1P8VA

Crystal structure of the complex of platelet receptor gpib-alpha and alpha-thrombin at 2.6a
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
278
structure length
277
Chain Sequence
b'HPICEVSKVASHLEVNCDKRDLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLDY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Platelet glycoprotein Ib alpha chain
publication title Crystal Structure of the GpIbalpha-Thrombin Complex Essential for Platelet Aggregation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein/hydrolase
total genus 71
structure length 277
sequence length 278
ec nomenclature
pdb deposition date 2003-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1p8vA00
2V70A 5A5CA 2Q4GW 4QBZA 1Z7XW 3GOZA 4LXSA 5GMGA 4Q3IA 4I6JB 4G8AA 4U7LA 4C2AB 4PSJA 5B0TA 3E2JA 1A4YA 3E4GA 2R9UA 4FMZA 4LXRA 5CMNA 4CC4C 4Q3GA 4R07A 1A9NA 2OMXA 3ZYJA 5IJCA 2P1QB 1M10B 2Z7XA 4LSAA 2OMTA 4ECNA 3WPBA 4B8CD 3ULUA 4H09A 5AWDA 2Z82A 3RFJA 4LI1A 4ARRA 2Z65A 1D0BA 3C6NB 5AWBA 5IYXC 4LSXA 4V2DA 3ZYOA 4HQ1A 5HZLB 5AWCA 3G3AA 4XOSA 2Z66A 2ID5A 4FCGA 4NKHA 4Q62A 2ASSB 4R5CA 3ZYNA 4FS7A 3WPGA 2XOTA 1XKUA 3OGLB 4AY9X 1FQVA 2UZXA 3G06A 3W3GA 2WQUA 4C2BB 4Z94G 3UN9A 4Y61B 4CC4A 4BSSA 2OMUA 4CNCA 4RCAB 1O6SA 3RW6A 2RA8A 1GWBA 3W3NA 4R6JA 3WPFA 2UZYA 4PKIG 3G3BA 3RFSA 3RW7A 1FT8A 2Z7XB 4KNGA 3REZA 4J0MA 4R58A 5LFNA 1W8AA 4L3FA 1FS2A 1OTOA 3P72A 2ELLA 2WQXA 4K17A 1OGQA 4Z79A 5GMHA 4KT1A 3JB9j 4AW4A 5B0NA 5CMPA 1M0ZA 2WQVA 3ULVA 1OTMA 1ZIWA 1O6TA 4KXFB 1H6TA 4V2CA 1SQ0B 1G9UA 1XWDC 4PERA 3E3ZA 4R0AA 1DCEA 5AZ5A 3WPIA 3ULAA 4TZHA 4R6FA 5GMFA 3CIYA 2FT3A 3A79B 2V9SA 5GS0A 2CA6A 2P1PB 2Z62A 4R08A 1P9AG 4GLPA 4FDWA 4P8SA 3WPEA 3WPCA 4FD0A 2BEXA 2JE1A 4EZGA 4FHOA 3CVRA 3SB4A 3WN4A 3UL9A 1KOHA 3BZ5A 2P1NB 4WP6A 4Z61C 1M9SA 3WPHA 3RFEA 3UL7A 3ZYIA 1K5GC 4RCWA 2P1MB 2Z64A 2JE0A 1OOKG 4ECOA 2OMYA 4Z8GA 4XGOA 4U08A 3C6PB 4CP6A 4LSXC 5D3IA 2O6QA 2Y5QA 4YEBB 1DFJI 4QC0A 2ASTB 3RIZA 3W3LA 1OZNA 2OMVA 2OMZA 1XEUA 4MQWX 3OJAB 3TSRE 3VQ2A 1KOOA 3KJ4A 4MN8B 3DZEA 2WFHA 4PEQB 4M7EC 1XCDA 2BNHA 4IM6A 4ARNA 3W3MA 4QXEA 3M19A 2JQDA 4GT6A 4BSRA 2V9TB 2WQWA 1PGVA 3OGKB 4Z64C 3G39A 3E6JA 3C6OB 3OJAA 5GQRK 1QYYA 3PMHG 2Z63A 1IO0A 1DS9A 3W3JA 3RJ0A 2A0ZA 4LI2A 4P91A 4J4LA 4R09A 3W3KA 5GS2B 3O6NA 4L3AA 4R6AA 3M18A 1WWLA 4LSCA 5AWAA 3RGZA 1OTNA 4NKGA 1U0ND 4XSQA 1M9LA 2Z81A 4R5DA 3UL8A 2XWTC 5B4PA 1YRGA 2O6SA 4CNMA 1K5DC 4R6GA 3WPDA 1LTXA 2IFGA 4M7EA 3FXIA 4BSUA 1H6UA 1FO1A 4BV4R 4U06A 5IJBA 1XECA 3CIGA 1P8VA 4WYKA 2O6RA 5IJDA 1O6VA 3VQ1A 4U09A 1JL5A 5FTTB 3OGMB 4PQ8A 2P1OB 2RR6A 1P8TA 4CILA 3G04C 2OMWA 3O53A 4UFRA 4OQTA 4V2EA 4RWTC 3RGXA 5HDHA
chains in the Genus database with same CATH superfamily
2V70A 5A5CA 2Q4GW 4QBZA 1Z7XW 3GOZA 4LXSA 5GMGA 4Q3IA 4I6JB 4G8AA 4U7LA 4C2AB 4PSJA 5B0TA 3E2JA 1A4YA 3E4GA 2R9UA 4FMZA 4LXRA 5CMNA 4CC4C 4Q3GA 4R07A 1A9NA 2OMXA 3ZYJA 5IJCA 2P1QB 1M10B 2Z7XA 4LSAA 2OMTA 4ECNA 3WPBA 4B8CD 3ULUA 4H09A 5AWDA 2Z82A 3RFJA 4LI1A 4ARRA 2Z65A 1D0BA 3C6NB 5AWBA 5IYXC 4LSXA 4V2DA 3ZYOA 4HQ1A 5HZLB 5AWCA 3G3AA 4XOSA 2Z66A 2ID5A 4FCGA 4NKHA 4Q62A 2ASSB 4R5CA 3ZYNA 4FS7A 3WPGA 2XOTA 1XKUA 3OGLB 4AY9X 1FQVA 2UZXA 3G06A 3W3GA 2WQUA 4C2BB 4Z94G 3UN9A 4Y61B 4CC4A 4BSSA 2OMUA 4CNCA 4NZRM 4RCAB 1O6SA 3RW6A 2RA8A 1GWBA 3W3NA 4R6JA 3WPFA 2UZYA 4PKIG 3G3BA 3RFSA 3RW7A 1FT8A 2Z7XB 4KNGA 3REZA 4J0MA 4R58A 5LFNA 1W8AA 4L3FA 1FS2A 1OTOA 3P72A 2ELLA 2WQXA 4K17A 1OGQA 4Z79A 5GMHA 4KT1A 3JB9j 4AW4A 5B0NA 5CMPA 1M0ZA 2WQVA 3ULVA 1OTMA 1ZIWA 1O6TA 4KXFB 1H6TA 4V2CA 1SQ0B 1G9UA 1XWDC 4PERA 3E3ZA 4R0AA 1DCEA 5AZ5A 3WPIA 3ULAA 4TZHA 4R6FA 5GMFA 3CIYA 2FT3A 3A79B 2V9SA 5GS0A 2CA6A 2P1PB 2Z62A 4R08A 1P9AG 4GLPA 4FDWA 4P8SA 3WPEA 3WPCA 4FD0A 2BEXA 2JE1A 4EZGA 4FHOA 3CVRA 3SB4A 3WN4A 3UL9A 1KOHA 3BZ5A 2P1NB 4WP6A 4Z61C 1M9SA 3WPHA 3RFEA 3UL7A 3ZYIA 1K5GC 4RCWA 2P1MB 2Z64A 2JE0A 1OOKG 4ECOA 2OMYA 4Z8GA 4XGOA 4U08A 3C6PB 4CP6A 4LSXC 5D3IA 2O6QA 2Y5QA 4YEBB 1DFJI 4QC0A 2ASTB 3RIZA 3W3LA 1OZNA 2OMVA 2OMZA 1XEUA 4MQWX 3OJAB 3TSRE 3VQ2A 1KOOA 3KJ4A 4MN8B 3DZEA 2WFHA 4PEQB 4M7EC 1XCDA 2BNHA 4IM6A 4ARNA 3W3MA 4QXEA 3M19A 2JQDA 4GT6A 4BSRA 2V9TB 2WQWA 1PGVA 3OGKB 4Z64C 3G39A 3E6JA 3C6OB 3OJAA 5GQRK 1QYYA 3PMHG 2Z63A 1IO0A 1DS9A 3W3JA 3RJ0A 2A0ZA 4LI2A 4P91A 4J4LA 4R09A 3W3KA 5GS2B 3O6NA 4L3AA 4NZTM 4R6AA 3M18A 1WWLA 4LSCA 5AWAA 3RGZA 1OTNA 4NKGA 1U0ND 4XSQA 1M9LA 2Z81A 4R5DA 3UL8A 2XWTC 5B4PA 1YRGA 2O6SA 4CNMA 1K5DC 4R6GA 3WPDA 1LTXA 2IFGA 4M7EA 3FXIA 4BSUA 1H6UA 1FO1A 4BV4R 4U06A 5IJBA 1XECA 3CIGA 1P8VA 4WYKA 2O6RA 5IJDA 1O6VA 3VQ1A 4U09A 1JL5A 5FTTB 3OGMB 4PQ8A 2P1OB 2RR6A 1P8TA 4CILA 3G04C 2OMWA 3O53A 4UFRA 4OQTA 4V2EA 4RWTC 3RGXA 5HDHA
chains in the Genus database with same CATH topology
2V70A 5A5CA 2Q4GW 4QBZA 1Z7XW 3GOZA 4LXSA 5GMGA 4Q3IA 4I6JB 4G8AA 4U7LA 4C2AB 4PSJA 5B0TA 3E2JA 1A4YA 3E4GA 2R9UA 4FMZA 4LXRA 5CMNA 4CC4C 4Q3GA 4R07A 1A9NA 2OMXA 3ZYJA 5IJCA 2P1QB 1M10B 2Z7XA 4LSAA 2OMTA 4ECNA 3WPBA 4B8CD 3ULUA 4H09A 5AWDA 2Z82A 3RFJA 4LI1A 4ARRA 2Z65A 1D0BA 3C6NB 5AWBA 5IYXC 4LSXA 4V2DA 3ZYOA 4HQ1A 5HZLB 5AWCA 3G3AA 4XOSA 2Z66A 2ID5A 4FCGA 4NKHA 4Q62A 2ASSB 4R5CA 3ZYNA 4FS7A 3WPGA 2XOTA 1XKUA 3OGLB 4AY9X 1FQVA 2UZXA 3G06A 3W3GA 2WQUA 4C2BB 4Z94G 3UN9A 4Y61B 4CC4A 4BSSA 2OMUA 4CNCA 4RCAB 1O6SA 3RW6A 2RA8A 1GWBA 3W3NA 4R6JA 3WPFA 2UZYA 4PKIG 3G3BA 3RFSA 3RW7A 1FT8A 2Z7XB 4KNGA 3REZA 4J0MA 4R58A 5LFNA 1W8AA 4L3FA 1FS2A 1OTOA 3P72A 2ELLA 2WQXA 4K17A 1OGQA 4Z79A 5GMHA 4KT1A 3JB9j 4AW4A 5B0NA 5CMPA 1M0ZA 2WQVA 3ULVA 1OTMA 1ZIWA 1O6TA 4KXFB 1H6TA 4V2CA 1SQ0B 1G9UA 1XWDC 4PERA 3E3ZA 4R0AA 1DCEA 5AZ5A 3WPIA 3ULAA 4TZHA 4R6FA 5GMFA 3CIYA 2FT3A 3A79B 2V9SA 5GS0A 2CA6A 2P1PB 2Z62A 4R08A 1P9AG 4GLPA 4FDWA 4P8SA 3WPEA 3WPCA 4FD0A 2BEXA 2JE1A 4EZGA 4FHOA 3CVRA 3SB4A 3WN4A 3UL9A 1KOHA 3BZ5A 2P1NB 4WP6A 4Z61C 1M9SA 3WPHA 3RFEA 3UL7A 3ZYIA 1K5GC 4RCWA 2P1MB 2Z64A 2JE0A 1OOKG 4ECOA 2OMYA 4Z8GA 4XGOA 4U08A 3C6PB 4CP6A 4LSXC 5D3IA 2O6QA 2Y5QA 4YEBB 1DFJI 4QC0A 2ASTB 3RIZA 3W3LA 1OZNA 2OMVA 2OMZA 1XEUA 4MQWX 3OJAB 3TSRE 3VQ2A 1KOOA 3KJ4A 4MN8B 3DZEA 2WFHA 4PEQB 4M7EC 1XCDA 2BNHA 4IM6A 4ARNA 3W3MA 4QXEA 3M19A 2JQDA 4GT6A 4BSRA 2V9TB 2WQWA 1PGVA 3OGKB 4Z64C 3G39A 3E6JA 3C6OB 3OJAA 5GQRK 1QYYA 3PMHG 2Z63A 1IO0A 1DS9A 3W3JA 3RJ0A 2A0ZA 4LI2A 4P91A 4J4LA 4R09A 3W3KA 5GS2B 3O6NA 4L3AA 4R6AA 3M18A 1WWLA 4LSCA 5AWAA 3RGZA 1OTNA 4NKGA 1U0ND 4XSQA 1M9LA 2Z81A 4R5DA 3UL8A 2XWTC 5B4PA 1YRGA 2O6SA 4CNMA 1K5DC 4R6GA 3WPDA 1LTXA 2IFGA 4M7EA 3FXIA 4BSUA 1H6UA 1FO1A 4BV4R 4U06A 5IJBA 1XECA 3CIGA 1P8VA 4WYKA 2O6RA 5IJDA 1O6VA 3VQ1A 4U09A 1JL5A 5FTTB 3OGMB 4PQ8A 2P1OB 2RR6A 1P8TA 4CILA 3G04C 2OMWA 3O53A 4UFRA 4OQTA 4V2EA 4RWTC 3RGXA 5HDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V70 A;  5A5C A;  2Q4G W;  4QBZ A;  1Z7X W;  3GOZ A;  4LXS A;  5GMG A;  4Q3I A;  4I6J B;  4G8A A;  4U7L A;  4C2A B;  4PSJ A;  5B0T A;  3E2J A;  1A4Y A;  3E4G A;  2R9U A;  4FMZ A;  4LXR A;  5CMN A;  4CC4 C;  4Q3G A;  4R07 A;  1A9N A;  2OMX A;  3ZYJ A;  5IJC A;  2P1Q B;  1M10 B;  2Z7X A;  4LSA A;  2OMT A;  4ECN A;  3WPB A;  4B8C D;  3ULU A;  4H09 A;  5AWD A;  2Z82 A;  3RFJ A;  4LI1 A;  4ARR A;  2Z65 A;  1D0B A;  3C6N B;  5AWB A;  5IYX C;  4LSX A;  4V2D A;  3ZYO A;  4HQ1 A;  5HZL B;  5AWC A;  3G3A A;  4XOS A;  2Z66 A;  2ID5 A;  4FCG A;  4NKH A;  4Q62 A;  2ASS B;  4R5C A;  3ZYN A;  4FS7 A;  3WPG A;  2XOT A;  1XKU A;  3OGL B;  4AY9 X;  1FQV A;  2UZX A;  3G06 A;  3W3G A;  2WQU A;  4C2B B;  4Z94 G;  3UN9 A;  4Y61 B;  4CC4 A;  4BSS A;  2OMU A;  4CNC A;  4RCA B;  1O6S A;  3RW6 A;  2RA8 A;  1GWB A;  3W3N A;  4R6J A;  3WPF A;  2UZY A;  4PKI G;  3G3B A;  3RFS A;  3RW7 A;  1FT8 A;  2Z7X B;  4KNG A;  3REZ A;  4J0M A;  4R58 A;  5LFN A;  1W8A A;  4L3F A;  1FS2 A;  1OTO A;  3P72 A;  2ELL A;  2WQX A;  4K17 A;  1OGQ A;  4Z79 A;  5GMH A;  4KT1 A;  3JB9 j;  4AW4 A;  5B0N A;  5CMP A;  1M0Z A;  2WQV A;  3ULV A;  1OTM A;  1ZIW A;  1O6T A;  4KXF B;  1H6T A;  4V2C A;  1SQ0 B;  1G9U A;  1XWD C;  4PER A;  3E3Z A;  4R0A A;  1DCE A;  5AZ5 A;  3WPI A;  3ULA A;  4TZH A;  4R6F A;  5GMF A;  3CIY A;  2FT3 A;  3A79 B;  2V9S A;  5GS0 A;  2CA6 A;  2P1P B;  2Z62 A;  4R08 A;  1P9A G;  4GLP A;  4FDW A;  4P8S A;  3WPE A;  3WPC A;  4FD0 A;  2BEX A;  2JE1 A;  4EZG A;  4FHO A;  3CVR A;  3SB4 A;  3WN4 A;  3UL9 A;  1KOH A;  3BZ5 A;  2P1N B;  4WP6 A;  4Z61 C;  1M9S A;  3WPH A;  3RFE A;  3UL7 A;  3ZYI A;  1K5G C;  4RCW A;  2P1M B;  2Z64 A;  2JE0 A;  1OOK G;  4ECO A;  2OMY A;  4Z8G A;  4XGO A;  4U08 A;  3C6P B;  4CP6 A;  4LSX C;  5D3I A;  2O6Q A;  2Y5Q A;  4YEB B;  1DFJ I;  4QC0 A;  2AST B;  3RIZ A;  3W3L A;  1OZN A;  2OMV A;  2OMZ A;  1XEU A;  4MQW X;  3OJA B;  3TSR E;  3VQ2 A;  1KOO A;  3KJ4 A;  4MN8 B;  3DZE A;  2WFH A;  4PEQ B;  4M7E C;  1XCD A;  2BNH A;  4IM6 A;  4ARN A;  3W3M A;  4QXE A;  3M19 A;  2JQD A;  4GT6 A;  4BSR A;  2V9T B;  2WQW A;  1PGV A;  3OGK B;  4Z64 C;  3G39 A;  3E6J A;  3C6O B;  3OJA A;  5GQR K;  1QYY A;  3PMH G;  2Z63 A;  1IO0 A;  1DS9 A;  3W3J A;  3RJ0 A;  2A0Z A;  4LI2 A;  4P91 A;  4J4L A;  4R09 A;  3W3K A;  5GS2 B;  3O6N A;  4L3A A;  4R6A A;  3M18 A;  1WWL A;  4LSC A;  5AWA A;  3RGZ A;  1OTN A;  4NKG A;  1U0N D;  4XSQ A;  1M9L A;  2Z81 A;  4R5D A;  3UL8 A;  2XWT C;  5B4P A;  1YRG A;  2O6S A;  4CNM A;  1K5D C;  4R6G A;  3WPD A;  1LTX A;  2IFG A;  4M7E A;  3FXI A;  4BSU A;  1H6U A;  1FO1 A;  4BV4 R;  4U06 A;  5IJB A;  1XEC A;  3CIG A;  1P8V A;  4WYK A;  2O6R A;  5IJD A;  1O6V A;  3VQ1 A;  4U09 A;  1JL5 A;  5FTT B;  3OGM B;  4PQ8 A;  2P1O B;  2RR6 A;  1P8T A;  4CIL A;  3G04 C;  2OMW A;  3O53 A;  4UFR A;  4OQT A;  4V2E A;  4RWT C;  3RGX A;  5HDH A; 
#chains in the Genus database with same CATH topology
 2V70 A;  5A5C A;  2Q4G W;  4QBZ A;  1Z7X W;  3GOZ A;  4LXS A;  5GMG A;  4Q3I A;  4I6J B;  4G8A A;  4U7L A;  4C2A B;  4PSJ A;  5B0T A;  3E2J A;  1A4Y A;  3E4G A;  2R9U A;  4FMZ A;  4LXR A;  5CMN A;  4CC4 C;  4Q3G A;  4R07 A;  1A9N A;  2OMX A;  3ZYJ A;  5IJC A;  2P1Q B;  1M10 B;  2Z7X A;  4LSA A;  2OMT A;  4ECN A;  3WPB A;  4B8C D;  3ULU A;  4H09 A;  5AWD A;  2Z82 A;  3RFJ A;  4LI1 A;  4ARR A;  2Z65 A;  1D0B A;  3C6N B;  5AWB A;  5IYX C;  4LSX A;  4V2D A;  3ZYO A;  4HQ1 A;  5HZL B;  5AWC A;  3G3A A;  4XOS A;  2Z66 A;  2ID5 A;  4FCG A;  4NKH A;  4Q62 A;  2ASS B;  4R5C A;  3ZYN A;  4FS7 A;  3WPG A;  2XOT A;  1XKU A;  3OGL B;  4AY9 X;  1FQV A;  2UZX A;  3G06 A;  3W3G A;  2WQU A;  4C2B B;  4Z94 G;  3UN9 A;  4Y61 B;  4CC4 A;  4BSS A;  2OMU A;  4CNC A;  4NZR M;  4RCA B;  1O6S A;  3RW6 A;  2RA8 A;  1GWB A;  3W3N A;  4R6J A;  3WPF A;  2UZY A;  4PKI G;  3G3B A;  3RFS A;  3RW7 A;  1FT8 A;  2Z7X B;  4KNG A;  3REZ A;  4J0M A;  4R58 A;  5LFN A;  1W8A A;  4L3F A;  1FS2 A;  1OTO A;  3P72 A;  2ELL A;  2WQX A;  4K17 A;  1OGQ A;  4Z79 A;  5GMH A;  4KT1 A;  3JB9 j;  4AW4 A;  5B0N A;  5CMP A;  1M0Z A;  2WQV A;  3ULV A;  1OTM A;  1ZIW A;  1O6T A;  4KXF B;  1H6T A;  4V2C A;  1SQ0 B;  1G9U A;  1XWD C;  4PER A;  3E3Z A;  4R0A A;  1DCE A;  5AZ5 A;  3WPI A;  3ULA A;  4TZH A;  4R6F A;  5GMF A;  3CIY A;  2FT3 A;  3A79 B;  2V9S A;  5GS0 A;  2CA6 A;  2P1P B;  2Z62 A;  4R08 A;  1P9A G;  4GLP A;  4FDW A;  4P8S A;  3WPE A;  3WPC A;  4FD0 A;  2BEX A;  2JE1 A;  4EZG A;  4FHO A;  3CVR A;  3SB4 A;  3WN4 A;  3UL9 A;  1KOH A;  3BZ5 A;  2P1N B;  4WP6 A;  4Z61 C;  1M9S A;  3WPH A;  3RFE A;  3UL7 A;  3ZYI A;  1K5G C;  4RCW A;  2P1M B;  2Z64 A;  2JE0 A;  1OOK G;  4ECO A;  2OMY A;  4Z8G A;  4XGO A;  4U08 A;  3C6P B;  4CP6 A;  4LSX C;  5D3I A;  2O6Q A;  2Y5Q A;  4YEB B;  1DFJ I;  4QC0 A;  2AST B;  3RIZ A;  3W3L A;  1OZN A;  2OMV A;  2OMZ A;  1XEU A;  4MQW X;  3OJA B;  3TSR E;  3VQ2 A;  1KOO A;  3KJ4 A;  4MN8 B;  3DZE A;  2WFH A;  4PEQ B;  4M7E C;  1XCD A;  2BNH A;  4IM6 A;  4ARN A;  3W3M A;  4QXE A;  3M19 A;  2JQD A;  4GT6 A;  4BSR A;  2V9T B;  2WQW A;  1PGV A;  3OGK B;  4Z64 C;  3G39 A;  3E6J A;  3C6O B;  3OJA A;  5GQR K;  1QYY A;  3PMH G;  2Z63 A;  1IO0 A;  1DS9 A;  3W3J A;  3RJ0 A;  2A0Z A;  4LI2 A;  4P91 A;  4J4L A;  4R09 A;  3W3K A;  5GS2 B;  3O6N A;  4L3A A;  4NZT M;  4R6A A;  3M18 A;  1WWL A;  4LSC A;  5AWA A;  3RGZ A;  1OTN A;  4NKG A;  1U0N D;  4XSQ A;  1M9L A;  2Z81 A;  4R5D A;  3UL8 A;  2XWT C;  5B4P A;  1YRG A;  2O6S A;  4CNM A;  1K5D C;  4R6G A;  3WPD A;  1LTX A;  2IFG A;  4M7E A;  3FXI A;  4BSU A;  1H6U A;  1FO1 A;  4BV4 R;  4U06 A;  5IJB A;  1XEC A;  3CIG A;  1P8V A;  4WYK A;  2O6R A;  5IJD A;  1O6V A;  3VQ1 A;  4U09 A;  1JL5 A;  5FTT B;  3OGM B;  4PQ8 A;  2P1O B;  2RR6 A;  1P8T A;  4CIL A;  3G04 C;  2OMW A;  3O53 A;  4UFR A;  4OQT A;  4V2E A;  4RWT C;  3RGX A;  5HDH A; 
#chains in the Genus database with same CATH homology
 2V70 A;  5A5C A;  2Q4G W;  4QBZ A;  1Z7X W;  3GOZ A;  4LXS A;  5GMG A;  4Q3I A;  4I6J B;  4G8A A;  4U7L A;  4C2A B;  4PSJ A;  5B0T A;  3E2J A;  1A4Y A;  3E4G A;  2R9U A;  4FMZ A;  4LXR A;  5CMN A;  4CC4 C;  4Q3G A;  4R07 A;  1A9N A;  2OMX A;  3ZYJ A;  5IJC A;  2P1Q B;  1M10 B;  2Z7X A;  4LSA A;  2OMT A;  4ECN A;  3WPB A;  4B8C D;  3ULU A;  4H09 A;  5AWD A;  2Z82 A;  3RFJ A;  4LI1 A;  4ARR A;  2Z65 A;  1D0B A;  3C6N B;  5AWB A;  5IYX C;  4LSX A;  4V2D A;  3ZYO A;  4HQ1 A;  5HZL B;  5AWC A;  3G3A A;  4XOS A;  2Z66 A;  2ID5 A;  4FCG A;  4NKH A;  4Q62 A;  2ASS B;  4R5C A;  3ZYN A;  4FS7 A;  3WPG A;  2XOT A;  1XKU A;  3OGL B;  4AY9 X;  1FQV A;  2UZX A;  3G06 A;  3W3G A;  2WQU A;  4C2B B;  4Z94 G;  3UN9 A;  4Y61 B;  4CC4 A;  4BSS A;  2OMU A;  4CNC A;  4RCA B;  1O6S A;  3RW6 A;  2RA8 A;  1GWB A;  3W3N A;  4R6J A;  3WPF A;  2UZY A;  4PKI G;  3G3B A;  3RFS A;  3RW7 A;  1FT8 A;  2Z7X B;  4KNG A;  3REZ A;  4J0M A;  4R58 A;  5LFN A;  1W8A A;  4L3F A;  1FS2 A;  1OTO A;  3P72 A;  2ELL A;  2WQX A;  4K17 A;  1OGQ A;  4Z79 A;  5GMH A;  4KT1 A;  3JB9 j;  4AW4 A;  5B0N A;  5CMP A;  1M0Z A;  2WQV A;  3ULV A;  1OTM A;  1ZIW A;  1O6T A;  4KXF B;  1H6T A;  4V2C A;  1SQ0 B;  1G9U A;  1XWD C;  4PER A;  3E3Z A;  4R0A A;  1DCE A;  5AZ5 A;  3WPI A;  3ULA A;  4TZH A;  4R6F A;  5GMF A;  3CIY A;  2FT3 A;  3A79 B;  2V9S A;  5GS0 A;  2CA6 A;  2P1P B;  2Z62 A;  4R08 A;  1P9A G;  4GLP A;  4FDW A;  4P8S A;  3WPE A;  3WPC A;  4FD0 A;  2BEX A;  2JE1 A;  4EZG A;  4FHO A;  3CVR A;  3SB4 A;  3WN4 A;  3UL9 A;  1KOH A;  3BZ5 A;  2P1N B;  4WP6 A;  4Z61 C;  1M9S A;  3WPH A;  3RFE A;  3UL7 A;  3ZYI A;  1K5G C;  4RCW A;  2P1M B;  2Z64 A;  2JE0 A;  1OOK G;  4ECO A;  2OMY A;  4Z8G A;  4XGO A;  4U08 A;  3C6P B;  4CP6 A;  4LSX C;  5D3I A;  2O6Q A;  2Y5Q A;  4YEB B;  1DFJ I;  4QC0 A;  2AST B;  3RIZ A;  3W3L A;  1OZN A;  2OMV A;  2OMZ A;  1XEU A;  4MQW X;  3OJA B;  3TSR E;  3VQ2 A;  1KOO A;  3KJ4 A;  4MN8 B;  3DZE A;  2WFH A;  4PEQ B;  4M7E C;  1XCD A;  2BNH A;  4IM6 A;  4ARN A;  3W3M A;  4QXE A;  3M19 A;  2JQD A;  4GT6 A;  4BSR A;  2V9T B;  2WQW A;  1PGV A;  3OGK B;  4Z64 C;  3G39 A;  3E6J A;  3C6O B;  3OJA A;  5GQR K;  1QYY A;  3PMH G;  2Z63 A;  1IO0 A;  1DS9 A;  3W3J A;  3RJ0 A;  2A0Z A;  4LI2 A;  4P91 A;  4J4L A;  4R09 A;  3W3K A;  5GS2 B;  3O6N A;  4L3A A;  4R6A A;  3M18 A;  1WWL A;  4LSC A;  5AWA A;  3RGZ A;  1OTN A;  4NKG A;  1U0N D;  4XSQ A;  1M9L A;  2Z81 A;  4R5D A;  3UL8 A;  2XWT C;  5B4P A;  1YRG A;  2O6S A;  4CNM A;  1K5D C;  4R6G A;  3WPD A;  1LTX A;  2IFG A;  4M7E A;  3FXI A;  4BSU A;  1H6U A;  1FO1 A;  4BV4 R;  4U06 A;  5IJB A;  1XEC A;  3CIG A;  1P8V A;  4WYK A;  2O6R A;  5IJD A;  1O6V A;  3VQ1 A;  4U09 A;  1JL5 A;  5FTT B;  3OGM B;  4PQ8 A;  2P1O B;  2RR6 A;  1P8T A;  4CIL A;  3G04 C;  2OMW A;  3O53 A;  4UFR A;  4OQT A;  4V2E A;  4RWT C;  3RGX A;  5HDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...