1P8VA

Crystal structure of the complex of platelet receptor gpib-alpha and alpha-thrombin at 2.6a
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
278
structure length
277
Chain Sequence
HPICEVSKVASHLEVNCDKRDLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Platelet glycoprotein Ib alpha chain
publication title Crystal Structure of the GpIbalpha-Thrombin Complex Essential for Platelet Aggregation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/hydrolase
total genus 71
structure length 277
sequence length 278
ec nomenclature
pdb deposition date 2003-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1p8vA00
3WPDA 3WPCA 3CIYA 1OGQA 1FS2A 4P91A 4QBZA 4FHOA 2OMXA 4KT1A 4U09A 1SQ0B 1FO1A 4LXSA 4R0AA 3ZYNA 5AWBA 4G8AA 3DZEA 4BSUA 4MN8B 4AW4A 5AWCA 3CVRA 5B0TA 4BSRA 3BZ5A 2Z81A 3UL8A 3KJ4A 3TSRE 2A0ZA 5IJCA 3E3ZA 3G06A 4R6FA 5B0NA 4KNGA 2UZXA 2O6QA 4R08A 3OGLB 4AY9X 3W3KA 4GLPA 1DS9A 1G9UA 5GQRK 2Q4GW 4LI1A 2Z63A 1YRGA 2XOTA 1M9LA 4Z79A 2P1OB 1H6TA 1K5GC 4ARRA 4CNCA 4CNMA 3RW6A 1Z7XW 3RFJA 3ZYJA 2IFGA 4R07A 4IM6A 1OZNA 3WPFA 3O6NA 4C2AB 1XCDA 2UZYA 4M7EC 5GS2B 3A79B 4CC4C 3REZA 4FMZA 4XGOA 2BNHA 2WFHA 2FT3A 1M0ZA 2Z7XB 4P8SA 2Y5QA 4U06A 5FTTB 5A5CA 1H6UA 2R9UA 1D0BA 1KOOA 3ULUA 4FDWA 4L3AA 5D3IA 3WPIA 4LI2A 1XWDC 5CMPA 4Z64C 2RA8A 3RJ0A 5GMGA 4Z61C 3WPHA 3OGMB 4R58A 4V2DA 4WYKA 3UN9A 4KXFB 3CIGA 4UFRA 3WN4A 4M7EA 2ELLA 4R6GA 4XOSA 4CC4A 1O6TA 3W3MA 4Z8GA 5IJBA 1QYYA 4MQWX 5AWAA 4ARNA 4OQTA 1P8VA 2P1NB 1U0ND 4ECOA 4YEBB 2JQDA 4RCAB 4PQ8A 2OMTA 4Y61B 4NKGA 4QC0A 2RR6A 4U7LA 4R6JA 3RIZA 1JL5A 3M19A 4NKHA 2Z64A 4V2EA 3ULVA 4PKIG 1PGVA 1M10B 4TZHA 4CILA 4J4LA 4FCGA 3WPGA 3UL7A 4U08A 1DCEA 3WPEA 2OMYA 2Z62A 3P72A 4H09A 3RGXA 3G04C 4HQ1A 4LSCA 1P9AG 3SB4A 2P1QB 1DFJI 3G39A 4R09A 1P8TA 1XKUA 2ID5A 3E6JA 1M9SA 1O6VA 5IYXC 4Q3GA 4Q3IA 5CMNA 2XWTC 1A9NA 4EZGA 1K5DC 1W8AA 4XSQA 1ZIWA 3ZYOA 4I6JB 4C2BB 4QXEA 5B4PA 2WQXA 3GOZA 2OMZA 1XECA 3OGKB 3UL9A 4BSSA 3RW7A 4Q62A 5HDHA 4R5DA 2P1PB 3OJAA 3O53A 1OTOA 4PEQB 5GMHA 1O6SA 2CA6A 3RGZA 4LSAA 3C6PB 3WPBA 5GMFA 3ULAA 3W3NA 2JE1A 5LFNA 4R6AA 4LXRA 4LSXC 4ECNA 3W3GA 2Z66A 2BEXA 2WQVA 1FT8A 3E4GA 4Z94G 1OTNA 1WWLA 2P1MB 4PSJA 2V9SA 1FQVA 3PMHG 3FXIA 2JE0A 2Z65A 4WP6A 1XEUA 2Z82A 4CP6A 3VQ2A 3C6OB 4J0MA 2WQUA 3G3BA 4FS7A 4PERA 2WQWA 2O6SA 1KOHA 5AZ5A 4GT6A 2V70A 2V9TB 4LSXA 3W3JA 3ZYIA 3JB9j 4RCWA 4RWTC 1OOKG 4B8CD 2OMVA 3RFEA 4BV4R 4FD0A 3M18A 5IJDA 1LTXA 1A4YA 2OMWA 3OJAB 3W3LA 1GWBA 5HZLB 3C6NB 1IO0A 3RFSA 3VQ1A 5AWDA 2O6RA 3G3AA 4V2CA 5GS0A 2ASTB 3E2JA 2Z7XA 2ASSB 4R5CA 2OMUA 4K17A 4L3FA 1OTMA
chains in the Genus database with same CATH superfamily
3WPDA 3WPCA 3CIYA 1OGQA 1FS2A 4P91A 4QBZA 4FHOA 2OMXA 4KT1A 4U09A 1SQ0B 1FO1A 4LXSA 4R0AA 3ZYNA 5AWBA 4G8AA 3DZEA 4BSUA 4MN8B 4AW4A 5AWCA 3CVRA 5B0TA 4BSRA 3BZ5A 2Z81A 3UL8A 3KJ4A 3TSRE 2A0ZA 5IJCA 3E3ZA 3G06A 4R6FA 5B0NA 4KNGA 2UZXA 2O6QA 4R08A 3OGLB 4AY9X 3W3KA 4GLPA 1DS9A 1G9UA 5GQRK 2Q4GW 4LI1A 2Z63A 1YRGA 2XOTA 1M9LA 4Z79A 2P1OB 1H6TA 1K5GC 4ARRA 4CNCA 4CNMA 3RW6A 1Z7XW 3RFJA 3ZYJA 2IFGA 4R07A 4IM6A 1OZNA 3WPFA 3O6NA 4C2AB 1XCDA 2UZYA 4M7EC 5GS2B 3A79B 4CC4C 3REZA 4FMZA 4XGOA 2BNHA 2WFHA 2FT3A 1M0ZA 2Z7XB 4P8SA 2Y5QA 4U06A 5FTTB 5A5CA 1H6UA 2R9UA 1D0BA 1KOOA 3ULUA 4FDWA 4L3AA 5D3IA 3WPIA 4LI2A 1XWDC 5CMPA 4Z64C 2RA8A 3RJ0A 4NZRM 5GMGA 4Z61C 3WPHA 3OGMB 4R58A 4V2DA 4WYKA 3UN9A 4KXFB 3CIGA 4UFRA 3WN4A 4M7EA 2ELLA 4R6GA 4XOSA 4CC4A 1O6TA 3W3MA 4Z8GA 5IJBA 1QYYA 4MQWX 5AWAA 4ARNA 4OQTA 1P8VA 2P1NB 1U0ND 4ECOA 4YEBB 2JQDA 4RCAB 4PQ8A 2OMTA 4Y61B 4NKGA 4QC0A 2RR6A 4U7LA 4R6JA 3RIZA 1JL5A 3M19A 4NKHA 2Z64A 4V2EA 3ULVA 4PKIG 1PGVA 1M10B 4TZHA 4CILA 4J4LA 4FCGA 3WPGA 3UL7A 4U08A 1DCEA 3WPEA 2OMYA 2Z62A 3P72A 4H09A 3RGXA 3G04C 4HQ1A 4LSCA 1P9AG 3SB4A 2P1QB 1DFJI 3G39A 4R09A 1P8TA 1XKUA 2ID5A 3E6JA 1M9SA 1O6VA 5IYXC 4Q3GA 4Q3IA 5CMNA 2XWTC 1A9NA 4EZGA 1K5DC 1W8AA 4XSQA 1ZIWA 3ZYOA 4I6JB 4C2BB 4QXEA 5B4PA 2WQXA 3GOZA 2OMZA 1XECA 3OGKB 3UL9A 4BSSA 3RW7A 4Q62A 5HDHA 4R5DA 2P1PB 3OJAA 3O53A 1OTOA 4PEQB 5GMHA 1O6SA 2CA6A 3RGZA 4LSAA 3C6PB 3WPBA 5GMFA 3ULAA 3W3NA 2JE1A 5LFNA 4R6AA 4LXRA 4LSXC 4ECNA 3W3GA 2Z66A 2BEXA 2WQVA 1FT8A 3E4GA 4Z94G 1OTNA 1WWLA 2P1MB 4PSJA 2V9SA 1FQVA 3PMHG 3FXIA 2JE0A 2Z65A 4WP6A 1XEUA 4NZTM 2Z82A 4CP6A 3VQ2A 3C6OB 4J0MA 2WQUA 3G3BA 4FS7A 4PERA 2WQWA 2O6SA 1KOHA 5AZ5A 4GT6A 2V70A 2V9TB 4LSXA 3W3JA 3ZYIA 3JB9j 4RCWA 4RWTC 1OOKG 4B8CD 2OMVA 3RFEA 4BV4R 4FD0A 3M18A 5IJDA 1LTXA 1A4YA 2OMWA 3OJAB 3W3LA 1GWBA 5HZLB 3C6NB 1IO0A 3RFSA 3VQ1A 5AWDA 2O6RA 3G3AA 4V2CA 5GS0A 2ASTB 3E2JA 2Z7XA 2ASSB 4R5CA 2OMUA 4K17A 4L3FA 1OTMA
chains in the Genus database with same CATH topology
3WPDA 3WPCA 3CIYA 1OGQA 1FS2A 4P91A 4QBZA 4FHOA 2OMXA 4KT1A 4U09A 1SQ0B 1FO1A 4LXSA 4R0AA 3ZYNA 5AWBA 4G8AA 3DZEA 4BSUA 4MN8B 4AW4A 5AWCA 3CVRA 5B0TA 4BSRA 3BZ5A 2Z81A 3UL8A 3KJ4A 3TSRE 2A0ZA 5IJCA 3E3ZA 3G06A 4R6FA 5B0NA 4KNGA 2UZXA 2O6QA 4R08A 3OGLB 4AY9X 3W3KA 4GLPA 1DS9A 1G9UA 5GQRK 2Q4GW 4LI1A 2Z63A 1YRGA 2XOTA 1M9LA 4Z79A 2P1OB 1H6TA 1K5GC 4ARRA 4CNCA 4CNMA 3RW6A 1Z7XW 3RFJA 3ZYJA 2IFGA 4R07A 4IM6A 1OZNA 3WPFA 3O6NA 4C2AB 1XCDA 2UZYA 4M7EC 5GS2B 3A79B 4CC4C 3REZA 4FMZA 4XGOA 2BNHA 2WFHA 2FT3A 1M0ZA 2Z7XB 4P8SA 2Y5QA 4U06A 5FTTB 5A5CA 1H6UA 2R9UA 1D0BA 1KOOA 3ULUA 4FDWA 4L3AA 5D3IA 3WPIA 4LI2A 1XWDC 5CMPA 4Z64C 2RA8A 3RJ0A 5GMGA 4Z61C 3WPHA 3OGMB 4R58A 4V2DA 4WYKA 3UN9A 4KXFB 3CIGA 4UFRA 3WN4A 4M7EA 2ELLA 4R6GA 4XOSA 4CC4A 1O6TA 3W3MA 4Z8GA 5IJBA 1QYYA 4MQWX 5AWAA 4ARNA 4OQTA 1P8VA 2P1NB 1U0ND 4ECOA 4YEBB 2JQDA 4RCAB 4PQ8A 2OMTA 4Y61B 4NKGA 4QC0A 2RR6A 4U7LA 4R6JA 3RIZA 1JL5A 3M19A 4NKHA 2Z64A 4V2EA 3ULVA 4PKIG 1PGVA 1M10B 4TZHA 4CILA 4J4LA 4FCGA 3WPGA 3UL7A 4U08A 1DCEA 3WPEA 2OMYA 2Z62A 3P72A 4H09A 3RGXA 3G04C 4HQ1A 4LSCA 1P9AG 3SB4A 2P1QB 1DFJI 3G39A 4R09A 1P8TA 1XKUA 2ID5A 3E6JA 1M9SA 1O6VA 5IYXC 4Q3GA 4Q3IA 5CMNA 2XWTC 1A9NA 4EZGA 1K5DC 1W8AA 4XSQA 1ZIWA 3ZYOA 4I6JB 4C2BB 4QXEA 5B4PA 2WQXA 3GOZA 2OMZA 1XECA 3OGKB 3UL9A 4BSSA 3RW7A 4Q62A 5HDHA 4R5DA 2P1PB 3OJAA 3O53A 1OTOA 4PEQB 5GMHA 1O6SA 2CA6A 3RGZA 4LSAA 3C6PB 3WPBA 5GMFA 3ULAA 3W3NA 2JE1A 5LFNA 4R6AA 4LXRA 4LSXC 4ECNA 3W3GA 2Z66A 2BEXA 2WQVA 1FT8A 3E4GA 4Z94G 1OTNA 1WWLA 2P1MB 4PSJA 2V9SA 1FQVA 3PMHG 3FXIA 2JE0A 2Z65A 4WP6A 1XEUA 2Z82A 4CP6A 3VQ2A 3C6OB 4J0MA 2WQUA 3G3BA 4FS7A 4PERA 2WQWA 2O6SA 1KOHA 5AZ5A 4GT6A 2V70A 2V9TB 4LSXA 3W3JA 3ZYIA 3JB9j 4RCWA 4RWTC 1OOKG 4B8CD 2OMVA 3RFEA 4BV4R 4FD0A 3M18A 5IJDA 1LTXA 1A4YA 2OMWA 3OJAB 3W3LA 1GWBA 5HZLB 3C6NB 1IO0A 3RFSA 3VQ1A 5AWDA 2O6RA 3G3AA 4V2CA 5GS0A 2ASTB 3E2JA 2Z7XA 2ASSB 4R5CA 2OMUA 4K17A 4L3FA 1OTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WPD A;  3WPC A;  3CIY A;  1OGQ A;  1FS2 A;  4P91 A;  4QBZ A;  4FHO A;  2OMX A;  4KT1 A;  4U09 A;  1SQ0 B;  1FO1 A;  4LXS A;  4R0A A;  3ZYN A;  5AWB A;  4G8A A;  3DZE A;  4BSU A;  4MN8 B;  4AW4 A;  5AWC A;  3CVR A;  5B0T A;  4BSR A;  3BZ5 A;  2Z81 A;  3UL8 A;  3KJ4 A;  3TSR E;  2A0Z A;  5IJC A;  3E3Z A;  3G06 A;  4R6F A;  5B0N A;  4KNG A;  2UZX A;  2O6Q A;  4R08 A;  3OGL B;  4AY9 X;  3W3K A;  4GLP A;  1DS9 A;  1G9U A;  5GQR K;  2Q4G W;  4LI1 A;  2Z63 A;  1YRG A;  2XOT A;  1M9L A;  4Z79 A;  2P1O B;  1H6T A;  1K5G C;  4ARR A;  4CNC A;  4CNM A;  3RW6 A;  1Z7X W;  3RFJ A;  3ZYJ A;  2IFG A;  4R07 A;  4IM6 A;  1OZN A;  3WPF A;  3O6N A;  4C2A B;  1XCD A;  2UZY A;  4M7E C;  5GS2 B;  3A79 B;  4CC4 C;  3REZ A;  4FMZ A;  4XGO A;  2BNH A;  2WFH A;  2FT3 A;  1M0Z A;  2Z7X B;  4P8S A;  2Y5Q A;  4U06 A;  5FTT B;  5A5C A;  1H6U A;  2R9U A;  1D0B A;  1KOO A;  3ULU A;  4FDW A;  4L3A A;  5D3I A;  3WPI A;  4LI2 A;  1XWD C;  5CMP A;  4Z64 C;  2RA8 A;  3RJ0 A;  5GMG A;  4Z61 C;  3WPH A;  3OGM B;  4R58 A;  4V2D A;  4WYK A;  3UN9 A;  4KXF B;  3CIG A;  4UFR A;  3WN4 A;  4M7E A;  2ELL A;  4R6G A;  4XOS A;  4CC4 A;  1O6T A;  3W3M A;  4Z8G A;  5IJB A;  1QYY A;  4MQW X;  5AWA A;  4ARN A;  4OQT A;  1P8V A;  2P1N B;  1U0N D;  4ECO A;  4YEB B;  2JQD A;  4RCA B;  4PQ8 A;  2OMT A;  4Y61 B;  4NKG A;  4QC0 A;  2RR6 A;  4U7L A;  4R6J A;  3RIZ A;  1JL5 A;  3M19 A;  4NKH A;  2Z64 A;  4V2E A;  3ULV A;  4PKI G;  1PGV A;  1M10 B;  4TZH A;  4CIL A;  4J4L A;  4FCG A;  3WPG A;  3UL7 A;  4U08 A;  1DCE A;  3WPE A;  2OMY A;  2Z62 A;  3P72 A;  4H09 A;  3RGX A;  3G04 C;  4HQ1 A;  4LSC A;  1P9A G;  3SB4 A;  2P1Q B;  1DFJ I;  3G39 A;  4R09 A;  1P8T A;  1XKU A;  2ID5 A;  3E6J A;  1M9S A;  1O6V A;  5IYX C;  4Q3G A;  4Q3I A;  5CMN A;  2XWT C;  1A9N A;  4EZG A;  1K5D C;  1W8A A;  4XSQ A;  1ZIW A;  3ZYO A;  4I6J B;  4C2B B;  4QXE A;  5B4P A;  2WQX A;  3GOZ A;  2OMZ A;  1XEC A;  3OGK B;  3UL9 A;  4BSS A;  3RW7 A;  4Q62 A;  5HDH A;  4R5D A;  2P1P B;  3OJA A;  3O53 A;  1OTO A;  4PEQ B;  5GMH A;  1O6S A;  2CA6 A;  3RGZ A;  4LSA A;  3C6P B;  3WPB A;  5GMF A;  3ULA A;  3W3N A;  2JE1 A;  5LFN A;  4R6A A;  4LXR A;  4LSX C;  4ECN A;  3W3G A;  2Z66 A;  2BEX A;  2WQV A;  1FT8 A;  3E4G A;  4Z94 G;  1OTN A;  1WWL A;  2P1M B;  4PSJ A;  2V9S A;  1FQV A;  3PMH G;  3FXI A;  2JE0 A;  2Z65 A;  4WP6 A;  1XEU A;  2Z82 A;  4CP6 A;  3VQ2 A;  3C6O B;  4J0M A;  2WQU A;  3G3B A;  4FS7 A;  4PER A;  2WQW A;  2O6S A;  1KOH A;  5AZ5 A;  4GT6 A;  2V70 A;  2V9T B;  4LSX A;  3W3J A;  3ZYI A;  3JB9 j;  4RCW A;  4RWT C;  1OOK G;  4B8C D;  2OMV A;  3RFE A;  4BV4 R;  4FD0 A;  3M18 A;  5IJD A;  1LTX A;  1A4Y A;  2OMW A;  3OJA B;  3W3L A;  1GWB A;  5HZL B;  3C6N B;  1IO0 A;  3RFS A;  3VQ1 A;  5AWD A;  2O6R A;  3G3A A;  4V2C A;  5GS0 A;  2AST B;  3E2J A;  2Z7X A;  2ASS B;  4R5C A;  2OMU A;  4K17 A;  4L3F A;  1OTM A; 
#chains in the Genus database with same CATH topology
 3WPD A;  3WPC A;  3CIY A;  1OGQ A;  1FS2 A;  4P91 A;  4QBZ A;  4FHO A;  2OMX A;  4KT1 A;  4U09 A;  1SQ0 B;  1FO1 A;  4LXS A;  4R0A A;  3ZYN A;  5AWB A;  4G8A A;  3DZE A;  4BSU A;  4MN8 B;  4AW4 A;  5AWC A;  3CVR A;  5B0T A;  4BSR A;  3BZ5 A;  2Z81 A;  3UL8 A;  3KJ4 A;  3TSR E;  2A0Z A;  5IJC A;  3E3Z A;  3G06 A;  4R6F A;  5B0N A;  4KNG A;  2UZX A;  2O6Q A;  4R08 A;  3OGL B;  4AY9 X;  3W3K A;  4GLP A;  1DS9 A;  1G9U A;  5GQR K;  2Q4G W;  4LI1 A;  2Z63 A;  1YRG A;  2XOT A;  1M9L A;  4Z79 A;  2P1O B;  1H6T A;  1K5G C;  4ARR A;  4CNC A;  4CNM A;  3RW6 A;  1Z7X W;  3RFJ A;  3ZYJ A;  2IFG A;  4R07 A;  4IM6 A;  1OZN A;  3WPF A;  3O6N A;  4C2A B;  1XCD A;  2UZY A;  4M7E C;  5GS2 B;  3A79 B;  4CC4 C;  3REZ A;  4FMZ A;  4XGO A;  2BNH A;  2WFH A;  2FT3 A;  1M0Z A;  2Z7X B;  4P8S A;  2Y5Q A;  4U06 A;  5FTT B;  5A5C A;  1H6U A;  2R9U A;  1D0B A;  1KOO A;  3ULU A;  4FDW A;  4L3A A;  5D3I A;  3WPI A;  4LI2 A;  1XWD C;  5CMP A;  4Z64 C;  2RA8 A;  3RJ0 A;  4NZR M;  5GMG A;  4Z61 C;  3WPH A;  3OGM B;  4R58 A;  4V2D A;  4WYK A;  3UN9 A;  4KXF B;  3CIG A;  4UFR A;  3WN4 A;  4M7E A;  2ELL A;  4R6G A;  4XOS A;  4CC4 A;  1O6T A;  3W3M A;  4Z8G A;  5IJB A;  1QYY A;  4MQW X;  5AWA A;  4ARN A;  4OQT A;  1P8V A;  2P1N B;  1U0N D;  4ECO A;  4YEB B;  2JQD A;  4RCA B;  4PQ8 A;  2OMT A;  4Y61 B;  4NKG A;  4QC0 A;  2RR6 A;  4U7L A;  4R6J A;  3RIZ A;  1JL5 A;  3M19 A;  4NKH A;  2Z64 A;  4V2E A;  3ULV A;  4PKI G;  1PGV A;  1M10 B;  4TZH A;  4CIL A;  4J4L A;  4FCG A;  3WPG A;  3UL7 A;  4U08 A;  1DCE A;  3WPE A;  2OMY A;  2Z62 A;  3P72 A;  4H09 A;  3RGX A;  3G04 C;  4HQ1 A;  4LSC A;  1P9A G;  3SB4 A;  2P1Q B;  1DFJ I;  3G39 A;  4R09 A;  1P8T A;  1XKU A;  2ID5 A;  3E6J A;  1M9S A;  1O6V A;  5IYX C;  4Q3G A;  4Q3I A;  5CMN A;  2XWT C;  1A9N A;  4EZG A;  1K5D C;  1W8A A;  4XSQ A;  1ZIW A;  3ZYO A;  4I6J B;  4C2B B;  4QXE A;  5B4P A;  2WQX A;  3GOZ A;  2OMZ A;  1XEC A;  3OGK B;  3UL9 A;  4BSS A;  3RW7 A;  4Q62 A;  5HDH A;  4R5D A;  2P1P B;  3OJA A;  3O53 A;  1OTO A;  4PEQ B;  5GMH A;  1O6S A;  2CA6 A;  3RGZ A;  4LSA A;  3C6P B;  3WPB A;  5GMF A;  3ULA A;  3W3N A;  2JE1 A;  5LFN A;  4R6A A;  4LXR A;  4LSX C;  4ECN A;  3W3G A;  2Z66 A;  2BEX A;  2WQV A;  1FT8 A;  3E4G A;  4Z94 G;  1OTN A;  1WWL A;  2P1M B;  4PSJ A;  2V9S A;  1FQV A;  3PMH G;  3FXI A;  2JE0 A;  2Z65 A;  4WP6 A;  1XEU A;  4NZT M;  2Z82 A;  4CP6 A;  3VQ2 A;  3C6O B;  4J0M A;  2WQU A;  3G3B A;  4FS7 A;  4PER A;  2WQW A;  2O6S A;  1KOH A;  5AZ5 A;  4GT6 A;  2V70 A;  2V9T B;  4LSX A;  3W3J A;  3ZYI A;  3JB9 j;  4RCW A;  4RWT C;  1OOK G;  4B8C D;  2OMV A;  3RFE A;  4BV4 R;  4FD0 A;  3M18 A;  5IJD A;  1LTX A;  1A4Y A;  2OMW A;  3OJA B;  3W3L A;  1GWB A;  5HZL B;  3C6N B;  1IO0 A;  3RFS A;  3VQ1 A;  5AWD A;  2O6R A;  3G3A A;  4V2C A;  5GS0 A;  2AST B;  3E2J A;  2Z7X A;  2ASS B;  4R5C A;  2OMU A;  4K17 A;  4L3F A;  1OTM A; 
#chains in the Genus database with same CATH homology
 3WPD A;  3WPC A;  3CIY A;  1OGQ A;  1FS2 A;  4P91 A;  4QBZ A;  4FHO A;  2OMX A;  4KT1 A;  4U09 A;  1SQ0 B;  1FO1 A;  4LXS A;  4R0A A;  3ZYN A;  5AWB A;  4G8A A;  3DZE A;  4BSU A;  4MN8 B;  4AW4 A;  5AWC A;  3CVR A;  5B0T A;  4BSR A;  3BZ5 A;  2Z81 A;  3UL8 A;  3KJ4 A;  3TSR E;  2A0Z A;  5IJC A;  3E3Z A;  3G06 A;  4R6F A;  5B0N A;  4KNG A;  2UZX A;  2O6Q A;  4R08 A;  3OGL B;  4AY9 X;  3W3K A;  4GLP A;  1DS9 A;  1G9U A;  5GQR K;  2Q4G W;  4LI1 A;  2Z63 A;  1YRG A;  2XOT A;  1M9L A;  4Z79 A;  2P1O B;  1H6T A;  1K5G C;  4ARR A;  4CNC A;  4CNM A;  3RW6 A;  1Z7X W;  3RFJ A;  3ZYJ A;  2IFG A;  4R07 A;  4IM6 A;  1OZN A;  3WPF A;  3O6N A;  4C2A B;  1XCD A;  2UZY A;  4M7E C;  5GS2 B;  3A79 B;  4CC4 C;  3REZ A;  4FMZ A;  4XGO A;  2BNH A;  2WFH A;  2FT3 A;  1M0Z A;  2Z7X B;  4P8S A;  2Y5Q A;  4U06 A;  5FTT B;  5A5C A;  1H6U A;  2R9U A;  1D0B A;  1KOO A;  3ULU A;  4FDW A;  4L3A A;  5D3I A;  3WPI A;  4LI2 A;  1XWD C;  5CMP A;  4Z64 C;  2RA8 A;  3RJ0 A;  5GMG A;  4Z61 C;  3WPH A;  3OGM B;  4R58 A;  4V2D A;  4WYK A;  3UN9 A;  4KXF B;  3CIG A;  4UFR A;  3WN4 A;  4M7E A;  2ELL A;  4R6G A;  4XOS A;  4CC4 A;  1O6T A;  3W3M A;  4Z8G A;  5IJB A;  1QYY A;  4MQW X;  5AWA A;  4ARN A;  4OQT A;  1P8V A;  2P1N B;  1U0N D;  4ECO A;  4YEB B;  2JQD A;  4RCA B;  4PQ8 A;  2OMT A;  4Y61 B;  4NKG A;  4QC0 A;  2RR6 A;  4U7L A;  4R6J A;  3RIZ A;  1JL5 A;  3M19 A;  4NKH A;  2Z64 A;  4V2E A;  3ULV A;  4PKI G;  1PGV A;  1M10 B;  4TZH A;  4CIL A;  4J4L A;  4FCG A;  3WPG A;  3UL7 A;  4U08 A;  1DCE A;  3WPE A;  2OMY A;  2Z62 A;  3P72 A;  4H09 A;  3RGX A;  3G04 C;  4HQ1 A;  4LSC A;  1P9A G;  3SB4 A;  2P1Q B;  1DFJ I;  3G39 A;  4R09 A;  1P8T A;  1XKU A;  2ID5 A;  3E6J A;  1M9S A;  1O6V A;  5IYX C;  4Q3G A;  4Q3I A;  5CMN A;  2XWT C;  1A9N A;  4EZG A;  1K5D C;  1W8A A;  4XSQ A;  1ZIW A;  3ZYO A;  4I6J B;  4C2B B;  4QXE A;  5B4P A;  2WQX A;  3GOZ A;  2OMZ A;  1XEC A;  3OGK B;  3UL9 A;  4BSS A;  3RW7 A;  4Q62 A;  5HDH A;  4R5D A;  2P1P B;  3OJA A;  3O53 A;  1OTO A;  4PEQ B;  5GMH A;  1O6S A;  2CA6 A;  3RGZ A;  4LSA A;  3C6P B;  3WPB A;  5GMF A;  3ULA A;  3W3N A;  2JE1 A;  5LFN A;  4R6A A;  4LXR A;  4LSX C;  4ECN A;  3W3G A;  2Z66 A;  2BEX A;  2WQV A;  1FT8 A;  3E4G A;  4Z94 G;  1OTN A;  1WWL A;  2P1M B;  4PSJ A;  2V9S A;  1FQV A;  3PMH G;  3FXI A;  2JE0 A;  2Z65 A;  4WP6 A;  1XEU A;  2Z82 A;  4CP6 A;  3VQ2 A;  3C6O B;  4J0M A;  2WQU A;  3G3B A;  4FS7 A;  4PER A;  2WQW A;  2O6S A;  1KOH A;  5AZ5 A;  4GT6 A;  2V70 A;  2V9T B;  4LSX A;  3W3J A;  3ZYI A;  3JB9 j;  4RCW A;  4RWT C;  1OOK G;  4B8C D;  2OMV A;  3RFE A;  4BV4 R;  4FD0 A;  3M18 A;  5IJD A;  1LTX A;  1A4Y A;  2OMW A;  3OJA B;  3W3L A;  1GWB A;  5HZL B;  3C6N B;  1IO0 A;  3RFS A;  3VQ1 A;  5AWD A;  2O6R A;  3G3A A;  4V2C A;  5GS0 A;  2AST B;  3E2J A;  2Z7X A;  2ASS B;  4R5C A;  2OMU A;  4K17 A;  4L3F A;  1OTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...