1P94A

Nmr structure of parg symmetric dimer
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
b'MSLEKAHTSVKKMTFGENRDLERVVTAPVSSGKIKRVNVNFDEEKHTRFKAACARKGTSITDVVNQLVDNWLKENE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords plasmid partition protein ParG
publication title ParG, a protein required for active partition of bacterial plasmids, has a dimeric ribbon-helix-helix structure.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Cell cycle
total genus 16
structure length 76
sequence length 76
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09274 ParG ParG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 1p94A00
4D8JA 2BJ1A 2HZAA 1PARA 2BNZA 1BAZA 2BNWA 2WVDA 3FMTA 3LGHA 2CPGA 1ARQA 3VW4A 2BSQE 2K9IA 3OD2A 3VEBA 4FXEA 1NLAA 1EA4A 1X93A 2JXIA 3H87C 2BJ7A 1P94A 2CAJA 2K5JA 4HV0A 1ARRA 3QOQA 1IRQA 3VEAA 1B28A 2K1OA 2WVBA 2AY0A 2JXHA 2CA9A 2K6LA 2BJ8A 1MNTA 1U9PA 2BJ9A 1MYLA 3FT7A 1BDTA 1MYKA 2JXGA 2BA3A 2HZVA 2GPEA 2WVCA 2WVFA 1Q5VA 2KELA 2CAXA 1QTGA 2H1OE 1B01A 2RBFA 4ME7E 2K29A 1BDVA 2WVEA 2CADA 3GXQA 2BJ3A
chains in the Genus database with same CATH superfamily
3UR0A 4NRUA 2BNWA 3FMTA 3NAIA 2CPGA 3H5XA 3G5OA 4QPXA 3VEBA 4FXEA 1EA4A 3QIDA 2JXIA 2KKEA 4HV0A 1ARRA 1IRQA 2AY0A 3SFUA 1MNTA 1U9PA 1MYLA 1BDTA 2BA3A 2WK4A 1SH3A 2K29A 1BDVA 1SIWA 4LQ9A 3GXQA 3UPFA 4D8JA 2A2BA 2CKWA 3LGHA 2JBVA 3SFGA 3UQSA 2BSQE 2KOEA 2H3AA 1NLAA 2ADLA 2WVBA 4LQ3A 2BJ9A 2B43A 2HZVA 2WVCA 1Q5VA 1QTGA 1B01A 4ME7E 2WVEA 2JXGA 2CADA 1OG7A 2HZAA 1BAZA 3LJPA 2WVDA 3NAHA 1OHNA 1ARQA 3VW4A 2BJ7A 2K5JA 3QOQA 3VEAA 1B28A 2K1OA 2JXHA 2CA9A 1SH2A 2BJ8A 3FT7A 2Q2KA 2CAXA 2KELA 4O4RA 4AAIA 1SH0A 2BJ3A 2BNZA 3H5YA 2BJ1A 1PARA 3IR7A 3BSNA 2K9IA 3OD2A 4MJWA 3BSOA 4LRVA 1X93A 3H87C 2UUTA 3NNEA 1P94A 2CAJA 3NO7A 2K6LA 4NRTA 2UUWA 1MYKA 2GPEA 2H1OE 2AN7A 2WVFA 2RBFA 1Q16A
chains in the Genus database with same CATH topology
4D8JA 2BJ1A 2HZAA 1PARA 2BNZA 1BAZA 2BNWA 2WVDA 3FMTA 3LGHA 2CPGA 1ARQA 3VW4A 2BSQE 2K9IA 3OD2A 3VEBA 4FXEA 1NLAA 1EA4A 1X93A 2JXIA 3H87C 2BJ7A 1P94A 2CAJA 2K5JA 4HV0A 1ARRA 3QOQA 1IRQA 3VEAA 1B28A 2K1OA 2WVBA 2AY0A 2JXHA 2CA9A 2K6LA 2BJ8A 1MNTA 1U9PA 2BJ9A 1MYLA 3FT7A 1BDTA 1MYKA 2JXGA 2BA3A 2HZVA 2GPEA 2WVCA 2WVFA 1Q5VA 2KELA 2CAXA 1QTGA 2H1OE 1B01A 2RBFA 4ME7E 2K29A 1BDVA 2WVEA 2CADA 3GXQA 2BJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D8J A;  2BJ1 A;  2HZA A;  1PAR A;  2BNZ A;  1BAZ A;  2BNW A;  2WVD A;  3FMT A;  3LGH A;  2CPG A;  1ARQ A;  3VW4 A;  2BSQ E;  2K9I A;  3OD2 A;  3VEB A;  4FXE A;  1NLA A;  1EA4 A;  1X93 A;  2JXI A;  3H87 C;  2BJ7 A;  1P94 A;  2CAJ A;  2K5J A;  4HV0 A;  1ARR A;  3QOQ A;  1IRQ A;  3VEA A;  1B28 A;  2K1O A;  2WVB A;  2AY0 A;  2JXH A;  2CA9 A;  2K6L A;  2BJ8 A;  1MNT A;  1U9P A;  2BJ9 A;  1MYL A;  3FT7 A;  1BDT A;  1MYK A;  2JXG A;  2BA3 A;  2HZV A;  2GPE A;  2WVC A;  2WVF A;  1Q5V A;  2KEL A;  2CAX A;  1QTG A;  2H1O E;  1B01 A;  2RBF A;  4ME7 E;  2K29 A;  1BDV A;  2WVE A;  2CAD A;  3GXQ A;  2BJ3 A; 
#chains in the Genus database with same CATH topology
 3UR0 A;  4NRU A;  2BNW A;  3FMT A;  3NAI A;  2CPG A;  3H5X A;  3G5O A;  4QPX A;  3VEB A;  4FXE A;  1EA4 A;  3QID A;  2JXI A;  2KKE A;  4HV0 A;  1ARR A;  1IRQ A;  2AY0 A;  3SFU A;  1MNT A;  1U9P A;  1MYL A;  1BDT A;  2BA3 A;  2WK4 A;  1SH3 A;  2K29 A;  1BDV A;  1SIW A;  4LQ9 A;  3GXQ A;  3UPF A;  4D8J A;  2A2B A;  2CKW A;  3LGH A;  2JBV A;  3SFG A;  3UQS A;  2BSQ E;  2KOE A;  2H3A A;  1NLA A;  2ADL A;  2WVB A;  4LQ3 A;  2BJ9 A;  2B43 A;  2HZV A;  2WVC A;  1Q5V A;  1QTG A;  1B01 A;  4ME7 E;  2WVE A;  2JXG A;  2CAD A;  1OG7 A;  2HZA A;  1BAZ A;  3LJP A;  2WVD A;  3NAH A;  1OHN A;  1ARQ A;  3VW4 A;  2BJ7 A;  2K5J A;  3QOQ A;  3VEA A;  1B28 A;  2K1O A;  2JXH A;  2CA9 A;  1SH2 A;  2BJ8 A;  3FT7 A;  2Q2K A;  2CAX A;  2KEL A;  4O4R A;  4AAI A;  1SH0 A;  2BJ3 A;  2BNZ A;  3H5Y A;  2BJ1 A;  1PAR A;  3IR7 A;  3BSN A;  2K9I A;  3OD2 A;  4MJW A;  3BSO A;  4LRV A;  1X93 A;  3H87 C;  2UUT A;  3NNE A;  1P94 A;  2CAJ A;  3NO7 A;  2K6L A;  4NRT A;  2UUW A;  1MYK A;  2GPE A;  2H1O E;  2AN7 A;  2WVF A;  2RBF A;  1Q16 A; 
#chains in the Genus database with same CATH homology
 4D8J A;  2BJ1 A;  2HZA A;  1PAR A;  2BNZ A;  1BAZ A;  2BNW A;  2WVD A;  3FMT A;  3LGH A;  2CPG A;  1ARQ A;  3VW4 A;  2BSQ E;  2K9I A;  3OD2 A;  3VEB A;  4FXE A;  1NLA A;  1EA4 A;  1X93 A;  2JXI A;  3H87 C;  2BJ7 A;  1P94 A;  2CAJ A;  2K5J A;  4HV0 A;  1ARR A;  3QOQ A;  1IRQ A;  3VEA A;  1B28 A;  2K1O A;  2WVB A;  2AY0 A;  2JXH A;  2CA9 A;  2K6L A;  2BJ8 A;  1MNT A;  1U9P A;  2BJ9 A;  1MYL A;  3FT7 A;  1BDT A;  1MYK A;  2JXG A;  2BA3 A;  2HZV A;  2GPE A;  2WVC A;  2WVF A;  1Q5V A;  2KEL A;  2CAX A;  1QTG A;  2H1O E;  1B01 A;  2RBF A;  4ME7 E;  2K29 A;  1BDV A;  2WVE A;  2CAD A;  3GXQ A;  2BJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...