1P8MA

Structural and functional importance of first-shell metal ligands in the binuclear manganese cluster of arginase i.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
314
structure length
314
Chain Sequence
KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTEINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase 1
publication title Structural and functional importance of first-shell metal ligands in the binuclear manganese cluster of arginase I.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 114
structure length 314
sequence length 314
chains with identical sequence B, C
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2003-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1p8mA00
3THJA 1WOIA 4IXVA 4IU0A 4RHKA 2EIVA 4Q3TA 3E6KA 1ZPGA 4Q40A 4IXUA 1CEVA 4IU5A 1WVBA 4GSVA 4FCKA 5HJ9A 3SL1A 4G3HA 4MYKA 1TBHA 4FCIA 4Q3PA 5CEVA 3RLAA 4Q42A 3TH7A 3MFVA 4Q3VA 3GN0A 4ITYA 3MMRA 4Q3QA 1D3VA 3E8ZA 3TF3A 4Q3SA 4Q3RA 2EF5A 1P8PA 1T5FA 3GMZA 4Q3RC 4DZ4A 4I06A 1WOGA 4GSZA 3SJTA 1GQ6A 3MFWA 1P8RA 1WOHA 1XFKA 2AEBA 5RLAA 3PZLA 1HQGA 4IE3A 1P8MA 3NIOA 1T4PA 4RHQA 4Q3UA 4RHLA 3MJLA 3THEA 3THHA 4IU1A 2ZAVA 3KV2A 1P8QA 1HQHA 4GWCA 4GSMA 1HQ5A 3NIQA 1T5GA 3SKKA 1GQ7A 3LHLA 4GWDA 1T4TA 1TBJA 4MXRA 3NIPA 4MYLA 1R1OA 2PHOA 1TBLA 2RLAA 4IE1A 3CEVA 4IU4A 4MYNA 4HXQA 1HQXA 1P8OA 3E6VA 1TA1A 3LP4A 2EF4A 1HQFA 4IE2A 4Q41A 4RLAA 3DJ8A 3SL0A 1RLAA 1PQ3A 4RHMA 3E9BA 2PLLA 1T4SA 5HJAA 2PHAA 4HZEA 1P8SA 4RHIA 4MYFA 4CEVA 3LP7A 1ZPEA 4HWWA 2A0MA 2CEVA 4RHJA 3F80A 3M1RA 1WVAA 1T4RA 1P8NA 3E8QA
chains in the Genus database with same CATH superfamily
3THJA 4ZUNA 1WOIA 4IXVA 3C0YA 3Q9FA 4IU0A 5G0IA 4RHKA 4CQFA 2EIVA 5EFNA 4Q3TA 3E6KA 1ZPGA 5DC6A 4Q40A 5G11A 4IXUA 1C3SA 1C3RA 2VQWG 5EEMA 1CEVA 4IU5A 1WVBA 3EWFA 4GSVA 4FCKA 5HJ9A 5G1CA 5G12A 3SL1A 4G3HA 5EENA 2V5XA 4MYKA 3Q9EA 4ZURA 5THUA 1VKGA 1TBHA 4FCIA 4Q3PA 5CEVA 1T67A 4LXZA 3RLAA 4Q42A 5LI3A 3ZNSA 3TH7A 3MFVA 3MZ6A 5G0GA 2VQOA 4CBTA 4Q3VA 3GN0A 4ITYA 3MMRA 5EF8A 5G3WA 4Q3QA 2V5WA 3ZNRA 1D3VA 3E8ZA 3TF3A 4Q3SA 5G17A 4Q3RA 2EF5A 1P8PA 1T5FA 3GMZA 4Q3RC 5IWGA 5FCWA 3SFHA 4BZ5A 1W22A 3C10A 4I06A 1WOGA 2VQQA 4GSZA 2VCGA 3SJTA 1GQ6A 3MFWA 3F07A 4RN2A 4ZUQA 1P8RA 1WOHA 1XFKA 3Q9CA 2AEBA 4QA6A 4QA1A 5DC7A 5RLAA 3PZLA 1HQGA 4IE3A 5EEIA 1P8MA 5G0HA 4BZ7A 3NIOA 1T4PA 4QA2A 4RHQA 4Q3UA 4RHLA 3MJLA 3THEA 3THHA 3F06A 4IU1A 2VQVA 1T69A 5EEFA 2GH6A 2ZAVA 4ZUPA 3KV2A 5EFHA 4BZ8A 1P8QA 1HQHA 4GWCA 3MZ4A 4GSMA 1HQ5A 3NIQA 5G1AA 5G0YA 1T5GA 3SKKA 5EEKA 5BWZA 1T64A 1GQ7A 4BKXB 3LHLA 4GWDA 1T4TA 1TBJA 3MZ3A 4MXRA 3NIPA 5G13A 4MYLA 1R1OA 5THVA 2PHOA 5THSA 2VQMA 1TBLA 2RLAA 4IE1A 5D1CA 5G0XA 3RQDA 5G10A 5ICNB 3EZTA 3CEVA 4IU4A 4LY1A 4MYNA 4HXQA 1HQXA 1P8OA 1ZZ1A 3E6VA 1TA1A 2EF4A 3EW8A 3LP4A 5EFBD 3C0ZA 1HQFA 4IE2A 4Q41A 4RLAA 3DJ8A 5EF7A 5IX0A 3SL0A 4QA7A 4QA3A 3MZ7A 4ZUMA 3MENA 4DZ4A 5D1DA 1RLAA 5G0JA 1PQ3A 4A69A 5DC5A 3SFFA 5EFKB 4RHMA 5A2SA 3E9BA 4BZ6A 2PLLA 1T4SA 3EZPA 5HJAA 2PHAA 1ZZ3A 5EFJD 2VQJA 4HZEA 1P8SA 3F0RA 3Q9BA 5FUEA 4BZ9A 3MAXA 4RHIA 5D1BA 4MYFA 4QA0A 3LP7A 4CEVA 4RN1A 1ZPEA 5JI5A 4HWWA 4QA4A 2A0MA 2CEVA 4RHJA 5THTA 4CBYA 3F80A 3M1RA 5G1BA 4RN0A 1WVAA 4ZUOA 5EFGA 1ZZ0A 4QA5A 1T4RA 1P8NA 1C3PA 3E8QA 5DC8A
chains in the Genus database with same CATH topology
3THJA 1WOIA 4IXVA 4IU0A 4RHKA 2EIVA 4Q3TA 3E6KA 1ZPGA 4Q40A 4IXUA 1CEVA 4IU5A 1WVBA 4GSVA 4FCKA 5HJ9A 3SL1A 4G3HA 4MYKA 1TBHA 4FCIA 4Q3PA 5CEVA 3RLAA 4Q42A 3TH7A 3MFVA 4Q3VA 3GN0A 4ITYA 3MMRA 4Q3QA 1D3VA 3E8ZA 3TF3A 4Q3SA 4Q3RA 2EF5A 1P8PA 1T5FA 3GMZA 4Q3RC 4DZ4A 4I06A 1WOGA 4GSZA 3SJTA 1GQ6A 3MFWA 1P8RA 1WOHA 1XFKA 2AEBA 5RLAA 3PZLA 1HQGA 4IE3A 1P8MA 3NIOA 1T4PA 4RHQA 4Q3UA 4RHLA 3MJLA 3THEA 3THHA 4IU1A 2ZAVA 3KV2A 1P8QA 1HQHA 4GWCA 4GSMA 1HQ5A 3NIQA 1T5GA 3SKKA 1GQ7A 3LHLA 4GWDA 1T4TA 1TBJA 4MXRA 3NIPA 4MYLA 1R1OA 2PHOA 1TBLA 2RLAA 4IE1A 3CEVA 4IU4A 4MYNA 4HXQA 1HQXA 1P8OA 3E6VA 1TA1A 3LP4A 2EF4A 1HQFA 4IE2A 4Q41A 4RLAA 3DJ8A 3SL0A 1RLAA 1PQ3A 4RHMA 3E9BA 2PLLA 1T4SA 5HJAA 2PHAA 4HZEA 1P8SA 4RHIA 4MYFA 4CEVA 3LP7A 1ZPEA 4HWWA 2A0MA 2CEVA 4RHJA 3F80A 3M1RA 1WVAA 1T4RA 1P8NA 3E8QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3THJ A;  1WOI A;  4IXV A;  4IU0 A;  4RHK A;  2EIV A;  4Q3T A;  3E6K A;  1ZPG A;  4Q40 A;  4IXU A;  1CEV A;  4IU5 A;  1WVB A;  4GSV A;  4FCK A;  5HJ9 A;  3SL1 A;  4G3H A;  4MYK A;  1TBH A;  4FCI A;  4Q3P A;  5CEV A;  3RLA A;  4Q42 A;  3TH7 A;  3MFV A;  4Q3V A;  3GN0 A;  4ITY A;  3MMR A;  4Q3Q A;  1D3V A;  3E8Z A;  3TF3 A;  4Q3S A;  4Q3R A;  2EF5 A;  1P8P A;  1T5F A;  3GMZ A;  4Q3R C;  4DZ4 A;  4I06 A;  1WOG A;  4GSZ A;  3SJT A;  1GQ6 A;  3MFW A;  1P8R A;  1WOH A;  1XFK A;  2AEB A;  5RLA A;  3PZL A;  1HQG A;  4IE3 A;  1P8M A;  3NIO A;  1T4P A;  4RHQ A;  4Q3U A;  4RHL A;  3MJL A;  3THE A;  3THH A;  4IU1 A;  2ZAV A;  3KV2 A;  1P8Q A;  1HQH A;  4GWC A;  4GSM A;  1HQ5 A;  3NIQ A;  1T5G A;  3SKK A;  1GQ7 A;  3LHL A;  4GWD A;  1T4T A;  1TBJ A;  4MXR A;  3NIP A;  4MYL A;  1R1O A;  2PHO A;  1TBL A;  2RLA A;  4IE1 A;  3CEV A;  4IU4 A;  4MYN A;  4HXQ A;  1HQX A;  1P8O A;  3E6V A;  1TA1 A;  3LP4 A;  2EF4 A;  1HQF A;  4IE2 A;  4Q41 A;  4RLA A;  3DJ8 A;  3SL0 A;  1RLA A;  1PQ3 A;  4RHM A;  3E9B A;  2PLL A;  1T4S A;  5HJA A;  2PHA A;  4HZE A;  1P8S A;  4RHI A;  4MYF A;  4CEV A;  3LP7 A;  1ZPE A;  4HWW A;  2A0M A;  2CEV A;  4RHJ A;  3F80 A;  3M1R A;  1WVA A;  1T4R A;  1P8N A;  3E8Q A; 
#chains in the Genus database with same CATH topology
 3THJ A;  4ZUN A;  1WOI A;  4IXV A;  3C0Y A;  3Q9F A;  4IU0 A;  5G0I A;  4RHK A;  4CQF A;  2EIV A;  5EFN A;  4Q3T A;  3E6K A;  1ZPG A;  5DC6 A;  4Q40 A;  5G11 A;  4IXU A;  1C3S A;  1C3R A;  2VQW G;  5EEM A;  1CEV A;  4IU5 A;  1WVB A;  3EWF A;  4GSV A;  4FCK A;  5HJ9 A;  5G1C A;  5G12 A;  3SL1 A;  4G3H A;  5EEN A;  2V5X A;  4MYK A;  3Q9E A;  4ZUR A;  5THU A;  1VKG A;  1TBH A;  4FCI A;  4Q3P A;  5CEV A;  1T67 A;  4LXZ A;  3RLA A;  4Q42 A;  5LI3 A;  3ZNS A;  3TH7 A;  3MFV A;  3MZ6 A;  5G0G A;  2VQO A;  4CBT A;  4Q3V A;  3GN0 A;  4ITY A;  3MMR A;  5EF8 A;  5G3W A;  4Q3Q A;  2V5W A;  3ZNR A;  1D3V A;  3E8Z A;  3TF3 A;  4Q3S A;  5G17 A;  4Q3R A;  2EF5 A;  1P8P A;  1T5F A;  3GMZ A;  4Q3R C;  5IWG A;  5FCW A;  3SFH A;  4BZ5 A;  1W22 A;  3C10 A;  4I06 A;  1WOG A;  2VQQ A;  4GSZ A;  2VCG A;  3SJT A;  1GQ6 A;  3MFW A;  3F07 A;  4RN2 A;  4ZUQ A;  1P8R A;  1WOH A;  1XFK A;  3Q9C A;  2AEB A;  4QA6 A;  4QA1 A;  5DC7 A;  5RLA A;  3PZL A;  1HQG A;  4IE3 A;  5EEI A;  1P8M A;  5G0H A;  4BZ7 A;  3NIO A;  1T4P A;  4QA2 A;  4RHQ A;  4Q3U A;  4RHL A;  3MJL A;  3THE A;  3THH A;  3F06 A;  4IU1 A;  2VQV A;  1T69 A;  5EEF A;  2GH6 A;  2ZAV A;  4ZUP A;  3KV2 A;  5EFH A;  4BZ8 A;  1P8Q A;  1HQH A;  4GWC A;  3MZ4 A;  4GSM A;  1HQ5 A;  3NIQ A;  5G1A A;  5G0Y A;  1T5G A;  3SKK A;  5EEK A;  5BWZ A;  1T64 A;  1GQ7 A;  4BKX B;  3LHL A;  4GWD A;  1T4T A;  1TBJ A;  3MZ3 A;  4MXR A;  3NIP A;  5G13 A;  4MYL A;  1R1O A;  5THV A;  2PHO A;  5THS A;  2VQM A;  1TBL A;  2RLA A;  4IE1 A;  5D1C A;  5G0X A;  3RQD A;  5G10 A;  5ICN B;  3EZT A;  3CEV A;  4IU4 A;  4LY1 A;  4MYN A;  4HXQ A;  1HQX A;  1P8O A;  1ZZ1 A;  3E6V A;  1TA1 A;  2EF4 A;  3EW8 A;  3LP4 A;  5EFB D;  3C0Z A;  1HQF A;  4IE2 A;  4Q41 A;  4RLA A;  3DJ8 A;  5EF7 A;  5IX0 A;  3SL0 A;  4QA7 A;  4QA3 A;  3MZ7 A;  4ZUM A;  3MEN A;  4DZ4 A;  5D1D A;  1RLA A;  5G0J A;  1PQ3 A;  4A69 A;  5DC5 A;  3SFF A;  5EFK B;  4RHM A;  5A2S A;  3E9B A;  4BZ6 A;  2PLL A;  1T4S A;  3EZP A;  5HJA A;  2PHA A;  1ZZ3 A;  5EFJ D;  2VQJ A;  4HZE A;  1P8S A;  3F0R A;  3Q9B A;  5FUE A;  4BZ9 A;  3MAX A;  4RHI A;  5D1B A;  4MYF A;  4QA0 A;  3LP7 A;  4CEV A;  4RN1 A;  1ZPE A;  5JI5 A;  4HWW A;  4QA4 A;  2A0M A;  2CEV A;  4RHJ A;  5THT A;  4CBY A;  3F80 A;  3M1R A;  5G1B A;  4RN0 A;  1WVA A;  4ZUO A;  5EFG A;  1ZZ0 A;  4QA5 A;  1T4R A;  1P8N A;  1C3P A;  3E8Q A;  5DC8 A; 
#chains in the Genus database with same CATH homology
 3THJ A;  1WOI A;  4IXV A;  4IU0 A;  4RHK A;  2EIV A;  4Q3T A;  3E6K A;  1ZPG A;  4Q40 A;  4IXU A;  1CEV A;  4IU5 A;  1WVB A;  4GSV A;  4FCK A;  5HJ9 A;  3SL1 A;  4G3H A;  4MYK A;  1TBH A;  4FCI A;  4Q3P A;  5CEV A;  3RLA A;  4Q42 A;  3TH7 A;  3MFV A;  4Q3V A;  3GN0 A;  4ITY A;  3MMR A;  4Q3Q A;  1D3V A;  3E8Z A;  3TF3 A;  4Q3S A;  4Q3R A;  2EF5 A;  1P8P A;  1T5F A;  3GMZ A;  4Q3R C;  4DZ4 A;  4I06 A;  1WOG A;  4GSZ A;  3SJT A;  1GQ6 A;  3MFW A;  1P8R A;  1WOH A;  1XFK A;  2AEB A;  5RLA A;  3PZL A;  1HQG A;  4IE3 A;  1P8M A;  3NIO A;  1T4P A;  4RHQ A;  4Q3U A;  4RHL A;  3MJL A;  3THE A;  3THH A;  4IU1 A;  2ZAV A;  3KV2 A;  1P8Q A;  1HQH A;  4GWC A;  4GSM A;  1HQ5 A;  3NIQ A;  1T5G A;  3SKK A;  1GQ7 A;  3LHL A;  4GWD A;  1T4T A;  1TBJ A;  4MXR A;  3NIP A;  4MYL A;  1R1O A;  2PHO A;  1TBL A;  2RLA A;  4IE1 A;  3CEV A;  4IU4 A;  4MYN A;  4HXQ A;  1HQX A;  1P8O A;  3E6V A;  1TA1 A;  3LP4 A;  2EF4 A;  1HQF A;  4IE2 A;  4Q41 A;  4RLA A;  3DJ8 A;  3SL0 A;  1RLA A;  1PQ3 A;  4RHM A;  3E9B A;  2PLL A;  1T4S A;  5HJA A;  2PHA A;  4HZE A;  1P8S A;  4RHI A;  4MYF A;  4CEV A;  3LP7 A;  1ZPE A;  4HWW A;  2A0M A;  2CEV A;  4RHJ A;  3F80 A;  3M1R A;  1WVA A;  1T4R A;  1P8N A;  3E8Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...