PA 2ADFH 2HFTA 1HSBB 1FG9C 4XNZC 2WBJA 1I9IL 1A6TB 4IRJC 4JGUA 4U1NB 4QHNA 1KIQA 4Y2OA 2R39A 3K81A 5JW5A 4Z7OE 5F7HA 1T66C 1ETZB 4U3CA 1JGVL 4W6WB 2JJTC 1RHHB 1H3UA 1WZLA 3I75B 4TSAL 3C87A 1DUYB 3BH9B 2FO4B 4ZAKB 2JKXA 1GRWA 1BX2B 3SBWA 5IW6B 3EHBD 1BZ7A 4DKFH 2V7HA 3UP1A 3KWWA 4L9LC 2WNGA 4Y19D 2X9XA 3HZVA 3UX9B 1CDHA 5EC2B 3SPVA 1QFWI 4XCFH 3CZFB 4PJEA 1ZVSB 1S5IH 4FOMA 3SKUD 2F8VA 3PE9A 4K3DH 3BKJH 4PY7A 3ULVH 2J6EL 4FTVB 2VN7A 2JCCA 5KVGH 4KI5C 1Q9WA 4NQUA 3NN8B 4XCNA 5HYQA 2P5WE 1JF1B 3QDJD 3SDCA 3GHBH 4NKDB 3MJ9H 1NKOA 4OB5H 4R4NC 1J1OH 3VXMB 5EU4B 1JPGB 3FRPA 4OGZA 5DJ0A 4NRYA 4S1DC 2FECL 2JF1A 4WEBH 2X40A 4GAGH 4TVPL 1YUHB 3X11A 2EDHA 2IPTL 4HXAL 3G6DH 4M00A 1DL7L 1KC5L 2CK0L 4LLUA 3OPZL 1M71A 2W9EL 4X7TB 3UAJD 3WFBL 4D0CB 4M9PA 3D39D 4CGTA 4G8EB 1KN4L 3MYJB 1WC7A 4N5UA 5HHOE 3R8BB 5BMFL 5C0GB 2E27H 4R97B 1DANU 3QDGB 1YEJL 3NCCB 3OB8A 2F19H 1BJ8A 4YIQA 3C9NB 5CS7A 1UVQB 4H8WH 3VI3F 2YD3A 3FZUD 4F3FA 3O3EB 5DK2A 4BZ2L 1J11A 5TGBB 1U93A 1IEBB 2P8MB 4RFNC 1QTYT 4O2EA 1JPTL 3DYMA 5D2LB 4JCMA 1QVOA 4W6YB 1SMOA 4MXWL 1N2RA 3D1MC 3V6BR 1NBVL 2OL3B 5LCVL 2APWA 3MOBH 5IEKB 4JREB 1XF3A 4RCAA 4CMMB 4NZTH 4R4BA 4J6RL 1SM3H 3OJ2C 3CLEL 1ODAA 1I1FB 2ESVD 1G7MB 5TDNB 1EEZB 4X80H 1QNZH 1MVUA 1CCZA 1KCRH 4LNRB 2XTJC 4OIAA 4XBEH 1FG2A 1RVFH 2EYTB 4TQEH 3MNVB 3VXOA 1H3XA 3EOAB 3UC0L 1ZA6A 3T0EE 3KXFA 1ORSB 5DO2C 1MJUL 5F8RC 5L7XL 4FNLH 3OKKA 3BI9X 4QXTB 2VKWA 4N8VB 3V4UH 4OLUL 3QXAB 2NY7L 4KK5D 2FD6L 3ULUF 2CGRL 1SY6L 5DD3L 4X7CC 5IWLC 5GRUH 1IC1A 4FQXD 3ULVD 4U6VL 2BVPB 1WFUA 3KS0H 2VL5B 5ESVB 3WFCL 2KZ1B 1GGYA 3JV6A 4V2CB 1AFVL 4EI6B 4MNQE 5H94B 1U91B 4P23A 2FHCA 2DD8H 2W38A 3SCMA 1EEQA 3HI5L 3ARZA 1JF5A 1DBKH 1EFXD 3OKEB 1AR1C 4G9DB 1JHLH 5HGBB 2NY4C 4G9FB 4URTB 4WWKB 3TIDA 3GJFB 2V5RA 2NY2B 4NSKB 1D7FA 4PIRF 4DK6A 1A9EA 3EOTH 3TN0C 1U0QA 1WT5C 4HFWB 1U8JB 1CYGA 3CDCA 1C5BL 2YC1A 4BQCA 1QFWL 1R3KB 3DSFH 4JQXC 1Y18A 5BV7H 2A9NL 5E2VL 4WFGD 4U6XB 3LS4L 3ZDYF 2GIYA 2BSSA 1VGKB 5J6HA 4CKVX 4G7YH 5EOCH 1R5IB 2G5RA 3RQ3A 1NLBH 5GGVH 4ZTOH 3QEUA 3RFZC 3CVHL 4GKOA 4Z8FH 2X44D 4CW1A 3IT8D 4GKNA 5MHSE 3E0GA 1AGBA 1HXMA 3GSXB 1U3HA 2ENYA 1YMHB 1DQTA 4Y1AE 3RWFB 5GZOC 5ICXA 3R06B 2CRYA 2LAAA 4PJ8B 2LU4A 3HPLB 1I3UA 4NUGH 4GG6B 1QLEH 3GJFK 4NNYB 3DX7B 3GSWB 5GRVL 5KVDH 4PG9A 4GRLA 3BT2L 2VQ1A 3ZZ1A 4F58H 1CFVH 4KRPB 1VACA 4IJ3C 4ACPA 3H3PL 2CKBA 3FRPG 5IVXB 2YWYA 1I7ZB 3HNSH 4FQIH 1XIWB 2QQLH 5JR1L 3ARXA 1IE5A 2IG2L 4Q7DA 4PJHA 2Z8VC 3V5HA 3SOBH 3L5JA 5HHNA 4QTIL 2OTPA 4Y4FA 5JHLL 4I3GA 1G7LB 4JGJA 1FYTE 4X8JB 4ZXBC 2Y5TA 1W8NA 2OXGA 1UEMA 5LQBL 4WJ5B 4J1UA 5HVGB 4GBXD 5HVHC 2NX5D 3DV4B 2DS4A 5DK3A 3QNXA 4FABL 4NHCH 4U33A 2APVA 2LFGA 3I50L 1FGVH 2R2HA 5D1ZC 5J13C 5IR1A 3EGSA 5IV2B 2GUOA 2JELL 3UJJL 4K7PH 3JTSA 3OJDA 1A7NL 1NGQL 5J06A 1NC2A 4QRPA 5ACZB 4MJ6A 4PLJD 3VFGL 3ZHKA 1JZ7A 4HWUA 3UJIH 5F3BA 2ARJQ 4RMTA 1LK2B 4Y4KB 4KPHH 3AFLA 5HGAB 1T4KB 1RU9H 1MI5D 2UZXB 4UAOC 1FV1B 1I1RA 1YEEL 2EE9A 3RKPA 3MPCA 5B8CA 5GGQL 1QR1B 3QULB 5J9PB 2A6IA 3HE7B 4V1DB 5C07B 2JLLA 3CPLA 4HPYL 4LLDA 4KI5F 4CU8A 1MWAB 1G9MH 2MOVA 1I1AD 3C5ZC 5F1NA 3L3GB 4OTXH 1F3JB 4KJWD 1PQZB 4L8DB 4M8QA 3BIKA 1HEZA 4LCWE 3IU4L 1N7ML 5EWIL 5F6IC 3KG5A 3WIHH 4O00A 1HH6B 5GS2D 1YEHL 2HN7A 1NPUA 4JPKH 3JV4A 4OF8A 4ENED 5KS9F 4JO2H 3EYUH 3DYOA 1YYMH 3PHSA 5FECA 3KNBA 4ORGA 1BZ9B 4O51B 1BAFH 3V4PH 1DQJB 1MFCL 1REIA 5B3NA 2PYEA 2UZIL 2R0ZL 3G5YA 3KYOA 2VDPL 3SE4C 4QHUA 4HPOL 2DQFB 3CFJA 4PRIB 3JWOC 4JGMA 4RWYL 5IESL 3PGDA 1LD9B 3MROB 1T1XA 5JNYA 3M8OH 4WUUE 2WAHA 4PR5A 1IGCL 3LEVL 3O3BB 3MCKA 3WUWA 4Z5RA 1NGPH 4RA0C 4RMVA 3GIZL 1FFPA 1JNJA 2H9GA 3GO1H 3TBSB 4YE4L 5I1GH 1UXWB 1KCLA 1WTGT 2VH5H 4XCCH 3QEQE 3Q2CA 2AJVH 3JWDH 4NO3B 4DZ8B 3MLRL 1QSFB 3PWUB 4YC2C 2PTTB 3EBAA 3SGDI 3MGAA 4M48L 2A6KB 4JRYA 3T09A 1RIVH 1LO4H 3ZE1E 4KTEH 3DVFA 4UINH 2W60B 4XVJL 2PR4H 2YA1A 3VG0L 4ZQKB 1U8KB 2IJ0C 5CSBA 3D18A 3P77A 5DJ2A 1MQKL 4N0RA 5JW3H 4L4TD 4LHUA 4ZSOA 3WDIA 2P44B 2MQ0A 1LO0H 1KJVA 2VISA 1YY8B 3BKCH 5DA4A 3ROLB 3I2CH 1I9EA 3FTGA 3I6LE 2C7UA 1DTUA 2FEEI 5B4MD 3QFDB 4ODWB 5FYLE 1CIDA 2PO6B 5TPWL 3BZEB 1X9QA 1QBLL 5I0DA 4P9ML 4HKJB 2AJXL 3VFTB 4IRSA 5FUCC 4ZOEA 3B6SB 4PJDA 4JVWA 3RBSA 1RUQH 1H5BB 1P4BL 3NTCH 3VJ6A 2AJUL 2KPNA 5D1QB 1GXEA 3CCHA 4AMKL 1VADB 4OAWA 3DMMC 2YZ1A 3IETA 3E6HB 4JR9L 3VFRB 1V05A 4MQ7A 5A3ID 4WI2A 1OPGH 5TQ2L 1G1CA 3LPWA 5I1EH 3UTSE 1WFTA 1UM4L 2VLJA 2CUMA 4R7NB 4XC1L 3FONA 3OB0K 5L0QB 2HTLD 3PQYE 5EPMA 3HZKB 3TPUA 3H9SD 2XA8H 4HHAB 1XH3A 3QNZB 5FA3B 4AEHH 4LPWA 3I9GL 4R8WH 5HBBA 1BQLH 3SKMA 4U1JA 1XR9B 4R2GD 2R15A 4GAFB 2GW5A 4F57L 4OF3A 1MFBL 4HZAA 4KU1A 4GQ9H 2X70B 3SDAD 3TO2A 4KQ4H 3SJVA 2BVQA 1AP2A 3NACL 4OCXL 2DIBA 4PRDA 4K8RL 1HHHA 2AEPL 5IB5B 4BSWB 1DDHB 3TYFB 5DC4B 4M6MH 4NO5A 3T8XB 1AHWA 1PKQA 2KZWA 1XGRB 4NHUA 3TIEA 2P24B 3GI8L 5BVPH 1CD0A 5L8LB 1EXUB 3AAZB 4K23L 4B5EA 2ZZUT 4Z7UE 3K0WA 2VUOA 2ITDB 1ZTXH 4X6CB 2HWZH 3RIFK 1IGJB 1MEXH 4WU5B 3VXRB 3F8UB 3QUZC 4H26B 3DURB 1S3KL 3KYKH 3D3VB 4KK6C 4XT1C 2YD7A 1BD2E 3MBEB 1P7QD 5F21B 2FIKA 5EC1A 4W6XB 3LIZL 5T3XL 5E8PB 2DI7A 2IAMB 3E2HC 2NY1C 5BOPA 2VDKH 4HUNB 4EJ1C 4JRXD 3SKNA 5D7JC 2WBJB 1S9XA 2BNRA 4QHNB 4YZFF 1KIQB 1WEJL 1UACL 2A38A 1EMTH 5C70A 5JW5B 3S34L 3U79A 3L3HA 4KDTA 3QG7L 1XMWA 4U1HA 2D3VA 5D7LE 5IQ9A 3PP3H 3H42H 5ISZD 4HSQA 3MCG1 1OAKL 5JIIA 3SDXF 5HHMB 1K8IA 1QFWM 1S7UA 5E6ZA 1BZ7B 4CADA 2V7HB 3KWWB 3ARGA 4OF5A 3MJ7A 5L2JA 3HZVB 1IZKA 5DVOA 3SPVB 1TTFA 1VGEH 4PJEB 5LGKA 5T3ZE 2X89A 3B2UD 1FORH 2VDLL 5ELIA 2AEQL 2VLRD 1JTPA 4YHML 3DRTA 4DGYL 2GJJA 1RUPH 3PABA 3MLYL 4I1NB 4PY7B 3RUGF 2C9AA 1K4CA 5CUSL 4DGVL 2OM5A 2JCCB 4G6FB 4KKBC 4LSPL 1Q9WB 4XCNB 5HYQB 3SDCB 3WJJC 1LE9A 4HJ0D 1FL5A 1BOYA 1IC5H 3C6LD 4JO3H 3JTTA 2X4RA 4HZLA 5FGCE 3CSGA 5DJ0B 5C08E 1OY3B 4NRYB 3MNWA 4HUXA 1JL8A 3X11B 1EGJL 3MV8E 3NA9L 4WW2A 2WQ8A 4NT6A 3MODL 4QF1A 5J12B 1IQWL 4LLUB 3L95A 1M71B 4NOBA 1HWHB 3O3DA 3RDTA 1CU4H 4PFEA 3WIFA 5I15H 1QLRA 1WC7B 4WUKL 1TVBA 2XNAA 3L1OL 5E7BA 4QWWD 2J8UF 5CEZH 3HZMA 1TQBC 2B1HL 2WANA 4YIQB 3T3PE 1CI5A 4M62L 2ZWLT 4JFDE 4F3FB 5DK2B 4G6JL 1U93B 5A1AA 4JG1H 5HYEA 3GMOA 2I25N 5C0BD 4FXLA 4O2EB 4YBLB 2P49B 3MJGX 4L9DA 1CGVA 4YUEH 3TA3D 1QVOB 2R2CA 4KHTH 1N2RB 1II4E 2YA2A 1ITCA 3FL7A 4PJFF 1ERNA 3WKMH 3DYPA 1EZVX 3V5DA 1BBDH 4OM1L 1EBAA 4P5TC 4OT1H 1XF3B 4OCSL 1F58H 3HNVL 3RVTC 4R4BB 3TBVB 3VCLA 3D87B 3G6JE 3BAEH 1HWGB 3P9LA 3UBXI 1NL0H 1YDPA 3SO3C 1MVUB 3JV0A 1FG2B 1ACYH 3H7BA 5IROC 4BELD 3ULUH 3UTTE 3VXOB 3DSNA 4G6ML 3MRPA 1ZA6B 2NPLX 3KXFB 2O93L 3RX8A 3X3GL 4L1HA 1UWEH 2LU3A 4HIEA 1MREL 3OKKB 4P0DA 3TF7C 4L4VD 4KRLB 2ZG2A 1RK1A 4LSTL 1OW0C 4FFWD 4HDIA 4JM2A 4YEEA 1U8PA 3QHZH 4EBQH 3BEWA 3MV01 5MEND 4RSVA 4OZGF 1LMKA 4YFDB 4R96A 1NCDL 3JV6B 4KJPC 2F54A 3IS0X 4M9OA 4GW5A 4OQTA 1GHFH 2LAGB 4F7PA 4P23B 3D9AL 5I8OH 3SCMB 3PXJA 2EDJA 1C5DA 2H2PD 1VHPA 5JOEA 1FLRL 1MIEL 1HCVA 4PP2A 2W9DL 4RGNB 3N1QC 3TIDB 5E2UH 2B4CH 4F15B 3FRUA 2CDFA 5B39A 5CP3A 1A9EB 3QI9C 1JE6A 5C09D 2XIDA 2V6HA 1GGCL 2YC1B 5FAAA 2VDML 1Y18B 3PG2A 3N1FC 3VWKD 3T2NL 3O41A 5EUOA 1EHXA 2BSSB 5J6HB 2R29H 5I8KH 4RZCA 1U3ZA 2VLKD 5HGGS 4YHKH 4NQCE 1JRHI 3BD5A 1FC1A 3QEUB 2OK0H 5IGXH 4R90H 3AMLA 3RZCC 4CW1B 3CK0L 3WLWD 4GKNB 3LQAH 1AGBB 5HD8D 4GKZA 1HXMB 1U3HB 4EDXA 4OSUH 1HINL 5ICXB 43C9A 2M26A 1YNLL 5F7MC 3BQUD 4L3AA 3SDYL 3NH7H 2X4PA 2VE6A 1FZMA 2IPKA 4PG9B 4GRLB 2VQ1B 3IDYB 4F33A 4ODSH 2X1WL 2AABH 1B6DA 1VACB 2D03L 3G5VA 4E5XA 2CKBB 4QHKI 2CUIA 4OGAC 2APBA 3QDAA 1I9IH 2FZ3A 3MV9D 3FJTA 2BSED 3ULUD 5F88A 5ID1A 2K7PA 4PJHB 3V5HB 1BECA 5HHNB 4N8PA 3KHOA 1JGVH 4M6NH 4Y4FB 3DXAE 3BWUC 1EV2E 4N0UA 1UGNA 3GSOA 4TSAH 3CNKA 1N3NA 4GS7B 2Y5TB 2VZSA 4J1UB 5LKNA 4KQ3L 3QXDA 3QNXB 4RMUA 1F3DJ 2R2HB 4XI5D 4KWUA 1ZE3C 5IR1B 4PG2C 3EGSB 2MCPL 5DZLA 2GUOB 4GRWF 4H0HB 3JTSB 3OJDB 3MLPA 1NC2B 4JG0L 4U1KA 5CZVL 4QRPB 4MJ6B 2E6JA 3NFPA 1L9MA 2V9RA 5F3BB 2BNQA 1JHKH 5KAQG 1TTGA 5J6GA 1TCMA 3DOSA 3CFEA 4QT5A 1CZ8L 3GSNA 1J9CT 3MACL 4Z95L 1N6VA 4PJ5A 5B8CB 1CLZL 2A6IB 1QFHA 2R0WL 3CPLB 4LLDB 2NXYD 4KKAC 5F1NB 4POZC 4O9HL 1F02I 3VFWA 4M8QB 3BIKB 1HEZB 4FG6D 4TVPH 3DGGA 3FAWA 2VOTA 3T0EC 2IPTH 2HN7B 4HXAH 2HVJA 5L8JB 2CRZA 1PEZA 3JV4B 2DJUA 1DL7H 2CK0H 3LN4A 1DUZA 3RWDA 5KVFL 3OPZH 2W9EH 3U6RA 3WFBH 1KPRB 1YEKL 3RA7L 3KNBB 5FECB 4ORGB 1KN4H 5BMFH 4YK4C 1YEJH 3OKNA 4BM7A 2XY2A 2QQKL 4PJXA 3AXLA 2IQ9H 2PYEB 3G5YB 3KYOB 4BZ2H 4QHUB 3CSPA 1JPTH 3CFJB 1TITA 3HAEA 3PGDB 4YWGL 1T1XB 2Y36L 4Q2ZA 1D5IL 5C0EA 2W0PA 4MXWH 4PR5B 3C08L 5CSGA 4FQQA 3ALWA 2DKUA 3D6GA 4ZPVA 3MCKB 5B39G 5LCVH 3WUWB 4Z5RB 2UV3A 5I1KL 1WWWX 4UIKL 1FFPB 3NOIA 2H9GB 1NCTA 3GB7A 1JGDA 1DQML 3O4LA 4J6RH 4UB0L 1TJGL 3CLEH 3KPSA 1X5GA 4N90D 3F6IA 5GGUA 3OAZH 3FCTA 3FQRA 1DVFD 4AQOA 5M95B 4KV5F 3N0PB 3N85L 1MCEA 4JRYB 1JRHL 1S78D 3UC0H 2IANE 1TNNA 4ETYA 2HLFC 1MJUH 5L7XH 1ZS8A 2F53E 2MPAL 3D18B 3QAZB 3P77B 5DJ2B 5JHDD 1NLDL 4OLUH 3S3PA 2NY7H 4ZSOB 2FD6H 4NC0B 1G7PA 1WVZA 2VZ3A 2CGRH 1KJVB 1SY6H 5DD3H 3WFEH 2VISB 1PG7L 2WUCL 3HRZA 4DK3A 2FB4L 3MCLL 5HVFB 4U6VH 3WFCH 3FTGB 4QRUA 5ENWA 5T1DL 2C7UB 1AFVH 1LP9A 5C0DA 3S3JA 5JOPE 4Y5XA 3BUTA 1BJ1H 4K71C 2EYSA 3HI5H 3Q3GA 1BREA 4TNVK 2EXYD 4IRSB 3IJHA 4PJDB 1CLYL 3VJ6B 3REVA 3CCHB 3U30C 1GC1C 4QXUL 4OAWB 1JN6A 2E6QA 3IETB 1I8LC 2L4OA 1ZLSL 2EDFA 3ZHLA 3TEUA 4MQ7B 4ISVA 3GGWA 1I1YA 4YDVA 3HRPA 2VLJB 3FONB 2NY0B 3BKYL 1UFUA 4H88L 4XHJC 5EPMB 3WKNA 2L7UA 3TPUB 1QFWH 2A9NH 1WWCA 1XH3B 3HG1A 1NDMA 5E2VH 5DRZA 3QIWC 3LS4H 1DBAL 3UYOD 3BW9A 5C0CE 5E6ID 3WXWL 3K7UA 5DJDA 3TH2T 4YDKL 1TPXB 2BVYA 4U1JB 2DM4A 3RVVC 1A14H 3PL6A 2PTUA 2OL3L 2OZ4L 1KULA 1WJ3A 3O6FA 2V2XA 2A0LC 1C5CL 3CVHH 2EC9T 2O5XL 5TH2A 3TO2B 2N1KA 3SJVB 2BVQB 1AP2B 2C5DC 4PRDB 1VEOA 3LV3A 4OCWL 1HHHB 4YR6A 4HIXL 4OGXL 4Z78A 4NO5B 1AHWB 1PKQB 4NHUB 2ICWA 3TIEB 5E9DA 1UJ3C 3ZE0E 3HFML 3FQUA 1LO3H 4M7ZC 2Q7YA 3BT2H 3ETBF 2MKLC 1J1PL 1UXSA 3DIFA 3OJMB 1RFDL 3GNML 3H3PH 6FABL 1W8OA 4AQ1B 1AH1A 2VIRA 5KZCB 2IG2H 2DTML 1TZGL 1CICA 3O9WD 1J8HD 1AXSA 1M6OA 1FVDA 2FIKB 5EC1B 4QTIH 1XF1A 1NFDE 1V3MA 5JHLH 3RGVC 1YN6A 3J7HA 5L2KE 4MDJA 5ALCL 2FEDC 3SKNB 1S9XB 4NC1E 4LPVA 3MV7A 4Q0XL 2BNRB 5LQBH 3PWPE 4NKOA 3I50H 2H2SC 4OZFH 2BVUA 3IAQA 3L3HB 3OF6D 5FDYA 4U1HB 4KXZI 5IQ9B 4UU9A 4NN7B 1G7JA 2JELH 1N4XL 1L0YA 3BGFB 3UJJH 1W72A 2NY4D 5DLML 1A7NH 1NGQH 3BO8A 1K8IB 4WHTA 3HAEG 1S7UB 2VSCA 4CADB 3VFGH 5BRZD 5IP4A 4HX1A 1EK3A 3ARGB 3MJ7B 4FFVC 5L2JB 3NIDE 2LTQB 3TN0D 5BJTA 4MA1B 1YMMA 5CINL 1GGIL 1YEEH 4RGOL 2H32H 4ELMA 3EYOA 3PDOA 2BX5A 3DRTB 3ILQC 3PABB 2J5LC 3QWRA 2A1WL 5GGQH 1EH9A 35C8L 2XZZA 4OF7A 1J5OL 4HPYH 1MPAL 1K4CB 4WI7A 3VWJD 2UWEE 1F3RB 4PD4K 4CJ1A 4HCRL 2YEZA 3ESUF 1IAIL 3IU4H 1N7MH 1LE9B 3MGTA 1FL5B 5I8EA 5EWIH 4PJ9C 2FGZA 1YEHH 3C5SA 2DJSA 3JTTB 1LVEA 1UG9A 2EEBA 2DQJL 2X4RB 5F71A 1JPSL 4HZLB 4NO0A 1LNUA 2OSLA 3ARFD 1UCTA 3TFKD 3MNWB 5F7NC 4EN3A 4HUXB 1YECL 4Z7WA 4I2XA 2YPLE 4WW2B 4NT6B 4QF1B 1WAAE 2WWKT 1Q94A 4I0PC 1MFCH 4MJID 1INDL 2UZIH 3H3KA 2R0ZH 3L95B 1RZIA 4S10A 3O3DB 2VDPH 3GMPA 1IEHA 3RDTB 4F7CA 3WIFB 1QLRB 4HPOH 4RQQA 2CDGA 4UZGA 4RWYH 5IESH 1TVBB 2XNAB 3WDJA 3LZFL 4PJ7E 3DUUA 3WS6A 3HZMB 5MEPA 1IGCH 3LEVH 5A43C 2I07A 3ET9F 4JFFE 1IM9D 1GSMA 3GMOB 2H41A 2Y06L 4YE4H 1GH7A 1NCCL 2VQTA 2WQRA 4OFYA 4UDUA 1DBJL 2EDTA 2NXZD 4OIBA 5C6TL 2IC2A 2XI9A 3QQ3A 1FL3A 3MLRH 1U8LA 4RMSA 3QUXD 5TFSL 4HC1A 3TESA 1P4IL 4M48H 3V5DB 3BYTA 4QOKA 3J8F7 4OI8A 1UA6L 4XVJH 3VCLB 2IFGA 4Y19E 3P9LB 2X4SA 2F8OA 1I85C 3QIBD 1YDPB 4ZFFA 5JXAL 3T0DA 1MQKH 5D93B 3O6LL 3H7BB 1ZXQA 5IVOA 2VC2L 4RDQF 5T1LD 5H2BA 2R2EA 3MRPB 3GMNA 2HLAA 2BK8A 2CIKA 5HI5C 2YWZA 2DMKA 4HIEB 4PTTA 5DC9B 1MWAL 1AC6A 2JJWA 2X4UB 1RK1B 4RFOL 4HDIB 4JM2B 1U8PB 1JTTA 3KHQA 3UJTL 3UTPD 3BEWB 4P4KC 2C3VA 3QDJE 1QBLH 3HS0A 4P9MH 1L6ZA 3EJYD 5M94B 1CXIA 2AJXH 3R4DA 3M1BA 5F6HJ 1U42A 4R96B 1VEMA 2AJUH 1JJUA 4MJ2A 4NCC2 4AMKH 5J3HD 2JJSA 5H35A 4GW5B 5TE6L 4F7PB 4JZJC 4JR9H 1RZKL 1UYWL 5D7IE 1C5DB 4BUGA 2X4NA 3ALXA 5TQ2H 3ROOA 3RWGA 4XC1H 4HFUL 2XOTA 4PP2B 3EYQC 4GXVL 1B6UA 3S37X 1MQ8A 3FRUB 2CDFB 5JPNA 3IDXL 5B39B 4HWBL 3D39E 3I9GH 1BLNA 4O5LL 4HLZG 2XY1A 2EE2A 1KJ2L 3T04D 4F57H 2Z92A 4WHYG 1MFBH 4JFOA 5I1LA 3O41B 3NGBC 5ICYA 5EUOB 1E6JL 4D2NA 1SYSA 3NACH 4OCXH 4DQOL 4K8RH 2AEPH 3MRLA 3VD9A 3LPFA 2W9LA 4TTDD 4RZCB 2FIRT 1Q9KA 2AV7A 2W0FA 5EORL 5HXMA 3GI8H 3VXSA 4K23H 5EIIA 1V3LA 4GKZB 1Q0XL 1NAMA 2ESVE 3CLFL 4EDXB 2AV1A 4YHPA 4LPYA 5JZ7C 4X9BA 43C9B 1MCKA 4XTRC 1T1WA 1S3KH 1FZKA 2FR4A 2X4PB 2VE6B 1FZMB 2VDOL 2IPKB 1WF5A 5H37H 4F33B 3LIZH 5T3XH 3N9GH 1ADQA 2W0KA 4QY8A 3G5VB 4CN1A 4E5XB 1F2XK 5DJ8A 2HP4A 3PHQA 2IGFL 1VA9A 2FZ3B 4LBEA 4XBGA 3RTQD 5IFHL 5F88B 2JJUA 1G6VK 1SBBA 5ID1B 3SEPA 1U36A 3R0MA 3BPLB 1OP5H 3BN3B 3S34H 4LSDA 3M45A 3WO4B 3ULVE 1UJTA 5EG6C 3QG7H 4GRWH 2HG5A 3BPOB 4IDLA 4N0UB 5CP7A 3QEHA 3GSOB 1FQ9C 1N3NB 1Z9LA 2DYPA 1QRND 1OAKH 3FT2A 4LL9A 5C0FA 1Z3GL 1Q8MA 3I6GA 3QXDB 1NEZA 3BH8A 1TQCC 5I76A 4O58L 5FYJE 4OCRL 1FE8L 3TPKA 3SGDH 3AB0B 4LLMA 4U1KB 2VDLH 1HSAA 1JNNH 2AEQH 5JIHA 3NFPB 4YHMH 4DGYH 2B0SL 3MLYH 2BNQB 5F97E 4HGMA 2PCPA 5J6GB 1X5KA 5J1AA 1D6VL 1MCIA 3CFEB 4QT5B 5CUSH 4DGVH 4LSPH 3GSNB 3LN9A 4WFGE 3W0WD 2DRUA 2D7MA 5HYFA 4PJ5B 4PY8J 4NQXA 4D3CL 2E9BA 2NY6B 1JYXA 1CFQA 2Y07H 4LVNC 4MXQC 4J8RA 2OX5A 4X0KA 4JFQA 4XMLL 2OTWA 4PGZA 1J12A 1T7YA 3VFWB 1MCOL 4G8GD 4UQ2A 4RAUA 3DGGB 4K8RD 4MB4A 4HUKB 5EB9A 3D85D 1EGJH 2A6JA 2HVJB 3MODH 1ZOXA 3LN4B 1IQWH 1DUZB 3RWDB 5D8JL 1P84J 3U6RB 3TVMA 1JV5A 2VXUL 3GIVA 3C60A 3N06B 3U9PL 3MA9L 4WUKH 2Q6WA 3L1OH 5IUSA 4Y2DD 3OKNB 2B1HH 4LLVA 4PJXB 3MBEC 3AXLB 5KANG 4M62H 1XGTA 5IVXF 4P2RA 4X7EC 4G6JH 2YUVA 3EOYG 4XBPA 1OTTD 3FB8A 3ZSSA 3MX0A 2UVFA 1IKFL 3HAEB 5DZNA 4MXVF 4LSVL 4OZIE 4IOSD 4Q2ZB 5C0EB 1SVZA 5F8QC 1WTLA 4FQQB 1OOAA 3VXUA 5KN5A 4ZPVB 2FJHA 4FHBD 3FN3A 4WU7A 4OM1H 5E08L 4OCSH 3HNVH 3GB7B 2NX5E 3BXNA 1JGDB 3O4LB 3KPSB 5GGUB 3V0WL 3WL9A 3FCTB 3FQRB 3TZVC 5DEGA 2EXWC 4J3VA 3TLRA 4P46C 3ORJA 4G6MH 1JBJA 4F7TA 1AXIB 4GRMA 3WN5C 1X5YA 1INEL 1SQ2N 3X3GH 3WMSA 1IAIM 1CXFA 1ZS8B 1MREH 1CFBA 3P73A 4M02A 4LSTH 5FGBC 4NIKB 3GI9L 4MVBC 1MI5E 1G7PB 1KPUA 4MZ3A 4OF0A 1AO7A 3ARED 3ARBD 4WO4A 4X99A 2VNCA 4YPJA 3MZTA 2J1KA 3HRZB 5CGMA 2IBZX 4IMKA 4YXHL 1FFOA 1ED3A 1NCDH 2M1KA 4QRUB 5ENWB 4ELKA 1AIFA 1LP9B 4XXCC 3D69A 5C0DB 1PKOA 4LLAA 3C6SA 4Y5XB 1DEDA 3EZJB 3D9AH 4JO1L 4WFHD 2EYSB 3Q3GB 1BWWA 1Q38A 4Q6YA 3MSPA 3IJHB 1FLRH 3QJFA 5HHXL 1FFQA 1MIEH 1UM6L 4RNRA 2W9DH 3REVB 4Y16C 1A4JA 3F58L 5KSVA 1JN6B 4U1IA 2PTVA 3JUYA 1TETL 4ISVB 3GGWB 1I1YB 4YDVB 4UBDD 2HVKA 3GZKA 3HA0A 3R0NA 4KROB 1GGCH 1UWXK 2VDMH 5AAWA 3ZKMD 3HG1B 1B90A 1QSEA 1NDMB 2NW3A 3L5IA 3T2NH 2P42B 5DRZB 1NEZG 4Z7QE 3BW9B 2BMKA 2QR0B 3UPCA 4H0IA 4G8IA 5DJDB 1F13A 3PL6B 1G9NL 1WFOA 3IF1A 3O6FB 2V2XB 5DMKB 5TH2B 4KFZC 3CK0H 1B0WA 1FPTH 1G9NC 5T1KD 3LV3B 1F45A 4YR6B 3V7AG 2OJZL 1SEQL 3OGCA 4J3XA 1R24A 4OD3L 1HINH 4Z78B 2ICWB 1OSZA 1YNLH 1BQHA 5D96C 1FGNL 1GOFA 4Y5VC 5EBMA 2B2XL 3DVNA 5C7XL 1K85A 5E9DB 3SDYH 4XX1E 3FQUB 2Q7YB 4ODHL 3W9DA 4FXGA 4F37F 1UXSB 1HHIA 4GLRI 2D03H 4ZFGL 3DIFB 3FN0L 5I75C 2X4TA 1CDUA 4L4TE 2VIRB 5I73B 1OLZA 5ETUA 1FAKT 1NUDA 1CICB 2R9HC 1GOHA 1AXSB 1M6OB 1FVDB 1OP3H 1KENL 4EVNA 1YN6B 4MDJB 3P0GB 1WZ1L 3U48A 4QRRA 3CH8A 3MV7B 5EBLA 1I75A 1MJ8L 4X7FC 4TSBL 2VR5A 4KQ3H 4NKOB 5HVWA 1DQQA 1K4DA 3AGVA 2MCPH 4UU9B 2DMCA 1G7JB 4GH7B 1MAML 3S9DB 1W72B 3DBXA 3BO8B 4JG0H 2VO5A 4WHTB 5CZVH 3KLHC 4KI1A 4S11A 1XGQA 4LCCC 1EUTA 4HX1B 1GGTA 2GFBA 5F1KC 2UZYB 1U3JA 3PNWA 3T3PF 3V8OA 1CZ8H 4L5FL 1T22A 2X10A 3H9SE 3V6OE 3SGJA 5BJTB 3QBTB 1YMMB 2XA3A 4R0LA 5INDA 2QADD 3MACH 4Z95H 1FVEA 3BKML 4ELMB 3EYOB 3PDOB 5E8EA 1WWBX 2OI9B 5ALBL 3IDUA 1CLZH 4EUPA 5DHXB 2R0WH 1QD0A 1F4AA 2YRLA 2I9TA 4O9HH 2YEZB 1MJ7L 3L3IA 3MGTB 5I8EB 4BSVA 3G6JF 1OWWA 4RBPH 4E9LA 3C5SB 5GGTA 2ZUUA 1U8OA 4NO0B 4YGVA 5KVFH 1N26A 3O2WL 1LNUB 2OSLB 3DO3A 1YEKH 3RA7H 4JHWL 3LEXA 4EN3B 3RI5F 5C0NC 4Z7WB 4I2XB 5KSUA 2IFFL 5GRWA 2D7PA 2CKBL 2QQKH 4S2SA 4X6CF 4EXKA 1OD7A 1Q94B 3MJ6A 3P0VL 3V6FB 4I3SL 1RZIB 3ARDC 1WZMA 3GMPB 1MHCA 4F7CB 3CMOL 4RQQB 3RY5A 2CDGB 4YWGH 2Y36H 3DUUB 1D5IH 4P2YA 4JRXE 3C08H 2AK4A 2I07B 5I1KH 2EZ0D 2I9LA 4RRPA 4UIKH 5I9QB 3NFSH 1DQMH 4UB0H 4UDUB 5D72L 1TJGH 4ZG1A 3QQ3B 1FL3B 1U8LB 1VFMA 3BFOA 3N85H 3O8XD 5KVMC 4PBWD 4YHYC 1JRHH 4QOKB 1SYVA 5ANMA 2RB8A 1N6QL 3MUJA 5I71C 3TNNA 2X4SB 2MPAH 1HDMA 4ZFFB 4AEFA 1NLDH 4UOJA 1NGZA 4XAKD 1PSKH 5F93C 5IMKA 2UY7A 2EDOA 3AM8A 4TULH 4PJEF 4APQA 5H2BB 3S7GA 2R2EB 4R4FL 3GMNB 2HLAB 1PG7H 3W5NA 2WUCH 3DVGA 2CIKB 2VLRE 3K2MC 2FB4H 3MCLH 1F4XL 5BO1L 3RPKA 2GCYA 2XWTA 1BQHG 5EIVA 4PTTB 5FUOL 5T1DH 1NBZA 5CSZA 1RD6A 4GOSA 5SWZD 3CJJA 2C3VB 1CLCA 3HS0B 3K4AA 3M1BB 2BOCA 1CLYH 1FL6A 4K7FA 5FM5O 2DBLL 4Y5YA 4QXUH 5H35B 1CTOA 4MA3A 5EOQL 3AY4C 1ZLSH 2O5ZL 4PLKC 2X4NB 4NWUL 2XZQL 3RWGB 3ROOB 3OR6A 1OT2A 3NPSC 4CDHA 4XVUD 3BKYH 3WHE0 4H88H 3KS0J 4HKBA 2R0KL 5GQBA 5JPNB 2EICA 1DBAH 4NC1C 4DAGL 3WXWH 5C3LD 4X9FA 1BLNB 1LWRA 4M6OL 2CSPA 5C9JA 4KK8D 5GJSL 1TENA 1OTSC 1JWSA 3VDBA 3PDDA 2FHFA 2I24N 3SKOA 2Z92B 1T2XA 2OZ4H 4EOWL 3QG6A 4FQ2L 1C5CH 4BZYA 4JFOB 4NPYA 5I1LB 2O5XH 5ICYB 1V7NL 5C0BE 2Q7NA 3QHFL 1FNLA 1SYSB 2QKIA 5DJXA 3MRBA 4OCWH 4HIXH 3MRLB 4OGXH 5HYIA 3SDDA 2A6DA 5FO7A 5ADOL 4XNXL 4ZAKD 1Q9KB 1W0VA 2AV7B 2W0FB 1WLHA 3HFMH 1T89C 4H20L 3WFDL 3VXSB 4RISL 5EIIB 1GJIA 2YPKA 3B9KC 4EUPG 1J1PH 2GTZA 1NAMB 1RFDH 3GNMH 2AV1B 4YHPB 6FABH 5EOCJ 5IJKC 1KJ3H 4OZHE 3BP7A 1T1WB 2FR4B 1FZKB 2DTMH 1TZGH 4GBXA 2FBOJ 4H0GA 3N1PC 3U4EA 3ZO0A 5D1XC 3RY6A 4QY8B 1KYOJ 5ALCH 5DJ8B 5JIKA 4FTVD 3T1FA 5F1OB 3U82B 3PHQB 5DUBA 4L4VE 3GM0A 5LGHL 4LBEB 4XBGB 4Q0XH 2NYYD 3MNZA 3U0WL 5MENE 1YC7A 3X14A 5C92A 4HS8L 2HG5B 5CP7B 3QEHB 3VXMD 3RIAF 3IFPA 5I19L 1N4XH 2DYPB 3FT2B 3ZKQD 5C0FB 5DMGD 5ILTL 5L88H 4WVRA 1IC4L 3I6GB 5MP6L 1NEZB 4M1GL 1JNHA 2DF3A 5FDWA 2MKWA 2HFGL 4B7IA 3BH8B 3BWAA 5I76B 1J0YA 2HT4D 4RRPG 5CINH 5JXEA 1GGIH 2YXFA 5BW7C 2EH7L 5CIPH 4LLMB 4RGOH 5E2JA 1A22B 1HSAB 2ZCHL 3QDGD 4ERSL 5JW4R 5DHYA 5C09E 2A1WH 1MUJA 2PCPB 2QJDA 2WWKO 35C8H 1IL1A 3VXPA 1J5OH 1KF9B 4PYGA 5J1AB 1MPAH 5E70A 5M7QA 3MUGA 1BZQK 5KOMC 4JKPL 5ERWA 4KKLD 4W68A 4HCRH 3T0XA 4MQSB 3BISA 1IAIH 4GW1A 3GMLA 4NQXB 3EHBC 3LEYL 3QFJE 1CFQB 4P2OA 2DQJH 4FRWA 4X0KB 4J8RB 1JPSH 4XPHL 4JFQB 2VLKE 4I48A 5F70A 2OTWB 1MY5A 4RMRA 4K7PX 3MGOA 3FHAA 3H9ZA 5F7DA 1YECH 1T6VN 4RAUB 2DL2A 2YUZA 3MLWH 3WE6A 5I74C 4CVXA 2A6JB 5LJYH 1OAZL 3ULSA 5I0ZA 1INDH 3QRFM 3ZKXC 3TVMB 1JV5B 1EO8L 4N8CL 3GIVB 3C60B 4NCDA 4XPTL 2PXYA 2Q6WB 1J0HA 4LOUD 3ALPA 1RJLA 3LZFH 3T2QA 4LLVB 2F15A 4UQ3A 4XCYA 4JDVA 3SGKC 1XGTB 5HGDA 2D0GA 3MV9E 4P2RB 3ULUE 32C2A 5IHBA 4Q97A 3P4OA 3FFCA 1XFPA 4M6AA 4XBPB 1JI1A 1X5LA 2FEDD 3FB8B 2Y06H 1NCCH 4YHZL 5C6TH 2ZUWA 3IJSA 3TV3H 1VENA 5FKPA 4D94A 5TFSH 3VXUB 5KN5B 1P4IH 1PYWA 4KRMB 4FQJL 4WU7B 5CJXC 5E5MA 4YDLC 1V8HA 2DLIA 3BOVA 3BXNB 3UAJC 1UA6H 4X4YA 2XACC 3EO1A 4B7LA 3LMJL 4WWKD 3HMXA 1JP5A 3WL9B 5JXAH 2NY2D 5DEGB 3O6LH 4G3YH 4X98A 1I9JL 1T6WA 3NPZB 2VC2H 4I3RL 3WO3B 3WNPA 5AWNL 4F7TB 1L0QA 4Z9KB 3FZUC 1SMAA 4GRMB 3PGFL 4ODVL 5DURB 3NZ8A 3TJHD 1MWAH 1DANT 1KT2A 3P73B 5ACMA 4RFOH 5MEOA 3HKFA 1QBML 5I6XB 1KPUB 3UJTH 5EO9A 1AO7B 4WO4B 2OR7A 4X99B 3IS1X 4KH2A 5DA0B 5EZIL 3ARUA 3WIHA 1FFOB 1ED3B 5HHVL 3GRWL 4TUOA 4ELKB 1AIFB 2VDRL 3D69B 4OUUA 3C6SB 3S3SA 1BQSA 1ZMYA 5TE6H 3QUYA 1RZKH 1UYWH 3ZE0F 1SJEA 4XPAL 4L8BA 3D0LA 3QJFB 3VGHA 4HFUH 5EULV 4RNRB 1FRGL 4GXVH 4KXZH 1KTDA 4PJ8D 1WIUA 5AEAA 3VMOA 4F9PC 1A4JB 2D7TL 2PW1A 1JYWA 5KSVB 1K2DA 4AK1A 5F7LB 3BZDA 1FSKC 4U1IB 3IDXH 1MCNA 5CCKL 1P5VA 3ARTA 4HWBH 2YD5A 4I0PD 4KK5C 1GAFL 4NKMA 4KRPD 4O5LH 4MQXD 2HVKB 5KG9A 4JANA 5ACLA 1KJ2H 3ILPA 4LFHG 1FNFA 4FQXC 1XIWD 3ULVC 1D5XA 2NW3B 1QSEB 4JFEA 1E6JH 4IOIA 2GYSA 2ZOKA 4L8SC 2BMKB 4G8IB 1E4KA 1RJZA 5D6DA 5FYJL 3LSOA 3I6KA 5D2NA 3E1F1 1VESA 3IF1B 5EORH 2L0DA 4RMQA 5CFHA 3LCYA 3RX7A 5HDLA 4M5ZL 4OUOA 4AG4H 4N90E 1Q0XH 4X6EA 3CLFH 3OGCB 2DQCL 1R24B 4ZUSA 1ZT1A 3MO1A 1KTKE 1OSZB 4GUPA 1BQHB 5EBMB 3DVNB 4IEFB 2VDOH 3W9DB 4CMHB 4FXGB 3S6CA 5SX4H 1HHIB 5F7WC 4Y4KD 2ZUSA 1UWGL 1EBPA 2X4TB 5ISZA 5EOTA 5JHDE 2IGFH 2VJXA 5IFHH 1E28A 5HI5D 1WITA 2UWEF 5ETUB 4W70A 3TCLA 3T0AA 3ZT6A 3BP6A 2Z91A 2MJWA 3HE7D 4V1DD 4EVNB 3ELAT 3QJHA 5LVEA 3VFSA 4QRRB 1T1ZA 3G6AA 1CG9A 5EBLB 3BJ91 5HYSG 1Z3GH 4PRPE 2A83A 3ECBA 2BSTA 5A2IH 4OLVL 1DQQB 1K4DB 4O58H 1WAAF 2JIXA 4PJDF 4OCRH 1FE8H 3WV0A 2B8OT 4FZ8L 3DBXB 5GJTL 5FIEA 3ZL4L 2X9YA 2QEJA 4Z7VE 2QBWA 2YR3A 4Y4HA 1XGQB 2B0SH 3DGCR 2GFBB 4PJ7F 1H3TA 3NCEB 3C6LA 3EDKA 1D6VH 3PNWB 3WFZA 1AI1L 1T22B 1RI8A 3T0BA 4R0LB 5INDB 2XG5A 2DQUL 4PRID 1FVEB 5E8EB 4D3CH 4EUPB 2WSKA 2IADA 2ERJC 4XMLH 5J11C 4OLZL 2P5EE 2I9TB 4JRWA 2VQUA 1I8IA 1HZHL 5F9JA 1MCOH 4EI5A 3L3IB 4GFTB 4BSVB 2HT2D 4PLJC 1QSFD 1N5YL 3C09B 5IBUG 5IB4A 1U8OB 4YGVB 5D8JH 3WJLA 4DEPC 2VXUH 2Y5EA 4NZUL 4ZUWA 2XXCB 3JUZA 3LEXB 3U9PH 3MA9H 1S9WA 2H45A 5KSUB 4YHNA 3P40A 3RWHA 1IGFH 3HZYA 4S2SB 1WK0A 4JQVA 1HILA 1BFSA 2EDWA 2WIIA 3BDBA 4F9LC 4KVCL 4HK0A 4KUZL 1MHCB 4XHQA 5BV7C 1ZHLA 1J8HE 1I1AC 4C56A 1MIML 1IKFH 4KJWC 4LSVH 3BPLC 4U1MA 2LV4A 1FIGL 2AK4B 3WO4C 2PO6D 2I9LB 4ENEC 3IKKA 5E08H 5D7IF 2NTSP 1IGYA 3V0WH 1A1OA 5HTSA 1MELA 1P53A 4LIQL 4KZDL 1S7RA 4WY7L 3UZEA 1SYVB 3D25A 5ANMB 5BRZE 1RZ8A 2Z31A 5T5NG 4OFIA 1INEH 4Q6IA 1HDMB 1MF2L 2ZP0T 4PUBL 5IMKB 1NGZB 3GSNL 5EZOL 4APQB 4P5KA 3DVGB 2E7HA 2GKIA 2EIDA 2VZ1A 3ARQA 4YXHH 1CDGA 2GCYB 2XWTB 2ICWI 1NBZB 5CSZB 4I4WA 5FYJU 5D5ME 4LCIL 3QIUA 4JO1H 1NDGA 2E7LA 1DQDL 4YLQT 4J4PC 2FGWL 1T3FA 5HHXH 5GS0L 2BOCB 4AY0A 1UM6H 2Q3ZA 4K7FB 1A8JH 4PRHA 5SX5H 4Y5YB 3F58H 2WV3A 4MA3B 5J7CC 1TETH 1CS6A 1FFNA 1GPOL 5JA8B 3OR6B 2WZPD 5DRXA 2VZOA 5I1CL 4CN6A 1G6RL 4WW2F 3LD8B 3VXRD 4MJIE 4IBLT 3B8YA 4HKBB 1ZLWK 5AZEL 3D3VD 3MBED 5B4MC 1J10A 1F97A 2QSCL 1OWRM 2IAMD 5C9JB 1F8TL 4OKDA 1JWSB 2WBJD 4TUKL 1G9NH 4YZFE 3SKOB 5F9WC 3IAPA 3QG6B 1NUGA 1RZFL 4XRCA 1CT8A 5C6PB 1MCFA 2QKIB 2V5MA 5DJXB 1NCWL 3MRBB 3VW3L 5A3IC 2OJZH 1SEQH 4HEPG 4OD3H 5IHLB 3SDDB 2A6DB 5FO7B 2DQTL 4NN5B 1FGNH 1W0VB 2HTLC 2B2XH 5HHMD 4GXUM 4KKNA 3V6OC 4ODHH 1HIML 4LSQL 1F4WL 2YPKB 4ZFGH 2GTZB 3FN0H 4TOYL 1CVSC 1U8NA 3NCYS 4KKCD 1UKSA 3OKMA 3JVGA 1VKXA 3BP7B 2FX9L 4R2GC 4MAYA 2RIKA 1TXKA 4GBXB 4PV8A 2Y25A 3RUGE 1KENH 2F5BL 3SDAC 3U4EB 4QHLA 2NLJA 4ONFL 3WHE1 1WZ1H 1C7SA 3OKOA 3HMWH 1Z2KA 3T1FB 3KGRA 3NA4A 4M4RA 5DUBB 4G6FD 4LLWA 4KVNL 1MJ8H 3MNZB 4JM2F 4CMMA 3SDCD 4TSBH 5CJOL 4WI5A 1JCKA 3HC4L 3X14B 1FNGA 2P8LA 7CGTA 2XKNA 3CDGA 1I8KA 3IFPB 1MAMH 4LRIC 2NZ9D 5MERA 3ZHDA 4X4ZA 3C2AL 1JNHB 4XCEA 2HA1A 1I1CA 5FDWB 4S1SL 4OFKA 3BWAB 1JUFA 3T2OA 5JUEL 3I84A 1B3JA 4K9EL 3CFBA 4EZMA 3O4OC 1P9MC 2J8UE 5DHYB 2XN9A 4K9EC 1AY1L 1MUJB 2CLZA 1IL1B 3VXPB 3DUHA 3QXWA 4AEEA 3HE6A 3MUGB 4YDJB 1YPZA 5ERWB 2AJSL 1MJ7H 1CR9L 4GW1B 2ORBL 3GMLB 5EUOF 5DQDL 1J0ZA 4PJFE 4YO0A 2DTSA 4P2OB 3RVUD 4NSKA 4U1GC 1ZKAA 3GSQA 4I48B 3MLXL 3MGOB 1OTUD 3C5JA 5F7DB 4LP4A 2BFVL 2P7TA 4JHWH 1E6OL 5HPMA 5F1SA 3WE6B 2IFFH 2ZUQC 3B2UC 3IYLW 4IRJA 4CVXB 2CKBH 5HI3D 1MRCH 3ULSB 3P0VH 4I3SH 4P2QA 2JJTA 4PJBA 3KXFD 3CMOH 3MXVL 1BFVL 2B5IB 2PXYB 3FMGL 2DJ4A 4LDLB 3V7MA 1RJLB 3W11C 1U8MA 4LQFL 2M2DA 5F7KC 4OD1L 4UQ3B 3AROA 4XCYB 2ADIA 4JDVB 5HGDB 1TJIH 4L9LA 3QEGL 32C2B 4OZGE 2QQQA 1AR2A 3P4OB 3ZYZA 3FFCB 4Z76A 5D72H 3GKWL 2BZDA 5CJ8A 4JJHA 3IJSB 1KYOK 3RHWF 4QNPF 5KSAC 5FKPB 3AS2A 1W72L 1QRNE 4IOFD 4P23D 1D5BA 1PYWB 2ICEA 3SCMD 1A3LL 3GBLA 3MYZA 3MV11 5E5MB 2H1PL 1H15A 3L3JA 1N6QH 1ZGLM 1KCKA 4X4YB 3EO1B 3QR2A 4RGND 4X5LA 3BP5A 4QWWC 5BVJA 4X98B 2Q1EA 4NQEA 5DVMA 3AUVA 4OGYL 4Z7QF 5AUMA 3U9UA 1F4XH 1A47A 5BO1H 2Z8SA 5KS9A 4ONHA 3NZ8B 5FUOH 3RP1A 1KT2B 3TA3C 3VD3A 5IBUB 5MEOB 4GJTB 2ITCA 5F96L 5I1IL 5EO9B 3LKOA 3W0WE 5KSBA 1JYNA 2MNUA 4E41A 4X7DC 5T1MA 4NO2A 3CX5K 4JCLA 1MRDL 2K9UA 3U4AA 4TUOB 1BQUA 4C55A 4OUUB 3MC0A 3VXQA 4Z77A 5DEZA 3F7VA 2DLGA 2IAND 3QUYB 3D0VA 5EOQH 2O5ZH 1SJEB 2QSQA 4NWUH 4M93C 4G8GE 2XZQH 1C12A 4U0RC 1U3HD 4L8BB 3HC0A 4RGMC 3C8DA 3D0LB 1HCFX 5EN2A 1KTDB 1ES0A 4BK4A 2PW1B 4R26L 4DUVA 1K2DB 4JN1L 4H5SA 2R0KH 4JY6A 5FYKE 1R5WA 4GRLD 4DAGH 4FFWC 3VD7A 3MRGA 3V5KA 4NKMB 3G5XA 1BJ1J 2E5EA 4M6OH 1JWMA 2OCFD 5GJSH 5KG9B 4JANB 4EEEA 3ILPB 5C1MB 4EOWH 4PJIA 1D5XB 4FQ2H 1UQSA 4KZEL 1V7NH 1OD9A 3QHFH 4JFEB 3DWTA 4HEME 1NAKL 4IOIB 2ZOKB 5DD5L 4Y4FD 3BPNB 3F7YA 1RJZB 2H2PC 2DB8A 3LSOB 5HDBE 3I6KB 2Z93A 5D2NB 3HLAA 5ADOH 4XNXH 3DI3B 4PBXA 4DKAA 4L3EA 1B4JL 3WFDH 1QKZH 4RISH 4UOW0 4DCQA 2E3VA 7FABH 4CAGA 1A7BA 5CLTA 2FX8L 4JHAL 4X6EB 1BIHA 4FA8A 4ZUSB 1GZPA 5FHAL 5IWLA 3ZMRA 2C4FU 1ZT1B 3MO1B 4GUPB 1HQ4A 2WM0A 4UT6L 4PJCA 4LCYA 4KK9D 3KJ4C 4YFEA 1NC2D 4QRPD 4KTYA 1SY6A 2GY7B 3VWKC 3H0TA 5C6WH 1MCHA 1JTOA 1GYAA 4QXWA 1WWAX 5ISZB 5EOTB 5LGHH 3ZE2F 1E28B 3VFUA 3U0WH 3TCLB 3CUPA 1ZANL 1T0PB 2ZSVA 3BP6B 1YNTA 2Z91B 3PF2A 3ZYJA 5I1AA 1PBYA 4D9LL 1DBBH 3WLWC 3QJHB 1R0AL 5HD8C 3VFSB 25C8L 5I19H 1LP9F 5GISL 1T1ZB 2KQMA 1WT5A 3G6AB 1CG9B 4U2YA 3KPRA 5ILTH 4PB9L 4PGBA 1IC4H 3ECBB 3BQUC 1KCUL 1OL0A 2A83B 2BSTB 4WFHE 5MP6H 4M1GH 1UH2A 4JQXA 1EZVY 2HFGH 4NC2B 1AQDA 2NY3B 2VB5A 1DN2A 2JIXB 2J7LA 2VDQL 1YNKL 1QR4A 2CXKA 2EH7H 3BHBA 2OMNA 5CEYA 1X5FA 2GSGA 3ULUC 2ZCHH 4ERSH 1PJ9A 3OTTA 2VXQL 4Y4HB 3BRGC 1A7PL 1MH5A 1NCUA 2DLEA 4TNWF 3C6LB 4UT9L 2PYED 4QXGL 4OLXL 4JKPH 2FYYA 3BMWA 4U3XA 4AJ0A 1W0YT 2KBGA 2DM3A 3LEYH 1RUML 2IADB 4XPHH 4XI5C 5J56B 3QA3A 4PJAA 1IAOA 1I8IB 4XVSL 4EI5B 4YHIA 5BS0A 1FNEA 4ZUVA 4BYHA 4KV5E 1QOKA 1OAZH 5DHVA 5DJAA 5IB4B 1HI6A 4JEGB 4RA3A 4JRYD 3U4BL 1EO8H 4N8CH 2B4CC 4XPTH 4ZUWB 3KYMA 1S9WB 4ZXBA 5JQHC 4YHNB 3RWHB 4NQTA 3HZYB 3DRQA 3SDXA 1HILB 3QISA 2WIIB 4LHUD 1KXVC 2AK1L 2IF7A 1QO3A 4HK0B 3VFNA 5D1ZA 2NXYC 1ZHLB 1S7QA 4C56B 2IBGA 4YHZH 5F7EL 4OZFA 4FG6C 3W82A 4U1MB 1G0DA 5DFVC 4JO4L 1QEWA 2FJGA 5IMMA 3CD4A 4FQJH 4BH8A 3VMNA 2VKXA 1A21A 4IRSD 4X9HA 2VSDA 4J3WA 4XNMA 5SV4A 3E8UL