1P8MA

Structural and functional importance of first-shell metal ligands in the binuclear manganese cluster of arginase i.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
314
structure length
314
Chain Sequence
b'KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTEINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase 1
publication title Structural and functional importance of first-shell metal ligands in the binuclear manganese cluster of arginase I.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 114
structure length 314
sequence length 314
chains with identical sequence B, C
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2003-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1p8mA00
2ZAVA 4RLAA 1HQHA 3E6KA 4CEVA 3NIPA 3NIQA 1WVBA 5CEVA 4GSVA 4GWDA 4FCIA 1T4RA 4IU4A 1P8PA 1HQGA 3E8ZA 4IU0A 4Q41A 1T4TA 3GMZA 1WVAA 4RHIA 1RLAA 4Q3TA 4MYKA 2PHOA 1WOHA 4IE2A 2EIVA 3M1RA 4G3HA 4MXRA 3SKKA 2AEBA 1TBHA 1T4SA 3MJLA 4RHQA 4Q3UA 1WOGA 4IXUA 4I06A 4DZ4A 1P8SA 4IU5A 3PZLA 1R1OA 4IXVA 4Q3RC 1HQXA 1P8MA 1TBLA 4Q40A 1WOIA 4GWCA 1T5GA 4RHKA 2A0MA 3F80A 3E9BA 4IU1A 1T4PA 3LP4A 3RLAA 3KV2A 1TBJA 3NIOA 3SJTA 4RHLA 3CEVA 1D3VA 4ITYA 4GSMA 3SL0A 1P8QA 1P8OA 3MFVA 1HQFA 4Q3SA 5HJAA 2RLAA 4MYNA 3SL1A 4HZEA 2EF5A 1TA1A 5RLAA 4Q3QA 3MFWA 2PLLA 4RHJA 4Q3VA 4IE3A 3THHA 4GSZA 1T5FA 4MYLA 5HJ9A 1HQ5A 4Q3PA 4IE1A 1GQ7A 1GQ6A 1XFKA 3MMRA 2CEVA 1ZPGA 4Q42A 3TH7A 3DJ8A 4HWWA 3E6VA 1CEVA 2EF4A 2PHAA 3E8QA 3THJA 3THEA 3LP7A 1ZPEA 1P8RA 3GN0A 4Q3RA 1PQ3A 3LHLA 4RHMA 4HXQA 4FCKA 3TF3A 4MYFA 1P8NA
chains in the Genus database with same CATH superfamily
4RN0A 5G17A 1T69A 4RN2A 3RQDA 5D1DA 4BZ9A 5EFHA 5D1BA 2ZAVA 4RLAA 1HQHA 4CQFA 5LI3A 5G11A 5G1CA 3EZTA 3E6KA 4LXZA 4QA3A 4CEVA 4QA1A 4ZUOA 3NIPA 4ZUPA 5IX0A 3NIQA 3SFFA 5EEIA 1WVBA 5THTA 4GSVA 3C0ZA 4GWDA 4FCIA 5CEVA 5JI5A 1C3SA 4LY1A 5DC6A 5EENA 1T4RA 1C3RA 5EFJD 4IU4A 1P8PA 3EWFA 3EZPA 4CBYA 1HQGA 3E8ZA 3F06A 4IU0A 4Q41A 1T4TA 3GMZA 1WVAA 1T67A 4QA7A 4ZUMA 5G0JA 4RHIA 4BZ6A 3MZ6A 5IWGA 1RLAA 5FUEA 4Q3TA 4MYKA 2PHOA 1WOHA 3Q9EA 4IE2A 4QA0A 2EIVA 3M1RA 5EEKA 4G3HA 4QA2A 1C3PA 4ZUQA 4MXRA 3SKKA 2VQWG 2AEBA 1TBHA 5EFNA 1T4SA 3MJLA 4RHQA 2V5XA 3MENA 4Q3UA 1WOGA 4IXUA 5BWZA 4I06A 4DZ4A 1P8SA 4IU5A 3PZLA 3C10A 3C0YA 1R1OA 4IXVA 5G0GA 5EF8A 4Q3RC 1HQXA 1W22A 5G13A 1P8MA 1TBLA 2VQOA 3MZ4A 4Q40A 5EEMA 1WOIA 4GWCA 1T5GA 4RHKA 2A0MA 3F07A 3E9BA 3F80A 4IU1A 3F0RA 2VQJA 5DC5A 4BZ8A 3Q9FA 3MZ7A 1T4PA 5D1CA 2VCGA 3LP4A 3RLAA 3KV2A 1TBJA 3NIOA 3MAXA 3SJTA 4RHLA 4ZURA 5G12A 3CEVA 1D3VA 2GH6A 4ITYA 4GSMA 5THVA 3SL0A 1P8QA 4QA5A 1P8OA 3MFVA 1T64A 1HQFA 5EF7A 3ZNRA 5ICNB 4Q3SA 5HJAA 3Q9BA 2RLAA 4MYNA 5DC7A 3SL1A 4QA6A 5G0XA 3EW8A 4HZEA 2EF5A 1TA1A 5RLAA 1ZZ3A 5G0HA 4Q3QA 5THUA 3MFWA 2PLLA 4RHJA 4BZ7A 4Q3VA 2VQVA 4IE3A 3THHA 4GSZA 5G0YA 5G10A 1T5FA 1ZZ0A 4MYLA 5HJ9A 1HQ5A 4Q3PA 1ZZ1A 5G3WA 2VQMA 4IE1A 5EFBD 1GQ7A 1GQ6A 1XFKA 3MMRA 4ZUNA 4BZ5A 2CEVA 1ZPGA 4Q42A 3TH7A 5A2SA 5G1AA 3Q9CA 3ZNSA 3DJ8A 4BKXB 2VQQA 4HWWA 1VKGA 1CEVA 3E6VA 5DC8A 2EF4A 5EFGA 2PHAA 3E8QA 5G0IA 3THJA 3THEA 3LP7A 5G1BA 1ZPEA 4CBTA 1P8RA 3GN0A 4Q3RA 4A69A 1PQ3A 3LHLA 4RHMA 5FCWA 4RN1A 5THSA 4HXQA 5EEFA 4FCKA 4QA4A 2V5WA 3TF3A 5EFKB 4MYFA 1P8NA 3SFHA 3MZ3A
chains in the Genus database with same CATH topology
2ZAVA 4RLAA 1HQHA 3E6KA 4CEVA 3NIPA 3NIQA 1WVBA 5CEVA 4GSVA 4GWDA 4FCIA 1T4RA 4IU4A 1P8PA 1HQGA 3E8ZA 4IU0A 4Q41A 1T4TA 3GMZA 1WVAA 4RHIA 1RLAA 4Q3TA 4MYKA 2PHOA 1WOHA 4IE2A 2EIVA 3M1RA 4G3HA 4MXRA 3SKKA 2AEBA 1TBHA 1T4SA 3MJLA 4RHQA 4Q3UA 1WOGA 4IXUA 4I06A 4DZ4A 1P8SA 4IU5A 3PZLA 1R1OA 4IXVA 4Q3RC 1HQXA 1P8MA 1TBLA 4Q40A 1WOIA 4GWCA 1T5GA 4RHKA 2A0MA 3F80A 3E9BA 4IU1A 1T4PA 3LP4A 3RLAA 3KV2A 1TBJA 3NIOA 3SJTA 4RHLA 3CEVA 1D3VA 4ITYA 4GSMA 3SL0A 1P8QA 1P8OA 3MFVA 1HQFA 4Q3SA 5HJAA 2RLAA 4MYNA 3SL1A 4HZEA 2EF5A 1TA1A 5RLAA 4Q3QA 3MFWA 2PLLA 4RHJA 4Q3VA 4IE3A 3THHA 4GSZA 1T5FA 4MYLA 5HJ9A 1HQ5A 4Q3PA 4IE1A 1GQ7A 1GQ6A 1XFKA 3MMRA 2CEVA 1ZPGA 4Q42A 3TH7A 3DJ8A 4HWWA 3E6VA 1CEVA 2EF4A 2PHAA 3E8QA 3THJA 3THEA 3LP7A 1ZPEA 1P8RA 3GN0A 4Q3RA 1PQ3A 3LHLA 4RHMA 4HXQA 4FCKA 3TF3A 4MYFA 1P8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZAV A;  4RLA A;  1HQH A;  3E6K A;  4CEV A;  3NIP A;  3NIQ A;  1WVB A;  5CEV A;  4GSV A;  4GWD A;  4FCI A;  1T4R A;  4IU4 A;  1P8P A;  1HQG A;  3E8Z A;  4IU0 A;  4Q41 A;  1T4T A;  3GMZ A;  1WVA A;  4RHI A;  1RLA A;  4Q3T A;  4MYK A;  2PHO A;  1WOH A;  4IE2 A;  2EIV A;  3M1R A;  4G3H A;  4MXR A;  3SKK A;  2AEB A;  1TBH A;  1T4S A;  3MJL A;  4RHQ A;  4Q3U A;  1WOG A;  4IXU A;  4I06 A;  4DZ4 A;  1P8S A;  4IU5 A;  3PZL A;  1R1O A;  4IXV A;  4Q3R C;  1HQX A;  1P8M A;  1TBL A;  4Q40 A;  1WOI A;  4GWC A;  1T5G A;  4RHK A;  2A0M A;  3F80 A;  3E9B A;  4IU1 A;  1T4P A;  3LP4 A;  3RLA A;  3KV2 A;  1TBJ A;  3NIO A;  3SJT A;  4RHL A;  3CEV A;  1D3V A;  4ITY A;  4GSM A;  3SL0 A;  1P8Q A;  1P8O A;  3MFV A;  1HQF A;  4Q3S A;  5HJA A;  2RLA A;  4MYN A;  3SL1 A;  4HZE A;  2EF5 A;  1TA1 A;  5RLA A;  4Q3Q A;  3MFW A;  2PLL A;  4RHJ A;  4Q3V A;  4IE3 A;  3THH A;  4GSZ A;  1T5F A;  4MYL A;  5HJ9 A;  1HQ5 A;  4Q3P A;  4IE1 A;  1GQ7 A;  1GQ6 A;  1XFK A;  3MMR A;  2CEV A;  1ZPG A;  4Q42 A;  3TH7 A;  3DJ8 A;  4HWW A;  3E6V A;  1CEV A;  2EF4 A;  2PHA A;  3E8Q A;  3THJ A;  3THE A;  3LP7 A;  1ZPE A;  1P8R A;  3GN0 A;  4Q3R A;  1PQ3 A;  3LHL A;  4RHM A;  4HXQ A;  4FCK A;  3TF3 A;  4MYF A;  1P8N A; 
#chains in the Genus database with same CATH topology
 4RN0 A;  5G17 A;  1T69 A;  4RN2 A;  3RQD A;  5D1D A;  4BZ9 A;  5EFH A;  5D1B A;  2ZAV A;  4RLA A;  1HQH A;  4CQF A;  5LI3 A;  5G11 A;  5G1C A;  3EZT A;  3E6K A;  4LXZ A;  4QA3 A;  4CEV A;  4QA1 A;  4ZUO A;  3NIP A;  4ZUP A;  5IX0 A;  3NIQ A;  3SFF A;  5EEI A;  1WVB A;  5THT A;  4GSV A;  3C0Z A;  4GWD A;  4FCI A;  5CEV A;  5JI5 A;  1C3S A;  4LY1 A;  5DC6 A;  5EEN A;  1T4R A;  1C3R A;  5EFJ D;  4IU4 A;  1P8P A;  3EWF A;  3EZP A;  4CBY A;  1HQG A;  3E8Z A;  3F06 A;  4IU0 A;  4Q41 A;  1T4T A;  3GMZ A;  1WVA A;  1T67 A;  4QA7 A;  4ZUM A;  5G0J A;  4RHI A;  4BZ6 A;  3MZ6 A;  5IWG A;  1RLA A;  5FUE A;  4Q3T A;  4MYK A;  2PHO A;  1WOH A;  3Q9E A;  4IE2 A;  4QA0 A;  2EIV A;  3M1R A;  5EEK A;  4G3H A;  4QA2 A;  1C3P A;  4ZUQ A;  4MXR A;  3SKK A;  2VQW G;  2AEB A;  1TBH A;  5EFN A;  1T4S A;  3MJL A;  4RHQ A;  2V5X A;  3MEN A;  4Q3U A;  1WOG A;  4IXU A;  5BWZ A;  4I06 A;  4DZ4 A;  1P8S A;  4IU5 A;  3PZL A;  3C10 A;  3C0Y A;  1R1O A;  4IXV A;  5G0G A;  5EF8 A;  4Q3R C;  1HQX A;  1W22 A;  5G13 A;  1P8M A;  1TBL A;  2VQO A;  3MZ4 A;  4Q40 A;  5EEM A;  1WOI A;  4GWC A;  1T5G A;  4RHK A;  2A0M A;  3F07 A;  3E9B A;  3F80 A;  4IU1 A;  3F0R A;  2VQJ A;  5DC5 A;  4BZ8 A;  3Q9F A;  3MZ7 A;  1T4P A;  5D1C A;  2VCG A;  3LP4 A;  3RLA A;  3KV2 A;  1TBJ A;  3NIO A;  3MAX A;  3SJT A;  4RHL A;  4ZUR A;  5G12 A;  3CEV A;  1D3V A;  2GH6 A;  4ITY A;  4GSM A;  5THV A;  3SL0 A;  1P8Q A;  4QA5 A;  1P8O A;  3MFV A;  1T64 A;  1HQF A;  5EF7 A;  3ZNR A;  5ICN B;  4Q3S A;  5HJA A;  3Q9B A;  2RLA A;  4MYN A;  5DC7 A;  3SL1 A;  4QA6 A;  5G0X A;  3EW8 A;  4HZE A;  2EF5 A;  1TA1 A;  5RLA A;  1ZZ3 A;  5G0H A;  4Q3Q A;  5THU A;  3MFW A;  2PLL A;  4RHJ A;  4BZ7 A;  4Q3V A;  2VQV A;  4IE3 A;  3THH A;  4GSZ A;  5G0Y A;  5G10 A;  1T5F A;  1ZZ0 A;  4MYL A;  5HJ9 A;  1HQ5 A;  4Q3P A;  1ZZ1 A;  5G3W A;  2VQM A;  4IE1 A;  5EFB D;  1GQ7 A;  1GQ6 A;  1XFK A;  3MMR A;  4ZUN A;  4BZ5 A;  2CEV A;  1ZPG A;  4Q42 A;  3TH7 A;  5A2S A;  5G1A A;  3Q9C A;  3ZNS A;  3DJ8 A;  4BKX B;  2VQQ A;  4HWW A;  1VKG A;  1CEV A;  3E6V A;  5DC8 A;  2EF4 A;  5EFG A;  2PHA A;  3E8Q A;  5G0I A;  3THJ A;  3THE A;  3LP7 A;  5G1B A;  1ZPE A;  4CBT A;  1P8R A;  3GN0 A;  4Q3R A;  4A69 A;  1PQ3 A;  3LHL A;  4RHM A;  5FCW A;  4RN1 A;  5THS A;  4HXQ A;  5EEF A;  4FCK A;  4QA4 A;  2V5W A;  3TF3 A;  5EFK B;  4MYF A;  1P8N A;  3SFH A;  3MZ3 A; 
#chains in the Genus database with same CATH homology
 2ZAV A;  4RLA A;  1HQH A;  3E6K A;  4CEV A;  3NIP A;  3NIQ A;  1WVB A;  5CEV A;  4GSV A;  4GWD A;  4FCI A;  1T4R A;  4IU4 A;  1P8P A;  1HQG A;  3E8Z A;  4IU0 A;  4Q41 A;  1T4T A;  3GMZ A;  1WVA A;  4RHI A;  1RLA A;  4Q3T A;  4MYK A;  2PHO A;  1WOH A;  4IE2 A;  2EIV A;  3M1R A;  4G3H A;  4MXR A;  3SKK A;  2AEB A;  1TBH A;  1T4S A;  3MJL A;  4RHQ A;  4Q3U A;  1WOG A;  4IXU A;  4I06 A;  4DZ4 A;  1P8S A;  4IU5 A;  3PZL A;  1R1O A;  4IXV A;  4Q3R C;  1HQX A;  1P8M A;  1TBL A;  4Q40 A;  1WOI A;  4GWC A;  1T5G A;  4RHK A;  2A0M A;  3F80 A;  3E9B A;  4IU1 A;  1T4P A;  3LP4 A;  3RLA A;  3KV2 A;  1TBJ A;  3NIO A;  3SJT A;  4RHL A;  3CEV A;  1D3V A;  4ITY A;  4GSM A;  3SL0 A;  1P8Q A;  1P8O A;  3MFV A;  1HQF A;  4Q3S A;  5HJA A;  2RLA A;  4MYN A;  3SL1 A;  4HZE A;  2EF5 A;  1TA1 A;  5RLA A;  4Q3Q A;  3MFW A;  2PLL A;  4RHJ A;  4Q3V A;  4IE3 A;  3THH A;  4GSZ A;  1T5F A;  4MYL A;  5HJ9 A;  1HQ5 A;  4Q3P A;  4IE1 A;  1GQ7 A;  1GQ6 A;  1XFK A;  3MMR A;  2CEV A;  1ZPG A;  4Q42 A;  3TH7 A;  3DJ8 A;  4HWW A;  3E6V A;  1CEV A;  2EF4 A;  2PHA A;  3E8Q A;  3THJ A;  3THE A;  3LP7 A;  1ZPE A;  1P8R A;  3GN0 A;  4Q3R A;  1PQ3 A;  3LHL A;  4RHM A;  4HXQ A;  4FCK A;  3TF3 A;  4MYF A;  1P8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...