1P97A

Nmr structure of the c-terminal pas domain of hif2a
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
GAMDSKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endothelial PAS domain protein 1
publication title Structural basis for PAS domain heterodimerization in the basic helix-loop-helix-PAS transcription factor hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2003-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1p97A00
1OTBA 5AVEA 3IBRA 4LPZA 5F68A 3K3DA 2PD8A 2PR6A 3C2WA 4F3LA 4MN5A 4NXGA 4F3LB 1S1YA 5HWWA 5IS1A 4KUOA 4GHIB 1TS0A 5HZHA 3CWFA 3FG8A 2VEAA 4H6JB 3ICYA 5KIZA 2D01A 2J80A 2H28A 2M1CA 2P7JA 3EWKA 4EETB 1Y28A 4WL9A 5AVFA 1LL8A 3LIFA 4HJ6A 2VLGA 4YWZA 3NHQA 4XT2A 2WKPA 3NOPC 4RQ9A 3LICA 5HDSA 3HJIA 3MQOA 4WF0A 3LIEA 3IS2B 2V0UA 3PHYA 4L9EA 3CLOA 3PYPA 2ZOHA 4I3IA 1T1BA 4I5SA 5HDCA 2HV1A 4WN5A 1OJ5A 4EERA 1T1AA 2D02A 4HP4A 3E4PA 4EESA 2A24A 1UGUA 4HI4A 5HDDA 3H9WA 3LUQA 2Z6CA 2PHYA 1BYWA 5TBMB 3UE6A 5F69A 1TS8A 3F1OA 4R38A 4LRYC 4WUJA 4I38A 4DJ2A 1UWNX 1OTAA 2W27A 1GSWA 4EEPA 4HHDA 3UMEA 1LSXA 3CAXA 4HH3A 2QHKA 1V9ZA 2KDKA 4EQ1A 4WLAA 1ODVA 3RH8B 2Z6DA 3LI9A 3F1PA 4NXFA 3F1PB 3OLOA 5DJTA 3E4OA 4LLOB 3RTYA 3D72A 1N9OA 2VV7A 1XJ3A 4LRXC 5DKKA 2OOLA 1XJ4A 1T19A 2INWA 1S4SA 4M4XA 3HJKA 2JHEA 1D06A 4EW7A 2YKHA 4HJ4A 4JGPA 3LYXA 4K08A 4GW9A 1UWPX 3GECA 1S1ZA 2WKQA 1LSVA 3MJQA 4I3AA 1P97A 5J3WA 2ZBBA 1X0OA 5HWVA 4XT2B 5A8BA 2QJ5A 2L1MA 5G4YA 1F9IA 3A0SA 3NJAA 3LIBA 5IU1A 1VB6A 3E4QA 3UB7A 2CMNA 4HJ3A 3UB9A 2YKFA 2PR5A 2QWSA 1KOUA 1P0ZA 5HSQA 2A24B 3C8CA 3A0RA 5I5LA 3P7NA 2PYRA 3BWLA 3VOLA 3F1OB 5F5YA 1LSWA 3F1NA 3ULFA 2B02A 3F1NB 1T1CA 3VE4A 5J7EA 4GCZA 5EFWA 4NXBA 1F98A 3MXQA 1S66L 2PDRA 4HQAA 4JGRA 4BBUA 2V1BA 1MZUA 2R78A 4KQDA 3H7WA 4HIAA 4HH2A 4PKYA 1DP8A 2PYPA 3H7WB 2PD7A 3SW1A 4R6LA 3UB6A 4R70A 4B9OA 3FC7A 1S4RA 4I39A 4JGQA 4L9GA 5J4EA 2VV6A 1DP6A 4HY8A 4DJ3A 1LT0A 3LIDA 4BBVA 1N9NA 1GSVA 1JNUA 2OWJA 4KUKA 1T18A 3H82A 1G28A 3H82B 3G6OA 3UB8A 4LRZE 1XJ2A 2L4RA 2ZOIA 2QKPA 4HNBA 4GHIA 4EXOA 2I9VA 4JGOA 1GSXA 2EA9A 4H6JA 1XJ6A 3MQQA 1TS7A 3A0VA 1OT9A 3GDIA 4EEUA 2JN7A 4MN6A 1DRMA 1OT6A 1S67L 4PKYG 2V0WA 2GJ3A 5DJUA 1OTDA 2V1AA 1D7EA 5G4ZA 4HP9A 3LIAA 3LI8A 5HWTA 1N9LA 2L0WA 3B33A 4E04A 3NOUC 3IS2A 3MR0A 1OTIA 4L9FA 1V9YA 3T50A 3BY9A 4I3JA 1XFQA 1XFNA 3BY8A 5HD3A 2K7SA 5DKLA 2QJ7A 5HD5A 1EW0A 3EEHA 4GS9A 4R3AA 2WKRA 2OWHA 3KX0X 4GS9B 3ZQ5A 3MFXA 5TBMA 5F6AA 4BBTA 3NOTC 2W0NA 2KX6A 2VV8A 2V9AA 3VE3A 1NWZA 1TS6A 1WA9A 4NXEA 2BASA 3K3CA 1OJGA 4HOIA 1DP9A 1OTEA 3UMDA
chains in the Genus database with same CATH superfamily
4DE3A 5F68A 3R7WA 4KENB 2LB5A 1GHMA 4FTXA 4N92A 4F3LA 2VGJA 4KUOA 2O9CA 5L10A 4UA9A 5FATA 4OKPA 2VGLS 1W7FA 3IF6B 4OH0A 5FDHA 1H8MA 4N9LA 2PAVP 1NYMA 5G18A 1CEFA 2M1CA 2P7JA 4B88A 4KZ3A 1FR6A 4ETZA 3B42A 4WL9A 3UB5P 2W1TA 2V1ZA 5TGFA 1GA0A 4HJ6A 2VLGA 2C6WB 4BD1A 3NHQA 4Y13A 3LICA 2G7UA 4XUZA 3ZG8B 1ZC2A 4WF0A 3QP6A 2W3HA 3IS2B 5K5BA 3OOVA 3MFDA 1E4DA 3ZNTA 1VETA 2ZMVA 4ZJ3A 1VQQA 2DMWA 2Q9MA 4KQQA 4OPYA 4LFUA 5FI7A 1BZAA 1TD5A 2ZM8A 4E3OA 4X56A 2RCXA 4CJNA 2A24A 2XK1A 1UGUA 5D3OA 5HPFA 4WBGA 3R4KA 2Y79A 4BL2A 3LUQA 2Z6CA 4UEYA 3CJMA 3LFVA 2JKRI 4ZDXA 1PWGA 1L3LA 5DTSA 4GJ4A 4MMNA 3ZDJA 2ZQ7A 4WZ5C 1K56A 4HHDA 4OQGA 2MJ6A 3FV7A 4MDZA 4R1GA 1ODVA 1TDLA 2HDUA 3O87A 3RH8B 1NRJA 3F1PA 2PT7A 2ZLYA 2EX8A 5L07A 4OPQA 1CI9A 5EVIC 2DRWA 2Y91A 3S7OA 4JXGA 1N9OA 4PM5A 3A3EA 1JVJA 2I72A 1IEMA 2JKTM 5JYOA 1SDNA 2INWA 1S4SA 5F1GA 3WWXA 1L0DA 3LCEA 4M4XA 2XEPA 2YKHA 4HJ4A 4ARZA 3LYXA 4K08A 1BUEA 4S2NA 4GW9A 5F82A 3G30A 4HEFA 1S1ZA 1PI4A 4FOFA 3SH9A 5AQ9A 2Q9NA 2ZM2A 5FI2A 3FZCA 1IYQA 4OOLA 1P97A 3V5MA 1KGFA 3I7JA 1X0OA 5HWVA 5FEGA 4DMZA 3A0SA 2EFXA 5CTMA 3LIBA 1K55C 4KZ5A 4CLCA 1YSPA 2ZC6B 4LV2A 1E3UA 1PZOA 3E4QA 2CMNA 3SS3A 4Y2FA 3W4OA 1IELA 1BLPA 2QWSA 2FFFB 1KOUA 3BFGA 2VK3A 3LEQA 1FSWA 5HSQA 4ZBEA 3N8SA 3HLEA 3L7HA 5EVID 3A0RA 4PM7A 3ITBA 2WKIA 3VOYA 4Y17A 3C7UA 3BWLA 3F1OB 3MXRA 3U2AA 3ULFA 4BMWA 4DDSA 2Y2OA 2B02A 5FEFA 4OLDA 1ES5A 4N1HA 3C38A 4OPRA 4X6TA 5DF9A 3RFBA 3VOZA 4WYYA 3UE3A 3MF0A 3GSGA 3BRMA 4BBUA 3MZEA 1VEUB 4KZ4A 4PAUA 4KQDA 4DN0A 5HPIA 2PYPA 3M6HA 2PD7A 2QPNA 3UB6A 3IXHA 2E8JA 2IA2A 1A0KA 2WZXA 3KO6A 2XRNA 3SZTA 4Y7PA 2V8CA 4JKTA 4PMAA 1LT0A 4HBTA 2O0YA 3LIDA 2UWXA 1N9NA 1GSVA 1Z09A 1JNUA 1T18A 5E2EA 4GB7A 4O8GA 1YMXA 2Y4AA 4LRZE 4NEED 1MWRA 4KG5A 4U0XA 1MXOA 4S2PA 2L4RA 3T12B 3S7QA 4EXOA 3AGEA 4JGOA 3PXPA 3IF6A 3NDEA 3D4FA 1AXBA 3EGXC 5FSRA 1TS7A 4GOGA 3A0VA 2EFUA 2P04A 1OT9A 2ZC5B 1CJFA 2WKEA 3DTEA 4QB8A 3NY4A 5CERA 1SKFA 2V20A 1CF0A 3E2KA 5CHMA 4WELA 1K38A 1PFLA 4PKYG 2HDRA 1OTDA 1D7EA 1NY0A 3LIAA 3FYZA 2GZAA 3SH7A 3IS2A 2H10A 4L9FA 2Y2PA 4UQIS 3T50A 2FFYA 4X53A 5GL9A 2B5RA 1NRFA 3BY9A 1YLYA 1W8YA 2B18A 3MSHA 2HPBA 3EEAA 1F2KA 4O7DA 2Y8HA 1ES4A 3MXSA 3S7PA 3BW6A 4MCWA 3MZDA 1SCWA 3S22A 1W79A 5CRFA 4PM9A 1GHIA 1YMSA 3QP2A 4C75A 5F6AA 1CI8A 3NCKA 3LR4A 2W0NA 4MBFA 5M1AA 4NG2A 5CHJA 3OCLA 2BG1A 1W8QA 4NXEA 2HZ5A 4KZ8A 5DFYA 1FCOA 3LR3A 2ZL1B 4P85A 4QJGA 1OJGA 3P01A 3VP4A 1J9MA 4S2LA 3HLFA 1KE3A 3N6IA 3IBRA 4P87A 4LPZA 3C4PA 1I2WA 3VP1A 3ZNYA 3T4LA 1TF1A 3UO9A 2PR6A 4MN5A 4LV0A 1ZKJA 4PM6A 4IJGA 5IS1A 1ESIA 1TS0A 3A3JA 5HZHA 1NLYA 3FG8A 3WS2A 4H6JB 5CEBA 1MPLA 2D01A 3IWQA 4KZAA 5EECA 4WM9A 4QD4A 4GD6A 4YNRA 3WS4A 4IEDA 3G32A 5I94A 2JKTI 5TFQA 1Y28A 4EU0A 5EVLA 4Q0HA 1LL8A 5EM1A 5EVEA 2WGVA 4OOYA 3QP4A 2WKPA 1FR1A 3NOPC 1HVBA 4U0TA 5FQIA 4RQ9A 2X01A 5HDSA 4R4SA 1PIOA 3BFDA 3M2JA 3LIEA 2V0UA 3PHYA 5E2FA 3C30A 4L9EA 1XXMA 3CLOA 3GR2A 2QYBA 3RJUA 1JWPA 1SHVA 1S6RA 4G3WA 1PW8A 4I5SA 1LHYA 3T1SA 4WN5A 1XGJA 4EERA 1T1AA 4HP4A 4WMCD 2JKGA 1FIKA 5CX7A 3E4PA 3CITA 3ZVWA 4HI4A 1MC0A 4K0XA 3C5AA 3LY4A 3JPUA 4FD8A 2VGKA 3H9WA 1LL5A 2QMIA 2PHYA 2H5SA 5TBMB 3ZG7B 3UE6A 5F69A 3DW0A 1TS8A 3F1OA 2Y59A 4I38A 1UWNX 3K2NA 3JYIA 3NDGA 2ZM0A 3N8RA 1K6SA 3BJNA 5BOHA 3UDXA 3CAXA 4HH3A 2QHKA 1VEUA 4R3BA 4EQ1A 3EQUA 1G68A 1KGEA 4WLAA 1SDEA 4ME4A 4NXFA 4BENA 1MKIA 1ZTUA 4LCLA 3OLOA 3MKFA 1N4OA 4BWIA 3M2KA 1H8YA 5CTNA 2P74A 4QWOA 3HLCA 4PPRA 4NK3A 4D60A 2VV7A 1GHPA 1XJ3A 4OQIA 1DY6A 1W63M 3SS5A 5F1FA 5HFOA 1XJ4A 1SKOB 2EXBA 3HVFA 2HJ9C 3BLMA 2ZQAA 2JHEA 5CECA 2ZD8A 3HUNA 4GLQA 4OPZA 3IX3A 4RYEA 1KE0A 4Q0JA 5FA7A 3PAEA 4OP8A 5EE8A 3HUOA 2J7VA 1FILA 2EWVA 5J3WA 4S2KA 4EUZA 4K91A 3T1RA 1H3QA 1Q2QA 2W3DA 3Q7ZA 3NJAA 1K54A 4LV3A 1ZG4A 4FH2A 3EGDC 1VB6A 2KOIA 4X68A 5IU1A 3UB9A 4GDBA 2YKFA 4XXRA 1ESUA 3A3IA 2H0TA 5DTKA 1XGIA 1RGZA 3KYEA 4QY5A 3S7NA 3Q81A 3Q7VB 1YKDA 3C8CA 1FOFA 3G2ZA 3P7NA 5GHYA 1TDGA 2PU2A 4JF6A 2Y55A 3VFHA 3VOLA 3W4PA 3DWKA 1LSWA 5F5YA 2ZMAA 1GA9A 3BM6A 3F1NB 4QY6A 1F98A 4MNRA 4O01A 2XA7S 5FASA 4HQAA 4JGRA 3GV9A 2V1BA 2XQZA 1MZUA 4OP5A 2J3TC 3H7WA 4HIAA 3SW1A 2Y2MA 1XKZA 2JC7A 3NC8A 4E3JA 3M6BA 1KE4A 2WZZA 4R70A 3GRJA 1S4RA 4L9GA 4E3NA 3HLDA 5KZHA 4HY8A 4DJ3A 3NIAA 3ZG9B 4DKIA 2OAP1 5E43A 3BQ8A 1K0KA 5A90A 4KUKA 5HAPA 1BLSA 5IT5A 3H82B 4IBRA 4BJPA 4RX3A 3G6OA 1Y4OA 1MBLA 2OV5A 3OCNA 5E2GA 4MLLA 1QMFA 1C3BA 2ZQ8A 3JVVA 3CI6A 4H6JA 3HLWA 4Y0TA 3E2LA 4KZ7A 3PBQA 3VFFA 4MN6A 1F5MA 3DTKA 3MKEA 4JLFA 4PM8A 2HGVA 3LY3A 2IWCA 3QNBA 1K54C 1FCMA 2GJ3A 5DJUA 1BT5A 1DJAA 2XH9A 4KZ9A 4HP9A 2J9PA 2J3TD 1AWIA 1RCJA 2P08A 1N9LA 2L0WA 4E04A 4DE2A 3MZFA 1WYCA 5CGSA 1K6RA 4I3JA 3PTEA 3G31A 3BY8A 5HD3A 1RP5A 1L2SA 1O07A 1FSYA 3TE8A 1PYYA 4IBXA 3EEHA 2WKRA 1Q2PA 2OWHA 2W1RA 4GS9B 3N7WA 3VP2A 2G2WA 5TBMA 2ZC3B 2Y2KA 4BBTA 3PR6A 2HDSA 5CXWA 2Y2GA 2XFTA 2VV8A 3BFCA 4IUKA 1NWZA 1TS6A 1WA9A 2FZ0A 5AQAA 1W63Q 3QP1A 2BASA 3CPTB 1JTGA 3K3CA 1FQGA 4JPMA 2Z2LB 5M18A 1L0EA 3KSGA 1PNEA 2OLUA 2P9VB 5FQ9A 1DP9A 1KDWA 4P6BA 4RVAA 1IYOA 5MC7A 2ZC4B 5AVEA 4X25A 4ZJ1A 1L0FA 5EVIB 2W3GA 4OQHA 3K3DA 3R7WB 4M3KA 1NZOA 3C2WA 1Z6FA 5KMWA 3O86A 4NXGA 4UA7A 4F3LB 4LCMA 1S1YA 2EX6A 3L9KA 4S2NC 3IH9A 5M19A 1CQAA 3HLBA 1XA1A 2PU4A 2H0YA 4P6ZM 5AJGA 2J9OA 4Y0OA 5KIZA 2W3EA 1HTZA 1KVLA 3T4QA 5DF8A 1VM1A 3S4XA 1IKIA 1KVMA 4C3QA 4FUWA 3LO7A 4FH4A 2WUQA 1H5XA 2ACGA 1MWSA 5AVFA 1LLBA 4K0WA 1K56D 4CLCC 4YWZA 1S0WA 4BL3A 1XP4A 3MQOA 2B95A 2Y2IA 5EUAA 2LB9A 4E3LA 2R9WA 2R9XA 2UV0E 3T4JA 3B3XA 4KG6A 3ITAA 3U4LP 1RGYA 5FQJA 2EWWA 3HL9A 2WAEA 3VP3A 1YAXA 3PBTA 3Q7VA 4EV4A 1XA7A 4IUHA 4WEJA 1IOUA 3W4QA 1BYWA 4PHTA 5AQ7A 4LRYC 4WUJA 2W3FA 4DJ2A 3QP8A 1XX2A 2OAQ1 1K57A 2KLIA 4DE0A 1GSWA 5FAPA 4DRTA 4GD8A 3B47A 3MQ0A 3UMEA 1STZA 1LSXA 1ERMA 1WYBA 3KYZA 3WS0A 2KDKA 5HL1A 3TJZC 3UY6A 3WRZA 2O9BA 4R4RA 3V3RA 3LI9A 4CLCD 1YQSA 3BQAA 1E3UD 3F1PB 5DJTA 1BSGA 5A92A 3E4OA 4LLOB 3RTYA 3D72A 4LV1A 3CUEA 5DKKA 5FI6A 5JYPA 4N9KA 2HJEA 1PI5A 3VSKA 3IF6C 2O9AA 2EX2A 1D06A 5AQBA 4EW7A 1YLZA 2Y2QA 3FPWA 4JGPA 4ARZB 1UWPX 1YT4A 3BYDA 2WKQA 4KQRA 4ID4A 1LSVA 3DAVA 3D3OA 3MJQA 1MWTA 1OPXA 5F83A 4X69A 2XLNA 4II7A 4EBPA 1PW1A 5L09A 4XT2B 3E0YA 4Y5FA 2QJ5A 2L1MA 5G4YA 1F9IA 3VMAA 4CQHA 4MEZA 3UPOA 4E3KA 3TRCA 4B93A 2RL3A 1XPBA 2Y2JA 4HJ3A 3G2YA 3ZG0A 3SS4A 2VA0A 4WZ4A 3MMHA 3W2ZA 3OPHA 4NETA 4MBHA 3ZFZA 3GMWA 3ZYTA 3BLSA 1N9BA 1M40A 3NI9A 2JE5A 4EWFA 5I5LA 5KSHA 2PYRA 3OZHA 5CEDA 1I5QA 1T1CA 3VE4A 5J7EA 5GLCA 3Q82A 5EFWA 4NXBA 4MN7A 1I2SA 1PWCA 3MXQA 4DXCA 1S66L 5FQMA 1HD8A 2A49A 3P09A 1LI0A 2XD1A 4PKYA 1IYSA 3JVUA 1ONHA 2AVXA 4WZ5A 4YOFA 2HP9A 1CK3A 3CPTA 1BTLA 3PBSA 3SH8A 3KSIA 4UAAA 5J4EA 4GNUA 2VV6A 3MBZA 2P9VA 4BBVA 5HL6A 4E6WA 3ZHHA 3O88A 5TR7A 5EVIA 3HUMA 3UB8A 3IXGA 2WADA 2XROA 1XJ2A 3T1QB 1BLCA 2ZOIA 3QNCA 3Q1FA 1IKGA 2QKPA 2ZC7A 5L8MA 1TEMA 1L0GA 2V8FA 4Y3IA 4UHUA 2I9VA 4YFMA 1YLPA 5HAQA 1GSXA 5FQQA 2EA9A 1XJ6A 3IQAA 3MQQA 2C5WB 4GDNA 3N4IA 4OVDA 3GDIA 2JN7A 1DRMA 1OMEA 5DF7A 2WAFA 5J8XA 4X1MA 1S67L 3OPRA 3LR0A 1E25A 2V0WA 1U60A 4Q0IA 1G5UA 5HARA 5TJJA 2J3WA 3V67A 2HP5A 2V1AA 3D9YA 4E3IA 3OPLA 2VZWA 1K25A 5C5KA 2XSSA 3B33A 3NOUC 5DFXA 1K55A 3MR0A 3N8LA 1H0MA 4QU3A 2K31A 1V9YA 5FAQA 3TW8A 3G4PA 1XFNA 1MWUA 2X02A 3UN7A 3W8KA 3UPPA 2K7SA 5DKLA 4N1XA 1HZOA 2QJ7A 4S2MA 5HD5A 3Q07A 3RXWA 2M7UA 1KDSA 1FCNA 1NJ4A 4DF6A 1G6OA 2A2LA 2WGWB 2OLVA 4O0PA 1D1JA 4R3AA 2GDNA 3KX0X 5HAIA 3PAGA 3MFXA 4GKUA 2VX8A 2EXAA 3C4OA 2NUPC 2DNSA 2G2UA 2XFSA 2KX6A 3V50A 4CPKA 3IH8A 3VE3A 1PZPA 1YSQA 4ZTKA 3BECA 1ACFA 4X55A 4JXWA 3LGOA 1JTDA 2ZL1A 2PBDP 3HREA 3IX8A 3UNWA 1MY8A 4HOIA 4DXBA 5FDSA 1OTBA 3LR5A 3ISGA 1ALQA 4KG2A 2PD8A 1IYPA 2GNXA 2VGLM 4QPRA 3FPVA 2Q0OA 3UDFA 1QMEA 2BLSA 5HWWA 3HBRA 4HESA 4Y15A 4GHIB 5U47A 3CWFA 2QZ6A 2VEAA 2VKSA 3ICYA 3A3FA 2J80A 2WK0A 2WGIA 4YINA 3CG5A 3SOIA 2XF3A 3NBLA 2H28A 3PBOA 3EWKA 4P6ZS 4BLMA 1NXYA 2K2NA 4EETB 3UE0A 4IVIA 3IF5A 3LIFA 2FH5A 3KSHA 5E2HA 4XT2A 2PRFA 4S2IA 3IBJA 4HBUA 3HJIA 3QHYA 1TVFA 4CLCE 3IHBA 4BD0A 4OOMA 2WKHA 2HF6A 3PYPA 2ZOHA 4KZBA 4I3IA 1T1BA 5HDCA 3OPPA 2HV1A 1OJ5A 2D02A 1G6AA 1MKMA 4JBFA 4EESA 4E3MA 4R23A 5HDDA 3ZGAB 4KQOA 4R38A 4LGWA 2XA7M 1ES2A 1HLUP 1SZVA 3EQVA 3T4KA 1YLTA 4GN2A 3OC2A 1PWDA 1OTAA 3T4SA 3GQZA 3GVBA 3TG9A 3VSLA 2W27A 4EEPA 3ZCZA 2HDQA 1V9ZA 5LBRA 5IHVA 4XUXA 3KYQA 4S2JA 1YPRA 5EV0A 4MBKA 2Z6DA 4FSFA 3EOIA 5GHXA 4RX2A 2Y2LA 4C6YA 3CMZA 1CEGA 5KSCA 4LRXC 4ESPA 3IWOA 2XD5A 3IXDA 2OOLA 1SKOA 1T19A 5HX9A 4UA6A 1W5DA 4WMCA 4DE1A 4OONA 2GX5A 4L0LA 5GLBA 2X71A 3HJKA 2Y2HA 4P0MA 2JCHA 1ZHHB 3WRTA 4QHCA 5CGWA 1JWVA 4BQMA 3GECA 5EPHA 3TOIA 5GLAA 1BLHA 3VP0A 4EBNA 1LI9A 3T4TA 4GZBA 1NYYA 4I3AA 1ZG6A 3NECA 4ZRRA 2W1TB 3MS6A 2ZBBA 1YLJA 4R3JA 3IT9A 3IX4A 5A8BA 4JXSA 1EROA 2BTFP 1GCEA 4ZAMA 2VJWA 1P9WA 3T4OA 4DDYA 3LEZA 4OQ0A 2XDMA 4R0QA 3E98A 3UB7A 3ZVTA 1VHMA 5GLDA 1JWZA 3BFEA 2PR5A 2JKRM 1ERQA 1VETB 4ETXA 4OLGA 3G34A 3IXBA 1P0ZA 4FCFA 2ZMFA 2O99A 3AGFA 2A24B 4D2OA 2E8IA 4A5RA 4NKPA 1YM1A 5A91A 3V3SA 4G3KA 2WGWA 3F1NA 4F94A 4JF5A 3PBRA 4Z9QA 4GCZA 5CGXA 5DTTA 2J8YA 3BFFA 3ZG5A 4Z1WA 4E6XA 2PDRA 1Y54A 3S1YA 4U3TA 2IWBA 2R78A 4HH2A 1DP8A 3H7WB 5HW3A 4R6LA 3P98A 2PBYA 3RXXA 1EWZA 4B9OA 3FC7A 4I39A 4JGQA 4KZ6A 5FQKA 3A3DA 1DP6A 3TSGA 1K4FA 1LL9A 3PBNA 5GHZA 2OWJA 2NUTC 3H82A 1G28A 2XR0A 1DJCA 3GTCA 4Q8IA 4RA7A 1PRQA 3HCYA 4HNBA 3AGDA 5L2FA 3O5YA 2JKFA 4GHIA 3UE1A 1NZUA 3DTIA 4EUVA 5CHUA 3WS5A 2WYXA 2V2FF 2ZQ9A 1WE4A 5DVAA 4S2OA 4JF4A 5FL3A 4B4ZA 2EX9A 2ZQCA 4EEUA 2ZJ9A 1OT6A 3DWZA 3VV4A 3DTMA 2CC1A 4LENA 4CLCB 4AFIA 3FKWA 4UQIM 5G4ZA 3KSFA 5EM0A 4B4XA 1BULA 3LI8A 5HWTA 2Y2NA 1H8ZA 1OTIA 3O3VA 3QP5A 4IVKA 3FWLA 2JBFA 2Z2MB 3CZDA 1XFQA 1NLZA 5A93A 1M6KA 2HP6A 1K4EA 1DJBA 3FKVA 3UDIA 5FAOA 4G3VA 1EW0A 1ONGA 4X1LA 3C7VA 4GS9A 4ZJ2A 3ZQ5A 1P9RA 2A3UA 3DBAA 1YLWA 4EBLA 2OSUA 3IWIA 3T1XA 3G35A 1K57C 5EOEA 3IHAA 3UPNA 2XGNA 3NOTC 1ES3A 3WS1A 1IFQA 1KGGA 1J3WA 3HLGA 2V9AA 4Y0UA 2ZQDA 4WEKA 4H8RA 2M7VA 4EQIA 1EI5A 4IHQA 3NULA 2DCFA 2IWDA 3CHWP 3BEBA 4JXVA 3CUEC 3OBFA 1O7EA 5EOOA 1OTEA 3UMDA 3V39A
chains in the Genus database with same CATH topology
1OTBA 5MC7A 5AVEA 3IBRA 3LR5A 4LPZA 5F68A 3R7WA 2W3GA 3T4LA 3K3DA 2LB5A 2PD8A 3R7WB 1TF1A 2GNXA 2VGLM 4QPRA 2PR6A 3FPVA 3C2WA 4F3LA 4MN5A 4NXGA 4F3LB 1S1YA 4IJGA 5HWWA 5IS1A 4KUOA 2O9CA 4GHIB 1TS0A 2VGLS 5HZHA 1NLYA 3CWFA 3FG8A 2VEAA 4H6JB 4P6ZM 5AJGA 2VKSA 1H8MA 3ICYA 5KIZA 2D01A 2W3EA 2J80A 3T4QA 2H28A 3PBOA 4YNRA 2M1CA 2P7JA 3EWKA 4P6ZS 2K2NA 4EETB 4ETZA 2JKTI 3B42A 1Y28A 4WL9A 2W1TA 4EU0A 4Q0HA 5AVFA 1LL8A 3LIFA 4HJ6A 2FH5A 2VLGA 3KSHA 4CLCC 4YWZA 3NHQA 4XT2A 2WKPA 3NOPC 3IBJA 3LICA 4RQ9A 5HDSA 3HJIA 2G7UA 3MQOA 4WF0A 3LIEA 2W3HA 2LB9A 4CLCE 3IS2B 2V0UA 3PHYA 3T4JA 5K5BA 3C30A 4L9EA 4OOMA 3OOVA 3CLOA 2HF6A 2QYBA 3PYPA 2ZOHA 4I3IA 1T1BA 4G3WA 2ZMVA 4I5SA 2EWWA 5HDCA 2HV1A 2DMWA 4WN5A 1OJ5A 4EERA 1T1AA 1TD5A 2D02A 4HP4A 1MKMA 1YAXA 3PBTA 5CX7A 3E4PA 3CITA 4EESA 2A24A 1UGUA 4HI4A 1MC0A 4IUHA 4WEJA 1IOUA 5HPFA 3R4KA 2Y79A 5HDDA 3H9WA 3LUQA 4KQOA 2Z6CA 2PHYA 1BYWA 4UEYA 5TBMB 3UE6A 3LFVA 2JKRI 4PHTA 5F69A 1TS8A 3F1OA 4LRYC 4R38A 2XA7M 4WUJA 2W3FA 4I38A 3EQVA 3T4KA 4DJ2A 4GJ4A 1UWNX 3OC2A 3K2NA 4MMNA 1OTAA 3T4SA 2OAQ1 2W27A 2KLIA 1GSWA 3B47A 3MQ0A 4EEPA 3BJNA 4HHDA 3UMEA 1STZA 1LSXA 3CAXA 4HH3A 2QHKA 3KYZA 1V9ZA 5LBRA 2KDKA 4EQ1A 3EQUA 3TJZC 2MJ6A 3KYQA 4MDZA 4WLAA 2O9BA 1ODVA 3RH8B 4ME4A 1NRJA 2Z6DA 4FSFA 3LI9A 3F1PA 4NXFA 4CLCD 2PT7A 1ZTUA 3BQAA 3EOIA 3F1PB 3OLOA 5DJTA 4BWIA 3E4OA 4LLOB 3S7OA 3RTYA 3D72A 1N9OA 2VV7A 1XJ3A 3CUEA 4LRXC 5DKKA 1W63M 2OOLA 1XJ4A 2HJEA 1T19A 2JKTM 2HJ9C 2INWA 2GX5A 1S4SA 4L0LA 2O9AA 4M4XA 3HJKA 2JHEA 1D06A 4EW7A 2YKHA 4HJ4A 4ARZA 3FPWA 4JGPA 1ZHHB 3LYXA 4K08A 4GW9A 1UWPX 4ARZB 4GLQA 3GECA 1S1ZA 2WKQA 4FOFA 3T4TA 1LSVA 3D3OA 4Q0JA 3MJQA 4I3AA 1OPXA 4ZRRA 2W1TB 4OOLA 1P97A 4II7A 2EWVA 5J3WA 2ZBBA 1X0OA 5HWVA 4XT2B 3E0YA 1H3QA 4Y5FA 2QJ5A 5A8BA 2W3DA 2L1MA 5G4YA 4DMZA 1F9IA 3A0SA 4CQHA 3NJAA 2VJWA 1P9WA 3LIBA 3T4OA 3TRCA 4B93A 4CLCA 1YSPA 1VB6A 2KOIA 3EGDC 3E4QA 5IU1A 3E98A 3UB7A 2CMNA 4HJ3A 3UB9A 4Y2FA 2YKFA 1VHMA 2PR5A 2VA0A 2JKRM 3MMHA 3W2ZA 4ETXA 2QWSA 1KOUA 1P0ZA 2ZMFA 5HSQA 2O99A 3S7NA 3ZYTA 1YKDA 2A24B 3A0RA 3C8CA 5I5LA 5KSHA 3P7NA 2PYRA 4NKPA 3BWLA 3VOLA 3F1OB 4G3KA 5F5YA 1LSWA 3U2AA 3F1NA 3ULFA 4BMWA 2B02A 3F1NB 3PBRA 1T1CA 3VE4A 5J7EA 4GCZA 3C38A 5EFWA 4NXBA 1F98A 5DF9A 3RFBA 4MN7A 4O01A 2XA7S 3MXQA 4Z1WA 1S66L 3UE3A 2PDRA 4HQAA 3MF0A 4JGRA 4BBUA 2V1BA 1MZUA 2R78A 2J3TC 4KQDA 4PAUA 3H7WA 4HIAA 4HH2A 4PKYA 4DN0A 1DP8A 5HPIA 2PYPA 3JVUA 3H7WB 2PD7A 3SW1A 4R6LA 4YOFA 3UB6A 4R70A 4B9OA 2IA2A 1S4RA 3FC7A 4I39A 3PBSA 4JGQA 4L9GA 3KO6A 3KSIA 2XRNA 5J4EA 2VV6A 1DP6A 4HY8A 4DJ3A 1LT0A 2OAP1 2O0YA 3LIDA 3PBNA 4BBVA 1N9NA 3BQ8A 1GSVA 5HL6A 1JNUA 2OWJA 4KUKA 2NUTC 5IT5A 1T18A 3H82A 1G28A 3H82B 4BJPA 4O8GA 3G6OA 3UB8A 4LRZE 2XROA 4NEED 1XJ2A 3OCNA 2L4RA 2ZOIA 2QKPA 3HCYA 4HNBA 3S7QA 5L8MA 4Y3IA 3O5YA 4GHIA 4EUVA 4EXOA 2I9VA 4JGOA 1GSXA 3PXPA 3JVVA 3CI6A 2EA9A 4H6JA 3EGXC 1XJ6A 3MQQA 1TS7A 3A0VA 5FL3A 2P04A 1OT9A 3GDIA 4EEUA 2JN7A 3PBQA 4MN6A 1DRMA 1F5MA 1OT6A 3VV4A 4WELA 2HGVA 1S67L 3LR0A 4PKYG 2V0WA 5TJJA 4Q0IA 2GJ3A 5DJUA 4CLCB 1OTDA 2J3WA 3V67A 4AFIA 4UQIM 2V1AA 1D7EA 5G4ZA 3KSFA 4HP9A 3LIAA 2VZWA 2J3TD 3LI8A 5HWTA 5C5KA 2P08A 2GZAA 1N9LA 2L0WA 2XSSA 3B33A 4E04A 3NOUC 3IS2A 5DFXA 3MR0A 1OTIA 4L9FA 4UQIS 2K31A 1V9YA 3T50A 3TW8A 3BY9A 2B18A 4I3JA 1XFQA 1NLZA 1XFNA 3EEAA 3BY8A 5HD3A 2Y8HA 2K7SA 5DKLA 2QJ7A 3S7PA 5HD5A 3BW6A 4G3VA 1EW0A 4MCWA 2M7UA 3TE8A 1G6OA 2A2LA 3EEHA 4O0PA 4GS9A 4R3AA 2WKRA 2OWHA 3KX0X 2W1RA 4GS9B 3ZQ5A 1P9RA 2VX8A 3DBAA 3MFXA 2NUPC 5TBMA 5F6AA 4BBTA 3PR6A 3LR4A 3NOTC 2W0NA 2KX6A 1IFQA 2VV8A 2V9AA 4IUKA 3VE3A 3OCLA 1NWZA 1TS6A 1WA9A 1YSQA 2FZ0A 4WEKA 2M7VA 1W63Q 4NXEA 5DFYA 2BASA 3K3CA 3LR3A 4IHQA 3KSGA 1OJGA 3P01A 4HOIA 3CUEC 3OBFA 1DP9A 1OTEA 3UMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OTB A;  5AVE A;  3IBR A;  4LPZ A;  5F68 A;  3K3D A;  2PD8 A;  2PR6 A;  3C2W A;  4F3L A;  4MN5 A;  4NXG A;  4F3L B;  1S1Y A;  5HWW A;  5IS1 A;  4KUO A;  4GHI B;  1TS0 A;  5HZH A;  3CWF A;  3FG8 A;  2VEA A;  4H6J B;  3ICY A;  5KIZ A;  2D01 A;  2J80 A;  2H28 A;  2M1C A;  2P7J A;  3EWK A;  4EET B;  1Y28 A;  4WL9 A;  5AVF A;  1LL8 A;  3LIF A;  4HJ6 A;  2VLG A;  4YWZ A;  3NHQ A;  4XT2 A;  2WKP A;  3NOP C;  4RQ9 A;  3LIC A;  5HDS A;  3HJI A;  3MQO A;  4WF0 A;  3LIE A;  3IS2 B;  2V0U A;  3PHY A;  4L9E A;  3CLO A;  3PYP A;  2ZOH A;  4I3I A;  1T1B A;  4I5S A;  5HDC A;  2HV1 A;  4WN5 A;  1OJ5 A;  4EER A;  1T1A A;  2D02 A;  4HP4 A;  3E4P A;  4EES A;  2A24 A;  1UGU A;  4HI4 A;  5HDD A;  3H9W A;  3LUQ A;  2Z6C A;  2PHY A;  1BYW A;  5TBM B;  3UE6 A;  5F69 A;  1TS8 A;  3F1O A;  4R38 A;  4LRY C;  4WUJ A;  4I38 A;  4DJ2 A;  1UWN X;  1OTA A;  2W27 A;  1GSW A;  4EEP A;  4HHD A;  3UME A;  1LSX A;  3CAX A;  4HH3 A;  2QHK A;  1V9Z A;  2KDK A;  4EQ1 A;  4WLA A;  1ODV A;  3RH8 B;  2Z6D A;  3LI9 A;  3F1P A;  4NXF A;  3F1P B;  3OLO A;  5DJT A;  3E4O A;  4LLO B;  3RTY A;  3D72 A;  1N9O A;  2VV7 A;  1XJ3 A;  4LRX C;  5DKK A;  2OOL A;  1XJ4 A;  1T19 A;  2INW A;  1S4S A;  4M4X A;  3HJK A;  2JHE A;  1D06 A;  4EW7 A;  2YKH A;  4HJ4 A;  4JGP A;  3LYX A;  4K08 A;  4GW9 A;  1UWP X;  3GEC A;  1S1Z A;  2WKQ A;  1LSV A;  3MJQ A;  4I3A A;  1P97 A;  5J3W A;  2ZBB A;  1X0O A;  5HWV A;  4XT2 B;  5A8B A;  2QJ5 A;  2L1M A;  5G4Y A;  1F9I A;  3A0S A;  3NJA A;  3LIB A;  5IU1 A;  1VB6 A;  3E4Q A;  3UB7 A;  2CMN A;  4HJ3 A;  3UB9 A;  2YKF A;  2PR5 A;  2QWS A;  1KOU A;  1P0Z A;  5HSQ A;  2A24 B;  3C8C A;  3A0R A;  5I5L A;  3P7N A;  2PYR A;  3BWL A;  3VOL A;  3F1O B;  5F5Y A;  1LSW A;  3F1N A;  3ULF A;  2B02 A;  3F1N B;  1T1C A;  3VE4 A;  5J7E A;  4GCZ A;  5EFW A;  4NXB A;  1F98 A;  3MXQ A;  1S66 L;  2PDR A;  4HQA A;  4JGR A;  4BBU A;  2V1B A;  1MZU A;  2R78 A;  4KQD A;  3H7W A;  4HIA A;  4HH2 A;  4PKY A;  1DP8 A;  2PYP A;  3H7W B;  2PD7 A;  3SW1 A;  4R6L A;  3UB6 A;  4R70 A;  4B9O A;  3FC7 A;  1S4R A;  4I39 A;  4JGQ A;  4L9G A;  5J4E A;  2VV6 A;  1DP6 A;  4HY8 A;  4DJ3 A;  1LT0 A;  3LID A;  4BBV A;  1N9N A;  1GSV A;  1JNU A;  2OWJ A;  4KUK A;  1T18 A;  3H82 A;  1G28 A;  3H82 B;  3G6O A;  3UB8 A;  4LRZ E;  1XJ2 A;  2L4R A;  2ZOI A;  2QKP A;  4HNB A;  4GHI A;  4EXO A;  2I9V A;  4JGO A;  1GSX A;  2EA9 A;  4H6J A;  1XJ6 A;  3MQQ A;  1TS7 A;  3A0V A;  1OT9 A;  3GDI A;  4EEU A;  2JN7 A;  4MN6 A;  1DRM A;  1OT6 A;  1S67 L;  4PKY G;  2V0W A;  2GJ3 A;  5DJU A;  1OTD A;  2V1A A;  1D7E A;  5G4Z A;  4HP9 A;  3LIA A;  3LI8 A;  5HWT A;  1N9L A;  2L0W A;  3B33 A;  4E04 A;  3NOU C;  3IS2 A;  3MR0 A;  1OTI A;  4L9F A;  1V9Y A;  3T50 A;  3BY9 A;  4I3J A;  1XFQ A;  1XFN A;  3BY8 A;  5HD3 A;  2K7S A;  5DKL A;  2QJ7 A;  5HD5 A;  1EW0 A;  3EEH A;  4GS9 A;  4R3A A;  2WKR A;  2OWH A;  3KX0 X;  4GS9 B;  3ZQ5 A;  3MFX A;  5TBM A;  5F6A A;  4BBT A;  3NOT C;  2W0N A;  2KX6 A;  2VV8 A;  2V9A A;  3VE3 A;  1NWZ A;  1TS6 A;  1WA9 A;  4NXE A;  2BAS A;  3K3C A;  1OJG A;  4HOI A;  1DP9 A;  1OTE A;  3UMD A; 
#chains in the Genus database with same CATH topology
 4DE3 A;  5F68 A;  3R7W A;  4KEN B;  2LB5 A;  1GHM A;  4FTX A;  4N92 A;  4F3L A;  2VGJ A;  4KUO A;  2O9C A;  5L10 A;  4UA9 A;  5FAT A;  4OKP A;  2VGL S;  1W7F A;  3IF6 B;  4OH0 A;  5FDH A;  1H8M A;  4N9L A;  2PAV P;  1NYM A;  5G18 A;  1CEF A;  2M1C A;  2P7J A;  4B88 A;  4KZ3 A;  1FR6 A;  4ETZ A;  3B42 A;  4WL9 A;  3UB5 P;  2W1T A;  2V1Z A;  5TGF A;  1GA0 A;  4HJ6 A;  2VLG A;  2C6W B;  4BD1 A;  3NHQ A;  4Y13 A;  3LIC A;  2G7U A;  4XUZ A;  3ZG8 B;  1ZC2 A;  4WF0 A;  3QP6 A;  2W3H A;  3IS2 B;  5K5B A;  3OOV A;  3MFD A;  1E4D A;  3ZNT A;  1VET A;  2ZMV A;  4ZJ3 A;  1VQQ A;  2DMW A;  2Q9M A;  4KQQ A;  4OPY A;  4LFU A;  5FI7 A;  1BZA A;  1TD5 A;  2ZM8 A;  4E3O A;  4X56 A;  2RCX A;  4CJN A;  2A24 A;  2XK1 A;  1UGU A;  5D3O A;  5HPF A;  4WBG A;  3R4K A;  2Y79 A;  4BL2 A;  3LUQ A;  2Z6C A;  4UEY A;  3CJM A;  3LFV A;  2JKR I;  4ZDX A;  1PWG A;  1L3L A;  5DTS A;  4GJ4 A;  4MMN A;  3ZDJ A;  2ZQ7 A;  4WZ5 C;  1K56 A;  4HHD A;  4OQG A;  2MJ6 A;  3FV7 A;  4MDZ A;  4R1G A;  1ODV A;  1TDL A;  2HDU A;  3O87 A;  3RH8 B;  1NRJ A;  3F1P A;  2PT7 A;  2ZLY A;  2EX8 A;  5L07 A;  4OPQ A;  1CI9 A;  5EVI C;  2DRW A;  2Y91 A;  3S7O A;  4JXG A;  1N9O A;  4PM5 A;  3A3E A;  1JVJ A;  2I72 A;  1IEM A;  2JKT M;  5JYO A;  1SDN A;  2INW A;  1S4S A;  5F1G A;  3WWX A;  1L0D A;  3LCE A;  4M4X A;  2XEP A;  2YKH A;  4HJ4 A;  4ARZ A;  3LYX A;  4K08 A;  1BUE A;  4S2N A;  4GW9 A;  5F82 A;  3G30 A;  4HEF A;  1S1Z A;  1PI4 A;  4FOF A;  3SH9 A;  5AQ9 A;  2Q9N A;  2ZM2 A;  5FI2 A;  3FZC A;  1IYQ A;  4OOL A;  1P97 A;  3V5M A;  1KGF A;  3I7J A;  1X0O A;  5HWV A;  5FEG A;  4DMZ A;  3A0S A;  2EFX A;  5CTM A;  3LIB A;  1K55 C;  4KZ5 A;  4CLC A;  1YSP A;  2ZC6 B;  4LV2 A;  1E3U A;  1PZO A;  3E4Q A;  2CMN A;  3SS3 A;  4Y2F A;  3W4O A;  1IEL A;  1BLP A;  2QWS A;  2FFF B;  1KOU A;  3BFG A;  2VK3 A;  3LEQ A;  1FSW A;  5HSQ A;  4ZBE A;  3N8S A;  3HLE A;  3L7H A;  5EVI D;  3A0R A;  4PM7 A;  3ITB A;  2WKI A;  3VOY A;  4Y17 A;  3C7U A;  3BWL A;  3F1O B;  3MXR A;  3U2A A;  3ULF A;  4BMW A;  4DDS A;  2Y2O A;  2B02 A;  5FEF A;  4OLD A;  1ES5 A;  4N1H A;  3C38 A;  4OPR A;  4X6T A;  5DF9 A;  3RFB A;  3VOZ A;  4WYY A;  3UE3 A;  3MF0 A;  3GSG A;  3BRM A;  4BBU A;  3MZE A;  1VEU B;  4KZ4 A;  4PAU A;  4KQD A;  4DN0 A;  5HPI A;  2PYP A;  3M6H A;  2PD7 A;  2QPN A;  3UB6 A;  3IXH A;  2E8J A;  2IA2 A;  1A0K A;  2WZX A;  3KO6 A;  2XRN A;  3SZT A;  4Y7P A;  2V8C A;  4JKT A;  4PMA A;  1LT0 A;  4HBT A;  2O0Y A;  3LID A;  2UWX A;  1N9N A;  1GSV A;  1Z09 A;  1JNU A;  1T18 A;  5E2E A;  4GB7 A;  4O8G A;  1YMX A;  2Y4A A;  4LRZ E;  4NEE D;  1MWR A;  4KG5 A;  4U0X A;  1MXO A;  4S2P A;  2L4R A;  3T12 B;  3S7Q A;  4EXO A;  3AGE A;  4JGO A;  3PXP A;  3IF6 A;  3NDE A;  3D4F A;  1AXB A;  3EGX C;  5FSR A;  1TS7 A;  4GOG A;  3A0V A;  2EFU A;  2P04 A;  1OT9 A;  2ZC5 B;  1CJF A;  2WKE A;  3DTE A;  4QB8 A;  3NY4 A;  5CER A;  1SKF A;  2V20 A;  1CF0 A;  3E2K A;  5CHM A;  4WEL A;  1K38 A;  1PFL A;  4PKY G;  2HDR A;  1OTD A;  1D7E A;  1NY0 A;  3LIA A;  3FYZ A;  2GZA A;  3SH7 A;  3IS2 A;  2H10 A;  4L9F A;  2Y2P A;  4UQI S;  3T50 A;  2FFY A;  4X53 A;  5GL9 A;  2B5R A;  1NRF A;  3BY9 A;  1YLY A;  1W8Y A;  2B18 A;  3MSH A;  2HPB A;  3EEA A;  1F2K A;  4O7D A;  2Y8H A;  1ES4 A;  3MXS A;  3S7P A;  3BW6 A;  4MCW A;  3MZD A;  1SCW A;  3S22 A;  1W79 A;  5CRF A;  4PM9 A;  1GHI A;  1YMS A;  3QP2 A;  4C75 A;  5F6A A;  1CI8 A;  3NCK A;  3LR4 A;  2W0N A;  4MBF A;  5M1A A;  4NG2 A;  5CHJ A;  3OCL A;  2BG1 A;  1W8Q A;  4NXE A;  2HZ5 A;  4KZ8 A;  5DFY A;  1FCO A;  3LR3 A;  2ZL1 B;  4P85 A;  4QJG A;  1OJG A;  3P01 A;  3VP4 A;  1J9M A;  4S2L A;  3HLF A;  1KE3 A;  3N6I A;  3IBR A;  4P87 A;  4LPZ A;  3C4P A;  1I2W A;  3VP1 A;  3ZNY A;  3T4L A;  1TF1 A;  3UO9 A;  2PR6 A;  4MN5 A;  4LV0 A;  1ZKJ A;  4PM6 A;  4IJG A;  5IS1 A;  1ESI A;  1TS0 A;  3A3J A;  5HZH A;  1NLY A;  3FG8 A;  3WS2 A;  4H6J B;  5CEB A;  1MPL A;  2D01 A;  3IWQ A;  4KZA A;  5EEC A;  4WM9 A;  4QD4 A;  4GD6 A;  4YNR A;  3WS4 A;  4IED A;  3G32 A;  5I94 A;  2JKT I;  5TFQ A;  1Y28 A;  4EU0 A;  5EVL A;  4Q0H A;  1LL8 A;  5EM1 A;  5EVE A;  2WGV A;  4OOY A;  3QP4 A;  2WKP A;  1FR1 A;  3NOP C;  1HVB A;  4U0T A;  5FQI A;  4RQ9 A;  2X01 A;  5HDS A;  4R4S A;  1PIO A;  3BFD A;  3M2J A;  3LIE A;  2V0U A;  3PHY A;  5E2F A;  3C30 A;  4L9E A;  1XXM A;  3CLO A;  3GR2 A;  2QYB A;  3RJU A;  1JWP A;  1SHV A;  1S6R A;  4G3W A;  1PW8 A;  4I5S A;  1LHY A;  3T1S A;  4WN5 A;  1XGJ A;  4EER A;  1T1A A;  4HP4 A;  4WMC D;  2JKG A;  1FIK A;  5CX7 A;  3E4P A;  3CIT A;  3ZVW A;  4HI4 A;  1MC0 A;  4K0X A;  3C5A A;  3LY4 A;  3JPU A;  4FD8 A;  2VGK A;  3H9W A;  1LL5 A;  2QMI A;  2PHY A;  2H5S A;  5TBM B;  3ZG7 B;  3UE6 A;  5F69 A;  3DW0 A;  1TS8 A;  3F1O A;  2Y59 A;  4I38 A;  1UWN X;  3K2N A;  3JYI A;  3NDG A;  2ZM0 A;  3N8R A;  1K6S A;  3BJN A;  5BOH A;  3UDX A;  3CAX A;  4HH3 A;  2QHK A;  1VEU A;  4R3B A;  4EQ1 A;  3EQU A;  1G68 A;  1KGE A;  4WLA A;  1SDE A;  4ME4 A;  4NXF A;  4BEN A;  1MKI A;  1ZTU A;  4LCL A;  3OLO A;  3MKF A;  1N4O A;  4BWI A;  3M2K A;  1H8Y A;  5CTN A;  2P74 A;  4QWO A;  3HLC A;  4PPR A;  4NK3 A;  4D60 A;  2VV7 A;  1GHP A;  1XJ3 A;  4OQI A;  1DY6 A;  1W63 M;  3SS5 A;  5F1F A;  5HFO A;  1XJ4 A;  1SKO B;  2EXB A;  3HVF A;  2HJ9 C;  3BLM A;  2ZQA A;  2JHE A;  5CEC A;  2ZD8 A;  3HUN A;  4GLQ A;  4OPZ A;  3IX3 A;  4RYE A;  1KE0 A;  4Q0J A;  5FA7 A;  3PAE A;  4OP8 A;  5EE8 A;  3HUO A;  2J7V A;  1FIL A;  2EWV A;  5J3W A;  4S2K A;  4EUZ A;  4K91 A;  3T1R A;  1H3Q A;  1Q2Q A;  2W3D A;  3Q7Z A;  3NJA A;  1K54 A;  4LV3 A;  1ZG4 A;  4FH2 A;  3EGD C;  1VB6 A;  2KOI A;  4X68 A;  5IU1 A;  3UB9 A;  4GDB A;  2YKF A;  4XXR A;  1ESU A;  3A3I A;  2H0T A;  5DTK A;  1XGI A;  1RGZ A;  3KYE A;  4QY5 A;  3S7N A;  3Q81 A;  3Q7V B;  1YKD A;  3C8C A;  1FOF A;  3G2Z A;  3P7N A;  5GHY A;  1TDG A;  2PU2 A;  4JF6 A;  2Y55 A;  3VFH A;  3VOL A;  3W4P A;  3DWK A;  1LSW A;  5F5Y A;  2ZMA A;  1GA9 A;  3BM6 A;  3F1N B;  4QY6 A;  1F98 A;  4MNR A;  4O01 A;  2XA7 S;  5FAS A;  4HQA A;  4JGR A;  3GV9 A;  2V1B A;  2XQZ A;  1MZU A;  4OP5 A;  2J3T C;  3H7W A;  4HIA A;  3SW1 A;  2Y2M A;  1XKZ A;  2JC7 A;  3NC8 A;  4E3J A;  3M6B A;  1KE4 A;  2WZZ A;  4R70 A;  3GRJ A;  1S4R A;  4L9G A;  4E3N A;  3HLD A;  5KZH A;  4HY8 A;  4DJ3 A;  3NIA A;  3ZG9 B;  4DKI A;  2OAP 1;  5E43 A;  3BQ8 A;  1K0K A;  5A90 A;  4KUK A;  5HAP A;  1BLS A;  5IT5 A;  3H82 B;  4IBR A;  4BJP A;  4RX3 A;  3G6O A;  1Y4O A;  1MBL A;  2OV5 A;  3OCN A;  5E2G A;  4MLL A;  1QMF A;  1C3B A;  2ZQ8 A;  3JVV A;  3CI6 A;  4H6J A;  3HLW A;  4Y0T A;  3E2L A;  4KZ7 A;  3PBQ A;  3VFF A;  4MN6 A;  1F5M A;  3DTK A;  3MKE A;  4JLF A;  4PM8 A;  2HGV A;  3LY3 A;  2IWC A;  3QNB A;  1K54 C;  1FCM A;  2GJ3 A;  5DJU A;  1BT5 A;  1DJA A;  2XH9 A;  4KZ9 A;  4HP9 A;  2J9P A;  2J3T D;  1AWI A;  1RCJ A;  2P08 A;  1N9L A;  2L0W A;  4E04 A;  4DE2 A;  3MZF A;  1WYC A;  5CGS A;  1K6R A;  4I3J A;  3PTE A;  3G31 A;  3BY8 A;  5HD3 A;  1RP5 A;  1L2S A;  1O07 A;  1FSY A;  3TE8 A;  1PYY A;  4IBX A;  3EEH A;  2WKR A;  1Q2P A;  2OWH A;  2W1R A;  4GS9 B;  3N7W A;  3VP2 A;  2G2W A;  5TBM A;  2ZC3 B;  2Y2K A;  4BBT A;  3PR6 A;  2HDS A;  5CXW A;  2Y2G A;  2XFT A;  2VV8 A;  3BFC A;  4IUK A;  1NWZ A;  1TS6 A;  1WA9 A;  2FZ0 A;  5AQA A;  1W63 Q;  3QP1 A;  2BAS A;  3CPT B;  1JTG A;  3K3C A;  1FQG A;  4JPM A;  2Z2L B;  5M18 A;  1L0E A;  3KSG A;  1PNE A;  2OLU A;  2P9V B;  5FQ9 A;  1DP9 A;  1KDW A;  4P6B A;  4RVA A;  1IYO A;  5MC7 A;  2ZC4 B;  5AVE A;  4X25 A;  4ZJ1 A;  1L0F A;  5EVI B;  2W3G A;  4OQH A;  3K3D A;  3R7W B;  4M3K A;  1NZO A;  3C2W A;  1Z6F A;  5KMW A;  3O86 A;  4NXG A;  4UA7 A;  4F3L B;  4LCM A;  1S1Y A;  2EX6 A;  3L9K A;  4S2N C;  3IH9 A;  5M19 A;  1CQA A;  3HLB A;  1XA1 A;  2PU4 A;  2H0Y A;  4P6Z M;  5AJG A;  2J9O A;  4Y0O A;  5KIZ A;  2W3E A;  1HTZ A;  1KVL A;  3T4Q A;  5DF8 A;  1VM1 A;  3S4X A;  1IKI A;  1KVM A;  4C3Q A;  4FUW A;  3LO7 A;  4FH4 A;  2WUQ A;  1H5X A;  2ACG A;  1MWS A;  5AVF A;  1LLB A;  4K0W A;  1K56 D;  4CLC C;  4YWZ A;  1S0W A;  4BL3 A;  1XP4 A;  3MQO A;  2B95 A;  2Y2I A;  5EUA A;  2LB9 A;  4E3L A;  2R9W A;  2R9X A;  2UV0 E;  3T4J A;  3B3X A;  4KG6 A;  3ITA A;  3U4L P;  1RGY A;  5FQJ A;  2EWW A;  3HL9 A;  2WAE A;  3VP3 A;  1YAX A;  3PBT A;  3Q7V A;  4EV4 A;  1XA7 A;  4IUH A;  4WEJ A;  1IOU A;  3W4Q A;  1BYW A;  4PHT A;  5AQ7 A;  4LRY C;  4WUJ A;  2W3F A;  4DJ2 A;  3QP8 A;  1XX2 A;  2OAQ 1;  1K57 A;  2KLI A;  4DE0 A;  1GSW A;  5FAP A;  4DRT A;  4GD8 A;  3B47 A;  3MQ0 A;  3UME A;  1STZ A;  1LSX A;  1ERM A;  1WYB A;  3KYZ A;  3WS0 A;  2KDK A;  5HL1 A;  3TJZ C;  3UY6 A;  3WRZ A;  2O9B A;  4R4R A;  3V3R A;  3LI9 A;  4CLC D;  1YQS A;  3BQA A;  1E3U D;  3F1P B;  5DJT A;  1BSG A;  5A92 A;  3E4O A;  4LLO B;  3RTY A;  3D72 A;  4LV1 A;  3CUE A;  5DKK A;  5FI6 A;  5JYP A;  4N9K A;  2HJE A;  1PI5 A;  3VSK A;  3IF6 C;  2O9A A;  2EX2 A;  1D06 A;  5AQB A;  4EW7 A;  1YLZ A;  2Y2Q A;  3FPW A;  4JGP A;  4ARZ B;  1UWP X;  1YT4 A;  3BYD A;  2WKQ A;  4KQR A;  4ID4 A;  1LSV A;  3DAV A;  3D3O A;  3MJQ A;  1MWT A;  1OPX A;  5F83 A;  4X69 A;  2XLN A;  4II7 A;  4EBP A;  1PW1 A;  5L09 A;  4XT2 B;  3E0Y A;  4Y5F A;  2QJ5 A;  2L1M A;  5G4Y A;  1F9I A;  3VMA A;  4CQH A;  4MEZ A;  3UPO A;  4E3K A;  3TRC A;  4B93 A;  2RL3 A;  1XPB A;  2Y2J A;  4HJ3 A;  3G2Y A;  3ZG0 A;  3SS4 A;  2VA0 A;  4WZ4 A;  3MMH A;  3W2Z A;  3OPH A;  4NET A;  4MBH A;  3ZFZ A;  3GMW A;  3ZYT A;  3BLS A;  1N9B A;  1M40 A;  3NI9 A;  2JE5 A;  4EWF A;  5I5L A;  5KSH A;  2PYR A;  3OZH A;  5CED A;  1I5Q A;  1T1C A;  3VE4 A;  5J7E A;  5GLC A;  3Q82 A;  5EFW A;  4NXB A;  4MN7 A;  1I2S A;  1PWC A;  3MXQ A;  4DXC A;  1S66 L;  5FQM A;  1HD8 A;  2A49 A;  3P09 A;  1LI0 A;  2XD1 A;  4PKY A;  1IYS A;  3JVU A;  1ONH A;  2AVX A;  4WZ5 A;  4YOF A;  2HP9 A;  1CK3 A;  3CPT A;  1BTL A;  3PBS A;  3SH8 A;  3KSI A;  4UAA A;  5J4E A;  4GNU A;  2VV6 A;  3MBZ A;  2P9V A;  4BBV A;  5HL6 A;  4E6W A;  3ZHH A;  3O88 A;  5TR7 A;  5EVI A;  3HUM A;  3UB8 A;  3IXG A;  2WAD A;  2XRO A;  1XJ2 A;  3T1Q B;  1BLC A;  2ZOI A;  3QNC A;  3Q1F A;  1IKG A;  2QKP A;  2ZC7 A;  5L8M A;  1TEM A;  1L0G A;  2V8F A;  4Y3I A;  4UHU A;  2I9V A;  4YFM A;  1YLP A;  5HAQ A;  1GSX A;  5FQQ A;  2EA9 A;  1XJ6 A;  3IQA A;  3MQQ A;  2C5W B;  4GDN A;  3N4I A;  4OVD A;  3GDI A;  2JN7 A;  1DRM A;  1OME A;  5DF7 A;  2WAF A;  5J8X A;  4X1M A;  1S67 L;  3OPR A;  3LR0 A;  1E25 A;  2V0W A;  1U60 A;  4Q0I A;  1G5U A;  5HAR A;  5TJJ A;  2J3W A;  3V67 A;  2HP5 A;  2V1A A;  3D9Y A;  4E3I A;  3OPL A;  2VZW A;  1K25 A;  5C5K A;  2XSS A;  3B33 A;  3NOU C;  5DFX A;  1K55 A;  3MR0 A;  3N8L A;  1H0M A;  4QU3 A;  2K31 A;  1V9Y A;  5FAQ A;  3TW8 A;  3G4P A;  1XFN A;  1MWU A;  2X02 A;  3UN7 A;  3W8K A;  3UPP A;  2K7S A;  5DKL A;  4N1X A;  1HZO A;  2QJ7 A;  4S2M A;  5HD5 A;  3Q07 A;  3RXW A;  2M7U A;  1KDS A;  1FCN A;  1NJ4 A;  4DF6 A;  1G6O A;  2A2L A;  2WGW B;  2OLV A;  4O0P A;  1D1J A;  4R3A A;  2GDN A;  3KX0 X;  5HAI A;  3PAG A;  3MFX A;  4GKU A;  2VX8 A;  2EXA A;  3C4O A;  2NUP C;  2DNS A;  2G2U A;  2XFS A;  2KX6 A;  3V50 A;  4CPK A;  3IH8 A;  3VE3 A;  1PZP A;  1YSQ A;  4ZTK A;  3BEC A;  1ACF A;  4X55 A;  4JXW A;  3LGO A;  1JTD A;  2ZL1 A;  2PBD P;  3HRE A;  3IX8 A;  3UNW A;  1MY8 A;  4HOI A;  4DXB A;  5FDS A;  1OTB A;  3LR5 A;  3ISG A;  1ALQ A;  4KG2 A;  2PD8 A;  1IYP A;  2GNX A;  2VGL M;  4QPR A;  3FPV A;  2Q0O A;  3UDF A;  1QME A;  2BLS A;  5HWW A;  3HBR A;  4HES A;  4Y15 A;  4GHI B;  5U47 A;  3CWF A;  2QZ6 A;  2VEA A;  2VKS A;  3ICY A;  3A3F A;  2J80 A;  2WK0 A;  2WGI A;  4YIN A;  3CG5 A;  3SOI A;  2XF3 A;  3NBL A;  2H28 A;  3PBO A;  3EWK A;  4P6Z S;  4BLM A;  1NXY A;  2K2N A;  4EET B;  3UE0 A;  4IVI A;  3IF5 A;  3LIF A;  2FH5 A;  3KSH A;  5E2H A;  4XT2 A;  2PRF A;  4S2I A;  3IBJ A;  4HBU A;  3HJI A;  3QHY A;  1TVF A;  4CLC E;  3IHB A;  4BD0 A;  4OOM A;  2WKH A;  2HF6 A;  3PYP A;  2ZOH A;  4KZB A;  4I3I A;  1T1B A;  5HDC A;  3OPP A;  2HV1 A;  1OJ5 A;  2D02 A;  1G6A A;  1MKM A;  4JBF A;  4EES A;  4E3M A;  4R23 A;  5HDD A;  3ZGA B;  4KQO A;  4R38 A;  4LGW A;  2XA7 M;  1ES2 A;  1HLU P;  1SZV A;  3EQV A;  3T4K A;  1YLT A;  4GN2 A;  3OC2 A;  1PWD A;  1OTA A;  3T4S A;  3GQZ A;  3GVB A;  3TG9 A;  3VSL A;  2W27 A;  4EEP A;  3ZCZ A;  2HDQ A;  1V9Z A;  5LBR A;  5IHV A;  4XUX A;  3KYQ A;  4S2J A;  1YPR A;  5EV0 A;  4MBK A;  2Z6D A;  4FSF A;  3EOI A;  5GHX A;  4RX2 A;  2Y2L A;  4C6Y A;  3CMZ A;  1CEG A;  5KSC A;  4LRX C;  4ESP A;  3IWO A;  2XD5 A;  3IXD A;  2OOL A;  1SKO A;  1T19 A;  5HX9 A;  4UA6 A;  1W5D A;  4WMC A;  4DE1 A;  4OON A;  2GX5 A;  4L0L A;  5GLB A;  2X71 A;  3HJK A;  2Y2H A;  4P0M A;  2JCH A;  1ZHH B;  3WRT A;  4QHC A;  5CGW A;  1JWV A;  4BQM A;  3GEC A;  5EPH A;  3TOI A;  5GLA A;  1BLH A;  3VP0 A;  4EBN A;  1LI9 A;  3T4T A;  4GZB A;  1NYY A;  4I3A A;  1ZG6 A;  3NEC A;  4ZRR A;  2W1T B;  3MS6 A;  2ZBB A;  1YLJ A;  4R3J A;  3IT9 A;  3IX4 A;  5A8B A;  4JXS A;  1ERO A;  2BTF P;  1GCE A;  4ZAM A;  2VJW A;  1P9W A;  3T4O A;  4DDY A;  3LEZ A;  4OQ0 A;  2XDM A;  4R0Q A;  3E98 A;  3UB7 A;  3ZVT A;  1VHM A;  5GLD A;  1JWZ A;  3BFE A;  2PR5 A;  2JKR M;  1ERQ A;  1VET B;  4ETX A;  4OLG A;  3G34 A;  3IXB A;  1P0Z A;  4FCF A;  2ZMF A;  2O99 A;  3AGF A;  2A24 B;  4D2O A;  2E8I A;  4A5R A;  4NKP A;  1YM1 A;  5A91 A;  3V3S A;  4G3K A;  2WGW A;  3F1N A;  4F94 A;  4JF5 A;  3PBR A;  4Z9Q A;  4GCZ A;  5CGX A;  5DTT A;  2J8Y A;  3BFF A;  3ZG5 A;  4Z1W A;  4E6X A;  2PDR A;  1Y54 A;  3S1Y A;  4U3T A;  2IWB A;  2R78 A;  4HH2 A;  1DP8 A;  3H7W B;  5HW3 A;  4R6L A;  3P98 A;  2PBY A;  3RXX A;  1EWZ A;  4B9O A;  3FC7 A;  4I39 A;  4JGQ A;  4KZ6 A;  5FQK A;  3A3D A;  1DP6 A;  3TSG A;  1K4F A;  1LL9 A;  3PBN A;  5GHZ A;  2OWJ A;  2NUT C;  3H82 A;  1G28 A;  2XR0 A;  1DJC A;  3GTC A;  4Q8I A;  4RA7 A;  1PRQ A;  3HCY A;  4HNB A;  3AGD A;  5L2F A;  3O5Y A;  2JKF A;  4GHI A;  3UE1 A;  1NZU A;  3DTI A;  4EUV A;  5CHU A;  3WS5 A;  2WYX A;  2V2F F;  2ZQ9 A;  1WE4 A;  5DVA A;  4S2O A;  4JF4 A;  5FL3 A;  4B4Z A;  2EX9 A;  2ZQC A;  4EEU A;  2ZJ9 A;  1OT6 A;  3DWZ A;  3VV4 A;  3DTM A;  2CC1 A;  4LEN A;  4CLC B;  4AFI A;  3FKW A;  4UQI M;  5G4Z A;  3KSF A;  5EM0 A;  4B4X A;  1BUL A;  3LI8 A;  5HWT A;  2Y2N A;  1H8Z A;  1OTI A;  3O3V A;  3QP5 A;  4IVK A;  3FWL A;  2JBF A;  2Z2M B;  3CZD A;  1XFQ A;  1NLZ A;  5A93 A;  1M6K A;  2HP6 A;  1K4E A;  1DJB A;  3FKV A;  3UDI A;  5FAO A;  4G3V A;  1EW0 A;  1ONG A;  4X1L A;  3C7V A;  4GS9 A;  4ZJ2 A;  3ZQ5 A;  1P9R A;  2A3U A;  3DBA A;  1YLW A;  4EBL A;  2OSU A;  3IWI A;  3T1X A;  3G35 A;  1K57 C;  5EOE A;  3IHA A;  3UPN A;  2XGN A;  3NOT C;  1ES3 A;  3WS1 A;  1IFQ A;  1KGG A;  1J3W A;  3HLG A;  2V9A A;  4Y0U A;  2ZQD A;  4WEK A;  4H8R A;  2M7V A;  4EQI A;  1EI5 A;  4IHQ A;  3NUL A;  2DCF A;  2IWD A;  3CHW P;  3BEB A;  4JXV A;  3CUE C;  3OBF A;  1O7E A;  5EOO A;  1OTE A;  3UMD A;  3V39 A; 
#chains in the Genus database with same CATH homology
 1OTB A;  5MC7 A;  5AVE A;  3IBR A;  3LR5 A;  4LPZ A;  5F68 A;  3R7W A;  2W3G A;  3T4L A;  3K3D A;  2LB5 A;  2PD8 A;  3R7W B;  1TF1 A;  2GNX A;  2VGL M;  4QPR A;  2PR6 A;  3FPV A;  3C2W A;  4F3L A;  4MN5 A;  4NXG A;  4F3L B;  1S1Y A;  4IJG A;  5HWW A;  5IS1 A;  4KUO A;  2O9C A;  4GHI B;  1TS0 A;  2VGL S;  5HZH A;  1NLY A;  3CWF A;  3FG8 A;  2VEA A;  4H6J B;  4P6Z M;  5AJG A;  2VKS A;  1H8M A;  3ICY A;  5KIZ A;  2D01 A;  2W3E A;  2J80 A;  3T4Q A;  2H28 A;  3PBO A;  4YNR A;  2M1C A;  2P7J A;  3EWK A;  4P6Z S;  2K2N A;  4EET B;  4ETZ A;  2JKT I;  3B42 A;  1Y28 A;  4WL9 A;  2W1T A;  4EU0 A;  4Q0H A;  5AVF A;  1LL8 A;  3LIF A;  4HJ6 A;  2FH5 A;  2VLG A;  3KSH A;  4CLC C;  4YWZ A;  3NHQ A;  4XT2 A;  2WKP A;  3NOP C;  3IBJ A;  3LIC A;  4RQ9 A;  5HDS A;  3HJI A;  2G7U A;  3MQO A;  4WF0 A;  3LIE A;  2W3H A;  2LB9 A;  4CLC E;  3IS2 B;  2V0U A;  3PHY A;  3T4J A;  5K5B A;  3C30 A;  4L9E A;  4OOM A;  3OOV A;  3CLO A;  2HF6 A;  2QYB A;  3PYP A;  2ZOH A;  4I3I A;  1T1B A;  4G3W A;  2ZMV A;  4I5S A;  2EWW A;  5HDC A;  2HV1 A;  2DMW A;  4WN5 A;  1OJ5 A;  4EER A;  1T1A A;  1TD5 A;  2D02 A;  4HP4 A;  1MKM A;  1YAX A;  3PBT A;  5CX7 A;  3E4P A;  3CIT A;  4EES A;  2A24 A;  1UGU A;  4HI4 A;  1MC0 A;  4IUH A;  4WEJ A;  1IOU A;  5HPF A;  3R4K A;  2Y79 A;  5HDD A;  3H9W A;  3LUQ A;  4KQO A;  2Z6C A;  2PHY A;  1BYW A;  4UEY A;  5TBM B;  3UE6 A;  3LFV A;  2JKR I;  4PHT A;  5F69 A;  1TS8 A;  3F1O A;  4LRY C;  4R38 A;  2XA7 M;  4WUJ A;  2W3F A;  4I38 A;  3EQV A;  3T4K A;  4DJ2 A;  4GJ4 A;  1UWN X;  3OC2 A;  3K2N A;  4MMN A;  1OTA A;  3T4S A;  2OAQ 1;  2W27 A;  2KLI A;  1GSW A;  3B47 A;  3MQ0 A;  4EEP A;  3BJN A;  4HHD A;  3UME A;  1STZ A;  1LSX A;  3CAX A;  4HH3 A;  2QHK A;  3KYZ A;  1V9Z A;  5LBR A;  2KDK A;  4EQ1 A;  3EQU A;  3TJZ C;  2MJ6 A;  3KYQ A;  4MDZ A;  4WLA A;  2O9B A;  1ODV A;  3RH8 B;  4ME4 A;  1NRJ A;  2Z6D A;  4FSF A;  3LI9 A;  3F1P A;  4NXF A;  4CLC D;  2PT7 A;  1ZTU A;  3BQA A;  3EOI A;  3F1P B;  3OLO A;  5DJT A;  4BWI A;  3E4O A;  4LLO B;  3S7O A;  3RTY A;  3D72 A;  1N9O A;  2VV7 A;  1XJ3 A;  3CUE A;  4LRX C;  5DKK A;  1W63 M;  2OOL A;  1XJ4 A;  2HJE A;  1T19 A;  2JKT M;  2HJ9 C;  2INW A;  2GX5 A;  1S4S A;  4L0L A;  2O9A A;  4M4X A;  3HJK A;  2JHE A;  1D06 A;  4EW7 A;  2YKH A;  4HJ4 A;  4ARZ A;  3FPW A;  4JGP A;  1ZHH B;  3LYX A;  4K08 A;  4GW9 A;  1UWP X;  4ARZ B;  4GLQ A;  3GEC A;  1S1Z A;  2WKQ A;  4FOF A;  3T4T A;  1LSV A;  3D3O A;  4Q0J A;  3MJQ A;  4I3A A;  1OPX A;  4ZRR A;  2W1T B;  4OOL A;  1P97 A;  4II7 A;  2EWV A;  5J3W A;  2ZBB A;  1X0O A;  5HWV A;  4XT2 B;  3E0Y A;  1H3Q A;  4Y5F A;  2QJ5 A;  5A8B A;  2W3D A;  2L1M A;  5G4Y A;  4DMZ A;  1F9I A;  3A0S A;  4CQH A;  3NJA A;  2VJW A;  1P9W A;  3LIB A;  3T4O A;  3TRC A;  4B93 A;  4CLC A;  1YSP A;  1VB6 A;  2KOI A;  3EGD C;  3E4Q A;  5IU1 A;  3E98 A;  3UB7 A;  2CMN A;  4HJ3 A;  3UB9 A;  4Y2F A;  2YKF A;  1VHM A;  2PR5 A;  2VA0 A;  2JKR M;  3MMH A;  3W2Z A;  4ETX A;  2QWS A;  1KOU A;  1P0Z A;  2ZMF A;  5HSQ A;  2O99 A;  3S7N A;  3ZYT A;  1YKD A;  2A24 B;  3A0R A;  3C8C A;  5I5L A;  5KSH A;  3P7N A;  2PYR A;  4NKP A;  3BWL A;  3VOL A;  3F1O B;  4G3K A;  5F5Y A;  1LSW A;  3U2A A;  3F1N A;  3ULF A;  4BMW A;  2B02 A;  3F1N B;  3PBR A;  1T1C A;  3VE4 A;  5J7E A;  4GCZ A;  3C38 A;  5EFW A;  4NXB A;  1F98 A;  5DF9 A;  3RFB A;  4MN7 A;  4O01 A;  2XA7 S;  3MXQ A;  4Z1W A;  1S66 L;  3UE3 A;  2PDR A;  4HQA A;  3MF0 A;  4JGR A;  4BBU A;  2V1B A;  1MZU A;  2R78 A;  2J3T C;  4KQD A;  4PAU A;  3H7W A;  4HIA A;  4HH2 A;  4PKY A;  4DN0 A;  1DP8 A;  5HPI A;  2PYP A;  3JVU A;  3H7W B;  2PD7 A;  3SW1 A;  4R6L A;  4YOF A;  3UB6 A;  4R70 A;  4B9O A;  2IA2 A;  1S4R A;  3FC7 A;  4I39 A;  3PBS A;  4JGQ A;  4L9G A;  3KO6 A;  3KSI A;  2XRN A;  5J4E A;  2VV6 A;  1DP6 A;  4HY8 A;  4DJ3 A;  1LT0 A;  2OAP 1;  2O0Y A;  3LID A;  3PBN A;  4BBV A;  1N9N A;  3BQ8 A;  1GSV A;  5HL6 A;  1JNU A;  2OWJ A;  4KUK A;  2NUT C;  5IT5 A;  1T18 A;  3H82 A;  1G28 A;  3H82 B;  4BJP A;  4O8G A;  3G6O A;  3UB8 A;  4LRZ E;  2XRO A;  4NEE D;  1XJ2 A;  3OCN A;  2L4R A;  2ZOI A;  2QKP A;  3HCY A;  4HNB A;  3S7Q A;  5L8M A;  4Y3I A;  3O5Y A;  4GHI A;  4EUV A;  4EXO A;  2I9V A;  4JGO A;  1GSX A;  3PXP A;  3JVV A;  3CI6 A;  2EA9 A;  4H6J A;  3EGX C;  1XJ6 A;  3MQQ A;  1TS7 A;  3A0V A;  5FL3 A;  2P04 A;  1OT9 A;  3GDI A;  4EEU A;  2JN7 A;  3PBQ A;  4MN6 A;  1DRM A;  1F5M A;  1OT6 A;  3VV4 A;  4WEL A;  2HGV A;  1S67 L;  3LR0 A;  4PKY G;  2V0W A;  5TJJ A;  4Q0I A;  2GJ3 A;  5DJU A;  4CLC B;  1OTD A;  2J3W A;  3V67 A;  4AFI A;  4UQI M;  2V1A A;  1D7E A;  5G4Z A;  3KSF A;  4HP9 A;  3LIA A;  2VZW A;  2J3T D;  3LI8 A;  5HWT A;  5C5K A;  2P08 A;  2GZA A;  1N9L A;  2L0W A;  2XSS A;  3B33 A;  4E04 A;  3NOU C;  3IS2 A;  5DFX A;  3MR0 A;  1OTI A;  4L9F A;  4UQI S;  2K31 A;  1V9Y A;  3T50 A;  3TW8 A;  3BY9 A;  2B18 A;  4I3J A;  1XFQ A;  1NLZ A;  1XFN A;  3EEA A;  3BY8 A;  5HD3 A;  2Y8H A;  2K7S A;  5DKL A;  2QJ7 A;  3S7P A;  5HD5 A;  3BW6 A;  4G3V A;  1EW0 A;  4MCW A;  2M7U A;  3TE8 A;  1G6O A;  2A2L A;  3EEH A;  4O0P A;  4GS9 A;  4R3A A;  2WKR A;  2OWH A;  3KX0 X;  2W1R A;  4GS9 B;  3ZQ5 A;  1P9R A;  2VX8 A;  3DBA A;  3MFX A;  2NUP C;  5TBM A;  5F6A A;  4BBT A;  3PR6 A;  3LR4 A;  3NOT C;  2W0N A;  2KX6 A;  1IFQ A;  2VV8 A;  2V9A A;  4IUK A;  3VE3 A;  3OCL A;  1NWZ A;  1TS6 A;  1WA9 A;  1YSQ A;  2FZ0 A;  4WEK A;  2M7V A;  1W63 Q;  4NXE A;  5DFY A;  2BAS A;  3K3C A;  3LR3 A;  4IHQ A;  3KSG A;  1OJG A;  3P01 A;  4HOI A;  3CUE C;  3OBF A;  1DP9 A;  1OTE A;  3UMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...