1P8NA

Structural and functional importance of first-shell metal ligands in the binuclear manganese cluster of arginase i.
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
314
structure length
314
Chain Sequence
KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFAVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase 1
publication title Structural and functional importance of first-shell metal ligands in the binuclear manganese cluster of arginase I
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 111
structure length 314
sequence length 314
chains with identical sequence B, C
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2003-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1p8nA00
4GSMA 1P8SA 4ITYA 4Q3UA 5HJ9A 3CEVA 3E9BA 3LP4A 3TH7A 4IXUA 3F80A 4RLAA 4IU0A 5RLAA 4HZEA 3KV2A 4IU4A 4Q3VA 4IU1A 2A0MA 1GQ6A 4Q3SA 2AEBA 1TA1A 3MJLA 1P8NA 2ZAVA 4MYKA 1P8QA 3GN0A 4RHMA 1HQHA 1TBHA 4GSZA 4IE3A 3LP7A 3SL0A 4MXRA 3E8ZA 4RHLA 3THJA 1T5GA 3MFWA 1HQFA 3THEA 4RHKA 4Q3RC 1P8PA 4GSVA 4MYFA 4Q41A 3RLAA 4IXVA 1P8RA 1T4PA 1TBJA 4FCIA 4CEVA 1WOHA 3PZLA 1TBLA 1GQ7A 3DJ8A 4HWWA 2RLAA 4Q3PA 1ZPGA 4RHIA 2EIVA 1R1OA 1P8OA 4I06A 3MFVA 1CEVA 2CEVA 1P8MA 1T4SA 1WVAA 4G3HA 3SL1A 3THHA 1HQGA 4GWDA 4MYLA 3SKKA 4IU5A 4RHQA 1D3VA 3E8QA 4FCKA 4MYNA 3LHLA 3TF3A 2EF4A 4HXQA 4Q42A 1HQ5A 1WVBA 4Q3QA 1WOIA 4Q40A 4Q3RA 4IE1A 1HQXA 3MMRA 4Q3TA 1T5FA 4GWCA 3M1RA 4IE2A 1T4TA 4RHJA 5CEVA 3NIQA 5HJAA 1RLAA 2EF5A 1T4RA 1ZPEA 2PHOA 3NIPA 1PQ3A 1XFKA 1WOGA 2PHAA 3E6VA 3SJTA 3E6KA 2PLLA 3GMZA 3NIOA 4DZ4A
chains in the Genus database with same CATH superfamily
5DC6A 5G11A 4GSMA 5EEFA 1P8SA 4ITYA 4Q3UA 5EFHA 1ZZ3A 3C0ZA 5HJ9A 4QA0A 3CEVA 3E9BA 5G1AA 5EFKB 4RN2A 4ZUNA 3LP4A 3SFHA 5G0GA 1ZZ0A 5A2SA 3TH7A 1C3PA 4LXZA 3RQDA 4IXUA 3F80A 4RLAA 3Q9CA 3MZ3A 4HZEA 4IU0A 3KV2A 5RLAA 5THUA 3ZNSA 3EW8A 5G13A 4BZ7A 3ZNRA 4IU4A 4Q3VA 4IU1A 4QA5A 4CBYA 2A0MA 1GQ6A 4Q3SA 4BZ5A 3Q9FA 2AEBA 1TA1A 4ZUPA 3MJLA 5G10A 4BKXB 1P8NA 2ZAVA 4MYKA 1P8QA 5EENA 3GN0A 5DC5A 4RHMA 1HQHA 1TBHA 5G1BA 5EFJD 2VQMA 4GSZA 4RN1A 4RN0A 4IE3A 4QA4A 4ZUQA 3LP7A 3SL0A 2VQVA 1C3SA 4MXRA 3E8ZA 4RHLA 3THJA 1T5GA 3MFWA 5EEIA 1HQFA 5THTA 3THEA 4RHKA 4CQFA 5DC7A 5EFGA 5G0YA 4Q3RC 5BWZA 1P8PA 4GSVA 4MYFA 5G0IA 5FUEA 4ZUMA 5THVA 3RLAA 4Q41A 4IXVA 5FCWA 1P8RA 1T4PA 2VQQA 1TBJA 4FCIA 4CEVA 5G0XA 5THSA 3F0RA 1WOHA 3PZLA 1TBLA 1GQ7A 3DJ8A 4QA7A 2VCGA 3MZ6A 5D1DA 5G0HA 3MZ7A 3F07A 4HWWA 2RLAA 3SFFA 4Q3PA 2V5WA 5D1BA 5EEKA 5IX0A 1ZPGA 3C0YA 4RHIA 5G17A 2EIVA 1R1OA 3EZPA 4ZURA 1P8OA 4I06A 5G1CA 1C3RA 4QA1A 3MFVA 5G3WA 1CEVA 2CEVA 4QA6A 3EWFA 1P8MA 1T4SA 3MAXA 3MZ4A 4BZ6A 1WVAA 4G3HA 5LI3A 4QA3A 3SL1A 3THHA 5JI5A 1HQGA 3MENA 4GWDA 4MYLA 3SKKA 4IU5A 5EFNA 4RHQA 1D3VA 1VKGA 3E8QA 3EZTA 4FCKA 4MYNA 3LHLA 4BZ8A 3Q9BA 4A69A 3TF3A 2EF4A 2V5XA 4HXQA 4Q42A 4BZ9A 5ICNB 1HQ5A 1WVBA 1ZZ1A 1WOIA 4Q3QA 4Q40A 1T67A 4Q3RA 1W22A 1HQXA 3Q9EA 3MMRA 2VQOA 4IE1A 4LY1A 2VQWG 4Q3TA 1T5FA 5DC8A 4GWCA 3M1RA 2VQJA 5D1CA 4IE2A 1T69A 1T4TA 4RHJA 1T64A 3NIQA 5CEVA 5EEMA 1RLAA 4CBTA 5HJAA 2EF5A 4ZUOA 5EF8A 3C10A 1T4RA 1ZPEA 2PHOA 3NIPA 1PQ3A 1XFKA 5G0JA 5IWGA 1WOGA 3F06A 2PHAA 5G12A 3E6VA 3SJTA 3E6KA 2GH6A 5EFBD 2PLLA 5EF7A 3GMZA 4QA2A 3NIOA 4DZ4A
chains in the Genus database with same CATH topology
4GSMA 1P8SA 4ITYA 4Q3UA 5HJ9A 3CEVA 3E9BA 3LP4A 3TH7A 4IXUA 3F80A 4RLAA 4IU0A 5RLAA 4HZEA 3KV2A 4IU4A 4Q3VA 4IU1A 2A0MA 1GQ6A 4Q3SA 2AEBA 1TA1A 3MJLA 1P8NA 2ZAVA 4MYKA 1P8QA 3GN0A 4RHMA 1HQHA 1TBHA 4GSZA 4IE3A 3LP7A 3SL0A 4MXRA 3E8ZA 4RHLA 3THJA 1T5GA 3MFWA 1HQFA 3THEA 4RHKA 4Q3RC 1P8PA 4GSVA 4MYFA 4Q41A 3RLAA 4IXVA 1P8RA 1T4PA 1TBJA 4FCIA 4CEVA 1WOHA 3PZLA 1TBLA 1GQ7A 3DJ8A 4HWWA 2RLAA 4Q3PA 1ZPGA 4RHIA 2EIVA 1R1OA 1P8OA 4I06A 3MFVA 1CEVA 2CEVA 1P8MA 1T4SA 1WVAA 4G3HA 3SL1A 3THHA 1HQGA 4GWDA 4MYLA 3SKKA 4IU5A 4RHQA 1D3VA 3E8QA 4FCKA 4MYNA 3LHLA 3TF3A 2EF4A 4HXQA 4Q42A 1HQ5A 1WVBA 4Q3QA 1WOIA 4Q40A 4Q3RA 4IE1A 1HQXA 3MMRA 4Q3TA 1T5FA 4GWCA 3M1RA 4IE2A 1T4TA 4RHJA 5CEVA 3NIQA 5HJAA 1RLAA 2EF5A 1T4RA 1ZPEA 2PHOA 3NIPA 1PQ3A 1XFKA 1WOGA 2PHAA 3E6VA 3SJTA 3E6KA 2PLLA 3GMZA 3NIOA 4DZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GSM A;  1P8S A;  4ITY A;  4Q3U A;  5HJ9 A;  3CEV A;  3E9B A;  3LP4 A;  3TH7 A;  4IXU A;  3F80 A;  4RLA A;  4IU0 A;  5RLA A;  4HZE A;  3KV2 A;  4IU4 A;  4Q3V A;  4IU1 A;  2A0M A;  1GQ6 A;  4Q3S A;  2AEB A;  1TA1 A;  3MJL A;  1P8N A;  2ZAV A;  4MYK A;  1P8Q A;  3GN0 A;  4RHM A;  1HQH A;  1TBH A;  4GSZ A;  4IE3 A;  3LP7 A;  3SL0 A;  4MXR A;  3E8Z A;  4RHL A;  3THJ A;  1T5G A;  3MFW A;  1HQF A;  3THE A;  4RHK A;  4Q3R C;  1P8P A;  4GSV A;  4MYF A;  4Q41 A;  3RLA A;  4IXV A;  1P8R A;  1T4P A;  1TBJ A;  4FCI A;  4CEV A;  1WOH A;  3PZL A;  1TBL A;  1GQ7 A;  3DJ8 A;  4HWW A;  2RLA A;  4Q3P A;  1ZPG A;  4RHI A;  2EIV A;  1R1O A;  1P8O A;  4I06 A;  3MFV A;  1CEV A;  2CEV A;  1P8M A;  1T4S A;  1WVA A;  4G3H A;  3SL1 A;  3THH A;  1HQG A;  4GWD A;  4MYL A;  3SKK A;  4IU5 A;  4RHQ A;  1D3V A;  3E8Q A;  4FCK A;  4MYN A;  3LHL A;  3TF3 A;  2EF4 A;  4HXQ A;  4Q42 A;  1HQ5 A;  1WVB A;  4Q3Q A;  1WOI A;  4Q40 A;  4Q3R A;  4IE1 A;  1HQX A;  3MMR A;  4Q3T A;  1T5F A;  4GWC A;  3M1R A;  4IE2 A;  1T4T A;  4RHJ A;  5CEV A;  3NIQ A;  5HJA A;  1RLA A;  2EF5 A;  1T4R A;  1ZPE A;  2PHO A;  3NIP A;  1PQ3 A;  1XFK A;  1WOG A;  2PHA A;  3E6V A;  3SJT A;  3E6K A;  2PLL A;  3GMZ A;  3NIO A;  4DZ4 A; 
#chains in the Genus database with same CATH topology
 5DC6 A;  5G11 A;  4GSM A;  5EEF A;  1P8S A;  4ITY A;  4Q3U A;  5EFH A;  1ZZ3 A;  3C0Z A;  5HJ9 A;  4QA0 A;  3CEV A;  3E9B A;  5G1A A;  5EFK B;  4RN2 A;  4ZUN A;  3LP4 A;  3SFH A;  5G0G A;  1ZZ0 A;  5A2S A;  3TH7 A;  1C3P A;  4LXZ A;  3RQD A;  4IXU A;  3F80 A;  4RLA A;  3Q9C A;  3MZ3 A;  4HZE A;  4IU0 A;  3KV2 A;  5RLA A;  5THU A;  3ZNS A;  3EW8 A;  5G13 A;  4BZ7 A;  3ZNR A;  4IU4 A;  4Q3V A;  4IU1 A;  4QA5 A;  4CBY A;  2A0M A;  1GQ6 A;  4Q3S A;  4BZ5 A;  3Q9F A;  2AEB A;  1TA1 A;  4ZUP A;  3MJL A;  5G10 A;  4BKX B;  1P8N A;  2ZAV A;  4MYK A;  1P8Q A;  5EEN A;  3GN0 A;  5DC5 A;  4RHM A;  1HQH A;  1TBH A;  5G1B A;  5EFJ D;  2VQM A;  4GSZ A;  4RN1 A;  4RN0 A;  4IE3 A;  4QA4 A;  4ZUQ A;  3LP7 A;  3SL0 A;  2VQV A;  1C3S A;  4MXR A;  3E8Z A;  4RHL A;  3THJ A;  1T5G A;  3MFW A;  5EEI A;  1HQF A;  5THT A;  3THE A;  4RHK A;  4CQF A;  5DC7 A;  5EFG A;  5G0Y A;  4Q3R C;  5BWZ A;  1P8P A;  4GSV A;  4MYF A;  5G0I A;  5FUE A;  4ZUM A;  5THV A;  3RLA A;  4Q41 A;  4IXV A;  5FCW A;  1P8R A;  1T4P A;  2VQQ A;  1TBJ A;  4FCI A;  4CEV A;  5G0X A;  5THS A;  3F0R A;  1WOH A;  3PZL A;  1TBL A;  1GQ7 A;  3DJ8 A;  4QA7 A;  2VCG A;  3MZ6 A;  5D1D A;  5G0H A;  3MZ7 A;  3F07 A;  4HWW A;  2RLA A;  3SFF A;  4Q3P A;  2V5W A;  5D1B A;  5EEK A;  5IX0 A;  1ZPG A;  3C0Y A;  4RHI A;  5G17 A;  2EIV A;  1R1O A;  3EZP A;  4ZUR A;  1P8O A;  4I06 A;  5G1C A;  1C3R A;  4QA1 A;  3MFV A;  5G3W A;  1CEV A;  2CEV A;  4QA6 A;  3EWF A;  1P8M A;  1T4S A;  3MAX A;  3MZ4 A;  4BZ6 A;  1WVA A;  4G3H A;  5LI3 A;  4QA3 A;  3SL1 A;  3THH A;  5JI5 A;  1HQG A;  3MEN A;  4GWD A;  4MYL A;  3SKK A;  4IU5 A;  5EFN A;  4RHQ A;  1D3V A;  1VKG A;  3E8Q A;  3EZT A;  4FCK A;  4MYN A;  3LHL A;  4BZ8 A;  3Q9B A;  4A69 A;  3TF3 A;  2EF4 A;  2V5X A;  4HXQ A;  4Q42 A;  4BZ9 A;  5ICN B;  1HQ5 A;  1WVB A;  1ZZ1 A;  1WOI A;  4Q3Q A;  4Q40 A;  1T67 A;  4Q3R A;  1W22 A;  1HQX A;  3Q9E A;  3MMR A;  2VQO A;  4IE1 A;  4LY1 A;  2VQW G;  4Q3T A;  1T5F A;  5DC8 A;  4GWC A;  3M1R A;  2VQJ A;  5D1C A;  4IE2 A;  1T69 A;  1T4T A;  4RHJ A;  1T64 A;  3NIQ A;  5CEV A;  5EEM A;  1RLA A;  4CBT A;  5HJA A;  2EF5 A;  4ZUO A;  5EF8 A;  3C10 A;  1T4R A;  1ZPE A;  2PHO A;  3NIP A;  1PQ3 A;  1XFK A;  5G0J A;  5IWG A;  1WOG A;  3F06 A;  2PHA A;  5G12 A;  3E6V A;  3SJT A;  3E6K A;  2GH6 A;  5EFB D;  2PLL A;  5EF7 A;  3GMZ A;  4QA2 A;  3NIO A;  4DZ4 A; 
#chains in the Genus database with same CATH homology
 4GSM A;  1P8S A;  4ITY A;  4Q3U A;  5HJ9 A;  3CEV A;  3E9B A;  3LP4 A;  3TH7 A;  4IXU A;  3F80 A;  4RLA A;  4IU0 A;  5RLA A;  4HZE A;  3KV2 A;  4IU4 A;  4Q3V A;  4IU1 A;  2A0M A;  1GQ6 A;  4Q3S A;  2AEB A;  1TA1 A;  3MJL A;  1P8N A;  2ZAV A;  4MYK A;  1P8Q A;  3GN0 A;  4RHM A;  1HQH A;  1TBH A;  4GSZ A;  4IE3 A;  3LP7 A;  3SL0 A;  4MXR A;  3E8Z A;  4RHL A;  3THJ A;  1T5G A;  3MFW A;  1HQF A;  3THE A;  4RHK A;  4Q3R C;  1P8P A;  4GSV A;  4MYF A;  4Q41 A;  3RLA A;  4IXV A;  1P8R A;  1T4P A;  1TBJ A;  4FCI A;  4CEV A;  1WOH A;  3PZL A;  1TBL A;  1GQ7 A;  3DJ8 A;  4HWW A;  2RLA A;  4Q3P A;  1ZPG A;  4RHI A;  2EIV A;  1R1O A;  1P8O A;  4I06 A;  3MFV A;  1CEV A;  2CEV A;  1P8M A;  1T4S A;  1WVA A;  4G3H A;  3SL1 A;  3THH A;  1HQG A;  4GWD A;  4MYL A;  3SKK A;  4IU5 A;  4RHQ A;  1D3V A;  3E8Q A;  4FCK A;  4MYN A;  3LHL A;  3TF3 A;  2EF4 A;  4HXQ A;  4Q42 A;  1HQ5 A;  1WVB A;  4Q3Q A;  1WOI A;  4Q40 A;  4Q3R A;  4IE1 A;  1HQX A;  3MMR A;  4Q3T A;  1T5F A;  4GWC A;  3M1R A;  4IE2 A;  1T4T A;  4RHJ A;  5CEV A;  3NIQ A;  5HJA A;  1RLA A;  2EF5 A;  1T4R A;  1ZPE A;  2PHO A;  3NIP A;  1PQ3 A;  1XFK A;  1WOG A;  2PHA A;  3E6V A;  3SJT A;  3E6K A;  2PLL A;  3GMZ A;  3NIO A;  4DZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...