1P97A

Nmr structure of the c-terminal pas domain of hif2a
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
GAMDSKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYNPRNLQPQCIMCVNYVLSEIEKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endothelial PAS domain protein 1
publication title Structural basis for PAS domain heterodimerization in the basic helix-loop-helix-PAS transcription factor hypoxia-inducible factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 27
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2003-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1p97A00
4I38A 2V1AA 2VEAA 4BBUA 2JN7A 4HHDA 3LIBA 4L9GA 4E04A 5J4EA 1ODVA 4HJ4A 1DP8A 1G28A 4GW9A 3UE6A 1UGUA 3FC7A 3K3CA 1XJ2A 3CAXA 4GHIA 4HOIA 5TBMA 1TS8A 3RH8B 4MN5A 3FG8A 1KOUA 1XFNA 4EQ1A 2ZOHA 2VV6A 4KUOA 1S4SA 4JGQA 4HY8A 3D72A 1OT6A 2D01A 3LUQA 1N9NA 3VE4A 3MXQA 1GSXA 4JGOA 1S4RA 4JGRA 4R70A 4R6LA 2PD8A 2V0WA 1S67L 2PYPA 4EEPA 2A24B 3LI9A 4JGPA 3E4OA 2OWHA 1Y28A 1T1BA 2L0WA 2PDRA 2ZOIA 5DJTA 2VV8A 4EESA 4HH3A 1S66L 4HJ3A 4HJ6A 3UB9A 4LPZA 3T50A 2VLGA 3NOUC 4KUKA 3H7WB 4MN6A 5HDSA 3PHYA 1XJ3A 3IS2B 4LRXC 2PHYA 3LYXA 4PKYG 1WA9A 4NXGA 1D06A 3VE3A 4I3AA 4BBVA 3F1OB 1DP6A 1X0OA 4WF0A 3B33A 5HDCA 2WKRA 1F98A 3H82B 1OT9A 2JHEA 1MZUA 4EEUA 1DRMA 4EW7A 4I5SA 1GSVA 3EWKA 3GDIA 4I3JA 4EETB 5HDDA 2W0NA 2I9VA 5DJUA 2L4RA 3MR0A 2L1MA 2HV1A 2QWSA 5DKLA 3G6OA 3H7WA 1D7EA 3A0SA 2KX6A 5J7EA 3IS2A 4BBTA 1S1YA 3C8CA 4HNBA 1VB6A 4L9FA 2K7SA 5KIZA 3GECA 1GSWA 3OLOA 3F1OA 3LICA 2H28A 4HI4A 1V9ZA 3H82A 3MQOA 2PR6A 5AVEA 2Z6DA 4HQAA 5IS1A 2R78A 3CLOA 2WKPA 1T19A 4WLAA 3UB8A 4HP9A 2ZBBA 3F1NB 2WKQA 4GS9B 5F68A 4NXFA 4HH2A 2QJ5A 5HWWA 3MJQA 3H9WA 1LSXA 2V1BA 2GJ3A 1EW0A 1T1AA 4XT2B 5F69A 1UWNX 3CWFA 4H6JB 2VV7A 3UMDA 3BY9A 1XFQA 1N9OA 3A0VA 2QHKA 1S1ZA 1P97A 1TS0A 3F1NA 5HWTA 3NJAA 5G4YA 2QJ7A 4GS9A 4WL9A 1XJ4A 2QKPA 1OTAA 2PYRA 3BY8A 1TS6A 3K3DA 4DJ3A 5HD3A 3NOPC 4F3LA 2KDKA 4EERA 1T18A 4PKYA 1OTEA 5F6AA 2J80A 2V9AA 1T1CA 3BWLA 5I5LA 4XT2A 1OJ5A 5J3WA 1JNUA 3HJKA 1BYWA 3EEHA 4H6JA 1N9LA 1UWPX 1LSWA 5EFWA 3MQQA 4GCZA 1OTIA 3LIDA 1V9YA 2W27A 1TS7A 4WN5A 3F1PB 1XJ6A 3RTYA 4M4XA 3PYPA 3UB7A 3VOLA 3LIAA 3ULFA 4K08A 3E4QA 2YKHA 2BASA 3IBRA 2OOLA 4R3AA 1F9IA 4WUJA 3UB6A 5A8BA 4B9OA 3NHQA 4YWZA 4I3IA 5G4ZA 4EXOA 4R38A 4F3LB 2OWJA 3E4PA 4KQDA 3ICYA 3F1PA 2D02A 4DJ2A 3SW1A 3LIEA 4NXEA 5HD5A 1OJGA 3P7NA 3NOTC 4LRZE 1OTDA 5AVFA 2M1CA 4L9EA 5IU1A 4RQ9A 2P7JA 2Z6CA 3MFXA 3UMEA 1NWZA 2YKFA 1OTBA 2EA9A 1LSVA 4LRYC 1LT0A 5HSQA 4GHIB 3C2WA 2PD7A 4HP4A 5TBMB 5F5YA 3ZQ5A 5HWVA 4NXBA 2A24A 3HJIA 5HZHA 3LI8A 2V0UA 5DKKA 4LLOB 1DP9A 3LIFA 2INWA 1P0ZA 2PR5A 1LL8A 4I39A 2B02A 4HIAA 3A0RA 2CMNA 3KX0X
chains in the Genus database with same CATH superfamily
2Y2KA 3Q07A 4I38A 2Y4AA 4X68A 1K56A 4OQGA 4BBUA 1DJAA 3O88A 4CQHA 3RXWA 4UQIS 2Y2QA 3U4LP 5J4EA 1ODVA 3VP1A 3T1QB 1LHYA 1MKIA 4R0QA 3A3EA 5HPIA 4BENA 1P9WA 5FDHA 2DMWA 4HOIA 5GHYA 1K25A 1BULA 2WYXA 5TBMA 1SKOB 3C4OA 3RH8B 4MN5A 3FG8A 2WGWB 5JYPA 4JBFA 4DDYA 3DTKA 1NRJA 1KGEA 5GHZA 3LEQA 3D72A 1OT6A 4UQIM 1VHMA 5E2EA 1ONGA 4OPZA 4GB7A 4JGRA 4R70A 2ZC5B 3BJNA 1L0GA 4XUZA 4F94A 2PD8A 4LV2A 2PYPA 2A24B 2PU2A 4X69A 5CXWA 3T1XA 5FI2A 3T12B 1Y28A 2W3HA 4E3NA 2J8YA 1AXBA 2XGNA 2Y2LA 2OLUA 1MC0A 1T1BA 3IT9A 1SKOA 4CLCB 2JKTM 2L0WA 2ZOIA 5DJTA 3ZG9B 4HH3A 3G2ZA 2EX9A 2M7VA 2WGWA 5CHMA 4ZAMA 3ZG0A 4HJ3A 1ERMA 3UDFA 2WAFA 2ZM8A 3FPWA 5CERA 4HJ6A 1JWVA 2H5SA 3W8KA 3T4JA 2V8FA 4OOYA 1GHPA 2VLGA 2Y2IA 3NOUC 4MN6A 1H8ZA 5HDSA 4LENA 1XJ3A 4G3VA 3SOIA 3R4KA 5I94A 3NCKA 1D06A 1W63M 2XD1A 1XGIA 3TJZC 3MKFA 4I3AA 1L0FA 2WKRA 1ZG6A 3N7WA 1MZUA 2FFYA 1DRMA 2P04A 2QYBA 3P01A 4EW7A 3ZYTA 2W1RA 1ESIA 3O87A 2Y55A 2W0NA 4WM9A 2Y2NA 2XDMA 4ID4A 5DJUA 1STZA 4PAUA 1SHVA 4S2JA 2HV1A 5DKLA 5DTSA 1PI5A 1ZG4A 3B42A 2ZL1B 2J9PA 5DVAA 5HFOA 4S2NA 1FSWA 2WGIA 3HBRA 4WZ5C 3C7UA 3HUNA 4GDBA 4B93A 5EOOA 2Q9NA 2ZMFA 4KG5A 5KIZA 3GECA 2QMIA 3OLOA 4MLLA 1Q2QA 3V5MA 3MQOA 4HQAA 2X02A 2R78A 4WLAA 3ZHHA 5HAQA 4GDNA 3F1NB 1BTLA 3T4OA 1H3QA 4ETZA 3IXDA 3C38A 3ITBA 5FQIA 2ZL1A 1H5XA 2OAP1 1LLBA 4NXFA 2QJ5A 2VGLS 5HWWA 3H9WA 2BTFP 1W63Q 2WK0A 1LSXA 2V1BA 2G2WA 1EW0A 2K2NA 3TOIA 1IYQA 4H6JB 2ZM0A 2VV7A 3UMDA 2X01A 2ZC4B 3BY9A 3GQZA 1XFQA 2XQZA 3OPRA 1HZOA 3QP8A 1W79A 1GCEA 4FD8A 4JXSA 3IXBA 3GRJA 3PBNA 1TS0A 3F1NA 4U0XA 3C7VA 3ZDJA 4G3KA 1ES3A 2HDRA 2PYRA 1CF0A 2VGLM 4A5RA 4DJ3A 2B95A 3NOPC 1IYPA 4DXCA 4RX2A 3FV7A 4E6WA 3PAEA 2ZM2A 2J80A 5M19A 4P85A 5I5LA 2E8JA 1OJ5A 1ALQA 2Y2OA 4Z9QA 3EEHA 4HEFA 4H6JA 1N9LA 3DTIA 1UWPX 1S0WA 4GCZA 1ESUA 1FSYA 2W27A 3LR5A 1PFLA 2PAVP 1XJ6A 2R9XA 3CUEA 2ZC3B 3ZG7B 1EI5A 4KZ7A 1XKZA 2JKFA 3V50A 3LIAA 2X71A 3ZFZA 2C6WB 4EUVA 4NK3A 1VETB 1AWIA 2BASA 3IBRA 5FATA 2XH9A 4R3AA 4WUJA 4B9OA 4YWZA 1C3BA 5G4ZA 4OP8A 1YLTA 5FQMA 4R38A 4F3LB 3W4OA 4JXVA 4S2OA 2OLVA 4Q0IA 1NRFA 3FWLA 3HUOA 3SW1A 4BJPA 1YSQA 3LIEA 3NULA 4NXEA 4OOMA 4N1XA 1BT5A 3W2ZA 1IEMA 2IA2A 1OTDA 2R9WA 1YLJA 3S1YA 1D1JA 2Y2HA 1J9MA 1BSGA 2XLNA 2P7JA 4QB8A 4B88A 3MFXA 4GNUA 1K55C 3TE8A 1VETA 2QZ6A 4E3JA 4Q0JA 1YKDA 1VEUB 3JYIA 1LT0A 3VP4A 2OSUA 1W5DA 3C2WA 2PD7A 3LGOA 1ZC2A 4P6ZM 3MQ0A 5HWVA 3KYZA 3HL9A 4IJGA 1CJFA 4IBXA 1PYYA 4NXBA 1RGYA 4S2KA 5DKKA 1P0ZA 2HDQA 4I39A 5GLBA 4X1MA 3O3VA 1PIOA 2CMNA 1ACFA 2H0YA 4UA9A 3G35A 2V1AA 4HHDA 4LFUA 1RGZA 2IWCA 4PMAA 4NEED 2XK1A 1YLZA 4E04A 2EX2A 5DFYA 1PZPA 4JF4A 1P9RA 3K3CA 5GLDA 1VEUA 4DKIA 3CAXA 3IWOA 2V8CA 2VGKA 3QP1A 2W3DA 1XFNA 3M6BA 4C75A 5CGXA 5TGFA 3RXXA 2VV6A 2ZD8A 3G34A 1VM1A 4JPMA 4HY8A 3PBSA 5AQBA 2XA7S 4ESPA 4IVIA 1TDLA 1F2KA 1E3UD 3N6IA 1S4RA 2XF3A 3SS3A 1M40A 3UE1A 3SH8A 5L10A 3D4FA 3S22A 1RCJA 4GD8A 2V0WA 3NI9A 3LI9A 4Y3IA 1K54A 4OP5A 2GDNA 1LL5A 4EBPA 3VV4A 3MXSA 2PDRA 4EESA 2P74A 5L09A 2XA7M 4R3JA 3CHWP 1HLUP 1G6OA 2DNSA 4CJNA 3UB5P 1NYYA 1IFQA 2ZQ8A 5K5BA 3UB9A 4LGWA 3SH9A 4LPZA 1J3WA 5DTKA 5C5KA 3IXHA 1K55A 2OAQ1 2EX6A 3BEBA 3IS2B 3ZVWA 1MWRA 1BUEA 4DF6A 1H8MA 1MWUA 3S7OA 3BFEA 3VFFA 3BLMA 4RVAA 4E6XA 3DAVA 4CLCC 1DP6A 2PRFA 2WZXA 2K31A 2JHEA 2HGVA 4P0MA 3MMHA 4I5SA 3W4QA 4GLQA 4HBTA 4PM5A 3EWKA 2W1TB 5FI6A 3BFDA 3BYDA 1EWZA 2ZQ7A 3UO9A 5E43A 4MNRA 4JXGA 5EPHA 4MDZA 3MZFA 2B18A 3MR0A 1IYSA 1TDGA 5HAIA 2G2UA 2VA0A 1D7EA 2J9OA 4FCFA 3A0SA 3IF6B 2EXBA 5M18A 3E2KA 3IS2A 4EBLA 4BBTA 3K2NA 2LB5A 3PXPA 3C8CA 1BLPA 4O0PA 3T4LA 4OQ0A 5G18A 4L9FA 2K7SA 3R7WB 3MFDA 1E25A 3Q1FA 2Y2PA 1G6AA 3LR3A 1E3UA 2HP6A 2JE5A 5D3OA 4X25A 5IS1A 4UA7A 2W1TA 2WKPA 5GLAA 1T19A 1MBLA 2J3TC 3HLCA 4HESA 5IT5A 3UB8A 1W8QA 3HVFA 2EFXA 2C5WB 3HLGA 3P98A 4BWIA 3V39A 4HP9A 4Y2FA 5EOEA 3UPNA 1PNEA 1N9BA 2DRWA 5EECA 3NC8A 5E2HA 5GL9A 3IF6A 3HLFA 5L2FA 1OPXA 3IH9A 4QPRA 2GJ3A 2NUTC 1UWNX 1G68A 3R7WA 1K4EA 3NY4A 5DTTA 1HD8A 3LR0A 2W3EA 2JCHA 2ZQ9A 4OOLA 4B4ZA 5FQKA 4MN7A 1Q2PA 5CGSA 4N9LA 1NLYA 1N9OA 1KDWA 4WBGA 2QHKA 5KSHA 1S1ZA 3ZGAB 4M3KA 1P97A 4QU3A 4FH2A 5HWTA 1K6SA 3CITA 4WL9A 4BD0A 3HLDA 1XJ4A 1OTAA 4YNRA 3BY8A 4WELA 3GV9A 4KENB 2RCXA 5JYOA 2KDKA 4JLFA 3HUMA 4DDSA 2ZMAA 2A49A 3WRTA 1NYMA 3BWLA 3OPLA 2GNXA 5J3WA 3HJKA 4FTXA 4Y15A 1YPRA 1BYWA 1FCOA 1LSWA 1I2SA 4OH0A 3DBAA 1V9YA 3EQVA 4WN5A 5AJGA 4MBHA 2A3UA 3EOIA 4Y0TA 3SH7A 3PYPA 3UE3A 3T4QA 2HJEA 1JWZA 2E8IA 1DJCA 5F1FA 1SKFA 4OPYA 3IWQA 3VP0A 4GN2A 5FEFA 1TEMA 1F9IA 1JTDA 5CHJA 4I3IA 2Y79A 5CHUA 2BG1A 3E4PA 4KZ5A 5KMWA 3C5AA 5FAQA 4D60A 1CI9A 4JF6A 3TW8A 3PR6A 4MCWA 4KQOA 5HD5A 3P7NA 1YLYA 3CJMA 5EE8A 4EV4A 3C30A 3QP2A 3CG5A 4P87A 4KZ8A 5U47A 4X56A 2IWBA 3S7NA 1TD5A 4C3QA 3HLWA 5EM0A 3NECA 4DN0A 3NBLA 2FFFB 3B47A 5CRFA 3QP6A 1LSVA 1QMFA 4PPRA 1NZOA 2HP9A 4R3BA 2JKRI 4Q8IA 1TF1A 4WEJA 3W4PA 3HJIA 5HZHA 3BLSA 3A3IA 3BFGA 5FA7A 3LIFA 4P6BA 2H0TA 2PR5A 3BQAA 2Y59A 1IOUA 3NIAA 3VMAA 4O01A 3BFCA 2W3FA 2JN7A 1KE4A 1L0EA 5TR7A 3WS0A 4YINA 4R1GA 4L9GA 1BLCA 1ZKJA 3Q7VB 1MY8A 4HJ4A 4WMCD 4KZ3A 4Z1WA 1XXMA 4GW9A 4O7DA 3UE6A 1UGUA 3FC7A 4IUKA 3KYEA 3DTEA 1XJ2A 4OQIA 1TS8A 5EVIC 4LCLA 1KOUA 2UV0E 4DE0A 5CTNA 3KSGA 2RL3A 2HDSA 4WZ5A 1K0KA 1QMEA 1S4SA 1WYCA 1W8YA 4S2MA 4JGQA 1ZHHB 3S4XA 3T1RA 2D01A 3LUQA 5EVID 1Z6FA 3MBZA 3HLBA 1SZVA 1PI4A 3MXQA 4JGOA 1BLSA 3DWKA 1ERQA 4R6LA 2OV5A 3C4PA 3Q7VA 5CTMA 4JGPA 4LV3A 3KSFA 1LL9A 4GD6A 3G32A 2XROA 3OZHA 1M6KA 5IHVA 4G3WA 4GZBA 1YAXA 4WYYA 4BLMA 4B4XA 3S7PA 1YSPA 1K57C 2VV8A 4DMZA 3BQ8A 4OQHA 3FYZA 1EROA 3UDIA 4K91A 4BMWA 2W3GA 3UNWA 2ZMVA 3EEAA 1Y4OA 2LB9A 1IKIA 4JXWA 4KZ4A 1GA0A 3N8RA 1MXOA 5A90A 4KUKA 3H7WB 1FR1A 3FZCA 3IWIA 1KDSA 2J7VA 3LY4A 3PHYA 5AQ7A 4ZBEA 4OVDA 4LRXC 2DCFA 1K38A 4OLGA 3PBOA 2PU4A 3V67A 4WEKA 3SS4A 2PT7A 4OONA 3VE3A 3F1OB 4WF0A 5HDCA 3B33A 3RJUA 3IHAA 1F98A 4Y5FA 1PWCA 3H82B 4JKTA 4EEUA 3BW6A 2QPNA 1GSVA 4MEZA 4X55A 3G4PA 4I3JA 5HDDA 4WMCA 2XR0A 2I9VA 4CPKA 2L4RA 3VP3A 1WE4A 2L1MA 2QWSA 3FKVA 3LR4A 3H7WA 4DE1A 1PRQA 4XXRA 5LBRA 5AQAA 3SS5A 5J7EA 5KSCA 2IWDA 1IKGA 2JBFA 1S1YA 4U0TA 1VB6A 4QHCA 3LO7A 3JVUA 2ACGA 1N4OA 1GSWA 3E0YA 2ZQAA 3F1OA 5FDSA 4NKPA 5CX7A 3H82A 5FSRA 3N8SA 2PR6A 2Z6DA 4D2OA 4KZ6A 2WAEA 2O9BA 4GKUA 2VK3A 2ZBBA 5DF8A 4GS9B 4E3OA 5EV0A 1PWDA 5MC7A 2EFUA 4ZRRA 2O9AA 5EM1A 3O5YA 3ZG5A 2ZQDA 4HH2A 3IQAA 2XEPA 2Z2LB 3PBQA 2M7UA 4ME4A 3WRZA 4E3IA 4PM9A 1T1AA 4XT2B 5F69A 3JPUA 3CWFA 2XFSA 4Y13A 4EBNA 4BL3A 4NETA 1NZUA 1H0MA 3D3OA 4ZTKA 2O99A 3A0VA 1FOFA 1K4FA 3QP5A 3E98A 3E2LA 5EVLA 2XRNA 2ZLYA 5G4YA 3Q7ZA 2QJ7A 4GS9A 2QKPA 1TS6A 3TRCA 3IX4A 3K3DA 4KQQA 5E2FA 5F83A 4PM6A 4ZDXA 2WKEA 1ES4A 3D9YA 1PZOA 4PKYA 1OTEA 5F6AA 1FCNA 2V9AA 1MPLA 1U60A 1XA1A 3BECA 2B5RA 4KG2A 4OKPA 5KZHA 4XT2A 1YLPA 1JNUA 2GX5A 4PHTA 4CLCD 3GR2A 4S2PA 4C6YA 3PBRA 3BRMA 3FKWA 3I7JA 3MQQA 2VGJA 1OTIA 4BD1A 2A2LA 2V1ZA 1FILA 1XGJA 4S2NC 3V3SA 3F1PB 3OOVA 2BLSA 4M4XA 3RTYA 3ITAA 3PTEA 3AGEA 1GA9A 4R4RA 3UE0A 1ES5A 2P9VB 3VOLA 2WKHA 3U2AA 3ULFA 4ARZB 5HL1A 4N9KA 3WS4A 4RX3A 2EWWA 3E4QA 3P09A 5HL6A 2YKHA 3AGFA 1CEGA 5E2GA 4YOFA 2OOLA 3MZEA 4QWOA 5F1GA 3UN7A 4RYEA 2JKTI 3UB6A 5A8BA 3G2YA 3NHQA 3OC2A 3IX8A 2G7UA 4FUWA 2J3TD 3WS2A 3ICYA 3SZTA 3F1PA 4BQMA 3A3FA 4R23A 5CEBA 3GSGA 1PW1A 3VOYA 3M6HA 3GVBA 5FQ9A 2KOIA 1OJGA 3ZNYA 5EUAA 5J8XA 1GHIA 3OPPA 3DWZA 1FQGA 5DF7A 5AVFA 2P9VA 2M1CA 3T1SA 3OPHA 4ARZA 5IU1A 4RQ9A 4DE2A 3HLEA 3NDGA 3EQUA 4S2LA 2YKFA 1Y54A 1OTBA 1GHMA 3N4IA 4Y17A 1O07A 4KQRA 3M2JA 4NG2A 1XPBA 5HSQA 4GHIB 1FCMA 4ETXA 4HP4A 5F5YA 1YMXA 2I72A 5HX9A 3Q81A 1KVMA 2A24A 4HBUA 2P08A 2V0UA 3OBFA 1I5QA 4LLOB 2INWA 1L2SA 4GJ4A 3UY6A 3KSHA 4HIAA 3A0RA 3ISGA 3OCLA 3MSHA 4H8RA 1KE0A 4CLCA 4X6TA 2HJ9C 2VEAA 4KZAA 5GHXA 1A0KA 1XX2A 3LIBA 1E4DA 3ZNTA 5FI7A 4IBRA 4LV1A 2PBDP 4O8GA 1DP8A 4E3MA 1G28A 1Z09A 2ZC6B 3LY3A 4EUZA 3CI6A 3CUEC 4OLDA 2Y91A 4X53A 4GHIA 5TFQA 4L0LA 1CK3A 4FH4A 2PBYA 4EQ1A 4IEDA 3B3XA 3IF5A 2ZOHA 4KUOA 3MS6A 1YM1A 3MKEA 3NDEA 2VJWA 1SDNA 1TVFA 3GMWA 5A93A 3JVVA 4IHQA 1N9NA 3QNCA 3VE4A 1GSXA 3L7HA 1MWTA 4X1LA 4FSFA 2H10A 3KSIA 3T4TA 3HCYA 1WYBA 1S67L 4EEPA 3QHYA 3E4OA 3RFBA 2OWHA 2XSSA 3IH8A 1JWPA 4PM8A 2UWXA 4KZBA 3VFHA 4ZJ3A 1NXYA 4PM7A 1BZAA 4EWFA 1S66L 1O7EA 4II7A 4IVKA 1VQQA 2WUQA 4Q0HA 2VKSA 2VZWA 3T50A 3ZVTA 4WZ4A 3M2KA 2WKIA 4QY5A 1KGFA 4DXBA 2Q0OA 1I2WA 2XD5A 4MMNA 4KZ9A 2PHYA 3LYXA 4PKYG 1WA9A 1SDEA 3ZCZA 4NXGA 3KYQA 1YT4A 4GOGA 1KVLA 4BBVA 1X0OA 3T4SA 1JVJA 1PWGA 1FIKA 1L3LA 1OT9A 1W7FA 4IUHA 5DF9A 3IX3A 3GDIA 2JKRM 4E3LA 4EETB 5F82A 1ONHA 1DJBA 3MXRA 1MWSA 5CEDA 1ES2A 2VX8A 2JC7A 2O0YA 2Q9MA 2FZ0A 3G6OA 2EXAA 3MF0A 3IXGA 3PAGA 2KX6A 1S6RA 1ZTUA 1KE3A 4HNBA 2GZAA 4S2IA 1NY0A 5FAOA 5HW3A 3CPTB 3BFFA 1IYOA 5FQJA 1JTGA 2Y2GA 3LICA 2H28A 2ZJ9A 4UAAA 4HI4A 1V9ZA 5AVEA 5AQ9A 2MJ6A 5GLCA 4R4SA 2KLIA 3CLOA 5M1AA 1KGGA 4LCMA 3GTCA 1RP5A 4KG6A 1L0DA 3IBJA 4FOFA 2HF6A 1NJ4A 2EWVA 1K54C 2WKQA 2WZZA 5F68A 5FAPA 1MKMA 1G5UA 5BOHA 1NLZA 3WWXA 2XFTA 3LEZA 3EGDC 3MJQA 2AVXA 4LV0A 5CGWA 4P6ZS 5FQQA 2WGVA 4QY6A 2J3WA 4MBFA 3ZG8B 3CPTA 4RA7A 1HVBA 3VP2A 5HAPA 3DW0A 1DY6A 4DRTA 3KO6A 3TSGA 1F5MA 3UDXA 2ZC7A 4EQIA 4N1HA 4K0XA 3V3RA 4XUXA 3OCNA 3NJAA 3FPVA 5FASA 5HD3A 5EVIB 4F3LA 4EERA 1T18A 3N8LA 1LI0A 4BL2A 5A92A 4YFMA 4N92A 3T4KA 1T1CA 1YLWA 2HDUA 1K6RA 4UA6A 4Y7PA 3A3DA 4ZJ1A 2ZQCA 4OPQA 5EVEA 3TG9A 1K56D 5EFWA 2V20A 2NUPC 1BLHA 1H8YA 3LIDA 4AFIA 3S7QA 1TS7A 4DE3A 3AGDA 3QP4A 1PW8A 3UPOA 1HTZA 1LI9A 1YMSA 4UEYA 5EVIA 3UB7A 3UPPA 1XA7A 2Y8HA 4K08A 4U3TA 2O9CA 4E3KA 4MBKA 2JKGA 1CI8A 3WS5A 1XP4A 3LFVA 2Y2MA 4OPRA 5HARA 3LCEA 2CC1A 3VSLA 3EGXC 5L07A 4EXOA 5DFXA 4ZJ2A 2OWJA 3IF6C 1YQSA 2HPBA 4JF5A 1CQAA 2Y2JA 4KQDA 4QD4A 2D02A 3VOZA 3PBTA 5A91A 3G31A 4DJ2A 5CECA 3CMZA 3L9KA 4Y0OA 3QNBA 4CLCE 3NOTC 2HZ5A 4LRZE 1K57A 5L8MA 4L9EA 3MZDA 2Z6CA 3IHBA 3UMEA 3CZDA 5FL3A 1NWZA 2EX8A 5HPFA 3G30A 4QJGA 2EA9A 2V2FF 1FR6A 3HREA 4LRYC 1OMEA 3WS1A 3DTMA 3VSKA 1CEFA 5TBMB 5FEGA 3ZQ5A 3BM6A 4Y0UA 4K0WA 4EU0A 1IELA 3LI8A 3Q82A 3O86A 3A3JA 2FH5A 2HP5A 1DP9A 2Z2MB 5TJJA 1LL8A 2WADA 1SCWA 2B02A 4UHUA 3KX0X
chains in the Genus database with same CATH topology
4CLCA 4I38A 2HJ9C 2V1AA 2VEAA 2W3FA 2JN7A 4BBUA 4HHDA 3LIBA 4CQHA 4UQIS 4L9GA 4NEED 4E04A 5J4EA 1ODVA 4HJ4A 5DFYA 4O8GA 1DP8A 4Z1WA 1G28A 4GW9A 3UE6A 1UGUA 3FC7A 1P9RA 4IUKA 3K3CA 5HPIA 1XJ2A 3CI6A 3CUEC 3CAXA 4GHIA 1P9WA 2DMWA 4HOIA 4L0LA 5TBMA 1TS8A 2W3DA 3RH8B 4MN5A 3FG8A 1KOUA 1XFNA 4EQ1A 3KSGA 2ZOHA 2VV6A 4KUOA 1S4SA 1NRJA 4JGQA 1ZHHB 4HY8A 3D72A 1OT6A 2VJWA 4UQIM 3PBSA 2XA7S 1VHMA 2D01A 3LUQA 3JVVA 4IHQA 1N9NA 3VE4A 3MXQA 1GSXA 4JGOA 1S4RA 4JGRA 4R70A 4R6LA 3BJNA 4FSFA 3KSIA 3T4TA 3HCYA 2PD8A 2V0WA 1S67L 2PYPA 4EEPA 2A24B 3LI9A 4JGPA 4Y3IA 3E4OA 3KSFA 3RFBA 2OWHA 2XSSA 1Y28A 2XROA 2W3HA 4G3WA 3VV4A 1MC0A 1T1BA 1YAXA 4CLCB 2JKTM 2L0WA 2PDRA 2ZOIA 3S7PA 1YSPA 5DJTA 2VV8A 4DMZA 4EESA 4HH3A 3BQ8A 2M7VA 2XA7M 1S66L 1G6OA 4BMWA 4HJ3A 4II7A 2W3GA 2ZMVA 3EEAA 3FPWA 1IFQA 4HJ6A 5K5BA 2LB9A 3UB9A 4Q0HA 3T4JA 2VKSA 2VZWA 4LPZA 3T50A 2VLGA 3NOUC 4KUKA 3H7WB 4MN6A 5C5KA 5HDSA 4MMNA 2OAQ1 3PHYA 1XJ3A 4G3VA 3IS2B 4LRXC 3R4KA 2PHYA 3LYXA 4PKYG 1WA9A 3PBOA 1H8MA 4NXGA 3V67A 4WEKA 1D06A 3KYQA 3S7OA 2PT7A 3VE3A 1W63M 3TJZC 4I3AA 4BBVA 3F1OB 1DP6A 1X0OA 4WF0A 3B33A 5HDCA 4CLCC 2WKRA 3T4SA 2K31A 4Y5FA 1F98A 3H82B 1OT9A 2JHEA 4IUHA 1MZUA 4EEUA 1DRMA 2HGVA 2P04A 2QYBA 3P01A 5DF9A 3MMHA 3BW6A 4I5SA 4EW7A 4GLQA 1GSVA 3EWKA 2W1TB 3ZYTA 3GDIA 2W1RA 2JKRM 4I3JA 4EETB 5HDDA 2W0NA 2I9VA 4MDZA 2VX8A 5DJUA 1STZA 2B18A 2L4RA 3MR0A 2O0YA 4PAUA 2L1MA 2HV1A 2QWSA 3LR4A 2FZ0A 5DKLA 3G6OA 3H7WA 3MF0A 2VA0A 1D7EA 3B42A 3A0SA 2KX6A 5LBRA 5J7EA 3IS2A 4BBTA 3K2NA 2LB5A 3PXPA 4B93A 1ZTUA 1S1YA 3C8CA 2ZMFA 4HNBA 2GZAA 1VB6A 4O0PA 3T4LA 3JVUA 4L9FA 2K7SA 5KIZA 3GECA 1GSWA 3E0YA 3R7WB 3OLOA 3F1OA 3LICA 4NKPA 2H28A 3LR3A 5CX7A 4HI4A 1V9ZA 3H82A 3MQOA 2PR6A 5AVEA 2Z6DA 2MJ6A 4HQAA 5IS1A 2R78A 2KLIA 3CLOA 2W1TA 2WKPA 1T19A 4WLAA 2J3TC 5IT5A 3UB8A 3IBJA 4FOFA 2HF6A 2EWVA 4BWIA 4HP9A 2O9BA 4Y2FA 2ZBBA 3F1NB 3T4OA 1H3QA 2WKQA 4GS9B 4ETZA 5MC7A 5F68A 4ZRRA 2O9AA 3C38A 1MKMA 3O5YA 1NLZA 2OAP1 1OPXA 4NXFA 4HH2A 2QJ5A 2VGLS 5HWWA 3MJQA 3EGDC 3H9WA 4P6ZS 1W63Q 3PBQA 2M7UA 1LSXA 4ME4A 4QPRA 2J3WA 2V1BA 2GJ3A 1EW0A 1T1AA 4XT2B 5F69A 2NUTC 1UWNX 3R7WA 3CWFA 3KO6A 2K2NA 1F5MA 4H6JB 3LR0A 2VV7A 3UMDA 2W3EA 4OOLA 3BY9A 4MN7A 1NLYA 1XFQA 3D3OA 1N9OA 2O99A 3A0VA 2QHKA 5KSHA 1S1ZA 3E98A 2XRNA 1P97A 3PBNA 1TS0A 3F1NA 3OCNA 5HWTA 3NJAA 5G4YA 3CITA 2QJ7A 3FPVA 4G3KA 4GS9A 4WL9A 2QKPA 1XJ4A 1OTAA 4YNRA 2PYRA 3BY8A 4WELA 2VGLM 1TS6A 3TRCA 3K3DA 4DJ3A 5HD3A 3NOPC 4F3LA 2KDKA 4EERA 1T18A 3T4KA 4PKYA 1OTEA 5F6AA 2J80A 2V9AA 1T1CA 3BWLA 5I5LA 4XT2A 1OJ5A 2GNXA 1JNUA 5J3WA 3HJKA 2GX5A 4PHTA 1BYWA 3EEHA 4CLCD 4H6JA 1N9LA 1UWPX 3PBRA 1LSWA 5EFWA 3MQQA 4GCZA 2NUPC 1OTIA 3LIDA 2A2LA 4AFIA 3DBAA 1V9YA 3EQVA 3S7QA 2W27A 3LR5A 1TS7A 4WN5A 3F1PB 5AJGA 3OOVA 1XJ6A 3RTYA 4M4XA 3EOIA 3PYPA 3UE3A 3CUEA 4UEYA 3T4QA 2HJEA 3UB7A 3VOLA 3LIAA 3U2AA 3ULFA 4ARZB 4EUVA 2Y8HA 4K08A 2EWWA 3E4QA 2O9CA 5HL6A 2YKHA 2BASA 3IBRA 4YOFA 2OOLA 3LFVA 2JKTI 4R3AA 1F9IA 4WUJA 3UB6A 5A8BA 4B9OA 3NHQA 4YWZA 3OC2A 4I3IA 5G4ZA 3EGXC 2G7UA 2Y79A 4EXOA 4R38A 5DFXA 4F3LB 2OWJA 3E4PA 4KQDA 2J3TD 4Q0IA 3ICYA 3F1PA 2D02A 3PBTA 3TW8A 4DJ2A 3SW1A 4BJPA 3PR6A 1YSQA 4MCWA 3LIEA 4NXEA 4OOMA 4KQOA 3W2ZA 2KOIA 1OJGA 5HD5A 4CLCE 3P7NA 3NOTC 2IA2A 4LRZE 1OTDA 5AVFA 2M1CA 3C30A 5L8MA 4L9EA 5IU1A 4ARZA 4RQ9A 2P7JA 2Z6CA 3MFXA 3TE8A 3S7NA 1TD5A 3UMEA 3EQUA 5FL3A 1NWZA 2YKFA 5HPFA 1OTBA 4DN0A 4Q0JA 3B47A 1YKDA 2EA9A 1LSVA 4LRYC 1LT0A 5HSQA 4GHIB 3C2WA 2PD7A 4ETXA 4P6ZM 4HP4A 5TBMB 3MQ0A 5F5YA 3ZQ5A 2JKRI 5HWVA 3KYZA 4IJGA 1TF1A 4NXBA 4WEJA 2A24A 4EU0A 3HJIA 2P08A 5HZHA 3LI8A 2V0UA 3OBFA 5DKKA 2FH5A 4LLOB 1DP9A 3LIFA 2INWA 5TJJA 1P0ZA 2PR5A 1LL8A 4I39A 3BQAA 4GJ4A 1IOUA 3KSHA 2B02A 4HIAA 3A0RA 3OCLA 2CMNA 4O01A 3KX0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I38 A;  2V1A A;  2VEA A;  4BBU A;  2JN7 A;  4HHD A;  3LIB A;  4L9G A;  4E04 A;  5J4E A;  1ODV A;  4HJ4 A;  1DP8 A;  1G28 A;  4GW9 A;  3UE6 A;  1UGU A;  3FC7 A;  3K3C A;  1XJ2 A;  3CAX A;  4GHI A;  4HOI A;  5TBM A;  1TS8 A;  3RH8 B;  4MN5 A;  3FG8 A;  1KOU A;  1XFN A;  4EQ1 A;  2ZOH A;  2VV6 A;  4KUO A;  1S4S A;  4JGQ A;  4HY8 A;  3D72 A;  1OT6 A;  2D01 A;  3LUQ A;  1N9N A;  3VE4 A;  3MXQ A;  1GSX A;  4JGO A;  1S4R A;  4JGR A;  4R70 A;  4R6L A;  2PD8 A;  2V0W A;  1S67 L;  2PYP A;  4EEP A;  2A24 B;  3LI9 A;  4JGP A;  3E4O A;  2OWH A;  1Y28 A;  1T1B A;  2L0W A;  2PDR A;  2ZOI A;  5DJT A;  2VV8 A;  4EES A;  4HH3 A;  1S66 L;  4HJ3 A;  4HJ6 A;  3UB9 A;  4LPZ A;  3T50 A;  2VLG A;  3NOU C;  4KUK A;  3H7W B;  4MN6 A;  5HDS A;  3PHY A;  1XJ3 A;  3IS2 B;  4LRX C;  2PHY A;  3LYX A;  4PKY G;  1WA9 A;  4NXG A;  1D06 A;  3VE3 A;  4I3A A;  4BBV A;  3F1O B;  1DP6 A;  1X0O A;  4WF0 A;  3B33 A;  5HDC A;  2WKR A;  1F98 A;  3H82 B;  1OT9 A;  2JHE A;  1MZU A;  4EEU A;  1DRM A;  4EW7 A;  4I5S A;  1GSV A;  3EWK A;  3GDI A;  4I3J A;  4EET B;  5HDD A;  2W0N A;  2I9V A;  5DJU A;  2L4R A;  3MR0 A;  2L1M A;  2HV1 A;  2QWS A;  5DKL A;  3G6O A;  3H7W A;  1D7E A;  3A0S A;  2KX6 A;  5J7E A;  3IS2 A;  4BBT A;  1S1Y A;  3C8C A;  4HNB A;  1VB6 A;  4L9F A;  2K7S A;  5KIZ A;  3GEC A;  1GSW A;  3OLO A;  3F1O A;  3LIC A;  2H28 A;  4HI4 A;  1V9Z A;  3H82 A;  3MQO A;  2PR6 A;  5AVE A;  2Z6D A;  4HQA A;  5IS1 A;  2R78 A;  3CLO A;  2WKP A;  1T19 A;  4WLA A;  3UB8 A;  4HP9 A;  2ZBB A;  3F1N B;  2WKQ A;  4GS9 B;  5F68 A;  4NXF A;  4HH2 A;  2QJ5 A;  5HWW A;  3MJQ A;  3H9W A;  1LSX A;  2V1B A;  2GJ3 A;  1EW0 A;  1T1A A;  4XT2 B;  5F69 A;  1UWN X;  3CWF A;  4H6J B;  2VV7 A;  3UMD A;  3BY9 A;  1XFQ A;  1N9O A;  3A0V A;  2QHK A;  1S1Z A;  1P97 A;  1TS0 A;  3F1N A;  5HWT A;  3NJA A;  5G4Y A;  2QJ7 A;  4GS9 A;  4WL9 A;  1XJ4 A;  2QKP A;  1OTA A;  2PYR A;  3BY8 A;  1TS6 A;  3K3D A;  4DJ3 A;  5HD3 A;  3NOP C;  4F3L A;  2KDK A;  4EER A;  1T18 A;  4PKY A;  1OTE A;  5F6A A;  2J80 A;  2V9A A;  1T1C A;  3BWL A;  5I5L A;  4XT2 A;  1OJ5 A;  5J3W A;  1JNU A;  3HJK A;  1BYW A;  3EEH A;  4H6J A;  1N9L A;  1UWP X;  1LSW A;  5EFW A;  3MQQ A;  4GCZ A;  1OTI A;  3LID A;  1V9Y A;  2W27 A;  1TS7 A;  4WN5 A;  3F1P B;  1XJ6 A;  3RTY A;  4M4X A;  3PYP A;  3UB7 A;  3VOL A;  3LIA A;  3ULF A;  4K08 A;  3E4Q A;  2YKH A;  2BAS A;  3IBR A;  2OOL A;  4R3A A;  1F9I A;  4WUJ A;  3UB6 A;  5A8B A;  4B9O A;  3NHQ A;  4YWZ A;  4I3I A;  5G4Z A;  4EXO A;  4R38 A;  4F3L B;  2OWJ A;  3E4P A;  4KQD A;  3ICY A;  3F1P A;  2D02 A;  4DJ2 A;  3SW1 A;  3LIE A;  4NXE A;  5HD5 A;  1OJG A;  3P7N A;  3NOT C;  4LRZ E;  1OTD A;  5AVF A;  2M1C A;  4L9E A;  5IU1 A;  4RQ9 A;  2P7J A;  2Z6C A;  3MFX A;  3UME A;  1NWZ A;  2YKF A;  1OTB A;  2EA9 A;  1LSV A;  4LRY C;  1LT0 A;  5HSQ A;  4GHI B;  3C2W A;  2PD7 A;  4HP4 A;  5TBM B;  5F5Y A;  3ZQ5 A;  5HWV A;  4NXB A;  2A24 A;  3HJI A;  5HZH A;  3LI8 A;  2V0U A;  5DKK A;  4LLO B;  1DP9 A;  3LIF A;  2INW A;  1P0Z A;  2PR5 A;  1LL8 A;  4I39 A;  2B02 A;  4HIA A;  3A0R A;  2CMN A;  3KX0 X; 
#chains in the Genus database with same CATH topology
 2Y2K A;  3Q07 A;  4I38 A;  2Y4A A;  4X68 A;  1K56 A;  4OQG A;  4BBU A;  1DJA A;  3O88 A;  4CQH A;  3RXW A;  4UQI S;  2Y2Q A;  3U4L P;  5J4E A;  1ODV A;  3VP1 A;  3T1Q B;  1LHY A;  1MKI A;  4R0Q A;  3A3E A;  5HPI A;  4BEN A;  1P9W A;  5FDH A;  2DMW A;  4HOI A;  5GHY A;  1K25 A;  1BUL A;  2WYX A;  5TBM A;  1SKO B;  3C4O A;  3RH8 B;  4MN5 A;  3FG8 A;  2WGW B;  5JYP A;  4JBF A;  4DDY A;  3DTK A;  1NRJ A;  1KGE A;  5GHZ A;  3LEQ A;  3D72 A;  1OT6 A;  4UQI M;  1VHM A;  5E2E A;  1ONG A;  4OPZ A;  4GB7 A;  4JGR A;  4R70 A;  2ZC5 B;  3BJN A;  1L0G A;  4XUZ A;  4F94 A;  2PD8 A;  4LV2 A;  2PYP A;  2A24 B;  2PU2 A;  4X69 A;  5CXW A;  3T1X A;  5FI2 A;  3T12 B;  1Y28 A;  2W3H A;  4E3N A;  2J8Y A;  1AXB A;  2XGN A;  2Y2L A;  2OLU A;  1MC0 A;  1T1B A;  3IT9 A;  1SKO A;  4CLC B;  2JKT M;  2L0W A;  2ZOI A;  5DJT A;  3ZG9 B;  4HH3 A;  3G2Z A;  2EX9 A;  2M7V A;  2WGW A;  5CHM A;  4ZAM A;  3ZG0 A;  4HJ3 A;  1ERM A;  3UDF A;  2WAF A;  2ZM8 A;  3FPW A;  5CER A;  4HJ6 A;  1JWV A;  2H5S A;  3W8K A;  3T4J A;  2V8F A;  4OOY A;  1GHP A;  2VLG A;  2Y2I A;  3NOU C;  4MN6 A;  1H8Z A;  5HDS A;  4LEN A;  1XJ3 A;  4G3V A;  3SOI A;  3R4K A;  5I94 A;  3NCK A;  1D06 A;  1W63 M;  2XD1 A;  1XGI A;  3TJZ C;  3MKF A;  4I3A A;  1L0F A;  2WKR A;  1ZG6 A;  3N7W A;  1MZU A;  2FFY A;  1DRM A;  2P04 A;  2QYB A;  3P01 A;  4EW7 A;  3ZYT A;  2W1R A;  1ESI A;  3O87 A;  2Y55 A;  2W0N A;  4WM9 A;  2Y2N A;  2XDM A;  4ID4 A;  5DJU A;  1STZ A;  4PAU A;  1SHV A;  4S2J A;  2HV1 A;  5DKL A;  5DTS A;  1PI5 A;  1ZG4 A;  3B42 A;  2ZL1 B;  2J9P A;  5DVA A;  5HFO A;  4S2N A;  1FSW A;  2WGI A;  3HBR A;  4WZ5 C;  3C7U A;  3HUN A;  4GDB A;  4B93 A;  5EOO A;  2Q9N A;  2ZMF A;  4KG5 A;  5KIZ A;  3GEC A;  2QMI A;  3OLO A;  4MLL A;  1Q2Q A;  3V5M A;  3MQO A;  4HQA A;  2X02 A;  2R78 A;  4WLA A;  3ZHH A;  5HAQ A;  4GDN A;  3F1N B;  1BTL A;  3T4O A;  1H3Q A;  4ETZ A;  3IXD A;  3C38 A;  3ITB A;  5FQI A;  2ZL1 A;  1H5X A;  2OAP 1;  1LLB A;  4NXF A;  2QJ5 A;  2VGL S;  5HWW A;  3H9W A;  2BTF P;  1W63 Q;  2WK0 A;  1LSX A;  2V1B A;  2G2W A;  1EW0 A;  2K2N A;  3TOI A;  1IYQ A;  4H6J B;  2ZM0 A;  2VV7 A;  3UMD A;  2X01 A;  2ZC4 B;  3BY9 A;  3GQZ A;  1XFQ A;  2XQZ A;  3OPR A;  1HZO A;  3QP8 A;  1W79 A;  1GCE A;  4FD8 A;  4JXS A;  3IXB A;  3GRJ A;  3PBN A;  1TS0 A;  3F1N A;  4U0X A;  3C7V A;  3ZDJ A;  4G3K A;  1ES3 A;  2HDR A;  2PYR A;  1CF0 A;  2VGL M;  4A5R A;  4DJ3 A;  2B95 A;  3NOP C;  1IYP A;  4DXC A;  4RX2 A;  3FV7 A;  4E6W A;  3PAE A;  2ZM2 A;  2J80 A;  5M19 A;  4P85 A;  5I5L A;  2E8J A;  1OJ5 A;  1ALQ A;  2Y2O A;  4Z9Q A;  3EEH A;  4HEF A;  4H6J A;  1N9L A;  3DTI A;  1UWP X;  1S0W A;  4GCZ A;  1ESU A;  1FSY A;  2W27 A;  3LR5 A;  1PFL A;  2PAV P;  1XJ6 A;  2R9X A;  3CUE A;  2ZC3 B;  3ZG7 B;  1EI5 A;  4KZ7 A;  1XKZ A;  2JKF A;  3V50 A;  3LIA A;  2X71 A;  3ZFZ A;  2C6W B;  4EUV A;  4NK3 A;  1VET B;  1AWI A;  2BAS A;  3IBR A;  5FAT A;  2XH9 A;  4R3A A;  4WUJ A;  4B9O A;  4YWZ A;  1C3B A;  5G4Z A;  4OP8 A;  1YLT A;  5FQM A;  4R38 A;  4F3L B;  3W4O A;  4JXV A;  4S2O A;  2OLV A;  4Q0I A;  1NRF A;  3FWL A;  3HUO A;  3SW1 A;  4BJP A;  1YSQ A;  3LIE A;  3NUL A;  4NXE A;  4OOM A;  4N1X A;  1BT5 A;  3W2Z A;  1IEM A;  2IA2 A;  1OTD A;  2R9W A;  1YLJ A;  3S1Y A;  1D1J A;  2Y2H A;  1J9M A;  1BSG A;  2XLN A;  2P7J A;  4QB8 A;  4B88 A;  3MFX A;  4GNU A;  1K55 C;  3TE8 A;  1VET A;  2QZ6 A;  4E3J A;  4Q0J A;  1YKD A;  1VEU B;  3JYI A;  1LT0 A;  3VP4 A;  2OSU A;  1W5D A;  3C2W A;  2PD7 A;  3LGO A;  1ZC2 A;  4P6Z M;  3MQ0 A;  5HWV A;  3KYZ A;  3HL9 A;  4IJG A;  1CJF A;  4IBX A;  1PYY A;  4NXB A;  1RGY A;  4S2K A;  5DKK A;  1P0Z A;  2HDQ A;  4I39 A;  5GLB A;  4X1M A;  3O3V A;  1PIO A;  2CMN A;  1ACF A;  2H0Y A;  4UA9 A;  3G35 A;  2V1A A;  4HHD A;  4LFU A;  1RGZ A;  2IWC A;  4PMA A;  4NEE D;  2XK1 A;  1YLZ A;  4E04 A;  2EX2 A;  5DFY A;  1PZP A;  4JF4 A;  1P9R A;  3K3C A;  5GLD A;  1VEU A;  4DKI A;  3CAX A;  3IWO A;  2V8C A;  2VGK A;  3QP1 A;  2W3D A;  1XFN A;  3M6B A;  4C75 A;  5CGX A;  5TGF A;  3RXX A;  2VV6 A;  2ZD8 A;  3G34 A;  1VM1 A;  4JPM A;  4HY8 A;  3PBS A;  5AQB A;  2XA7 S;  4ESP A;  4IVI A;  1TDL A;  1F2K A;  1E3U D;  3N6I A;  1S4R A;  2XF3 A;  3SS3 A;  1M40 A;  3UE1 A;  3SH8 A;  5L10 A;  3D4F A;  3S22 A;  1RCJ A;  4GD8 A;  2V0W A;  3NI9 A;  3LI9 A;  4Y3I A;  1K54 A;  4OP5 A;  2GDN A;  1LL5 A;  4EBP A;  3VV4 A;  3MXS A;  2PDR A;  4EES A;  2P74 A;  5L09 A;  2XA7 M;  4R3J A;  3CHW P;  1HLU P;  1G6O A;  2DNS A;  4CJN A;  3UB5 P;  1NYY A;  1IFQ A;  2ZQ8 A;  5K5B A;  3UB9 A;  4LGW A;  3SH9 A;  4LPZ A;  1J3W A;  5DTK A;  5C5K A;  3IXH A;  1K55 A;  2OAQ 1;  2EX6 A;  3BEB A;  3IS2 B;  3ZVW A;  1MWR A;  1BUE A;  4DF6 A;  1H8M A;  1MWU A;  3S7O A;  3BFE A;  3VFF A;  3BLM A;  4RVA A;  4E6X A;  3DAV A;  4CLC C;  1DP6 A;  2PRF A;  2WZX A;  2K31 A;  2JHE A;  2HGV A;  4P0M A;  3MMH A;  4I5S A;  3W4Q A;  4GLQ A;  4HBT A;  4PM5 A;  3EWK A;  2W1T B;  5FI6 A;  3BFD A;  3BYD A;  1EWZ A;  2ZQ7 A;  3UO9 A;  5E43 A;  4MNR A;  4JXG A;  5EPH A;  4MDZ A;  3MZF A;  2B18 A;  3MR0 A;  1IYS A;  1TDG A;  5HAI A;  2G2U A;  2VA0 A;  1D7E A;  2J9O A;  4FCF A;  3A0S A;  3IF6 B;  2EXB A;  5M18 A;  3E2K A;  3IS2 A;  4EBL A;  4BBT A;  3K2N A;  2LB5 A;  3PXP A;  3C8C A;  1BLP A;  4O0P A;  3T4L A;  4OQ0 A;  5G18 A;  4L9F A;  2K7S A;  3R7W B;  3MFD A;  1E25 A;  3Q1F A;  2Y2P A;  1G6A A;  3LR3 A;  1E3U A;  2HP6 A;  2JE5 A;  5D3O A;  4X25 A;  5IS1 A;  4UA7 A;  2W1T A;  2WKP A;  5GLA A;  1T19 A;  1MBL A;  2J3T C;  3HLC A;  4HES A;  5IT5 A;  3UB8 A;  1W8Q A;  3HVF A;  2EFX A;  2C5W B;  3HLG A;  3P98 A;  4BWI A;  3V39 A;  4HP9 A;  4Y2F A;  5EOE A;  3UPN A;  1PNE A;  1N9B A;  2DRW A;  5EEC A;  3NC8 A;  5E2H A;  5GL9 A;  3IF6 A;  3HLF A;  5L2F A;  1OPX A;  3IH9 A;  4QPR A;  2GJ3 A;  2NUT C;  1UWN X;  1G68 A;  3R7W A;  1K4E A;  3NY4 A;  5DTT A;  1HD8 A;  3LR0 A;  2W3E A;  2JCH A;  2ZQ9 A;  4OOL A;  4B4Z A;  5FQK A;  4MN7 A;  1Q2P A;  5CGS A;  4N9L A;  1NLY A;  1N9O A;  1KDW A;  4WBG A;  2QHK A;  5KSH A;  1S1Z A;  3ZGA B;  4M3K A;  1P97 A;  4QU3 A;  4FH2 A;  5HWT A;  1K6S A;  3CIT A;  4WL9 A;  4BD0 A;  3HLD A;  1XJ4 A;  1OTA A;  4YNR A;  3BY8 A;  4WEL A;  3GV9 A;  4KEN B;  2RCX A;  5JYO A;  2KDK A;  4JLF A;  3HUM A;  4DDS A;  2ZMA A;  2A49 A;  3WRT A;  1NYM A;  3BWL A;  3OPL A;  2GNX A;  5J3W A;  3HJK A;  4FTX A;  4Y15 A;  1YPR A;  1BYW A;  1FCO A;  1LSW A;  1I2S A;  4OH0 A;  3DBA A;  1V9Y A;  3EQV A;  4WN5 A;  5AJG A;  4MBH A;  2A3U A;  3EOI A;  4Y0T A;  3SH7 A;  3PYP A;  3UE3 A;  3T4Q A;  2HJE A;  1JWZ A;  2E8I A;  1DJC A;  5F1F A;  1SKF A;  4OPY A;  3IWQ A;  3VP0 A;  4GN2 A;  5FEF A;  1TEM A;  1F9I A;  1JTD A;  5CHJ A;  4I3I A;  2Y79 A;  5CHU A;  2BG1 A;  3E4P A;  4KZ5 A;  5KMW A;  3C5A A;  5FAQ A;  4D60 A;  1CI9 A;  4JF6 A;  3TW8 A;  3PR6 A;  4MCW A;  4KQO A;  5HD5 A;  3P7N A;  1YLY A;  3CJM A;  5EE8 A;  4EV4 A;  3C30 A;  3QP2 A;  3CG5 A;  4P87 A;  4KZ8 A;  5U47 A;  4X56 A;  2IWB A;  3S7N A;  1TD5 A;  4C3Q A;  3HLW A;  5EM0 A;  3NEC A;  4DN0 A;  3NBL A;  2FFF B;  3B47 A;  5CRF A;  3QP6 A;  1LSV A;  1QMF A;  4PPR A;  1NZO A;  2HP9 A;  4R3B A;  2JKR I;  4Q8I A;  1TF1 A;  4WEJ A;  3W4P A;  3HJI A;  5HZH A;  3BLS A;  3A3I A;  3BFG A;  5FA7 A;  3LIF A;  4P6B A;  2H0T A;  2PR5 A;  3BQA A;  2Y59 A;  1IOU A;  3NIA A;  3VMA A;  4O01 A;  3BFC A;  2W3F A;  2JN7 A;  1KE4 A;  1L0E A;  5TR7 A;  3WS0 A;  4YIN A;  4R1G A;  4L9G A;  1BLC A;  1ZKJ A;  3Q7V B;  1MY8 A;  4HJ4 A;  4WMC D;  4KZ3 A;  4Z1W A;  1XXM A;  4GW9 A;  4O7D A;  3UE6 A;  1UGU A;  3FC7 A;  4IUK A;  3KYE A;  3DTE A;  1XJ2 A;  4OQI A;  1TS8 A;  5EVI C;  4LCL A;  1KOU A;  2UV0 E;  4DE0 A;  5CTN A;  3KSG A;  2RL3 A;  2HDS A;  4WZ5 A;  1K0K A;  1QME A;  1S4S A;  1WYC A;  1W8Y A;  4S2M A;  4JGQ A;  1ZHH B;  3S4X A;  3T1R A;  2D01 A;  3LUQ A;  5EVI D;  1Z6F A;  3MBZ A;  3HLB A;  1SZV A;  1PI4 A;  3MXQ A;  4JGO A;  1BLS A;  3DWK A;  1ERQ A;  4R6L A;  2OV5 A;  3C4P A;  3Q7V A;  5CTM A;  4JGP A;  4LV3 A;  3KSF A;  1LL9 A;  4GD6 A;  3G32 A;  2XRO A;  3OZH A;  1M6K A;  5IHV A;  4G3W A;  4GZB A;  1YAX A;  4WYY A;  4BLM A;  4B4X A;  3S7P A;  1YSP A;  1K57 C;  2VV8 A;  4DMZ A;  3BQ8 A;  4OQH A;  3FYZ A;  1ERO A;  3UDI A;  4K91 A;  4BMW A;  2W3G A;  3UNW A;  2ZMV A;  3EEA A;  1Y4O A;  2LB9 A;  1IKI A;  4JXW A;  4KZ4 A;  1GA0 A;  3N8R A;  1MXO A;  5A90 A;  4KUK A;  3H7W B;  1FR1 A;  3FZC A;  3IWI A;  1KDS A;  2J7V A;  3LY4 A;  3PHY A;  5AQ7 A;  4ZBE A;  4OVD A;  4LRX C;  2DCF A;  1K38 A;  4OLG A;  3PBO A;  2PU4 A;  3V67 A;  4WEK A;  3SS4 A;  2PT7 A;  4OON A;  3VE3 A;  3F1O B;  4WF0 A;  5HDC A;  3B33 A;  3RJU A;  3IHA A;  1F98 A;  4Y5F A;  1PWC A;  3H82 B;  4JKT A;  4EEU A;  3BW6 A;  2QPN A;  1GSV A;  4MEZ A;  4X55 A;  3G4P A;  4I3J A;  5HDD A;  4WMC A;  2XR0 A;  2I9V A;  4CPK A;  2L4R A;  3VP3 A;  1WE4 A;  2L1M A;  2QWS A;  3FKV A;  3LR4 A;  3H7W A;  4DE1 A;  1PRQ A;  4XXR A;  5LBR A;  5AQA A;  3SS5 A;  5J7E A;  5KSC A;  2IWD A;  1IKG A;  2JBF A;  1S1Y A;  4U0T A;  1VB6 A;  4QHC A;  3LO7 A;  3JVU A;  2ACG A;  1N4O A;  1GSW A;  3E0Y A;  2ZQA A;  3F1O A;  5FDS A;  4NKP A;  5CX7 A;  3H82 A;  5FSR A;  3N8S A;  2PR6 A;  2Z6D A;  4D2O A;  4KZ6 A;  2WAE A;  2O9B A;  4GKU A;  2VK3 A;  2ZBB A;  5DF8 A;  4GS9 B;  4E3O A;  5EV0 A;  1PWD A;  5MC7 A;  2EFU A;  4ZRR A;  2O9A A;  5EM1 A;  3O5Y A;  3ZG5 A;  2ZQD A;  4HH2 A;  3IQA A;  2XEP A;  2Z2L B;  3PBQ A;  2M7U A;  4ME4 A;  3WRZ A;  4E3I A;  4PM9 A;  1T1A A;  4XT2 B;  5F69 A;  3JPU A;  3CWF A;  2XFS A;  4Y13 A;  4EBN A;  4BL3 A;  4NET A;  1NZU A;  1H0M A;  3D3O A;  4ZTK A;  2O99 A;  3A0V A;  1FOF A;  1K4F A;  3QP5 A;  3E98 A;  3E2L A;  5EVL A;  2XRN A;  2ZLY A;  5G4Y A;  3Q7Z A;  2QJ7 A;  4GS9 A;  2QKP A;  1TS6 A;  3TRC A;  3IX4 A;  3K3D A;  4KQQ A;  5E2F A;  5F83 A;  4PM6 A;  4ZDX A;  2WKE A;  1ES4 A;  3D9Y A;  1PZO A;  4PKY A;  1OTE A;  5F6A A;  1FCN A;  2V9A A;  1MPL A;  1U60 A;  1XA1 A;  3BEC A;  2B5R A;  4KG2 A;  4OKP A;  5KZH A;  4XT2 A;  1YLP A;  1JNU A;  2GX5 A;  4PHT A;  4CLC D;  3GR2 A;  4S2P A;  4C6Y A;  3PBR A;  3BRM A;  3FKW A;  3I7J A;  3MQQ A;  2VGJ A;  1OTI A;  4BD1 A;  2A2L A;  2V1Z A;  1FIL A;  1XGJ A;  4S2N C;  3V3S A;  3F1P B;  3OOV A;  2BLS A;  4M4X A;  3RTY A;  3ITA A;  3PTE A;  3AGE A;  1GA9 A;  4R4R A;  3UE0 A;  1ES5 A;  2P9V B;  3VOL A;  2WKH A;  3U2A A;  3ULF A;  4ARZ B;  5HL1 A;  4N9K A;  3WS4 A;  4RX3 A;  2EWW A;  3E4Q A;  3P09 A;  5HL6 A;  2YKH A;  3AGF A;  1CEG A;  5E2G A;  4YOF A;  2OOL A;  3MZE A;  4QWO A;  5F1G A;  3UN7 A;  4RYE A;  2JKT I;  3UB6 A;  5A8B A;  3G2Y A;  3NHQ A;  3OC2 A;  3IX8 A;  2G7U A;  4FUW A;  2J3T D;  3WS2 A;  3ICY A;  3SZT A;  3F1P A;  4BQM A;  3A3F A;  4R23 A;  5CEB A;  3GSG A;  1PW1 A;  3VOY A;  3M6H A;  3GVB A;  5FQ9 A;  2KOI A;  1OJG A;  3ZNY A;  5EUA A;  5J8X A;  1GHI A;  3OPP A;  3DWZ A;  1FQG A;  5DF7 A;  5AVF A;  2P9V A;  2M1C A;  3T1S A;  3OPH A;  4ARZ A;  5IU1 A;  4RQ9 A;  4DE2 A;  3HLE A;  3NDG A;  3EQU A;  4S2L A;  2YKF A;  1Y54 A;  1OTB A;  1GHM A;  3N4I A;  4Y17 A;  1O07 A;  4KQR A;  3M2J A;  4NG2 A;  1XPB A;  5HSQ A;  4GHI B;  1FCM A;  4ETX A;  4HP4 A;  5F5Y A;  1YMX A;  2I72 A;  5HX9 A;  3Q81 A;  1KVM A;  2A24 A;  4HBU A;  2P08 A;  2V0U A;  3OBF A;  1I5Q A;  4LLO B;  2INW A;  1L2S A;  4GJ4 A;  3UY6 A;  3KSH A;  4HIA A;  3A0R A;  3ISG A;  3OCL A;  3MSH A;  4H8R A;  1KE0 A;  4CLC A;  4X6T A;  2HJ9 C;  2VEA A;  4KZA A;  5GHX A;  1A0K A;  1XX2 A;  3LIB A;  1E4D A;  3ZNT A;  5FI7 A;  4IBR A;  4LV1 A;  2PBD P;  4O8G A;  1DP8 A;  4E3M A;  1G28 A;  1Z09 A;  2ZC6 B;  3LY3 A;  4EUZ A;  3CI6 A;  3CUE C;  4OLD A;  2Y91 A;  4X53 A;  4GHI A;  5TFQ A;  4L0L A;  1CK3 A;  4FH4 A;  2PBY A;  4EQ1 A;  4IED A;  3B3X A;  3IF5 A;  2ZOH A;  4KUO A;  3MS6 A;  1YM1 A;  3MKE A;  3NDE A;  2VJW A;  1SDN A;  1TVF A;  3GMW A;  5A93 A;  3JVV A;  4IHQ A;  1N9N A;  3QNC A;  3VE4 A;  1GSX A;  3L7H A;  1MWT A;  4X1L A;  4FSF A;  2H10 A;  3KSI A;  3T4T A;  3HCY A;  1WYB A;  1S67 L;  4EEP A;  3QHY A;  3E4O A;  3RFB A;  2OWH A;  2XSS A;  3IH8 A;  1JWP A;  4PM8 A;  2UWX A;  4KZB A;  3VFH A;  4ZJ3 A;  1NXY A;  4PM7 A;  1BZA A;  4EWF A;  1S66 L;  1O7E A;  4II7 A;  4IVK A;  1VQQ A;  2WUQ A;  4Q0H A;  2VKS A;  2VZW A;  3T50 A;  3ZVT A;  4WZ4 A;  3M2K A;  2WKI A;  4QY5 A;  1KGF A;  4DXB A;  2Q0O A;  1I2W A;  2XD5 A;  4MMN A;  4KZ9 A;  2PHY A;  3LYX A;  4PKY G;  1WA9 A;  1SDE A;  3ZCZ A;  4NXG A;  3KYQ A;  1YT4 A;  4GOG A;  1KVL A;  4BBV A;  1X0O A;  3T4S A;  1JVJ A;  1PWG A;  1FIK A;  1L3L A;  1OT9 A;  1W7F A;  4IUH A;  5DF9 A;  3IX3 A;  3GDI A;  2JKR M;  4E3L A;  4EET B;  5F82 A;  1ONH A;  1DJB A;  3MXR A;  1MWS A;  5CED A;  1ES2 A;  2VX8 A;  2JC7 A;  2O0Y A;  2Q9M A;  2FZ0 A;  3G6O A;  2EXA A;  3MF0 A;  3IXG A;  3PAG A;  2KX6 A;  1S6R A;  1ZTU A;  1KE3 A;  4HNB A;  2GZA A;  4S2I A;  1NY0 A;  5FAO A;  5HW3 A;  3CPT B;  3BFF A;  1IYO A;  5FQJ A;  1JTG A;  2Y2G A;  3LIC A;  2H28 A;  2ZJ9 A;  4UAA A;  4HI4 A;  1V9Z A;  5AVE A;  5AQ9 A;  2MJ6 A;  5GLC A;  4R4S A;  2KLI A;  3CLO A;  5M1A A;  1KGG A;  4LCM A;  3GTC A;  1RP5 A;  4KG6 A;  1L0D A;  3IBJ A;  4FOF A;  2HF6 A;  1NJ4 A;  2EWV A;  1K54 C;  2WKQ A;  2WZZ A;  5F68 A;  5FAP A;  1MKM A;  1G5U A;  5BOH A;  1NLZ A;  3WWX A;  2XFT A;  3LEZ A;  3EGD C;  3MJQ A;  2AVX A;  4LV0 A;  5CGW A;  4P6Z S;  5FQQ A;  2WGV A;  4QY6 A;  2J3W A;  4MBF A;  3ZG8 B;  3CPT A;  4RA7 A;  1HVB A;  3VP2 A;  5HAP A;  3DW0 A;  1DY6 A;  4DRT A;  3KO6 A;  3TSG A;  1F5M A;  3UDX A;  2ZC7 A;  4EQI A;  4N1H A;  4K0X A;  3V3R A;  4XUX A;  3OCN A;  3NJA A;  3FPV A;  5FAS A;  5HD3 A;  5EVI B;  4F3L A;  4EER A;  1T18 A;  3N8L A;  1LI0 A;  4BL2 A;  5A92 A;  4YFM A;  4N92 A;  3T4K A;  1T1C A;  1YLW A;  2HDU A;  1K6R A;  4UA6 A;  4Y7P A;  3A3D A;  4ZJ1 A;  2ZQC A;  4OPQ A;  5EVE A;  3TG9 A;  1K56 D;  5EFW A;  2V20 A;  2NUP C;  1BLH A;  1H8Y A;  3LID A;  4AFI A;  3S7Q A;  1TS7 A;  4DE3 A;  3AGD A;  3QP4 A;  1PW8 A;  3UPO A;  1HTZ A;  1LI9 A;  1YMS A;  4UEY A;  5EVI A;  3UB7 A;  3UPP A;  1XA7 A;  2Y8H A;  4K08 A;  4U3T A;  2O9C A;  4E3K A;  4MBK A;  2JKG A;  1CI8 A;  3WS5 A;  1XP4 A;  3LFV A;  2Y2M A;  4OPR A;  5HAR A;  3LCE A;  2CC1 A;  3VSL A;  3EGX C;  5L07 A;  4EXO A;  5DFX A;  4ZJ2 A;  2OWJ A;  3IF6 C;  1YQS A;  2HPB A;  4JF5 A;  1CQA A;  2Y2J A;  4KQD A;  4QD4 A;  2D02 A;  3VOZ A;  3PBT A;  5A91 A;  3G31 A;  4DJ2 A;  5CEC A;  3CMZ A;  3L9K A;  4Y0O A;  3QNB A;  4CLC E;  3NOT C;  2HZ5 A;  4LRZ E;  1K57 A;  5L8M A;  4L9E A;  3MZD A;  2Z6C A;  3IHB A;  3UME A;  3CZD A;  5FL3 A;  1NWZ A;  2EX8 A;  5HPF A;  3G30 A;  4QJG A;  2EA9 A;  2V2F F;  1FR6 A;  3HRE A;  4LRY C;  1OME A;  3WS1 A;  3DTM A;  3VSK A;  1CEF A;  5TBM B;  5FEG A;  3ZQ5 A;  3BM6 A;  4Y0U A;  4K0W A;  4EU0 A;  1IEL A;  3LI8 A;  3Q82 A;  3O86 A;  3A3J A;  2FH5 A;  2HP5 A;  1DP9 A;  2Z2M B;  5TJJ A;  1LL8 A;  2WAD A;  1SCW A;  2B02 A;  4UHU A;  3KX0 X; 
#chains in the Genus database with same CATH homology
 4CLC A;  4I38 A;  2HJ9 C;  2V1A A;  2VEA A;  2W3F A;  2JN7 A;  4BBU A;  4HHD A;  3LIB A;  4CQH A;  4UQI S;  4L9G A;  4NEE D;  4E04 A;  5J4E A;  1ODV A;  4HJ4 A;  5DFY A;  4O8G A;  1DP8 A;  4Z1W A;  1G28 A;  4GW9 A;  3UE6 A;  1UGU A;  3FC7 A;  1P9R A;  4IUK A;  3K3C A;  5HPI A;  1XJ2 A;  3CI6 A;  3CUE C;  3CAX A;  4GHI A;  1P9W A;  2DMW A;  4HOI A;  4L0L A;  5TBM A;  1TS8 A;  2W3D A;  3RH8 B;  4MN5 A;  3FG8 A;  1KOU A;  1XFN A;  4EQ1 A;  3KSG A;  2ZOH A;  2VV6 A;  4KUO A;  1S4S A;  1NRJ A;  4JGQ A;  1ZHH B;  4HY8 A;  3D72 A;  1OT6 A;  2VJW A;  4UQI M;  3PBS A;  2XA7 S;  1VHM A;  2D01 A;  3LUQ A;  3JVV A;  4IHQ A;  1N9N A;  3VE4 A;  3MXQ A;  1GSX A;  4JGO A;  1S4R A;  4JGR A;  4R70 A;  4R6L A;  3BJN A;  4FSF A;  3KSI A;  3T4T A;  3HCY A;  2PD8 A;  2V0W A;  1S67 L;  2PYP A;  4EEP A;  2A24 B;  3LI9 A;  4JGP A;  4Y3I A;  3E4O A;  3KSF A;  3RFB A;  2OWH A;  2XSS A;  1Y28 A;  2XRO A;  2W3H A;  4G3W A;  3VV4 A;  1MC0 A;  1T1B A;  1YAX A;  4CLC B;  2JKT M;  2L0W A;  2PDR A;  2ZOI A;  3S7P A;  1YSP A;  5DJT A;  2VV8 A;  4DMZ A;  4EES A;  4HH3 A;  3BQ8 A;  2M7V A;  2XA7 M;  1S66 L;  1G6O A;  4BMW A;  4HJ3 A;  4II7 A;  2W3G A;  2ZMV A;  3EEA A;  3FPW A;  1IFQ A;  4HJ6 A;  5K5B A;  2LB9 A;  3UB9 A;  4Q0H A;  3T4J A;  2VKS A;  2VZW A;  4LPZ A;  3T50 A;  2VLG A;  3NOU C;  4KUK A;  3H7W B;  4MN6 A;  5C5K A;  5HDS A;  4MMN A;  2OAQ 1;  3PHY A;  1XJ3 A;  4G3V A;  3IS2 B;  4LRX C;  3R4K A;  2PHY A;  3LYX A;  4PKY G;  1WA9 A;  3PBO A;  1H8M A;  4NXG A;  3V67 A;  4WEK A;  1D06 A;  3KYQ A;  3S7O A;  2PT7 A;  3VE3 A;  1W63 M;  3TJZ C;  4I3A A;  4BBV A;  3F1O B;  1DP6 A;  1X0O A;  4WF0 A;  3B33 A;  5HDC A;  4CLC C;  2WKR A;  3T4S A;  2K31 A;  4Y5F A;  1F98 A;  3H82 B;  1OT9 A;  2JHE A;  4IUH A;  1MZU A;  4EEU A;  1DRM A;  2HGV A;  2P04 A;  2QYB A;  3P01 A;  5DF9 A;  3MMH A;  3BW6 A;  4I5S A;  4EW7 A;  4GLQ A;  1GSV A;  3EWK A;  2W1T B;  3ZYT A;  3GDI A;  2W1R A;  2JKR M;  4I3J A;  4EET B;  5HDD A;  2W0N A;  2I9V A;  4MDZ A;  2VX8 A;  5DJU A;  1STZ A;  2B18 A;  2L4R A;  3MR0 A;  2O0Y A;  4PAU A;  2L1M A;  2HV1 A;  2QWS A;  3LR4 A;  2FZ0 A;  5DKL A;  3G6O A;  3H7W A;  3MF0 A;  2VA0 A;  1D7E A;  3B42 A;  3A0S A;  2KX6 A;  5LBR A;  5J7E A;  3IS2 A;  4BBT A;  3K2N A;  2LB5 A;  3PXP A;  4B93 A;  1ZTU A;  1S1Y A;  3C8C A;  2ZMF A;  4HNB A;  2GZA A;  1VB6 A;  4O0P A;  3T4L A;  3JVU A;  4L9F A;  2K7S A;  5KIZ A;  3GEC A;  1GSW A;  3E0Y A;  3R7W B;  3OLO A;  3F1O A;  3LIC A;  4NKP A;  2H28 A;  3LR3 A;  5CX7 A;  4HI4 A;  1V9Z A;  3H82 A;  3MQO A;  2PR6 A;  5AVE A;  2Z6D A;  2MJ6 A;  4HQA A;  5IS1 A;  2R78 A;  2KLI A;  3CLO A;  2W1T A;  2WKP A;  1T19 A;  4WLA A;  2J3T C;  5IT5 A;  3UB8 A;  3IBJ A;  4FOF A;  2HF6 A;  2EWV A;  4BWI A;  4HP9 A;  2O9B A;  4Y2F A;  2ZBB A;  3F1N B;  3T4O A;  1H3Q A;  2WKQ A;  4GS9 B;  4ETZ A;  5MC7 A;  5F68 A;  4ZRR A;  2O9A A;  3C38 A;  1MKM A;  3O5Y A;  1NLZ A;  2OAP 1;  1OPX A;  4NXF A;  4HH2 A;  2QJ5 A;  2VGL S;  5HWW A;  3MJQ A;  3EGD C;  3H9W A;  4P6Z S;  1W63 Q;  3PBQ A;  2M7U A;  1LSX A;  4ME4 A;  4QPR A;  2J3W A;  2V1B A;  2GJ3 A;  1EW0 A;  1T1A A;  4XT2 B;  5F69 A;  2NUT C;  1UWN X;  3R7W A;  3CWF A;  3KO6 A;  2K2N A;  1F5M A;  4H6J B;  3LR0 A;  2VV7 A;  3UMD A;  2W3E A;  4OOL A;  3BY9 A;  4MN7 A;  1NLY A;  1XFQ A;  3D3O A;  1N9O A;  2O99 A;  3A0V A;  2QHK A;  5KSH A;  1S1Z A;  3E98 A;  2XRN A;  1P97 A;  3PBN A;  1TS0 A;  3F1N A;  3OCN A;  5HWT A;  3NJA A;  5G4Y A;  3CIT A;  2QJ7 A;  3FPV A;  4G3K A;  4GS9 A;  4WL9 A;  2QKP A;  1XJ4 A;  1OTA A;  4YNR A;  2PYR A;  3BY8 A;  4WEL A;  2VGL M;  1TS6 A;  3TRC A;  3K3D A;  4DJ3 A;  5HD3 A;  3NOP C;  4F3L A;  2KDK A;  4EER A;  1T18 A;  3T4K A;  4PKY A;  1OTE A;  5F6A A;  2J80 A;  2V9A A;  1T1C A;  3BWL A;  5I5L A;  4XT2 A;  1OJ5 A;  2GNX A;  1JNU A;  5J3W A;  3HJK A;  2GX5 A;  4PHT A;  1BYW A;  3EEH A;  4CLC D;  4H6J A;  1N9L A;  1UWP X;  3PBR A;  1LSW A;  5EFW A;  3MQQ A;  4GCZ A;  2NUP C;  1OTI A;  3LID A;  2A2L A;  4AFI A;  3DBA A;  1V9Y A;  3EQV A;  3S7Q A;  2W27 A;  3LR5 A;  1TS7 A;  4WN5 A;  3F1P B;  5AJG A;  3OOV A;  1XJ6 A;  3RTY A;  4M4X A;  3EOI A;  3PYP A;  3UE3 A;  3CUE A;  4UEY A;  3T4Q A;  2HJE A;  3UB7 A;  3VOL A;  3LIA A;  3U2A A;  3ULF A;  4ARZ B;  4EUV A;  2Y8H A;  4K08 A;  2EWW A;  3E4Q A;  2O9C A;  5HL6 A;  2YKH A;  2BAS A;  3IBR A;  4YOF A;  2OOL A;  3LFV A;  2JKT I;  4R3A A;  1F9I A;  4WUJ A;  3UB6 A;  5A8B A;  4B9O A;  3NHQ A;  4YWZ A;  3OC2 A;  4I3I A;  5G4Z A;  3EGX C;  2G7U A;  2Y79 A;  4EXO A;  4R38 A;  5DFX A;  4F3L B;  2OWJ A;  3E4P A;  4KQD A;  2J3T D;  4Q0I A;  3ICY A;  3F1P A;  2D02 A;  3PBT A;  3TW8 A;  4DJ2 A;  3SW1 A;  4BJP A;  3PR6 A;  1YSQ A;  4MCW A;  3LIE A;  4NXE A;  4OOM A;  4KQO A;  3W2Z A;  2KOI A;  1OJG A;  5HD5 A;  4CLC E;  3P7N A;  3NOT C;  2IA2 A;  4LRZ E;  1OTD A;  5AVF A;  2M1C A;  3C30 A;  5L8M A;  4L9E A;  5IU1 A;  4ARZ A;  4RQ9 A;  2P7J A;  2Z6C A;  3MFX A;  3TE8 A;  3S7N A;  1TD5 A;  3UME A;  3EQU A;  5FL3 A;  1NWZ A;  2YKF A;  5HPF A;  1OTB A;  4DN0 A;  4Q0J A;  3B47 A;  1YKD A;  2EA9 A;  1LSV A;  4LRY C;  1LT0 A;  5HSQ A;  4GHI B;  3C2W A;  2PD7 A;  4ETX A;  4P6Z M;  4HP4 A;  5TBM B;  3MQ0 A;  5F5Y A;  3ZQ5 A;  2JKR I;  5HWV A;  3KYZ A;  4IJG A;  1TF1 A;  4NXB A;  4WEJ A;  2A24 A;  4EU0 A;  3HJI A;  2P08 A;  5HZH A;  3LI8 A;  2V0U A;  3OBF A;  5DKK A;  2FH5 A;  4LLO B;  1DP9 A;  3LIF A;  2INW A;  5TJJ A;  1P0Z A;  2PR5 A;  1LL8 A;  4I39 A;  3BQA A;  4GJ4 A;  1IOU A;  3KSH A;  2B02 A;  4HIA A;  3A0R A;  3OCL A;  2CMN A;  4O01 A;  3KX0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...