1P84K

Hdbt inhibited yeast cytochrome bc1 complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
107
structure length
107
Chain Sequence
DIELTQTPVSLAASLGDRVTISCRASQDINNFLNWYQQKPDGTIKLLIYYTSRLHAGVPSRFSGSGSGTDYSLTISNLEPEDIATYFCQHHIKFPWTFGAGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the yeast cytochrome bc1 complex with a hydroxyquinone anion Qo site inhibitor bound
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I
total genus 15
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2003-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1p84K00
1AO7D 5D7LB 4ODTH 4F15C 3BO8B 3T04D 4HPOH 1P2CA 3A6BL 1EHLH 3HZYB 4FFWC 5GRUH 3WS3A 5DEFB 4MZ2A 1S9XB 4QHNA 4ZPVA 5C7XL 2L7JA 1AD9A 1E6JH 1LP9A 1DANU 1DFBL 1NBYA 1ZOXA 4XNZC 4YR6B 4HV8A 3SKJH 3VRJA 4PR5B 5CKGA 5D7IB 3S7GA 4LLDB 3FQWB 3QUZC 4YLQT 1ZLSH 5IFAL 2DL2A 3Q0HA 5AZ2L 5CSGA 4H5SB 4MCYA 1BLNA 3QIWB 4ETQB 1OARH 4ZUSA 2XYCA 3ZT5A 1U42A 4NZUH 3BPNB 3Q5TA 5SWSD 1Z3GH 5IBLD 2LABA 4JFFD 1G6RA 3O2WH 4E5XB 3SDYL 4W4OC 1A1NA 2NY4B 1TJIH 3TBSB 2ADFH 1XCQA 1IGJA 2J8UE 4BA8A 2OXGA 4LQFH 3NFSH 3DYMA 5E70A 1QSEA 1ORQA 4HWEH 1IEAA 1VGKB 5T1KB 3O3EB 1DZBA 5KOVC 3S88L 1L4IA 4TSCL 3VXRA 5ICXA 5F7KC 4XNUH 1H3GA 3DSFH 1YEHL 1DQJA 1FN4B 3O2DA 4JN2B 1KPRA 5L2KE 2DB8A 5D5MF 1XF4B 1R5VB 3JV6A 3IRZA 3TVMC 1W2KT 2AK1L 4M3JA 2JB5L 3EGSA 4FXGB 1VFAB 1E4KA 2ITCB 3UTSB 5I1DB 1JTPA 5IOPB 4R7DB 4HJ0C 1RUKH 5DK0A 5I1GL 4ETYA 3V4UL 2N1KA 5I8KL 3D18A 1G7QA 4GW4A 5FF6B 4J3WA 3UJTL 3D9AL 3N0PB 4UV7H 3RVTD 4P2CG 3C6SA 5DD0L 1LILA 2VDPL 1EIBA 3WEXB 5MEOA 2VYRE 5K9OB 5FUZH 3U82B 1CCZA 3O2DH 4OF3A 3CVHB 3K81A 1XZ0A 5B8CA 2NZIA 3P4NA 2ESVD 3KYMA 3QG7H 5EA0H 3TN0A 3LQZA 4XPAH 1ULVA 2X4OB 5D1QA 4YIQB 1BM3H 4U1NB 5KJRL 5SWQB 5HHQA 3IXAB 4POYA 3CFJA 2R0WH 3H3BC 4RIRB 1P7QB 3RGHA 3L5XL 2VDQH 2GJ6A 4P59H 4YHOL 1FIGL 3SKNA 4YHYB 3LEYL 2VQTA 1OAXH 1IMHC 1DJSA 4PBVC 4JO4L 3P77A 2EIZA 3TPUB 1RI8A 4KKBC 4HT1H 1KXTB 1OAKH 2F53D 1KJMA 1NUGA 4MXWL 4R2GD 5E6IA 5GGRB 4KZDH 1EHNA 3VXQB 3QUML 4LEXL 1T22B 4BSWA 5DRWB 5I8KH 4DGIH 5KG9A 2DWDB 5TE7L 4H8WH 1Q1JL 5CZXC 5EOCH 4WO4C 5FAAA 1OTTC 3NFPB 3ARPA 4WHTA 1A8JH 2R56H 3O4OB 3QXVA 4GW5A 1AQKH 3FOLA 4ONHB 5E8EA 2FJHB 1MFEL 4AJ0A 1CVSC 1S9VA 2NXYC 4R8WH 2Z4QA 4UV4H 1M6OA 4M5ZH 1S7XB 1JHKL 1MHCB 1HKFA 4MXQC 5GRXG 4PUBL 4RNRB 1NDGA 5HPMA 1CGWA 1EVTC 3QSKB 4JLRA 3B2VL 3PHQA 1LD9A 4X9IA 4GMSH 2R69L 5DGQA 5HY9A 4JZNA 1AQDA 3MBEB 5MP6H 3P11H 4K3EL 1PAMA 5EO0A 2NZ9D 1J8HB 5HYQA 5HVGB 5DJ2A 4PJIA 1YYLL 1I3GH 4ZQKB 4CVUA 3H6JA 4OUUB 5I0DA 4NQTA 2R0LL 4QXGH 5KAQG 4AT6A 2FO4A 3MRJB 3IDYB 3MRMB 3ZKXC 5CKAA 2Y06H 2CDFB 4CAGA 1HQ4A 4ZNCD 2VR4A 3ARBB 3C60D 1Z3GL 1JNNH 1AXIB 1R3KB 3BD3A 5E94B 4HS6A 3WFCH 2ZCKL 1RK1A 2OM5A 2BX5A 4FQ1H 2FJFB 2IPUG 4OGAD 3U4EB 3QYCA 1IGTB 1NCWL 4R26L 1QRND 3HNTH 3SEPA 3UPRA 1P9MC 35C8H 4Y19E 3OKDA 3CXHJ 5I1IL 1IM9D 4EXPX 4UT9L 4ZXBA 1NEZG 2FATL 4TTGA 3NA4A 3TP4A 1MIEL 4QO1A 4HQQL 3RX8A 4QHUB 1A6PA 1OGAD 4PJEA 1MQKL 4G5ZL 2VDLL 4PB0L 1P7HL 1T7VA 1A7NH 1K85A 5ESVA 3TVMB 5CZXD 3QISA 4NHCL 1WCBB 1NGWB 4LARH 4F37K 4R90L 2CK0L 4LP5A 3QIUD 4NKMA 4JO3H 4HH8A 4BH8B 3C9NB 3UTPE 2DM2A 4NKQB 2B0SH 2YD1A 4LVOB 1T1WB 1IBGL 1C12B 3BGAA 2VR5A 2MKWA 3Q3GB 3A6CH 1C12A 5EBWB 3HMXA 5BRZE 1D5ZA 1AHWA 4QRTA 3BZEB 4Y7MA 4QXTB 2QQLL 1A3LH 2C7UA 5E99H 1EDQA 4DTGH 3T0EE 3CMOL 2BFVH 4G6KL 3A6CL 2UV3A 3CX5K 2EDYA 4IMLA 2Q7YB 5I76B 4MHHI 4HKBA 3RGVB 1HYSD 4JKLA 4P5KB 4EI6B 3HN3A 5HHPA 3UJJH 4Y2DB 4HUXB 1L7IL 2B2XL 2VZOA 4U49A 5FYKH 2NW2A 3BYYA 3ULUL 1MRFH 2E9IA 5LQBL 3MV7E 3HE7A 1FG9C 1U8IB 5J9PB 3ARFA 4HIIA 3SN6N 3L3IB 1YY8B 2GUOA 3NIGF 3MRNB 3C5ZC 5A2LH 1J18A 3V5DA 3BDBA 4D0DB 4NQSB 3BIKA 3W11C 2Q8AL 1UWGH 35C8L 1SBSH 4XCYB 3P73A 4WWKB 1UM5H 4R4FL 3GI9H 4YO0B 3U9UA 5J4MA 5MEND 4PJGE 5ID0B 1LGVA 3GSRA 4HIHB 5ESVB 3HR5B 2EDBA 3U7YH 5DA4A 1NBZB 1Q8MA 2YD8A 5DJYB 4QHUA 1CI5A 1DBBH 2PYEE 2GIYA 2NY5L 3CX2A 1FZJA 1N7ML 4FG6C 4I0KA 3V52H 3VFSA 4PJXB 3VFMB 5K9KA 1NEZB 1INQB 4PRAA 4X6CE 4NFCA 1OP3H 2BMKB 1Z9OA 1RJYB 3HZMA 3ZZ1A 1T5XA 3TM6A 5E08L 1NQBA 1JL8A 4UQ3B 1WTGT 1T5WB 4PPTA 4I77H 5FGRA 1J0KA 5AD0B 32C2B 5E6YA 3CFCH 3WKMH 4HS6B 4LF3A 3V5HB 1SVCP 2VLKD 3Q3GA 2YD7A 2BNQE 4JKWA 4H88H 1ZLVK 4J3OC 4YPGB 1MPAH 5D1ZB 1RZ8A 4ONOA 4G8GB 3FB6A 1L9MA 2XKSA 4PJIB 4MQ7B 1L0QA 2EDHA 3VXQA 2QQNH 2IWGA 4O2CA 2VLRD 4OZHF 1DP0A 4UTAL 2B7DT 5HHNA 3THML 3T2NH 3DO7A 5H94A 2G5RA 4GAFB 5I8EA 2BVQB 3DMMA 3P0VH 4BFGA 2KBGA 1BQSA 2JJVA 1J1XH 1NC2A 3BIAX 3DJ9A 2OS7A 3I6GA 2EKSA 4QOKB 4Y4KC 3VW3H 1FHGA 5SWQA 4S1RH 1QR4A 4K3JH 4LHQB 5E5MB 4X7EC 3KGRA 5E03A 3EDFA 3OAYK 3GBML 5LBSH 1FIGH 1JRHI 3SE8L 1Q9OB 3QH3A 2VDQL 4PREB 4YHKL 1DQDL 1HHJB 1IAOA 5IVXB 1A9EA 1BM3L 1E6OH 1JYNA 1CIUA 3U7AA 3VD5A 1S7UA 2QL1A 5HHOE 3T09A 3S5LA 5TGBB 4KFZC 2BY3A 2P7TB 3O4LA 3L9RB 2ENYA 1I8MB 4Y16B 3IJHA 5C92A 2WP3O 4EDXA 5BVJA 3PG2A 5EBLB 1YMHA 5F7MC 1MFCH 4V2CB 5JW4N 1LD9B 4PG9A 5DD0H 4MXVF 3RPKA 4LF3B 1EHXA 2Y5TB 4R97B 2P8PA 2WBWB 5E2WH 3X11A 4GH7B 1FNEA 1REIA 3IDJB 5IIEB 1VSCA 2QSCL 3EAKA 4Z7NF 4JHWL 3HE6C 4QRRD 4JRXA 4RFEB 4QWWC 3RIFK 2CLVB 4OZFA 3ZTNL 3ARDB 3QRGL 3ZDXE 4YX2H 3W5NA 1TTUA 3RVVD 1FO0A 3AB0B 3RQ3A 1LWRA 2F54B 3ROOA 1J86A 4XWOC 5C86A 5MHSE 4HD9A 4KRLB 1A1NB 3HFML 4HKZA 1M4KA 3HNSH 2FL5B 1UZ8A 3GIZH 4WW2F 1CGYA 3SDXE 2AJZA 2YS4A 4XNUL 1XGUA 3HKFA 3Q5YA 5AUMB 5CBEA 1NUDA 5HGGS 5JHDE 5EBGA 1UFUA 3FFCA 2FWOA 4ZAKC 1OF2B 5FO7A 2W65A 2P49B 4HWEL 4NQSA 2B1AL 1NAML 4EN3C 4OF5A 1F13A 4U1HB 2O26U 3VXUA 2IQAB 5JZ7D 4HKXB 3RL2B 1GC1L 5AEAA 3WHE1 3SQOH 2AEQL 4CMMB 2HKFL 3IXAA 4BH7B 3ALXA 1D9KC 2QHLA 2FGWH 3LPGA 1SEBB 2A6JB 4EJ1C 3V0VB 4UU9A 1P7KB 1INDL 5DD1L 2B1HH 1HH6B 1P5VA 2VXSH 3FO2B 3RFZC 1JV5A 1UWEH 2UWEF 5FUCC 4ZUTB 5HI5C 3VG9B 2ITDB 1I9IL 5TE6H 3AS3A 2A6IB 4FXKB 4ZTOL 2AJSH 1X5YA 1OVZA 4NQEA 4OD2A 4PJBE 3OB0K 2DYPB 5DRNA 4MGXA 3QO1B 4D2NA 3D0LB 2HRPH 3GSXA 5C0GB 1KG0B 2AJ3B 4JFZL 4TUJA 5GRUL 2JCCA 3T2QA 4ZO9A 3MOBH 1HSBA 5IOPA 4MD5A 1L0YA 3FB7B 1FG2B 4YHML 2NNAB 4PR5A 1CLYL 3B9KC 4K9EH 4OT1H 1JGVH 1DQTA 4ODXB 5IV2B 3PWNB 1B0GA 1QACA 5TPWH 1CT8A 2Y7QB 1MJ7H 2HVJB 3DVNA 4HFWA 4XT1C 4NO2A 5HHXL 1F4HA 5D5ME 4MA3A 3GJEA 5F9JA 3JTTA 4XXCA 2CUMA 3GRWH 5MEQA 3EYQC 4KUZH 1HEZB 4U7MA 5LKNA 4K8RC 1RZGA 3EHBC 1Z5LB 4X8JB 5CWSA 1QA9A 2R2EB 3TO2B 4X6DA 2W9DH 4FQHB 1KC5H 2FB4L 4L3EB 3U6RA 4H25A 1IAKB 2HLAB 2IH1B 3CFBA 5JXAH 1MHPL 1D6VL 1JPGA 1KTDA 1X5FA 2YOCA 4M1DL 5E56A 3TFKD 3IDNB 4X9BA 4LNRA 3O4LE 4MNQA 4IMKA 1ZSDA 4N1HB 1H5BC 5L7XL 5KVGL 3T3PE 1YDPA 2FJFA 4YUEL 5GS2D 1UWEL 3U2SB 4S1QH 3QFDB 1FVCB 4PP2B 1INDH 5DD1H 2RFXA 1II4E 4YHLL 4QHMA 5LCVH 5GGQH 4JCLA 1UT9A 1IGML 4Z76B 4RGMB 2G2RA 1V3JA 1EEYB 3BGMA 4OUUA 3WLWC 4DKAA 4Z8FL 2Z92B 2WWMD 2XZQH 3K8KA 3T0DA 4JN1L 4PJBF 2FX8L 5DDHB 2Y36L 3HRPA 1S5IL 3MO1B 4U1MB 1JPGB 3RTQC 3TBYA 3PDOA 1T3FA 4MAYB 1RHFA 4X9HA 4F2MA 1U95B 5IUSA 2D4DA 1E28A 4PRHB 4YBLB 3GMMB 3HE6D 5I16B 3LS4H 5FO8B 5LWYH 5C0RH 2V2TB 1DUYA 4UDTB 3MRCB 5HPMB 3VFOA 1NDGB 2FR4B 3MCKA 1KIRA 4ACPA 4YDLB 1MHCA 3V7AE 2Z4QB 5HTSA 3AREB 4F7CA 4FS0A 2VITA 3JV4A 3S3JA 5D7KE 1QLEL 5A2JH 2DTSA 5C0FB 1IEBB 2HRPL 4D8PA 2R8SL 3V0AC 3U4BL 4PTTA 4BK5A 3B9VA 3FQRB 4N5EC 5EU6E 3T4YA 2OQJA 3MZTA 5L0QB 3MLZL 2GITB 4DOHB 4FP8H 2DIBA 4M1CC 3BRDA 3IFLL 1KJMB 3LEXB 5D71H 4LCWB 4TUJB 3PQYA 1KFAH 3X17A 3SE9H 4DN3L 4N90E 1EGJL 2FGWL 3Q1SL 4KPHL 3WD5L 2AVGA 4X5WB 5EBMA 3V5KA 4CNIB 4Y4KB 1HCVA 3U0WL 4F58H 1TCMA 3DIFA 4Y5YC 1QFHA 4JO2L 4OF8A 3S37H 4KTEH 2OZ4L 4YXKL 1P53A 1I1AA 5JLZA 3GSOA 4WFHE 4PJ5A 4P3CH 4F3FA 3L6FA 3TN0B 1ZA6A 4FA8A 3KPRA 4BH7A 4D0BB 5E7BA 4EN3B 3O41B 1W8NA 4OZGB 4QKXB 4HH9A 2PW1A 3SKOB 4WI3A 4MX7B 1BIIA 1EA9C 2AXFA 4CW1B 3O9WD 2I07A 4WWID 3EJZC 4P2RE 2YRPA 1G7QB 4C4KT 4Y16C 2RCSH 3VFWA 1NUFA 1ZVSA 3BKYL 4JJHA 2BRRH 5AG9A 4NPYA 4YDIL 2HVKB 1ZVSB 1OPGH 2NYYC 2DF3A 1OQXA 4WFGD 1I9JL 2B4CL 4TSBH 3PF2A 2E9JA 3I6KA 5JDJA 3ARTA 3EYQD 3T8XB 4M6AA 3H9ZA 1PJ9A 4NQDD 5KANG 4IIQC 3MYJB 4KVNH 5IBTL 4DGYH 4Z18A 5IQ7L 3BOVA 4QRRA 4IDLA 3O41A 1X7QB 5IGXL 4HHAB 2H45A 3NN8A 1QBBA 3AREA 4YE4L 1PG7H 1FL6A 1FNEB 1T0MA 3VWKB 1XGTB 2VC2L 1IGYB 5EUKB 1SVZA 3HPLA 2OTWA 1A3RL 2ZUYA 3LVEA 4LSDA 2X4PA 4HAGA 1H5BB 4I0PB 5CFHA 1U95A 4BQ8A 2EIDA 2LVEA 1F4XH 3QIBB 4H1LG 3O4LB 5DMIL 1J1OH 3KPOA 4Z7UE 4NWTH 4OCLC 1V3LA 2XRAH 1HZHL 4MJIA 4XPBH 3VXUD 4HG4J 3G5YB 4FMFA 4K3JL 3WS6A 3D5OF 2Q8BL 5GHWH 1QBMH 3H7BA 3BMVA 3W5MA 3GMLB 3DX8B 5KOMC 4OZGA 1QSEE 1UM5L 2LV4A 3EJYC 4R4FH 3QXUA 1WWAX 1SBSL 2QLVB 1DL7L 3BPNC 4KAQH 1F3RB 4PRPB 1JRHH 2HFFA 2RHEA 3ARXA 5E2JA 4Y88A 3NVQA 5D5MB 3L6FB 1T1XA 1CFTA 5ALCL 5D1ZD 3BH9A 3HB3D 4WU7B 5D7JB 2VDNL 3PWVA 1OM3H 5LGJB 3QWRA 5DHVA 4P2RA 4UIMB 4KROB 5HYSB 1KYOJ 4H25B 5IB4B 4C56E 2EDEA 5B38G 4DKDC 5FO8A 5J89A 1MF2H 3VXMA 4I48A 1MPAL 1MFAL 2D7TL 4PBXA 3OGCB 4Y5XA 3T3MF 1IL1A 4F2MB 5IHZA 3PQYB 3MQIA 4IRSD 1BBDH 5I74B 3C87A 3B6SA 1AGEB 4OLXL 2XPGA 1DLFH 5CP7B 5F7YC 5FFLA 3BP7B 2DICA 5IHBA 6FABL 2BFVL 1KCKA 2YC1B 3N1GC 4N0CD 5EO9B 2VTFA 2OK0L 3WUWB 2ZP0T 3WFBL 4GKZA 1I4FB 3BX7C 5DMJB 4XC3L 2XTJB 4I0PC 1LO2H 3VXRE 3HMXH 3L5JA 4JRWA 3H2WA 2G2RB 5TF1L 3T0WA 2AI0L 2DM3A 3V52L 3VXNA 1UB5B 4O4YH 3GJFK 3JWOL 1G7PA 4L4VB 4EI5A 4NNXA 2A74A 1PKQB 3MX0A 2OSLB 3VFOB 1AKJD 3NCJH 1SYVB 5CEYA 5IR1A 4H8WC 4PRAB 4WO4A 4GAYB 4KHTH 3O6KH 5D70L 4Z7WB 2HJLB 3F7VB 1GH7A 1NC4B 4OFKA 1RFDL 2WBJD 5C8JA 3O6FC 3IF1B 4OUOA 1HI6A 4MNQD 3BVNA 3MJ7A 3QIWD 5DF0A 4KMTH 4FN0A 4R96A 3ULVD 1K4CA 2OCFD 2LTQC 5GJSL 3TEUA 3KPTA 2A83A 1DBAH 1E4XH 1M05B 2DKSA 3MRQA 4YFLI 1ZT4B 2X7LA 4LPWA 5BQ7B 2IAMC 4X4ZA 4NCC1 5HD8C 1ZV5A 3S35L 1CT8B 2Y7QA 3QFDA 3OKNA 5T5FL 5AZEH 1I9RH 1BVKA 3RA7H 3QXDB 1DBKH 2J7LA 2AXGA 4R97C 2ICEA 4IRJD 4G9FE 1XH3A 2QQLH 3CFBB 5HVHB 1YEIL 1S7VB 4LLVA 5HVHC 3RY6A 1N64H 4H20L 2CR6A 4FQQA 1TJHL 4XCCL 1IGFL 2A0LC 5JHDA 4LKCB 3DI2B 3MZGB 1P4IL 5L6YL 5CSBA 3RVXC 1GOFA 1RUPH 2AEIT 1BBDL 1U92A 5EDXA 4I8DA 4GBXA 3JTTB 1K2DA 2A9NH 3DTXA 4XCEB 1CF8H 1AHWB 1CD9B 1QYGL 3H0TB 3R8QA 2YD2A 5JW4Q 1SJVA 3PHSA 2J6EH 4ODXA 5IV2A 1WBZA 3RVWD 4FQXA 1MI5D 1QQDA 4NRZB 4LVNC 3G6JE 4Z77B 3BPCA 4DJMA 2ICWB 2R56L 5I30L 2ZSVA 3C9NA 4ODHL 4U1GB 4J4PD 4KHXL 3HPJB 4QOKE 5J13C 4K55A 1Q1JH 5TGBA 4KAQL 3QUXD 4JFED 3IDYC 3VA6A 3SDXF 3E3QC 3QULB 1KPVA 1XGUB 5AUMA 1LDPL 2VXTH 4PLKD 3TA3C 1T7ZA 2PKDA 4TRPL 3WDHA 3ARRA 1K8IB 43CAB 3BHBA 4UUJB 3PWUA 3F5WA 1X44A 3HCVB 4D9RD 4YHIB 1T80A 4HT1L 3L7EA 3SE3C 4PJ5D 2ZCKH 3ARVA 1MCQA 3D2UA 5KS9A 2P48B 1KUMA 3ECBB 4LDOB 3PGCA 2YUWA 3CNKA 1CE6A 2Q86A 5DMIH 4G8GE 3RIAK 1OGAE 1F4XL 1TZHB 3N1MC 3DSNA 3MA7A 3L5XH 4G6MH 3MLVH 5FO9B 4GLRI 1S9YA 2E3VA 2ERJC 2V9RA 1A6TB 3UTTB 5ADOL 5KJRH 4RX4A 3Q6FA 2NY1B 2G75B 2IBGA 1G84A 1MQ8A 1IVLA 3DMMB 1HQ4B 1OAQL 1TFHA 4ODUB 3IJHB 3MV9B 4EI5D 3CZFA 4L1DA 4PGEB 3I50H 5JR1H 1PZUB 4NQXA 2JJTA 4JANA 1SEQH 4UV7L 3B9KB 3G5XB 3O3DA 1RZ8B 5DRZB 4YDKH 2ZPKH 4HMCA 3ARGC 2BRRL 4RFEA 2G9HA 2X4QB 1HHGB 4YDKL 5J12C 3BUYA 1SM3H 3MNZA 5D2NE 3EDKA 4P23B 2VDKH 2DQGH 2GJZB 4APQB 1EO8H 2G5BB 5C3LD 3QUMH 3PABA 1A5FL 3U0TA 5GGSY 1ES0A 1A4JB 4KZDL 4LSRL 4XCFH 5BRZD 3S3PA 2G9HB 4QOKA 5BV7H 4NNPL 5M95B 1L0XA 5T1KD 4AL8L 1JMXA 1FZJB 4MA7L 3T77B 5FYLE 2Y6SC 1HSAA 3BDYL 3NFSL 4OI7A 1G0DA 4C54A 2V17L 4PV8A 5ID0A 1MWAA 3FMGL 5F44A 3MV11 1LO4H 4WI9A 2HT3D 3LDBB 4RA0C 5D1ZA 3G6DL 3S34H 5C08D 1WBYA 3EO0A 2OX5A 1JNLH 4KJYA 4A6YB 2QV2A 1I7TA 4FQXB 4LLUA 1P84J 3MA7B 4GKOA 3SQBA 4ZFFA 1S7SB 3ARQA 3LQZB 5I17B 3OR7B 3FQXB 5J8OA 1U58B 7FABL 5EIIB 1CXIA 3ZHDA 4HUXA 1HYSC 5K33A 1MI5A 4IRSA 5K9OA 1MRDL 1U92B 4Y4FC 4YWGL 2OJEB 2F19L 3QNZB 2MPAH 5HI4C 3RGVA 3VFSB 3ZE0E 5DQ9A 2YA2A 1YC7A 3FQTB 1WLHA 5IESH 4M8QA 5ID1B 1AR2A 3C2AH 4Q6IB 1G9NC 2J6EL 2GSIA 3WFHB 1FFOA 5LWYL 4HX1A 1ZE3C 4OF6A 4QXTA 5EZLA 2VSDA 1A1OA 1IQDB 1WZKA 3K74B 5INDA 4FXGA 4XCYA 5JA8B 3LKNA 4I18C 1P6AB 1RK0A 2DI9A 3UTTD 1S5IH 1EEQA 2CDGA 4AM0B 3SGKA 4N9GA 5JMOC 2VLLB 3QDMB 1G1CA 1RMFH 1CXEA 1TJHH 1T89A 4LHUD 1UZ6F 4PLOB 1YC8A 3ZYZA 4KJPC 1H3UA 1VPOH 3O8XD 2FEEI 4NKMB 4GFTB 4TQEL 5GGQL 2VXUH 4YNYB 2OTPA 5D2LF 5CJOH 3CVHL 5ILTL 1J1PL 4X7SL 4HBCH 3QJFB 1BZ7A 1A14H 1YEFL 4GAGH 5DZOA 1JF1A 3BVNB 1J11A 2APFA 1KIQB 5FA4A 1XAUA 4OLYL 3MRHA 3GSRB 4JG1L 3QWQB 5E6ID 2ID5A 3SE3A 2Z35A 1GL4B 2VDMH 1Y6KR 4QLRA 4P2OC 4L4VA 2XACC 3EBAA 4PFEA 5I9QC 5EBWA 3OKOB 2PR4H 1WCQA 1J8HD 3ZKMD 4JY6A 3RI5K 1A6AA 3D1MC 4JRYD 3VWJC 1FVDA 3QDGE 3U4AA 2VLMD 3SJVE 5HHXH 4YHPB 5JO5A 2VLJB 3F7YB 1RU9L 4X8XA 3K80A 2X89A 5IW3A 4KU1A 2X9YA 4MMXC 4OT1L 3JWOH 3VFUA 4X4YA 1YUHA 4HXAL 5J1AA 2Z93A 1N5YL 4MDJB 2X44D 1JZ8A 4RRPA 4XNYH 3UYPA 3W11D 2C7UB 3B3IA 1WIOA 1JNHB 3W0WB 5IEHA 4M9OA 5F9AC 1U8MA 1AXTH 2YZ1A 4LVEA 3ESVF 1G7HA 4NOFA 1MREH 5GXBB 5BS0D 1PKQA 3EW3B 3KHQA 3KPLA 5F7LB 4B5EA 4UB0L 5HVWA 4LPTA 1CVRA 1V8HA 4QF1B 2AJSL 2VUYA 3QXDA 5DHVH 5J6GA 4LLUB 3BH9B 1XIWB 3ZYOA 4NCC2 4IRJC 4A6YA 1HIML 1IAIM 1ED3A 3DROB 4QWWD 2B5IC 3T4AA 5DJCA 5DHXB 3RY5A 4FQCL 4GKZB 1J87A 2FO4B 3MRJA 1HXMA 6CGTA 3REWA 2ICES 2FRGP 3GMLA 4Z7VB 5BVPH 5EU5A 5F3BB 1HK6A 3OJDB 1RZJC 5C9JB 3FOMB 1T03L 3CIQA 3AM8A 1HSAB 5GS1C 4QNPF 4JFXA 3UTQA 4JFOA 2ZZUT 3GMPA 4KROC 1LK2A 4PRNA 1RUAH 4U0QB 1VADA 2PCPB 4IS6A 4Z9KB 1D9KB 2IADB 1C5CL 1CFVL 1FV1A 2OR7A 4PV9A 3SKNB 3ZE0F 2P4AB 5JIHA 2ICWJ 1X6NA 2DIAA 1ORSB 3DV6B 1SY6A 5HXMA 4JZJA 3GIZL 1OAZH 5GGRY 3HNSL 4XX1G 4CVXB 2NY1C 3GJFH 1GPOL 1ZGLA 2YR3A 2J88H 3KYMB 4ZOBA 3RWGB 3GJFA 4Y4HD 4YX2L 2DDQH 2C9AA 3UJIL 5EC2A 5EFIA 1KLUB 4Q0XH 2X42A 4YBQC 1R3HB 5DMYA 3GI8H 5I75B 3W82A 1D5BA 3T8XA 1SMAA 1KELL 4BQ9A 5DRXA 5ISZA 2VQUA 1XR9A 5EO9A 2BXYA 3RAJL 5CP7A 1RZJH 5JOEA 2XKNA 3TF7C 1DN2A 1ZLWK 1RJZB 2VO5A 3MXWL 5H37G 1TQBC 5IGXH 3P77B 3C8DA 4WW2C 5IQ7H 1JGLL 3MYZA 4R3SB 7FABH 1T0PB 5DJAB 3TZVD 3QEGL 4K7PY 2AK4E 1C8PA 3ZSTA 4G9FB 3CSBA 4CW1A 1C7SA 4Q6IC 3TIEA 2YZ8A 2Z31D 3VRIB 1P4LB 2B4CH 4ZS6D 1KT2A 3CX5J 4D0BA 4PJAE 4OB5H 5D7JA 1QRNE 2LFGA 4Q0XL 4MYWB 3O11A 4X0KB 1DBJH 2YD3A 3BKCL 3DX6B 3I3EA 3GMRB 4WCYL 3NFPA 4WHTB 4PD4K 3EJJX 3ARED 3OPZL 1TDQA 1NBQA 2AJYL 4K8RD 4OCSL 3MGAA 1LO4L 3BP5B 1HHHB 5DRWA 4P57B 3VI4E 3HG1D 4XP5H 4Y4KA 1W72L 2FEDC 4NPYB 3E6FA 3KXFD 4LSPL 2VZSA 1TNMA 5IROA 3M8OH 5ELIA 2AEPH 2XWBB 2FHCA 4G43B 3P3YA 4GSDH 3SDAD 2ILLA 2YWZA 4JDVB 2ZSVB 1QLFA 4JM2F 2W91A 3DXAB 3EGSB 5KSBB 4PJ9C 3PP4H 4J6RL 4JFQB 2OQJB 3BSZH 3MJGX 2W59A 3PJSA 1A5FH 3VXTA 1PKQE 4JE4B 3EO1B 1BFVH 2DQGL 2VDKL 3RVTC 2YA1A 4QCIA 3QDGA 1CFNA 2R1WA 2VQ1B 3LIZH 3MRIA 4H26B 2MCPL 4HWBL 3LEVH 5FKAB 4AEEA 4OZHA 4LFHD 1N6UA 2EEDA 3L5IA 3MV01 5CGYD 5D96B 5L2JB 3BO8A 4QRRB 5JIPA 5HJ3B 3ZO0A 1DVFA 5C3TA 1AI1H 1P84K 4RGND 5T3XE 3G5VA 1FZMB 3MRCA 2PXYB 4NC1C 5IG7B 1WZ1L 1MWAH 1XCQB 5BZWA 3PNWA 1QLEH 4NT6A 3RDTA 2VLRE 4M6NL 1QSFA 3EYUL 4ZAKB 1W8OA 2DJ4A 5C0AD 4IIQA 3B83A 1CG9B 3CUPA 4XRCA 5DC0A 2APBA 4QRRE 4BJLA 3D48R 5C0RL 4L9LA 4LVNB 2J1KA 2VR9A 1JYVA 4F9PA 4EVNB 2HYMA 4ENED 1Y0LA 3E6HB 2Q8AH 5EZJB 4PTUB 3DO3A 5EWIL 4CN4A 3KPPA 2J8OA 5GQBA 1T66D 5LAXB 3MBED 1ZSDB 1QSEB 3DXAE 5KSBE 1DUYB 1GAFL 2JLLA 4G7VL 1AGDB 4P2OA 5IJKA 2D3VA 4JVUA 5A2IH 1X5JA 3MRPB 1FJ1B 4Z8FH 4U1JA 5I1LA 3K4DA 3KDMA 4XVJH 3T08A 1N5AA 1IJ9A 2K1MA 5C0CB 4I2XA 2NTFA 2IGFH 3EZJB 1NC4A 4N0FA 1S9KC 1VADB 3WV0A 3RNQA 2ZSWB 4S1QL 4XP4H 1FFRA 4ODHH 4CDGC 4P2OB 4HIJA 4RGMC 5BS0E 1GGBL 1X4XA 2ZNXA 4QHKI 5B21A 1PGRB 2K3TA 1QHPA 5D9SB 1NDMA 2EDDA 5C0ND 1FAIH 3CVHH 3E6HA 2EH7H 2MJWA 1XMWA 4JFHE 4HS8H 1QYGH 1BWWA 2VXUL 2EKJA 4CMHB 5E9DE 5I73C 4NJ9L 1XR8A 1L6ZA 3CDFA 3QUYA 3O45B 1EEZA 4S1DD 3VG9C 1MELA 2EIBA 2CLZB 4JFPB 4F7CB 5IMMB 3SGKC 3H9YA 1BAFH 2R1YB 2IC2A 3BPLC 2EDKA 5C0JB 3AMLA 5CINH 1IAKA 2HLAA 2IFFH 4CADB 3LCYA 3EOTL 1YN6A 2MWCA 3KLAB 4P5TB 1GOHA 4Y4FD 5FIEA 1EAJA 1JFQH 4R7NB 3GSVB 3H3KA 4ISVB 1WFTA 3D0VB 2HFGH 4P2RB 4U1MA 1ZVHA 1N2RB 2AK4A 4NC2B 3B5TA 5FGCE 1F4AA 5DDHA 4PB0H 3S3SA 1JWUA 3DHMA 1MQKH 4JJ5A 2LU7A 1C16A 4EUPH 1MRDH 5LAXA 3J8F7 3S35H 4OZGE 1CGXA 4YHPA 4JR9H 3RZCC 4DK6A 2DBLH 2AV1A 1F6AA 2X70A 3EYOA 2UUDK 3D6GA 2Z91B 4EVNA 1X4YA 1KGCD 4AIXA 4XVJL 2GTZB 2E9BA 2XWJA 5I1EH 5DVKA 1CXLA 1YECH 5F8RC 4N5UA 1FG2A 1XGPA 4MD5B 3WJJC 4JDVA 2V2WB 4K71C 1AGCB 1YQVL 2B4CC 2EEBA 2I60H 1H8SA 1TVBB 4Y19A 4KVCH 3G6DH 4RFOH 5ACLA 3E3QE 5GRZA 1DVFD 3O6KL 4FQJH 4RBPK 4OGAC 4U3XA 4X80L 3S4SB 4OV5B 2HKFH 1MCHA 3SCMC 1B6UA 1B6DA 1ZHBB 3MRRB 2ITDA 3CC5B 1BD2E 4OZFH 1IARB 1X5XA 5D2NC 4RZCB 4KY1L 5HJ3A 4MA7H 1UKTA 3MV8B 2H6PA 3NFNB 1T0MB 4KV5E 4I3SL 2EYTB 1VENA 3P2TA 3VXUE 3MRIB 4HF5L 4P4KD 4DWHA 4GMSL 2P8MA 4NKDA 4HC1L 4L9LB 3BUTA 1HILA 3TT3L 5HHVH 1N6VA 1EO8L 5KVMC 1CTOA 1MCRA 3ZTNH 1RIUL 2NY2C 1F2QA 4GRLB 4IIQB 1VKXB 1AQKL 4X5LA 3K1DA 4XX1E 5JDSA 3LEVL 2D7TH 1RJZA 1MF2L 5TE7H 1WAAE 1PQZB 1CD8A 3DWTA 3WFEL 3MBXH 3T1FB 4JGJA 3RX5A 2I07B 2DYPA 5DRNB 2NR6C 1T20B 1MLBB 2GCYA 3DBXB 4JZOB 2BVPB 2P5ED 4JDTL 1JI1A 3PGFL 5F89A 3TYFA 1OAKL 2NX5A 3OTTA 2WMPA 4YQXL 1KIPA 3MFFA 1OB1A 4LASL 1GGYA 1NMBH 3JTSA 2HFTA 3U1SH 1ONQB 1FAKT 5B38B 5CEZD 3QPQD 5CJBA 3EO1A 4ZS7H 4OTXH 1DLHB 1QHOA 1MAML 4GQPH 4XTRD 3I6GB 3LRGA 4U4BA 1KB9K 3O81A 4Q9QL 4P3DA 4YGAB 4DKEH 4N1CA 1M7DA 4XGZB 3OXRA 4HXBL 1K3IA 3VDBA 1I8KB 3U48A 2C3VB 3GBMH 5LBSL 2PTTB 4JHZA 3OPZH 5E8PA 4G42B 4HUNB 1JE6A 2XWBA 1CD0A 3BKCH 4M48H 4NO0A 3JSSA 4OB5L 1HE7A 3OQ3B 1V05A 4J4PC 5IW1A 3CXHK 1HHJA 1IAOB 1UKQA 3PIQB 1W0WB 2SEBB 5E1AA 2VDPH 2AJVH 4HKZB 1MHHA 4ZS7L 5A2KH 2QBWA 3WO4C 3GK8L 1LO3L 2W38A 4BKLA 4YQXH 2EECA 3ZTJG 5F21B 3QDME 1U3JA 2IPUK 5EC2B 4WENB 5KN5A 5DYOA 5E9DD 4DUXA 3D25B 3P9LA 3HHRB 1R0AL 1G7LA 4ORGA 1T5WA 3FKUS 4XAWH 1GGIH 1PX3A 4R3SA 5C2BL 1JNHA 4WUUB 4XMPH 4L29B 4RQQA 1WWCA 3MR9A 2A9NL 4TSCH 4IRZL 4OGYL 3MV8D 5E4IA 2ED8A 3RGVD 3E0GA 5IHUL 1P4IH 5L6YH 2X6MA 3IRPX 3IDIB 1WBXA 3SKMB 2ORBH 3RWIA 5I15H 3NIDE 1O7SA 1RHHA 5DUBA 2V6HA 2XV6B 1ZT1A 4ZNEA 2GY7B 3RU8H 3MODH 3HE7D 4PJ8A 2P45B 4RSVA 1G0XA 3OAYH 2DTMH 3QQ4A 4GAJL 4P2QA 1DBKL 3BGFB 5CGMA 3QFJA 3RP1A 5C09A 1N6QL 2F5AL 4HKJA 3DX7B 5CHNA 3NZ8A 3WXVL 3O6MH 5T5FH 3RY4A 1U8QA 3L5WB 4X80H 4UAOB 4GO6B 1DFBH 2ZOKB 5J57B 3BWUC 5CS7A 1E6JL 5C7XH 5DD3L 1KFAL 4PV9B 1U8NB 1WZMA 1U8MB 1OAUL 1I1YB 3TH2T 2BVQA 2AGJH 5GJSH 2VZ1A 1FDLL 3SDXB 3GO1L 1HOCB 4JQVA 5EIQA 1RZIA 4NSKA 4WFFD 2WINA 3RTQB 1AC6A 3P4LA 2MTPA 1MNUL 3QHFL 4PJEF 3RWJB 1CL7I 5LGKA 5L88H 3RZCA 2DYPD 3DMMC 4YBLC 4M7JL 5CP3A 4PJAA 1NCNA 1BECA 4K23H 3L3IA 4AEFA 2NX5D 3QA3A 3ARFD 5IWLA 1H15A 5HGBB 1AP2A 1A7OL 5D2NB 1CXHA 3QXTA 2NNAA 2ZG3A 2V2XA 5INDB 3ZL4L 3M17B 1PZ5B 5IB3B 4Y4FA 1A1OB 1IQDA 4Y5VA 2XXMB 3O2VL 4XCEA 4XBPB 2EDFA 5IEHB 2D03H 1NGWA 3LD8C 1B3JA 5JOFB 1JTOA 3RTQA 3B4NA 3LD8B 3OKLB 4GT7A 5L0QC 4KRNA 2Z93B 4MJIE 3BN9D 1JPTH 3S96B 4OZIF 1TZGH 2VDML 4YDJB 4IM8A 1JYXA 4QXWA 5F7WC 3BAEL 4IDJH 1RPQA 2H2PD 1EJ6A 4LGPB 3UPRB 5MI0B 4K94C 1Y6MR 1U8QB 4YNYA 5F88B 4ZFFB 1B4JH 4ZXBD 1QFUL 3B9AA 3ME0A 5C09B 2EH8H 3KPSB 1NJ9B 2H26A 5GGVY 3EOBB 5TF0A 5TDPA 2VLKA 1MCWM 3SY0A 4M02A 3EO9H 2WAHA 4GXVL 2V5MA 1D6VH 5CJOL 5CEXA 2D9QB 5IT2L 4Z0XB 3OHXA 2D0GA 5C71A 4PY8I 1VPOL 3O8XB 2W9DL 4G8EB 2FLRT 1JP5A 1LNUA 2X4UB 3DURA 2VLRA 4LCUB 1RMFL 1R6VA 4ENEC 1AO7A 2Q8BH 3ZSSA 1JHLL 2F9BT 1HI6B 4PRID 4RAVB 2AW2A 1S5HB 2D7NA 5EWIH 3EDDA 1A6UL 2B39A 4Z7WA 2BC4B 1K9TA 2D7MA 1J1OL 4ZOAA 3MRBB 2ADGB 5IMOA 3VFRA 4L9LC 4UTBH 3C2SA 4HKJB 1ES0B 3MLSL 4Y4FB 3ZE2F 1DQQB 2BNQB 3UTPD 4JPVL 5F1NA 4KK8D 4PJGF 4PJ8D 4LCCA 3C09B 4KI1A 3FB5B 5HGBA 3OWEA 3NCMA 2BZDA 2MPAL 1CZ8L 1QVOA 1PG7L 3CK0H 5J06A 5A40E 4BSVA 3N85L 2DWEB 1FGVL 3RNKB 4JG0H 1ZT1B 4X7CC 4DGYL 4YZFE 1VEPA 3QHZL 2N7AA 4X6CB 5GGUA 1RAMA 1EERB 4PJXE 3AC0A 1E0OB 4MAUL 3ZE1F 3QPXL 4FABL 5SWZD 3QEQA 3C5JB 2CLRB 1W0WA 5EO0B 2H1PH 2PYEB 5IP4A 5L8JB 4Y5YB 4GMTH 2R15A 4PREA 2WBJA 4ZFGH 1GIGL 2MMXA 3TPUA 4AY0A 1IL1B 4Y1AA 4NZTL 4Z7OE 4L4TD 1KULA 1QBLL 3L95B 2B1HL 3HG1E 4H8WL 4L8SC 1TXKA 3HAEG 3OKKB 1OP5H 4XXDA 1BFVL 1R3LB 2ZOKA 4RIRA 3G5ZA 1A7QL 2YPKA 3SQOL 1S7SA 5ITFA 1RURH 4XBGB 3QFJE 2NY2D 1ONQA 1NAMH 3ZKSD 3HI6L 3U4EA 4OF0A 3CXDH 2OTUA 1T21B 3VJ6A 2ZOLB 4MQXD 5FCUL 5LXGH 3F7PC 2ZG1A 2GK2A 4QY8A 3WN5A 1MIML 1T1YA 3ZKNC 4S1SH 4DQOH 5C6TH 3S37L 3F6IA 4RDQG 4EN3D 3QCUL 4Y5YA 1WEJH 2AERT 4TSAH 4HG4K 4F8QA 3T1FA 1F45A 1WBXB 2DQUL 3HE7C 1TETH 2GFBA 4KKBD 2QR0B 5HD8D 3E2HC 4NQCA 3A0OA 4GQ9L 4MJ4A 4HZLA 4JEGB 4IJ3C 2ICWA 2NY6B 2DQDH 2HRLA 4BELD 2QSCH 3TN0D 1OD9A 4I0PA 1YPZA 4L4VE 3S36H 4EIZC 2VZVA 2FECI 1EJOL 4JFDE 4TNWK 4DKFH 5IBLC 2IMMA 5D1XD 3QPXH 3BYTA 3V0WL 5F1NB 4CRPA 4FQ2H 4DKFL 2UY7A 3L3JB 1KN4L 3QHZH 1MFCL 3V4UH 5C6PB 5FO9A 5DS8B 1ZWIA 4WW2A 1FGVH 3IETA 5C07A 4HUWA 4WHDA 2YPLB 4NQUA 3HC3L 4F7TA 3ECBA 3QQ9D 5EU6A 4H0GA 3O3DB 5DRZA 1T0NB 4HGWB 1T22A 1E6OL 1BJ1H 5IWLC 2CIIA 5GRVK 3TBSA 1ZHBA 1DQDH 4F7PA 4LLVB 3WYRA 5BW7A 1P1ZA 1MIMH 1J0HA 1F8TH 1LK3H 1PY9A 4LNVA 3LKOA 3QQ3A 4WFED 4PRDB 5IM7A 2DQHL 1LVEA 4P23C 1E27A 4L8DA 3B9EA 1AE6H 1XGPB 1BLNB 1TQCC 4X6DF 2ADJB 3MREB 4KXZH 4NKDB 1A22B 3NCBB 3R1GL 1MFNA 4JFHD 1U8IA 5J9PA 4F33B 4ZD3L 1NBYB 1U8PA 2VXTL 1IGMH 3O6FA 3VFTA 5B38A 4MMZC 5IT2H 1KPUA 4BZ2H 3HLAB 4X7TB 4URTB 5J7CC 3M07A 4GXVH 1UM6H 5JLZB 2HWZL 2F5BH 3D2UB 3VA2C 5KS9B 3AM8C 3V7MA 1ZGLM 2VZ3A 1GZQA 1GIGH 4RMTA 4P5KA 1IGJB 5HHPB 3V6FB 4EI6A 1HYRC 2EO1A 4GW1B 4NBXB 5L7XH 4IMKC 5AWNL 4JHAL 1U8HB 1VA9A 2PETA 3QJHA 1NCBH 4XH2B 4M8VA 3T0BA 8FABB 4NGHL 1B4JL 4MAYC 2K7QA 1OSZB 1A6VH 1R3IL 4GAYA 3L3GA 1CFSA 1C7TA 2FB4H 4WGWB 3O4OC 2X09A 1RZKH 2NX5E 1GGTA 3QQ9C 2GITA 2AXHA 2XWJB 1T6VN 2DQTH 5J0BA 4M6ML 4HV8B 4MS8C 4EOWH 4JPVH 3TC9A 4KMQA 4UB0H 3VDAA 3VGAB 5E24E 1MSPA 1YMME 3CCHB 3RPIB 3OKNB 2DQIL 4DZ8B 3ULVH 3S97C 2R4RL 1JWSB 3K8MA 3NIFE 3VFGL 2AP2A 4DUVA 2D7PA 3VFNB 1NMAL 5HYJB 3ULVC 2JK5A 1VGKA 4NJAH 5GGVH 1XIWD 5T1KA 3TVMA 3PQYD 1YEGL 5AAMA 3NGBC 4S1DC 1JGUH 5GS0D 4OD3L 5H35B 4B0MM 3U46B 2VISA 1U2HA 3MRRA 1E28B 1FYTB 4M7JH 3GI9L 3WN5C 1I1YA 3IAGC 2IH3A 2VNCA 4YHZH 5I1KH 5GS0C 1BBJB 2CKBL 5I1LB 4FQXD 2R1YA 1X4ZA 2W07A 4WDIB 4G9DB 5J1SC 3FO1A 5BV7C 5EZOL 5J6HA 4Z7OF 4R0LA 1IGTA 4ETQA 4XTRC 1ACYL 4NYLA 4JY4B 2VXSL 1ZGLP 2WWKO 3QCVL 2DQJH 1XGYH 4OZFG 2RFXB 4Z78B 1WFNA 2O5XH 3ETBF 1LE9B 3I02B 1MCWW 2APXA 4M61A 5D2LA 2BCKA 4PLNC 3IFPB 3V4VH 4H1LA 3WXVH 4R0LB 1AJ7H 4N0CC 1QSFD 1YEFH 4OJFH 4HIJB 2DLEA 2LAAA 2B1AH 2VL5B 3WIFB 3RWFB 4OIAA 3LRSB 2XA8H 4OAWB 15C8H 4LVHC 4A2MA 3CJJA 3INUL 5D1QD 1MCFA 4NQVB 2J8UF 3FAXA 4DOHE 1NCAH 1FFPB 1AGDA 2CGRH 2DLTA 4I13B 1XGRA 2P5WA 4MQSB 5KBNC 3P9LB 5DJDA 1DLFL 4MD4B 4OLXH 4EQ3A 1YYML 1YY9D 5EZJA 3P9MA 1UACH 3CDGB 1KF9B 4IRZH 3LS5L 1A64A 3RJDA 2F8XC 5K9QG 3QNYB 3BQUD 3CSYA 5C0IA 1QEWA 2GK0A 3RPIA 5DJZA 1SY6H 4XAWL 5MENA 2DM4A 5SWZA 1DSFL 2VXVL 1NGYA 4LQ1A 3HTLX 4PJ7E 1CG9A 3CUPB 3HUJA 3DXAA 5KSBA 1J12A 5E6IB 5GGRA 4PJ9A 3HZKA 3I3DA 4HIEB 3DETD 1NCDH 3JWDC 3QUKA 4NQDE 1KG0A 4DN4H 4XWGH 2I26N 1MCLA 1CFSB 3P4OB 5F97E 5SX4H 1JBJA 3GSQB 2ARJB 2X40A 3RUGE 3IDGB 4HWZA 4ZUUA 1A6WL 3HNTL 4UNUA 5KSUB 2NTFB 1FZMA 3BEWA 4D0CA 1QTYT 1FLTX 1JZ6A 3IVKB 5FA3A 2YKLL 3LV3A 4QOKD 1JZ3A 3KPNB 4LSTH 2YMXL 2ADIA 3AAZA 4FQ1L 4U1NA 5IEKA 1J05B 1UJTA 4ELMF 4Z7NE 4LPCA 1HZHH 2PNDA 1CFTB 3SDAB 4GAJH 1ZHLB 4QT5B 3V0VA 1UJ3C 4PJ5B 4F3FB 3QZWA 1DEEA 5C6WH 2V5TA 5IFJB 3RL1B 4Y4HB 1U8JB 3U9PH 4KZEH 3CDCA 4WTZG 2BK8A 1ZEAH 3K4ZA 2R29H 3RL2A 3PDDA 2OZ4A 4DVBA 4OLVL 1MAMH 1M7XA 2BVPA 4U1LB 3QNXA 5BMFH 3QUZA 4KK8C 3RZWA 5F71A 2VWEC 1CQKA 3TT1L 1QO3A 4PLJD 5IHUH 2W65B 2BVUA 3HAEB 2XFXB 3P11L 4NM4L 4IJ3B 5MP6L 2L7UA 3ILQD 4JM2C 3LN4B 4MA8L 1VEMA 2X9XA 5SV4A 1K3ZA 3T2NL 4XCFL 3BXNB 2YD9A 4LSRH 2PXYD 1XF3B 4OCWL 1TZIB 1VFBA 4GG6E 5E8DH 1HHHA 4QXUH 5E8DL 2IBZX 5JXEC 2HMIC 4R4BA 1HILB 2R39A 3WHXB 3BPLB 2X1WL 4QRPE 3NAAH 2UYLB 1BOGA 1YJDL 3NN8B 1D7FA 4KJQD 5IIEA 1QR1B 1BFOA 5HYFA 5TDOA 3JWDH 3TV3L 4AEHH 3WHE0 1IEAB 1NCTA 1KJ2L 2NXYD 1IM3B 1PFCA 3QWRD 3FQNB 5DJAA 2ARJQ 5A3IC 3I50L 3UYRL 2Y6SD 4RWYL 2FDBP 4RMSA 1EXUB 3QI9D 3RJQB 5ECJE 3VXMD 4I3SH 4Q7DA 2P7TA 4NQCB 3VFWB 4OFPA 2H32H 2DOCA 5FYJL 3PL6A 3MRLB 2FLBT 3ELAT 5EU5B 2XZAH 5F3BA 4XMKL 3FQWA 3FB8B 1CIDA 2GTZA 4AH2B 3WN5B 3O9WA 3C5SB 3WD5H 5F7NC 4G7YH 1JI2A 4FQJL 5MENB 1YNKL 3RL1A 3RRQA 1T1ZB 3STLB 4N8VA 4DN4L 4P0DA 1A7PL 1IC4L 2HG5B 3VXSA 2I60L 2VITB 5FYLL 3TFKC 5K9JH 4IRJA 4JDTH 4JJ5B 4QF1A 5I19L 4X99A 3BE1L 2XZZA 1LDPH 4XXDB 3UJTH 1KCVL 2BVTA 5LQBH 2Z31B 3H9SA 1QFWI 2Y23A 2P5WB 3VWJB 2Z31C 4XVSH 1A7RH 5EH1A 2XWTB 3QAZB 3P4OA 4OCXH 3TZVC 3QUKB 3O3UN 1Q0YL 3MJ8A 1OP9A 3IYLW 5EUOB 4M62L 2XY1A 4JO1L 2QTEA 2HFEB 3C09C 5KZCB 3CH1B 1EO5A 3RHWF 1HXYA 1S7TA 1YEHH 3HE6B 2BCKB 2DJUA 4ONGH 3PWNA 1QSVA 1MCPH 1QVOB 3DPBA 15C8L 3HC0B 3LKRB 1NBVL 4OIIH 3NMEA 3RWHB 2OJZL 3GJFB 3DECA 3FT3B 3KXFB 4PJ7A 5DJ6A 5T3XL 1Y18B 1AJ7L 4QRPD 1NKRA 5E2UH 4UQ3A 2OL3H 4XHJC 3MLPA 1BX2B 1JPST 4MA1B 3O2WL 4NQVA 3D0LA 1KB5L 2FIRT 2WIIB 4RRPG 5T5NF 1ZA3A 4HS8L 5BXFB 2W0FB 3KYOA 1D9KA 4L3EA 4X4YB 5DA0B 4LPXA 4NQCE 2VWEE 5HI5D 4XH2A 3QEQE 1JF1B 4CU8A 5LGHH 2VL5A 3WIFA 4CVZB 3N1FC 3D2UD 4LMQE 1RJLA 3DX9B 4K94L 2EDTA 3FFDB 3FO0H 3SKJL 2VL4A 3HLAA 4X7TA 3KPPB 2FATH 3FRPA 4WWKA 2EXYC 1C08A 1T83A 5L9DH 1XF2B 3GJEB 4C4KO 5MEQB 5EZIL 3V6OC 1U8PB 2IGFL 4D0DA 1KC5L 4DZ8A 5ITBH 5B3JE 4K94H 1GZPB 3QDMA 1N4XH 2VLLA 2WQRA 1R5IA 4KMTL 5EOQH 1PY4A 3DMMD 3X13A 3EFFB 3OL2A 5JQ6L 3GRWL 4JPIA 3Q6GL 2CDEB 4GG6B 5ENWA 5CBEB 1IFHL 4KQ4H 3BJ91 1FPTH 1BBJA 5C70A 3U6RB 3QXWA 3D39A 4DGVL 2ZUVA 3GSXB 5E2UL 5T3XH 1JZ7A 3G5VB 4NP4L 2OJZH 4C56D 1MVUB 1BEYH 2DL9A 4O4YL 5JNYB 1KIUA 3GMQA 3PDGA 3X3FH 4PRIE 2AI0H 2YPLA 2FZ3B 3IFOB 3VXOA 1ZWIB 1QKZL 4O2FB 5C0CD 5IB3A 3HMXL 2FIKA 3ULVF 1B0GB 4ESKA 2XN9B 3OB0H 2VZUA 5D93B 3S5LG 1LEIB 2E27L 4P49A 5F72S 4CMMA 4M5ZL 3UBXG 4JFQA 4OLZH 3V4PL 4M4PA 3W0WE 1EUTA 2WANA 2JCCB 1Q9LA 1A7RL 1I1FB 2GFBB 4N8VG 5D8JL 1OGTB 2FSEB 4XZUA 3CU1A 4ZD3H 1BP3B 4J12A 5GSVA 3R1GH 1QPXA 2BVOA 2VDNH 5EU4A 5K9JL 2VLJE 5E8NA 1YNLL 2CH8A 1U8OB 2AV7A 3SJVB 4KI5F 5DUPH 1JV5B 2VB5A 4KQ3H 2J6EA 4JRXB 3LEYH 1FZKA 4LAJH 4CJ1A 1F8TL 1LK3L 1MVFA 3EJZD 4AG4L 4OI8A 1EGJA 1BQUA 3DUUA 4Z7QF 1OWWA 5E00B 1FL3B 1WJ3A 4PG2C 2KKQA 3ILPA 4WNQB 4XP5L 3TBTB 5D7KD 4FFYL 1JGDA 4XPBL 2J12B 3KLHC 4P5MA 3TN0C 5D2LE 3QG7L 1A0QH 2X4QA 3L95A 4M1GL 2OL3B 1YMHB 4RDQF 5CILL 1JZ2A 4P99A 5IKCB 3O2DL 1I8MA 3ET9F 1Q9KB 4DK3A 3C5ZD 5HGAB 3RWIB 4YZFF 4U7SA 4FQ2L 5D4QA 2Q76B 1HDMB 2P8LA 3WFHA 2CJUL 4JQIL 4XCNA 2UWEA 1T0NA 4HGWA 3QDGD 4AEHL 5TJWK 4UIKL 5J3HC 3RNKA 5J1TC 4TTDC 1F97A 4BSVB 1T1YB 4GKSA 2GEEA 1RUKL 5I1GH 2WW8A 2DQDL 3GHBH 2VAAA 5FKPB 3IETB 5C07B 3PHQB 3WCYA 2EDJA 4KVNL 1XF5B 4PJHF 3OKYA 2DAVA 5EIIA 4WUKL 2R4SL 2OTUB 3BKJL 3W9DB 4NQED 1ZGLB 3FQXA 1XEDA 1T2JA 4LIQH 1TCRA 4U0RB 3ULUE 4DQOL 4NZRH 2VLKE 4V1DB 3SE8H 3LPWA 4PJAF 1UZ6E 1WBYB 1ZS8A 2ATPA 4KDWA 3QDJE 2CR3A 1QZ1A 3VD7A 4DAGL 3S5LB 1B4RA 4WW1A 3S4SG 3PWUB 3KPQB 5BMFL 4R4ND 4POZD 2YHGA 1PVHA 5F9OL 2P43B 4MA1C 4HDIB 4LCIL 1FNAA 1XT5A 4OZIB 3PWPB 2HT2C 4KH2A 2AJYH 4Z95H 4NNYA 5GGUB 4LVHB 2VKXA 4G8GA 3V5DB 4POUB 1RUAL 4L4TB 2OZ4H 4YXKH 5T1MA 4WI7A 2IANE 3UTTA 4DEPB 3ILPB 4WNQA 1UA6H 2OLDA 3BKMH 4AK1A 4APQD 1YMMB 4EBQH 5TH2B 1KLGB 5HPOA 2BVYA 5F6HJ 4YH6A 3DUSB 3TO4A 4MNGB 5C0BD 2GSGA 2NX5B 4TNWF 3HCVA 4L3CB 2R2HB 5CJ5A 1K8IA 5FDYA 4U2ZA 43CAA 1CGVA 4LDEB 3OG4B 1FC1A 4XZUB 1KPVB 1JUFB 3QULA 4I5BB 1AO7B 3GZKA 1FGNH 4A6YL 5HI3C 5DK0B 5EO1A 3SGJA 4OFVA 1T04B 4U6TA 2R0KH 2GW5A 2CDEA 5T1LB 4RISL 2I5YL 1UACL 3DI3B 2LAGB 4ZYKA 4LLYB 3I9GL 3WUZA 2CMRH 2A0LD 3QG6A 2CKBA 4LDLB 4PJ7F 1EZVX 4JN2A 2F15A 2BOCA 1CL7H 1A2YB 1T66C 2A77L 1TMCB 3RX7A 3HA0A 3DUUB 3RZCB 3INUH 3NFNA 2XA8L 4RZCA 2A83B 2Y36H 4M7LH 2X4RA 4OSUL 2RB8A 3DGCR 4IMLB 4ODBD 3LAFA 3SGDI 2V9TA 3QO0B 1Q72L 5HI3D 1WGOA 5D1XC 3K2MC 3WE6A 1I7RB 5JW4R 3BAEH 4XI5C 3GSNL 5GZND 3NZ8B 1Q9LB 4D9LH 3BIKB 4QRTB 2QKIA 1PLGL 2A74B 5KVGH 5DMGD 5DJ6B 3RVUC 4E41D 2AAVA 1RK1B 2BSSA 1CD1B 3QUMB 4J3VA 4OLEA 1RZFL 5I18H 4WEUD 43C9A 5F88A 2DI7A 2NW2B 3KJ4B 3T0VA 5DEFA 5DTFA 4BM7A 1A21A 4EIGB 4NZDA 3ZHLA 2NXYB 3OR6A 3OXSB 3RWDB 4KDVA 1OT2A 4LLWB 1M1SA 5HGHB 3SGEI 1KBGL 2GSIB 3NCYS 4ORZC 1W0VA 4C56A 3L3OA 3LRHA 3MJ8B 2YBRA 4YBHA 2I5YH 1LEKA 1ZA3B 5BXFA 3TJHC 4L29A 4RQQB 4PGBA 3TH3T 5JOFA 2WIMA 3UTSE 2ICCA 2PTUA 1MJ7L 3UCRA 5IMKA 4E41E 1QSFE 4JO3L 1EFXB 4BFIA 3RBGA 4RNRA 5HDQL 1JGVL 1MNUH 4NHCH 2ESVB 5IQ9B 5E95B 2AXGB 4J8RA 5L2KB 2E9WA 4YHMH 1I7TB 3L3DB 4CKVX 2EZ0C 3MLXL 4KJYB 5GGTL 3KWWA 1FFNA 1FBIL 5T1MB 2HFFB 5DLML 3SGDH 3V6BR 1OAUH 3SO3C 3KJ6H 3B8SA 3V6OA 1PYWB 3WJLA 3ARBA 1I3VA 4XAKD 3FL7A 2FBJH 3N1QC 3VWJD 5BJTB 5HDOA 1B90A 4K8RH 1T83C 1BZ9B 1GOGA 1GYAA 5E8OB 3STBA 2BRQA 5GS1A 5I2IB 4H0IA 4N8PA 4Y0GA 3H42H 4O51B 4R26H 3FFDA 5AWNH 1G0YR 2QQKH 2F5AH 1I9IH 3VFPA 3X14B 3PL6B 2VJXA 4QTHA 1A14L 1U41A 4BSJA 2FYYA 4CVZA 4HMEA 2HWZH 1J8HA 1IKNC 4PRPD 3T77A 2DMKA 2P44B 3OXRB 2Z0BA 4ZG1A 5CBAB 3KS0J 3MODL 2C1OB 3GGWA 5DEGB 4YXHL 3KR3H 2GTWA 3KYNB 1H3PL 1MCIA 4XNQA 5IFHL 2OSLA 3HPLB 4NUGL 3BDYH 1WT5A 2I9TA 2HKHL 2G5BA 1ZT7B 1ND0B 2R9HC 4NCDA 1RV6X 3WLBB 3LH2L 4UZGA 4P23A 2NY6D 4NO5B 4BQ6A 1VGEH 4G80A 1B2WL 3BFOA 4L8CB 5C2BH 3UPCA 3SHSA 4AT6B 1C1EH 4BKLB 1LO0L 3B9DA 4TVPL 5AYUH 2ESVE 1JN6B 3NPZB 3CH1A 5GRVL 5B39B 4Y4KD 5FF6A 1XF3A 4JFYB 4PJXF 3QUZD 3V2AR 1SHMA 25C8H 5IW6A 1ZK9A 3O3AB 4G9FD 1QSFB 2PYED 1D5IH 3QCTH 5D72L 2IJ0C 5EOCL 1UGNA 1RUQL 2BOBB 4CN1A 4YFDB 4HFUL 5F96L 2PTTA 1LO3H 2AQ1A 4IEFB 4KK6D 1M7DB 1T7WA 5HYSA 3GDBA 3ZE2E 2E8ZA 1FZOA 5E00A 1BQLL 1S9VB 2XG5A 3VXRB 3S34L 2R1WB 3MV8A 3FO9A 4WVRA 2WV3A 1SBBA 1LO5B 2E6JA 1YEDB 2WZPD 1XZ0B 2AXJA 4WJ5B 4R4BB 3O9WC 3RWEB 2F53A 2DQUH 4KKNA 4OKVA 1BVZA 5FA3B 3VDCA 3PV6B 4WFEE 4YHKH 2E7MA 3AS0A 4U6XB 3VMOA 4MJIB 4OBRA 3GBNH 3KVQA 3LPFA 4PJFF 5FCUH 4NQEE 4XNZB 3CXDL 4PRIA 3PWJA 4HUUB 3QIBA 1F5WA 1IAII 1VKXA 4S1RL 3PE9A 4NRZA 4HH9B 5DO2C 3Q48A 2YXMA 3T4YB 2BY2A 4MB5A 3P0YH 3C5ZB 1NGYB 1TVDA 4PRPE 3BP5A 2YEZB 5DURD 3QI9C 5ANMA 3TO4D 2VXQH 4HFUH 3MV7A 3BISA 3JTSB 5DFVD 2BNRD 4PJ9D 1NUNB 1I7ZA 3HZYA 4RGNE 3SGJC 4OM1L 3O4LD 3EYVB 1D5IL 2EYTA 3VXOB 3TESA 1J0ZA 2H6PB 1OL0A 4JPWL 5I1JL 3C6LA 3D3VA 3DIFB 4GMTL 2X10A 4BK4A 1MVUA 4B7LA 1KIRB 2AK1H 3WHXA 4D0CB 5I75C 4NKIH 3WFZA 4XHQA 1FFPA 3GSQA 3GSVA 2R1XB 2D7QA 2XNAB 3C8KA 3HZVB 4LSQH 3S4SA 2WQ8A 1EZVY 1DBMH 4OAWA 1AO7E 1F3DJ 4HLZH 4P46A 5I1DA 5FK9B 4R2GB 4X6DE 5C08A 3WNNA 4JRXD 4ZFOB 3V8CA 9CGTA 4YGVA 2E7HA 3CFCL 2EE2A 2JKXA 1ZVYA 4PTTB 5B3JF 2J5LC 4XCCH 3QUYB 5HYIA 2AXFB 3VD3A 1MUJA 3UEZA 5T1DH 4DGVH 1BJ1J 1BQHA 2A6DB 5D1ZC 2W9EL 1BF2A 4QHLA 4KGJA 3RWGA 2XT1B 3NPSC 4YDVB 5MI0C 3SBWC 3SDAA 1P5UA 1A9BA 1VCAA 1JHLH 4LRIA 1DN0B 2KDGA 3GKWL 3T0XA 4MSWB 4L4TE 3U7YL 1CLZL 2C1OA 4PRHA 3MRGA 4Q58C 4I4WB 1AFVL 1KTRL 1FV1B 3D0VA 1DCLA 4WU5A 4HS3A 2X41A 3KDMB 1LK2B 1G6RB 2ED7A 3KJ6L 2A73B 2NXZC 2WLYA 3TH4T 5KSAD 5IR1B 3OJDA 1U91A 2P42B 3LEXA 3RIFF 3G04B 3BWAA 5MERB 1VFMA 3WS6C 3X12A 5I2IA 1G7PB 1Q0XL 3JXAA 5FYKD 1TJGH 1QD0A 4LHUA 1WICA 4JKMA 3ULUH 1JWMA 5BJTA 1CDHA 3QRFM 1F6AB 8CGTA 2J8HA 2A6KA 3CFKA 3IU4L 2KH2B 3EOTH 1MCNA 3D3VE 3NCJL 1S7TB 5DEZA 3ZDYF 4ONFH 2LE9A 4MNQB 4J3XA 5M94B 1IE5A 4U3HA 2JJTC 4WY7H 4L4JA 4UILL 4TUOB 2GT9B 1KN2L 3FB7A 3J7HA 4OIIL 1EFXA 3NZHH 5HHMB 5D6CB 1IM9B 5F9DC 2VE6B 3C8KB 3HZVA 4LCWE 3RIAF 3D85D 3RY6C 2DQFA 5TF1H 1EEUA 1YEIH 4XP1L 1X6LA 5E6ZA 3VRLF 1LO2L 1LEKB 3ZYIA 1OSZA 1YN6B 3GNMH 2Z8RA 4OFYD 2EH7L 4JO1H 3B8YA 2QHRH 5IJVA 1FCGA 4PLJC 2HJKB 3FTGA 5LGJA 5F9JB 4YK4B 5FCSH 1JWSA 2YD4A 1UADC 2ZUSA 2MNUA 4UDUA 43C9B 3BZ4B 1DQLH 4R90H 5I1HH 5CP3H 3QEQD 2PO6A 4CN6A 2NTSP 3C8HA 1F58H 3MACH 5KVFH 5JIKA 5ADPH 1F11B 4U31A 1GAFH 4G7VH 3REVA 4KK5C 4LEOA 3IS1X 3PWJB 1G7IB 2AJ3A 5FYJD 4R6UA 3CAFA 3QQNA 1ZMYA 4ZXBC 4J7RA 4RGOH 4U6VH 4IOSD 5FGBC 5C08B 1KENH 4PJHA 4ODSL 3RDTB 4AQ1B 4P5TD 4Y4HC 3OF6A 1NFDF 2ZWLT 1F3DH 3PNWB 3QJHB 2R23B 2CIIB 1H5BA 1OLLA 3QUYD 4QTIL 3RI5F 2F53B 1IM3A 4UINL 2CXGA 3EYFA 3IFNL 4LAQH 1RZGB 5FOBA 4PJIF 3IS0X 4P46D 4TYUA 3RKPA 5HYJA 1IGYA 2DTML 2NW3B 1JZ5A 5A16B 4NKOA 5F6HI 1Y0LB 5E9DA 1AD0B 4GKNB 5FKAA 2R0LH 5DS8A 5JORA 2FJGB 4MJ6B 4KTDL 4RWYH 5DK3A 1E4WL 2ERJB 2P8PB 1YYLH 4TNVF 4HMDA 1WZ1H 1PDKA 3MROA 1B0WA 5KVDL 3RVVC 4AMKH 3HI5L 4S2SA 1KCLA 5E1HB 2IALA 2CUIA 4RWHA 4ZDHA 3TV3H 5BVJB 1UC6A 3MCLH 3FT2A 5CD3B 4JY5L 1A1MA 4MXQD 3LQAH 4E0RA 2EE6A 2MCPH 1MI5E 1MFAH 4PRIB 3LIZL 2GYSA 1P1ZB 1F6LL 3FN0H 3VH8A 1NC2D 4K3DL 3UC0H 4PJBA 4PUBH 1P4BL 5HVFB 2AABL 8FABA 1BIIB 1UYWH 3SPVB 1U8HA 1QPPA 4JB9L 4K7PH 3MLWH 3FT4A 1MFDL 4U1GC 5GS2H 4GW1A 5J13B 4YDIH 1BHGA 3RWEA 3EYVA 4OKDA 2O5YL 5IVXF 4ELME 2F8VA 2BHZA 4R2GC 3BPOB 3VI3E 4DGIL 3GK8H 1EV2E 3O0RH 4XP9H 2YSSB 2ADIB 3AAZB 5F9OH 4HZAA 1AY1L 1S9WB 1AY1H 4MXWH 5GHWL 4FQLH 3FHAA 3MA9L 2R29L 1L6XA 4QYOA 5CAYB 1FQ9C 4Y2DC 4U1HA 1MCOL 2C3HA 2IADA 3MJ9A 3DNKA 4N8CH 2DLFH 3V7AG 2O5YH 3CSPA 4E9LA 5BW7C 5ESQA 5IVXA 3WIHH 1EFXD 1RULH 2R0WL 3MC0A 3O3AA 3QEQB 1V3MA 3REWB 1OTSC 5FDWB 3KXFE 3U1SL 5DJCB 5ETUA 1IGCH 3ULVE 4D8PB 1LO5A 3DROA 4JGMA 4U6HA 1MJUL 4UMGA 3B43A 3AY4A 4ZOCA 5ALBH 4O5LL 4G80B 3OKMB 3MCLL 5SWSA 1HWGB 3T3ME 5F3HB 2R2CA 3V6OE 4G8FB 1CLCA 4MD4A 4JQIH 2EKSB 1YJDC 1MEXL 1ZTXL 1R3LA 3HC4L 4APQA 2C3WA 2FD6H 5DR5H 3WFEH 2GTWB 3KYNA 3HZMB 4X6EA 5BS0B 1ORSA 5CILH 3KPMB 2RCSL 5D96C 4WI8A 1YUHB 2F54E 1RIUH 2J4WL 5JIIA 3B2UD 3LRSA 5FM5O 4LCUA 4MQ7A 3DURB 4XP6H 3MUHL 4FFZL 1D5BB 2JE8A 2C1PA 1NANH 5IKCA 1HXMB 1QFOA 1BREA 1UQSB 2OR8A 2Q7NA 1ITBB 4C83A 1BZ9A 2P5WE 5FYJU 1KJ2A 3VU2A 3H7LA 3HMWL 1HKLH 1ED3B 1WV7T 1YDPB 2BNQA 5INCA 4XAKE 3IJSA 3FONA 5DI8A 3U0WH 3QDJA 3PL6C 1H0DB 4GLRH 3IDNA 3Q1SH 2O5XL 4PY7B 4FZ8H 3MGTA 5SV3A 3KPLB 4D3CL 1NC2B 1I9EA 3SE9L 2MCG1 1N8ZA 1X5AA 2KQMA 3LN5B 4HCRA 3H8NA 5KSAA 1LP9F 4K07A 5JUEL 3DVFA 3VMNA 1QLRB 1DEDA 1ACYH 3V4PH 3G6AA 4PJCA 2M2DA 2H2SC 3DO7B 1NBZA 4M4RA 2WBJB 2EZ0D 2CIKA 5TDNA 5IFAH 5F1KC 1I1RA 1WWWX 3AS1A 5D7LD 5ESAA 1MREL 3BEVB 4OFDA 4XPGL 4JR9L 5IF0B 1AH1A 4S11A 2GJ6D 2ZCHH 1EHLL 3CCHA 1N5YH 1GVIA 4NDMB 1NAMB 5JXEA 1RZ7H 3UP1A 1JPFA 3CFEB 2HFGL 3JUYA 4P2OD 3ZTJH 3VFGH 2IPKA 5T1LA 32C2A 4DCQB 1JFQL 4O2FA 5TQ0L 4LBEA 2F58L 3R06A 3TZVB 2DKUA 5CJQL 5DFWH 3MMEB 3W0WA 1G9EA 3HUJF 3LHPL 3MNWB 3VE0A 5GRYA 2WUCH 4G8GD 2Q7YA 4OD2B 3KLSA 5IB5B 5TE4L 3V95A 4PJIE 1JK8A 4JN1H 1HHKA 2UWEE 1ADQH 2HN7A 4FXLA 3GSNB 1N4XL 1MI5B 5F1IA 3QIBC 2YUZA 3D39B 1S7VA 4JFZH 3TO4B 1XH3B 5T3ZE 1FYTD 1KTLA 4DW2L 3CVIL 4GG6A 3KLHD 4HEPG 5I66A 1A6VL 1MJJB 3PHOA 4WGVB 3IJSB 4IBLT 1YEKH 4HKXA 4GAGL 3MRNA 4V2BA 3RKDD 4LRIC 2ADJA 4OLWL 5CD5D 5CUSL 4O2EB 4X7SH 1B0RB 2A2QT 3MLRL 4M7KH 1DTUA 5CSZB 1MJJA 3PHOB 3PWPA 4QEGA 1M05A 2F53E 3TJEH 3RZCD 3DX9A 3GMOB 1RZIB 4NSKB 2M8XA 4F57H 1GC1H 3AXLB 4JFEB 3TNMB 4F7PB 4GRWB 4FQIL 4WHCA 1TTFA 4F37F 3MJ7B 1X5IA 4XB7A 4BZ1L 3CFIC 2NPLX 5J11B 2V7NA 3MNVB 4U1KB 2CLVA 2IQ9L 4OZFB 2NY1D 3BRFA 4NQDB 4P46C 2X4TA 3MRFB 4IRSB 3TWCH 1S78C 4PJDF 3O3BA 3IDJA 5J12B 2OI9B 3Q5OA 3D25A 2IPKB 2X4NA 4K9EL 4TN9A 1Q94B 1O0VA 4EEEA 3RWHA 5KN5B 4P2QB 5EULV 1AP2B 5SWSB 3T0AA 5GS0H 2DRUA 1KJ2B 4L1HA 1NAMA 2VAAB 4KMLB 5FKPA 5FM5M 4LLYA 5I1JH 3X3GH 3KNBA 4YWGH 3LKNB 4GRLD 4OCXL 2WNGA 3U36B 1PSKL 5CEZL 3SE4A 2UVFA 5EZLB 1CXKA 3UTOA 4N0UE 1G6RH 2GY5A 7CGTA 3RWJA 1FFOB 5HYQB 4ZTOH 4HDIA 1G9MH 1XIWC 4JRYB 5IW1B 4TPRH 1L9NA 1UVQB 4WHYH 5IHZB 5KW9L 5HHME 4WW1B 4I48B 4BFBD 4MNGA 3T2PA 5IB4A 2CQVA 3BZFA 1ZS8B 3ARDC 3H9SB 3WIIH 1QSZA 4FTVD 3GSUB 4Z0BL 4MNQE 1MAKA 4HW6A 4K3HA 3AUVA 4PIRF 2V17H 3AFLA 2YSSA 4YIQA 3FOLB 1OWRM 1BVLB 4POZC 1UH4A 3U0TB 1FZKB 1CGSH 3S98A 5TFSL 3ZKXB 1Y6NR 1HHIB 1NGZB 5GZOC 3ARSA 3BMWA 2DLFL 3ARBC 3WJLC 1MCJA 1YN7A 2AV7B 3L7EB 4KDTC 4KKLC 4O00A 1FVEB 5D6DC 5LJYH 1OTSD 1XGQB 1TPXB 4ZO8A 1UVQA 3C6SB 3P30H 3EFDL 2C1PB 2CLRA 1OGTA 4LSUL 5DVLA 1MJ8L 1HNGA 2Q6WA 4U2YA 3JWDL 5DGRA 2OBGA 3GSWB 1CR9H 4XGZA 3EHBD 1TNNA 1EXUA 2GQHA 3KAAA 5HY9B 3MRKB 3KNBB 2XZCH 2IALB 3EOYG 2YPLD 2DLIA 3ARBD 2NR6D 5HYJE 3K8LA 1SEQL 4I9WE 4ODVL 1VESA 1R5VA 4LCCB 4PGDA 2X4NB 3UBXB 2P8MB 4HUKB 3WFDH 5GGSB 4G8FA 3FN0L 3A6OA 1UKSA 2P5EE 1BPVA 4Q9RL 4GW5B 3QDHA 1HHGA 3N85H 4ONHA 5E8EB 3IJYB 3GMQB 1I85C 5E2TH 2X4SA 1NFIA 3FQUA 1SQ2N 4ZSOE 4J2XA 3PGCB 4HEME 4CU6A 4L5FH 1S5HA 1T20A 3LSOA 3TT1H 4GW4B 1G7MB 2H3NB 3MGOA 3MLSH 4ODWB 3MLVL 4OLVH 2X4UA 2BSED 2VUOA 5JHLL 5E08H 4UOW0 3D69A 5ENWB 4H0HB 3MV9A 5KS9E 1OD7A 1CU4L 1VFOA 4ZDHB 2YRZA 3V9FA 1DBBL 1WSST 4LEOB 5B3NA 2FEDD 3EOBA 4LLDA 4W6YB 1GZPA 1F02I 1P7QA 3VW3L 4X4XB 3H42L 4YR6A 1FL3A 3B2UC 2VOTA 4EN3A 4ZUVB 1SJHA 5E7FA 3NOIA 2WK2A 1XF2A 1KENL 4HJJL 4I1NB 1ZHLA 3Q2CA 3MRQB 4KKCC 3ZDXF 1ORQB 2AK4D 3BP6A 1OB1B 3BGFC 4N9OB 4U1IA 1RZKC 5EPMB 3SDDA 5I30H 1RJLB 1IT9H 5I8CA 5DVOA 3FT4B 4ZAKD 4ALAH 3NA9L 5D7LA 3TYFB 3M1BA 3QEHB 5IJVB 2CRIA 1JK8B 4E5XA 5C8JB 1MLBA 2GCYB 3KYOB 3RUGA 4Q2ZB 1JPSL 2FSEA 3NIFF 1FL5A 2ZJSH 3E2HB 1CF8L 2V9QA 1DQMH 3KJ4C 1IM9A 1G9NL 3ZE1E 3VG0H 2YPLE 4W4NA 5DSCA 1AIFB 5D7IA 3KHOA 4OF7A 2QHRL 5FV2A 4P48A 5FHAH 5E99L 1G7JA 4JFDB 1IEBA 3DV4B 2ZCLH 2ZCLL 1OTUC 3JV4B 3G6JA 4PGJA 4XVUD 3LKPA 5JPMA 5F7EL 3DLQR 5BO1H 4ZTPL 2NY5H 2JELH 5DT1H 1IZJA 4KJWD 3RA7L 3U0PB 3S35X 1OW0C 2NY5C 3A67H 2XWTA 1U3HC 4PJFB 1TVHB 3G08A 2Z31A 4I2XB 3TCLA 5C0JA 3QCVH 3CSGA 3BPOC 2QQQA 1EK3A 1TJGL 4NN5B 2PR4L 1DN0A 3GIVB 4YFEA 2Q87A 5GRWA 5DWUH 3QFJB 4K2UH 1FDLH 2FX9L 1KV3A 1MIEH 4OQTA 4J1UB 5I71C 1OCWH 3BQUA 4Z7WF 4OQTH 2C4XA 2PO6B 3HC0A 2DN7A 2IAMB 4JG1H 4JY4A 5E5UB 1OAYH 3FCTA 3HG1B 3VFVA 3A67L 2P5EA 1KNOA 2W0PA 1S7WB 4Y8DC 2KZ1B 3SGEH 5IBUG 3SKMA 2UZXB 3FFCD 2JELL 3ARWA 4KC3B 5DT1L 2J2ZA 3H9HB 5GGVL 5GISH 3OZ9L 4WI4A 1J1PH 5FK9A 1LQSR 5F7EH 3IF1A 5GSRA 2Y06L 2XTLA 4U3CA 1YPZF 4TQEH 4QXGL 2WIIA 1KSRA 5CLTA 5DK2A 3WNMA 1H9VA 2VISB 2E5EA 4P5TA 3VCLB 3WFBH 1IAMA 1A9BB 1T4KA 2DQTL 4KI5E 2GT9A 2VDRL 1S7XA 3DVGB 1KOAA 1ZANL 1KJ3L 4XVTL 1CFQB 1R24A 3UYOD 2UYLA 4Y2OA 1S7QB 5HBBA 3UO1H 3PP3H 4XMPL 3WL9A 3PWLB 1GGIL 1VDGA 4N68A 1I8IB 3B2VH 3AS2A 1IAIH 4U05A 1W72A 3VXTB 2V7HB 4LHUB 5IESL 1NCCH 4EBQL 1PW3A 4UV4L 3BKML 4ALAL 3PV7A 2SEBA 5E1AB 4LLQA 4LU5L 1Z2KA 2XZCL 2F19H 3G04A 4FG6D 5FB8A 2NY0C 3MOQA 3T65A 4OFIA 2YK1L 1F4WH 4XI5D 1K5NA 4BZ2L 1D3CA 3KPOB 3E6FB 1P9MA 5EC1A 2PXYA 2E7LA 2AS5M 3MUJA 4TOYL 2GJ6B 4YPJA 4P3DB 4U1JB 1NCWH 5T3ZD 4RX4D 1DLHA 3ARFC 3CFJB 2BNUA 4FFVC 1JNLL 4X5XA 3SDDB 3KPRB 1JMZA 5IFJA 4JO4H 1EAPA 3HRZB 1XGTA 3GSOB 4N8VB 2A6JA 1OAXL 3O6FB 3VFTB 4X83A 5CIPH 1SJHB 4F9PC 3LN9A 4XNXH 2CPCA 2NXZB 1I3GL 2RR3A 1A3RH 2H2SD 4LIQL 3HAEH 2R2BA 4OFYA 4MAYD 4XPAL 1FLRH 2IBZY 3IXTB 3MRLA 4NN7B 4PJGA 4Y1AD 3ALWA 4P2QD 4LASH 5E2TL 1NSNL 3D69B 3GHBL 4LCWA 2AJZB 2HVKA 3RDTC 4AENB 4IOIA 1ZLVH 1I3RB 4Y5VC 1UZ8B 3RVUD 5FUZL 1AHWC 5L2KD 2C5DC 1KN4H 4UIKH 5BZWB 3ALPA 1G7MA 2IAMD 4LPVA 3V0WH 4ODVH 1K6QH 1WFOA 1JHKH 1FO0B 1QFWL 3D9AH 1OT1A 5IK3B 1I8IA 3UDWC 3C08H 5C0FA 3S36L 4IOFD 3FQUB 1DVFB 1YEEH 1KPRB 1UEYA 1RUQH 2Y4SA 2VH5H 1N59B 2Q3AA 3TBVB 1CFQA 4L8BA 5SWZE 3VXSD 1A0QL 4LSSL 1AGBB 4QT5A 5GPRA 1BGXL 4KK9C 3TIEB 3HUJE 4PD4J 4KRPD 5ANMB 4YC2B 4FFYH 4JFFE 5AYUL 4PG2A 1WVZA 4IHOA 5DEGA 3RGVC 4YAQB 2BOBA 4GRWH 4OI9A 5JQHC 4S1SL 1WAAA 4QGYA 3SDDC 5EG6C 3MV9D 4L8SB 3KYAA 1BZQK 4ZUUB 1I3RA 3IDGA 4HWZB 4HZLB 4CUCA 5H8DA 5HYJD 5F6IB 4Z7WE 3LZFH 3CU7A 4NWUH 2XFXA 4JFYA 5C9JA 2HT2D 4WV1B 4YHOH 3HI6H 3X14A 4MDIA 1U36A 1AGCA 3GBLA 4NRYB 4DEPC 1H3XA 3HZKB 4JO2H 4U6XA 3CDYA 4O51A 2ADFL 3BN9C 4H5SA 4MCYB 1IILE 3HG1A 3RKDC 2L0DA 4YXHH 2N7BA 5ACMA 4P57A 4QHMB 3ZHKA 3GRWA 5HDLA 4LPYA 4NYLB 3MLRH 1H8NA 1IRAY 2WBKA 4M7KL 4UT6L 3PWLA 1QEWB 3GMRA 5DFTA 1BVLA 4OLZL 1OARL 5LG1A 5IEKB 1FRGH 5FGSA 5IQ9A 3NABL 4MJ5B 4LRNL 1ADQA 1U3HD 3DV6A 3IT8D 1TVHA 5CJ8A 3PWPE 4OZIE 2R8SH 1B9ZA 2DBLL 5CEZH 1FNGB 4PJHE 1FYHB 4XPFH 2D9CA 3VGBA 3CK0L 2FH8A 4L3ED 3X3FL 3MLXH 4NQCD 4HPOL 4EDWH 1BEYL 3PDOB 5HDBE 1J0JA 1W0VB 4C56B 2X1PA 4MWFA 5JZ7C 4TUOA 5IW6B 3KPRD 4CJ0A 1TENA 2CLZA 4JFPA 3S6CA 4HFWB 3WXWL 4UTBL 3NACL 1BD2D 5IB1A 5ICZA 1NANI 5TQ0H 1RVFH 4M43H 2A9ML 2EYRA 3OV6A 2ICWI 1A6AB 1CD1A 3QUMA 4PP2A 4LSVH 4FHBD 1D5XB 1QNZL 3MXVL 1NDMB 1RZ7L 3X12B 3V8OA 3VGAC 4JDZA 5H2BB 3QEUA 4ZO7A 5FHBL 4CVXA 3SO3B 4NJ9H 3AU1A 3L3KB 4GOSA 4D9RE 5DK2B 4HULB 1Z9LA 4XPGH 1UEMA 4NQDA 3VFMA 4Q2ZA 2NY7L 4KRMB 3DARA 1KXQE 3MNVA 4NHUB 4NN5C 4U1KA 1T3FB 1MAJA 4MAYA 4Z7UB 3FO0L 2OR9L 5CUSH 2FH6A 4GRMA 1QA9B 2CKNA 4HPYL 1LEGA 2VLME 1YEKL 3SJVD 2EH8L 1BFTA 2BSTB 3ULUC 1KCSL 3ROLB 1HH6A 4XP4L 1A4KA 1NCUA 1O5DT 1VB9A 4M1DH 3VFVB 4M61B 5D2LB 2JJUA 4MJ2A 4Z76A 5JXAL 3CVIH 1HINH 2IAMA 2NY7H 1FVDB 2ZUXA 2DD8L 4X4XA 2XQBH 1WIPA 5CIPA 2PYFB 2X89D 4WTXA 3OKOA 3BD4A 4U1SB 1X5ZA 1T89C 4N9GB 1UXWA 1G7JB 3BP4B 3OAUL 1YA5A 3RWCA 3SDCB 4HUVA 3OX8B 3AROA 4ZYKB 2WP3T 5TE4H 2WUCL 4ZFOA 1KB5B 4M00A 2JJSC 3GB7B 4I18A 5D70H 3I75B 3QQ3B 4KUCF 2D03L 3TCXA 4FRWA 4K3GA 1WK0A 3NACH 2A77H 1FL5B 3GSNA 4HIXL 3L3GB 1OW0A 4JHBA 2B20A 2R2EA 3OJ2C 4G3YH 5GJTL 1FORL 1PBYA 2YBRB 1BZ7B 5DQ9B 1K4DA 4EDWL 2JCCE 2O5ZL 3K3QA 3H3PL 4HUWB 4XBPA 4M6NH 2IANA 4U1IB 2J3SA 2H9GA 3DUSA 1D5ZB 5L88L 1M7IB 5JOPE 2DJSA 1MWAL 1S8DB 1T2XA 3MV8E 5D2NA 1YMMA 3BE1H 4AM0A 3HC4H 5FXCH 2RAMA 1F3JB 4EKXA 4F33A 3PJSB 5F8QC 5TE6L 3CLEH 3NGBB 3JV0A 3L9RA 1YNTA 3NCYP 1MJUH 3GSWA 2YUXA 1E27B 4L8DB 3L1OH