1P8CA

Crystal structure of tm1620 (apc4843) from thermotoga maritima
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
111
structure length
111
Chain Sequence
RRELNEKVLSRGTLNTKRFFNLDSAVYRPGKLDVKTKELMGLVASTVLRCDDCIRYHLVRCVQEGASDEEIFEALDIALVVGGSIVIPHLRRAVGFLEELREMEKNGETIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal Structure Analysis of Thermotoga maritima protein TM1620 (APC4843)
rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 39
structure length 111
sequence length 111
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02627 CMD Carboxymuconolactone decarboxylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1290.10 Mainly Alpha Up-down Bundle AhpD-like AhpD-like 1p8cA00
3LVYA 3D7IA 2GMYA 1P8CA 2OYOA 3BEYA 2QEUA 3C1LA 1ME5A 2IJCA 1KNCA 2Q0TA 2PRRA 1GU9A 4G9QA 2AF7A 2O4DA 2CWQA 5DIPA 2OUWA 1VKEA 1LW1A 5DIKA 2PFXA
chains in the Genus database with same CATH superfamily
3LVYA 1IZNA 3D7IA 2GMYA 1P8CA 2OYOA 4AKRA 3AAAA 3BEYA 5ADXK 2QEUA 3C1LA 1ME5A 2IJCA 2KXPA 1KNCA 2Q0TA 2KZ7A 2PRRA 1GU9A 4G9QA 3AA1A 2AF7A 5AFUK 2O4DA 3AA6A 3LK2A 2CWQA 3AAEA 2ES9A 5DIPA 2OUWA 1VKEA 2JN8A 1LW1A 3AA0A 3LK3A 3AA7A 5DIKA 2PFXA 3LK41
chains in the Genus database with same CATH topology
3LVYA 1IZNA 3D7IA 2GMYA 1P8CA 2OYOA 4AKRA 3AAAA 3BEYA 5ADXK 2QEUA 3C1LA 1ME5A 2IJCA 2KXPA 1KNCA 2Q0TA 2KZ7A 2PRRA 1GU9A 4G9QA 3AA1A 2AF7A 5AFUK 2O4DA 3AA6A 3LK2A 2CWQA 3AAEA 2ES9A 5DIPA 2OUWA 1VKEA 2JN8A 1LW1A 3AA0A 3LK3A 3AA7A 5DIKA 2PFXA 3LK41
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LVY A;  3D7I A;  2GMY A;  1P8C A;  2OYO A;  3BEY A;  2QEU A;  3C1L A;  1ME5 A;  2IJC A;  1KNC A;  2Q0T A;  2PRR A;  1GU9 A;  4G9Q A;  2AF7 A;  2O4D A;  2CWQ A;  5DIP A;  2OUW A;  1VKE A;  1LW1 A;  5DIK A;  2PFX A; 
#chains in the Genus database with same CATH topology
 3LVY A;  1IZN A;  3D7I A;  2GMY A;  1P8C A;  2OYO A;  4AKR A;  3AAA A;  3BEY A;  5ADX K;  2QEU A;  3C1L A;  1ME5 A;  2IJC A;  2KXP A;  1KNC A;  2Q0T A;  2KZ7 A;  2PRR A;  1GU9 A;  4G9Q A;  3AA1 A;  2AF7 A;  5AFU K;  2O4D A;  3AA6 A;  3LK2 A;  2CWQ A;  3AAE A;  2ES9 A;  5DIP A;  2OUW A;  1VKE A;  2JN8 A;  1LW1 A;  3AA0 A;  3LK3 A;  3AA7 A;  5DIK A;  2PFX A;  3LK4 1; 
#chains in the Genus database with same CATH homology
 3LVY A;  1IZN A;  3D7I A;  2GMY A;  1P8C A;  2OYO A;  4AKR A;  3AAA A;  3BEY A;  5ADX K;  2QEU A;  3C1L A;  1ME5 A;  2IJC A;  2KXP A;  1KNC A;  2Q0T A;  2KZ7 A;  2PRR A;  1GU9 A;  4G9Q A;  3AA1 A;  2AF7 A;  5AFU K;  2O4D A;  3AA6 A;  3LK2 A;  2CWQ A;  3AAE A;  2ES9 A;  5DIP A;  2OUW A;  1VKE A;  2JN8 A;  1LW1 A;  3AA0 A;  3LK3 A;  3AA7 A;  5DIK A;  2PFX A;  3LK4 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...