1P98A

High-resolution nmr structure of the ubl-domain of hhr23a
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
78
structure length
78
Chain Sequence
b'MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UV excision repair protein RAD23 homolog A
publication title Structural determinants for the binding of ubiquitin-like domains to the proteasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 11
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2003-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1p98A00
4I6PA 1WGGA 4F8CB 2CS4A 5JH5C 4RMAA 4E74A 2LUEA 3H1UA 3ALBA 4II3B 2MBHA 1E90A 2O2VA 1WJNA 2KJ6A 1WMHB 5JZEB 4M8NA 4ZRJA 3GOEA 4XZ4A 2LGXA 3U7DA 3QCAA 3QAQA 4XC2A 2PE6B 2IO0B 3B08A 1EF5A 3MJWA 3QWZB 4BBNF 2MP2B 4IW0A 3ZNHB 2MA9B 4FJZA 4BKSD 3ZNZB 4BKGA 2O6VD 2GBNA 2GMIC 1Z2MA 2JF5A 2KFJA 4IM0A 3PLVA 2KWUB 4M0WB 4OVUA 2KD0A 1QZEA 3JW0X 3TIXA 4IM2A 3WANA 3WIMA 1UD7A 3U30A 1ZW7A 3W1YA 2GBKA 5AZHA 1TGZB 4W9IA 3UF8A 4HCNB 2LD9A 5D7GA 2DZJA 1IP9A 4KVGB 4PYZA 1RRBA 3N30A 2NPTB 4GDKA 3H7PA 2KO3A 2LZ6A 3TL5A 4FA6A 3N32A 2NBUA 4FULA 2KC2A 4ICVA 4CHKA 2RSUA 4JL9A 5CTRC 4B6WA 1YX6B 3N3KB 1P3QU 4DK5A 4AUQC 2RGFA 1X1MA 2IY0B 4KIKA 2JY6A 4ZDVA 3NHEB 2ZPYA 3O65B 1WGYA 1NBFC 5FR6A 4NJ6A 4NQLB 1WJ4A 1GJZA 2K6DB 3DDCB 2I1JA 1E5WA 3PLUA 3OJ3A 2DAJA 3QQ8B 4PS8A 3L0WB 1Y8RC 4N9F4 5CHWA 4HDQA 1LM8B 5E6NA 1U4AA 2JWZA 2NVUI 5DPTA 5LLIA 2DHZA 4WJOA 1L2NA 3PREA 1E8YA 4HDOA 2KDEB 3EFUA 3TBLD 4EOYA 4JIOU 3A9JB 3PT2B 3TCAA 4LJOB 4NNJB 1WJUA 2HD5B 2CKHB 2KFKA 2IY1B 2G4SA 2M8SA 3HK0A 4G50A 4E71A 2A5UA 1V81A 2JT4B 2M0XA 1BT0A 2V4LA 2CHWA 2BWFA 2OOBB 1KOTA 3SDLC 2KTRB 4EZJA 1P98A 4DHZB 2HE7A 1YJ1A 3T8MA 3JSVB 1R4MI 3EC8A 3U8ZA 1V49A 2FCQA 2Z0EB 1L7YA 2KC1A 2N7DA 1XQQA 2W9NA 2XEWA 4KZ0A 1K8RB 4K7WA 4NJ7A 3V60A 3ZDMC 1J8CA 4W9EA 3DBSA 4RM9A 4IC7B 4LCDE 5C1ZA 1S3SG 2C5LC 4W9HA 3DPDA 2KTFA 1RLFA 1WIAA 3RCZA 2ZPNA 1FXTB 3QHTA 1P1AA 4ANXA 4EZLA 3K9OB 1GUAB 3R7RA 2G3QB 2K6QA 2YLMA 2AYOB 2ZNVB 2UWQA 4HLEA 2JZ3B 3VUXA 1LFDA 2D3GA 5AZGA 3ZTDA 2B3AA 4IUMB 4RM8A 2LXCA 2XK5B 4WQOB 4ANUA 2LGDA 4HWIB 2KHWB 4LJPB 4KV2A 2BYVE 4LDTD 2GBJA 3UIOB 3A1QB 4K7SA 1WZ0A 5G2NA 1J0GA 2IZVB 4HPLB 4IWOA 3ZLZA 4GDLB 4WWNA 1F9JA 1YX5B 2KJRA 4FJYA 2FCMA 5IA7A 1Q1OA 4NQKE 5D6JB 3UINB 3VH4B 3KUDB 1WE7A 2C60A 2KMCA 3DVNV 3CF6E 3RUIB 2LWPA 2N4FA 2DENB 4JGHB 4MEMA 2O6VB 5D94A 3K9PB 4MGKE 1WGRA 3ZVVA 2FUHB 5KHOA 3PSEB 3QC8B 3DVNU 1WX7A 3W1SA 3DQVA 3AXCA 2KLGA 2PPHA 3CSTA 3IG3A 1CMXB 3KUZA 1UBQA 2K8BA 3PRPB 3R3MA 2L8JA 2N7EA 3Q3FA 4K81A 4PYUA 4DHZE 3VHTC 4W9DA 3PRZA 2FCSA 2MBQA 2YVCA 3APDA 2UYZB 2D2QA 2NPTA 4IWPA 2PE9A 2PJHA 1E8WA 3A9KA 2AL6A 1HE8A 3AU4A 2GBRA 5JHAA 4GMVA 2BKFA 4M8MA 2IO2B 1RFAA 5AZFA 4DDGD 2J0KA 1ZGUB 2KVRA 2O2VB 2DZIA 1OQYA 5DPWA 3L10B 1TTNA 4MJSA 2GOWA 5BO4B 4W9FA 4G11A 3KH0A 3RZFA 1H4RA 4WWPA 2LASA 3NZSA 2M17A 2L00B 2ZZPB 3APCA 3NS8A 1D3ZA 4I6NB 4F7ZA 5EDSA 4MGZE 2Y5BB 3ZRFA 3VFKA 2AWTA 3QIJA 1WXVA 4OVVA 3HIZA 2C7HA 2ZVOA 3PZDA 3TJPA 2D07B 3S2AA 3WA0A 1C1YB 2ZEQA 3NZUA 3PGEA 4GU2A 3W1SC 4DHJD 3ZUNA 2WWZA 2Z0DB 4XX5A 1J19A 2KNBA 4KDLB 2BF8B 4AP4C 2KANA 4ICUA 1LQBA 3KVFB 4GDKB 3ML8A 2FIFA 2LXAA 1UGMA 4W9CA 4TKNA 2KQ7A 3ZTCA 1GC7A 3M63B 4BBNC 2LI5A 4FN2A 2FAZA 2FIDA 3VTWA 1IYFA 2AEHA 3A4SC 4TQ0A 2MCNB 5DPSA 2CR5A 1EF1A 1YD8U 2ZCCA 1WYWB 3VTUA 1EUVB 2ASQA 2KLCA 2KDIA 2NR2A 1WJ6A 3B0AA 3GZNI 4W9KA 3VXWA 1UBIA 3KYDD 4NAWA 4ANVA 2K25A 2Z59B 4HK2A 1OEYA 2VRRB 1WY8A 4FLHA 4K7UA 2D11A 3ZW3A 1C3TA 3V61A 2D10A 3PHXB 3CSFA 3KW5B 3D32A 5L95C 2WX1A 4TQ1A 2JZZA 1OTRB 1KM7A 1WFYA 3L13A 4KSLC 3BINA 3RYTA 1KLVA 4MGIE 1AARA 4MGYE 5G55A 1WM3A 4G3XB 4GXBA 2R2QA 4DBGA 1OEYJ 2DZMA 4LDTB 2KFKB 3UGBB 1Z5SB 3ZRCA 1E8ZA 2L05A 2DZKA 4TUUA 4GN1A 2CHXA 3V6CB 3DOWA 2NCNA 3AI5A 3DBRI 3L08A 4I6LB 3SHQA 3H6NA 4A3OA 4KSKC 2LJ5A 2EMTA 2JPHA 5TR5A 3AU5A 3QJZA 1XT9B 2C7NB 1MG8A 4DDID 2ZCBA 2V3SA 2MRPA 1IPGA 3MTNB 3QK0A 2BGFA 2NBWB 1WGDA 4KZCA 2A4ZA 1WRDB 2KWVB 2L7RA 3DVGX 2L76A 1VD2A 2KX0A 3NY5A 4MSQB 3HM3A 1V5TA 4CO7A 3A4RA 4MELA 2MWSB 4ZRKA 1WE6A 3V62A 4ZRIA 4EKUA 4EZKA 1E8XA 2KQSA 2DYMA 3IHPC 3UQBA 1WMHA 2JXXA 2MBBB 4TV3A 4NY0A 2IBIB 3ZNID 3IFWB 4AJYB 4J6IA 3VH3B 3ZNGC 3C0RB 2MP2A 3VAWA 2L3ZA 3A33B 1WGHA 3H9DA 4MSMB 2BYEA 3UQAA 3BY4B 1H8CA 2J7QB 4CYEA 5J18A 2RPQA 3PVLA 2MBEA 1OGWA 2WYQA 3HM6X 2FNJB 4IG7B 2DX5B 4IWQA 4DWFA 2N9EB 3PS6A 2ZNVC 3VUYA 5J2RA 2M4NA 2MQJA 2WDTB 2GBMA 2MW5A 1XD3B 1UELA 2DAFA 2MX2A 1E7VA 4FJVB 3M3JA 1V80A 2DYBA 2KWCA 2RD0A 2BKRB 3QARA 3ZO5B 1WXSA 3JYUA 3RD2A 4HXDA 4FADA 2N9XA 4URKA 2C9WB 2KDBA 1WH3A 3PTFC 2LVOA 3QX1A 2KOXA 4AOFA 3RULA 1GC6A 1RAXA 1WR1A 3KYCD 2L0TA 1I42A 2N9PC 4NPNA 3OLMD 1TZ1A 2LRWA 1WZ3A 1A5RA 2KK8A 4B9KA 3EECA 2K1FA 2KDFB 3X0WA 3DVGY 3PRMB 5AEKB 3Q3JA 5E6OA 2CU1A 3DBLI 3PV1A 3RT3B 1NDDA 2JUOA 3OAWA 1JRUA 3WALA 2QHOA 4DHJB 4GGQA 2EKEC 3ML9A 1KJTA 4FHJA 4MM3A 3H7SA 3NOBA 3ONSA 2IO1B 4GB9A 1I35A 1V9JA 4MH0E 2AL3A 4PS3A 4EFOA 4DXAB 1VCBA 1TBEA 1G6JA 3A9JA 3A9KB 4GIVA 2PEAA 3APFA 5IAAC 1V6EA 1WXMA 2KN5A 4P7IA 3X23A 1ZKHA 5CX3A 2J0MA 3RZWC 3CMMB 3JVZX 2BWES 3H7PB 5DPRA 3ZIMA 2OJRA 1GNUA 1UZXB 3L54A 1V2YA 4E3CA 2R2OA 4W9JA 3SD5A 1PQSA 3R7QA 2ZVNA 2DYOA 2JVCA 2KTRA 4K1RB 4MJSB 4KIKB 3JSVA 2N1WA 3P2BA 3IBEA 4G0NB 5CHVC 4GOCA 3VVWB 3WAPA 1V5OA 4HCPB 4FBJB 3DCGA 1WF9A 3ZDTA 1SGHA 1Q0WB 1YIWA 5KHQA 2LRUA 2K8HA 3QA8A 3LJ3A 3UIPB 3VDZA 3EHVA 1P9DU 3DBHI 3M62B 2KJHB 4WJPA 2BYFA 5JHBA 5LXIB 1YQBA 2L0FA 2KMAA 4FHKA 5HKHA 4WWOA 3L17A 2NBVB 5GMVA 5CHFA 3M95A 4HJKA 4YL8A 2MBOA 4MDKE 1R4NI 4WAAA 3VTVA 2HJ8A 3PPAA 2REXA 1Q5WB 1SE9A 3MHSD 2XK5A 4ASWC 2CHZA 3WAMA 4BVUC 2KX3A 3VQIA 4BOSC 2BPSA 2JRIB 1WXAA 2KXJA 3A1QA 3TMPB 3V6EB 4BOZB 3T9LA 4BFRA 4PS7A 5L83A 1WX8A 2MSED 4B95A 1WX9A 3HHMA 4GDLA 4NAWB 4X57B 4A3PA 4BKTA 4EUTA 4II2B 2EMSA 1P0RA 2M1MA 3L16A 1V86A 1EO6A 3OJ4B 2IYDB 2FCNA 4AWJA 2JRHA 1S1QB 3R66C 1NI2A 5C23A 1LXDA 1WI0A 4BKSA 4ZYNA 1UH6A 2K8CA 2KKCA 4JLCA 5E6PA 2KZRA 2O6VA 2NS5A 3LDZE 4HVBA 4GSWA 4IM3A 4W9GA 4ANWA 1ISNA 2J0JA 2N1VA 4WJQA 4W9LA 4HPMB 1M94A 1GG3A 3I3TB 3VUWA 2LVPA 2G4DB 4EEWA 2MLBA 3ECIA 3ZKJC 3B1LX 2XBBC 3WAOA 2LVQA 4KDIC 5DCNA 1T0YA 2G45B 2C7MB 2IO3B 3AULA 2K39A 2WX0A 5J17A 3ENEA 3KUCB 4WJNA 1E7UA 2ZJDA 2RR9A 4F1SA 5D2MB 4JQWC 1WM2A 2I1KA 2LGYA 3SU8X 3PHWB 4A20A 4AJWA 1SIFA 2V1YA 2HTHA 3IVFA 1WR6E 5LXHA
chains in the Genus database with same CATH superfamily
4LNIA 2CS4A 1TKYA 3FILA 3H1UA 3ALBA 2LUMA 2MBHA 1E90A 2L52A 1UF0A 3QAQA 2W55A 2IO0B 3B08A 1EF5A 1SJHD 2MP2B 4IW0A 2MA9B 4FJZA 3ZNZB 2O6VD 3T3NA 1RWSA 1Z2MA 2V9HA 2KWUB 4M0WB 4OVUA 4YWGG 1QZEA 3J9CA 3JW0X 4IM2A 3WANA 4P1CC 1ZW7A 4XE0A 4W9IA 3Q6BA 5D7GA 1IP9A 1FXIA 3B9JA 2M19A 4GDKA 4XYCA 3TL5A 2N9LA 4CHKA 3TEZA 1ZDXA 3N3KB 4KIKA 3NHEB 2ZPYA 3O65B 1ZOYB 5FR6A 4NJ6A 4WURA 1GJZA 2K6DB 1ENFA 3DDCB 2I1JA 3RNCC 2H89B 4YXDB 4OZAA 1Y8RC 5EE9A 4HDQA 2KMMA 5LLIA 3AE5B 4WJOA 3PREA 3TEYA 3EFUA 3A9JB 1FRDA 2IY1B 2PTLA 2BYTA 1NYQA 4E71A 3AE4B 1GPXA 4EZJA 2HE7A 1YJ1A 1XLQA 4KGRA 1V49A 3FC4A 3AE3B 1L7YA 1XQQA 2M0AA 2JU6X 4RH6A 1DOIA 2PW9A 5C1ZA 1S3SG 3P4PB 3NS1A 3RCZA 2ZPNA 1P1AA 2ZNVB 4HLEA 3Q14C 2WHIA 3VUXA 1LFDA 3ZTDA 1A70A 4IUMB 4ANUA 3SR6A 2NTSA 1JW9D 4IWOA 4GDLB 4WWNA 1YX5B 2KJRA 4WWMA 3RNAC 3UINB 2C60A 2WXRA 3Q8AA 2DENB 4B0EA 1WGRA 3NVWA 3W1SA 3DQVA 2KT7A 3CSTA 2WXHA 1UBQA 1WSPA 4KKIA 2L8JA 2N7EA 4PYUA 3TEXA 2NPTA 2DBYA 4MACA 3FILB 1RFAA 5AZFA 4DDGD 2J0KA 2WGSA 1OQYA 4MJSA 3W2DA 4G11A 4M02A 1HEZE 3ZQ4A 3NZSA 2M17A 2AQ1B 3KWVA 1SXTA 3VFKA 3LYYA 4OVVA 2CJOA 1EU4A 1AYFA 3S2AA 2N9KA 3NZUA 4GU2A 3W1SC 3ZJTA 3ZUNA 1J19A 2KNBA 4ICUA 3SFDB 2RDGA 3KVFB 4GDKB 4K3CA 1R4MB 2LXAA 1UGMA 2QJLA 4W9CA 2KQ7A 4A6QA 3M63B 4BBNC 3NUHB 5BMHA 2LI5A 1XCQL 1JWMD 2WXMA 5FK9C 1EWYC 3VTUA 1WYWB 1EUVB 2KLCA 3B0AA 1WJ6A 2K0PA 2ONQA 4ANVA 1N6ZA 2HJ1A 3I57A 1F1HA 2OEDA 3NVZA 1T0RC 2WX1A 1EU3A 1WFYA 4YTPB 4KSLC 1C77A 2W82A 4G3XB 1C4AA 2ZW0A 3Q2AC 4AS1A 3LXFA 4LDTB 3PZ7A 3UGBB 1TIFA 2JYEA 2NCNA 3AI5A 4RGNA 4I6LB 1YNTE 3WCQA 2LJ5A 1N62A 2LHEA 3MC0B 4KZCA 1WRDB 2L76A 1VD2A 1V5TA 4MELA 1K51A 4EKUA 3DWMA 1WMHA 1HXYD 3PO0A 2J4XA 3ZNID 1VDVA 3IFWB 3VH3B 3ZNGC 1D5ZC 3A33B 2BYEA 1UGJA 4WAFA 1C4CA 5J18A 3RI7C 5HHDG 4DWFA 4IWQA 4XGAB 3PS6A 1ET9A 2RMMA 2MQJA 2WDTB 2GBMA 1UNSA 1UELA 2KWCA 3ZO5B 2RD0A 3QARA 4FADA 2YEPF 4HXDA 4URKA 3CIRB 2MEKA 2LVOA 1FM0D 3AE2B 3RULA 1WXQA 2RDBC 3UI3A 2INCC 3W9CB 1A5RA 4XWWA 2KK8A 5FR3A 3EECA 1KTKA 3PRMB 5EE0A 3Q3JA 3Q8BA 3PV1A 3URYA 4PK1A 1DYQA 2QHOA 4DHJB 4MM3A 1VRAB 2IO1B 4RFBA 1TT5B 4ARCA 3N1YC 4MH0E 1G6JA 2FBWB 1WXMA 2OHFA 5CX3A 3C19A 1C78A 3HVZA 1F77A 1GNUA 1V2YA 1L0VB 1JALA 2ZVNA 2KTRA 4MJSB 4IKGA 4RF1A 1R4NB 3WAPA 1V5OA 4HCPB 3DCGA 4DXFA 1SGHA 1ZE3D 1IBXA 1AW7A 3DBRB 1SB3C 4S17A 3SEBA 2L0FA 4FHKA 1TS4A 2NBVB 4YL8A 4MDKE 4WAAA 2HJ8A 1YJIA 2XK5A 2NMQA 3RPFC 1V1PA 3VQIA 1D5XC 3AEEB 2BPSA 4PT5A 3TMPB 4BOZB 2WDRB 3TSSA 4HJGE 1SSNA 4X57B 2WXOA 4BKTA 2D3BA 1P0RA 1XLPA 1MPEA 3L16A 1EO6A 1PGBA 3OJ4B 1S1QB 5C23A 1WI0A 4N58A 4AQ7A 1UH6A 4JLCA 3PZ8A 2NS5A 3AEDB 5IOIA 3NJTA 3E56A 4IM3A 1ISNA 1QLBB 1QOBA 4W9LA 3IT4B 5BMIA 3N1XC 1GG3A 1L6UA 2LVPA 3VR9B 3ZKJC 1JWSD 1SE2A 3RMKC 5DCNA 1T0YA 3AULA 2K39A 2WX0A 4WJNA 2ZJDA 5D2MB 4AJWA 2I1KA 4A20A 3PHWB 4L1BA 3B2GA 5JH5C 4E74A 5HI1A 2O2VA 2HDEA 1WMHB 3QCAA 5TSSA 2QMTA 4BKSD 1I4XA 1JRPA 2GBNA 4IM0A 2JF5A 2KFJA 2JZPA 1J7AA 1UD7A 2GBKA 1TGZB 4YSXB 2X38A 4ZHOA 2Y3AA 1KLGD 1MJDA 4KVGB 4PYZA 2N7JA 2KO3A 5AUIA 4FA6A 3N32A 3V05A 2NBUA 2BVCA 4FULA 3RNGC 1FCCC 1B9RA 2L83A 5CTRC 4B6WA 2LJIA 2WXQA 2RGFA 2Z8LA 3T3OA 4ZDVA 1HTQA 1B1ZA 2JYTA 2IGGA 4NAMA 2V4IB 1CZPA 1NBFC 1L5PA 4NQLB 1WJ4A 4L23A 2OJWA 2DAJA 3L0WB 1XF5L 4MM3B 3P4QB 2NVUI 1L2NA 2DHZA 5GXGB 2WDQB 4HDOA 4LK0M 4EOYA 4LJOB 1WJUA 2CU3A 4WH4A 4A9AA 2KYWA 2KFKA 2G4SA 2M8SA 3HK0A 1JQ4A 1FXAA 2A5UA 2JT4B 1EM7A 2W54A 4IOIE 1BT0A 1V1OA 1KOTA 3SDLC 2KTRB 4HKZE 4XWTA 3BIID 2EKIA 3R8BA 3EC8A 3U8ZA 5EE1A 2N7DA 2W9NA 2VZKB 4LNNA 1VZ8A 1RYJA 3RNBC 3AN1A 3GB1A 1XCTL 2WXKA 1IBXB 3P4RB 4K7WA 1GB4A 4IC7B 4LCDE 2WXPA 3DPDA 1WIAA 1IGDA 3K9OB 1GUAB 2G3QB 2K6QA 3GE8C 2JZ3B 1QT9A 2ACZB 5AZGA 4C4VA 2XK5B 1V1PB 4HWIB 5BMGA 2KACA 1FD6A 4KV2A 4LDTD 3UIOB 2GBJA 4K7SA 2WS3B 5G2NA 1DOYA 2WXGA 4HPLB 3ZLZA 1YQ3B 5IA7A 2GLSA 1K53A 2LWPA 2N4FA 4JGHB 1QQRA 1SE4A 2W3SA 1TS3A 2KLGA 1BMLC 1FRRA 2L1AA 3KUZA 1KF6B 3PRPB 4DHZE 2G9HD 1HQRD 5G5GA 4IWPA 2PJHA 4ZHPA 1UWXA 1FPYA 1VZ7A 3AU4A 3FAHA 1WGKA 4GMVA 2BKFA 2UU7A 4MH8A 2MJ3A 4RGMA 2O2VB 2KVRA 2DZIA 3BWUD 4DQOC 4JWSC 3RZFA 1MVKA 1D3ZA 1MI0A 5EDSA 1PGXA 2Y5BB 3HIZA 2ZVOA 1I4PA 2ZEQA 3PGEA 1T3QA 4DHJD 2WWZA 2BF8B 4AP4C 2KANA 1T0QC 1LQBA 1F52A 3TUOA 1C76A 1TKGA 3ML8A 2FIFA 1FFVA 1ZPSA 3ZTCA 2QSDA 2V3PA 4A8XC 2BT6A 2AEHA 1ACCA 1IYFA 2LGSA 2ZCCA 1MHHE 3EA6A 2NR2A 1OFFA 3BK2A 3VXWA 5C2TB 1PGAA 2RPVA 2K25A 4K7UA 1C4PA 2D11A 2JWUA 5JXVA 1C3TA 3PHXB 3DHIC 5L95C 3L13A 3RYTA 1KLVA 2E6XA 4MGYE 1VR9A 5G55A 3HRDD 1WM3A 3EGRA 1L6VA 2MHJA 4DBGA 3W5VB 2DZMA 4A90A 2KFKB 1Z5SB 5LNK1 4TUUA 4A3OA 3SHQA 3GS2A 3H6NA 5D3IB 2JPHA 3ZXRA 5TR5A 3QJZA 4DDID 4RF0A 5BYQA 2ZCBA 3QK0A 4QAYA 2BB5A 4HRSA 5D3DA 3DVGX 3P1MA 2KX0A 3HM3A 1L0YB 2WU5B 4EZKA 1K52A 3IHPC 3UQBA 3KQ4A 3N1ZC 2JX5A 2JXXA 4AJYB 2IGDA 4J6IA 3RNFC 4N6EB 3VRBB 2L3ZA 4MSMB 3H9DA 4RCOA 1ET6A 1H8CA 1L4ZB 1NEKB 2J7QB 4CYEA 4D2KA 2WXNA 1M4VA 4C4VB 3PVLA 3GE3C 2MBEA 2FNJB 3I9V1 4IG7B 2N9EB 5EE3A 2MW5A 2DAFA 1V80A 2DYBA 4NJCA 1WXSA 3JYUA 2DNFA 4JPSA 1WH3A 2KOXA 1I42A 3BVZA 1TZ1A 1WZ3A 1SJED 4B9KA 2K1FA 2KDFB 3C8YA 3ZJUA 3X0WA 3AE9B 3Q8EA 1AN8A 5AEKB 5E6OA 3OAWA 4GGQA 1TY2A 1KJTA 3NOBA 3RN9C 3P4SB 1I7HA 4KX6B 1I35A 1TS5A 2AL3A 1VCBA 1IGCA 3GZNB 1SIJA 2KN5A 1DOXA 1XXGA 1DGJA 2BWES 1YN4A 5DPRA 1UZXB 2HTME 4K3BA 2BS2B 4UDUC 4O1NA 4E3CA 2R2OA 1PQSA 3R7QA 4K1RB 4KIKB 3P2BA 3IBEA 5CHVC 2JSVX 3VVWB 4FBJB 1Q10A 1WF9A 2WU2B 4OW0A 1YIWA 5KHQA 2LRUA 3NVYA 2KWDA 3LJ3A 3OG5A 1Y56A 4R3DA 4J3OD 2BYFA 2DWQA 2N0SB 1MG4A 2JQRB 2KMAA 4WWOA 5CHFA 2PIAA 2MBOA 2I2YA 1E10A 1Q5WB 3WAMA 1WXAA 2KXJA 1HZ6A 3T9LA 5L83A 2G1EA 1I4GA 1F0ZA 1WX8A 2MSED 2XN9C 4KGSA 4A3PA 4M00A 2M1MA 1V86A 2QIEB 2K5PA 1LXDA 4ZYNA 5E6PA 1QF6A 1FFUA 2VZKD 4WJQA 1M94A 3VUWA 2MLBA 1QOGA 3B1LX 4KDIC 2G45B 2R61A 1E7UA 5C3JB 2RR9A 1JCKB 1T0SC 2AX5A 3IVFA 3E9SA 4ITKA 4F8CB 3DBLB 4RMAA 2LUEA 3LB8C 3P63A 1UUPA 1WJNA 5JZEB 4M8NA 4XZ4A 1CK1A 4XC2A 2PE6B 1N5WA 3BZDB 3QWZB 3AEBB 1E0ZA 1KH0A 4BKGA 4HPPA 4IDIA 2KD0A 3U30A 1E9MA 1T5XD 4HCNB 2LD9A 2DZJA 1FNUA 3N30A 2NPTB 4OVZA 3H7PA 1GAQB 2MJEA 4ICVA 2KN4A 2RSUA 4JL9A 1YX6B 1P3QU 3ZGZA 1X1MA 2IY0B 2JY6A 3DBHB 1WGYA 4YTMB 1FIQA 1TJEA 2XNAC 1LO5D 3OJ3A 4PS8A 3B2FA 5CHWA 2W3RA 1FNWA 4REZA 2K9XA 1LM8B 5E6NA 3AEFB 4N59A 3VR8B 2KDEB 2MH7A 2LMCA 3TBLD 3TCAA 3N9YC 2HD5B 4RGTA 2D3AA 3KWLA 1SEBD 2BWFA 5HG2A 5H92C 3AECB 1P98A 1N61A 1FMAD 4DHZB 2WDVB 3T8MA 3ZXVA 3AM9A 3KLSX 1R4MI 2Q5WD 2XEWA 2IDYA 4KZ0A 1K8RB 3V60A 1J8CA 3DBSA 4RM9A 4C80A 2C5LC 4W9HA 2KTFA 2CJNA 1FXTB 3QHTA 1OQQA 4ANXA 2LGIA 2AYOB 2D3GA 4C56C 2B3AA 4RM8A 1YN5A 3ABVB 4WQOB 1N5XA 2LGDA 3R2IA 2KHWB 4LJPB 1J0GA 1KLUD 2IZVB 1TY0A 2FCMA 5D6JB 3VH4B 3P42A 1JROA 3DVNV 2LHDA 3RUIB 4LNOA 5D94A 3K9PB 2FUHB 2INDC 3RNEC 3AXCA 2PPHA 1J7CA 1CMXB 2K8BA 3R3MA 4K81A 1FNVA 1JWBD 3VHTC 1I4HA 3U52E 3PRZA 2WLBA 2FCSA 2YVCA 1TYGB 2UYZB 2D2QA 5IO9A 1HE8A 4LTUA 2GBRA 2WXJA 1J7BA 5JHAA 4M8MA 4MT5A 2IO2B 3NZ3A 4YT0B 1YJJA 3H8HA 2PVOD 3L10B 1TTNA 2GOWA 2YEPB 4W9FA 1ROEA 3NS8A 4I6NB 4F7ZA 2FE8A 4MGZE 3ZRFA 1XO3A 3AE8B 2AWTA 1WXVA 2WXLA 2C7HA 2D07B 3WA0A 2KDMA 4B0MA 4TKNA 1I4QA 2FAZA 3VTWA 4EE2A 5DPSA 1CJEA 1EF1A 4W9KA 4NAWA 1LGRA 1OEYA 4FLHA 1HZ5A 3SFEB 3ZW3A 1L0XB 3V61A 3CSFA 3KW5B 5IP4D 3HUIA 2JZZA 2QDFA 1QOAA 1ZP0B 1PYWD 1RM6C 3DHGC 2PMVA 4MGIE 1AARA 1RFKA 4GXBA 1OEYJ 3ZRCA 1E8ZA 1C79A 2L05A 4GN1A 4XDDA 3L08A 3DBRI 4KKJA 2EMTA 4OHJA 3BYYB 3AU5A 1OQRA 2C7NB 3MC8A 1YQ4B 3I5JC 2V3SA 2MRPA 2BGFA 2NBWB 3BVGA 1MFWA 2A4ZA 4MSQB 2J52A 2KWVB 4DXAB 3NY5A 2MWSB 4ZRKA 1WE6A 3V62A 4ZRIA 1E8XA 3IAM1 2KQSA 2DYMA 4LNFA 5FKAC 4NY0A 2IBIB 3C0RB 4L2YA 3DWGC 1WGHA 3UQAA 3BY4B 4HKQA 2SEBD 1OGWA 3HM6X 5BYRA 2DX5B 2ZNVC 5E6JA 3VUYA 5J2RA 2Y5CA 2M4NA 4TSSA 1FO4A 2MX2A 4FJVB 2BKRB 4H2AA 3RD2A 2N9XA 2KDBA 3MP9A 5BYSA 3NVVA 4AOFA 1RAXA 2D5GA 1WR1A 3KYCD 2L0TA 2N9PC 4JWUC 2LRWA 1JWUD 3DVGY 2VH1A 2L32A 2B76B 3RT3B 1KFYB 2JUOA 1JRUA 2M56B 2EKEC 4FHJA 3H7SA 1N63A 1P7EA 1V9JA 4EFOA 3R2TA 1TBEA 4USAA 5IAAC 4P7IA 3X23A 1ZKHA 3RZWC 2OJRA 1NVID 3BK1A 2QCZA 2JVCA 1WRIA 4RNAA 5G5HA 3BVMA 3BYTB 3JSVA 2N1WA 1PFDA 4G0NB 3MHZA 3DHHC 1HA5A 1C9FA 3VDZA 3AE6B 1P9DU 3M62B 1L4DB 2KJHB 3Q3NC 4WJPA 1XLNA 1MHXA 5JHBA 1YQBA 3EUB2 4CQNA 5GMVA 4JX1C 4HJKA 1NENB 3VTVA 4P6VF 2REXA 4ASWC 2CHZA 4BOSC 4US8A 2JRIB 3A1QA 3V6EB 1NYRA 4PS7A 4B95A 1WX9A 1F2RI 3HHMA 4NAWB 1E6EB 3O13A 2IYDB 2FCNA 4AWJA 2JRHA 4S0RA 3R66C 1NI2A 1YOVB 2KKCA 2O6VA 3LDZE 4US9A 4HVBA 3AE7B 1N60A 3Q3OC 2N1VA 4HPMB 4WQMA 2VH2A 1WWTA 3IXSA 3ECIA 2D3CA 1YN3A 2XBBC 3V3XA 2C7MB 5J17A 3MC9A 2E3TA 3ENEA 3SU8X 4JQWC 1WM2A 2LGYA 1SIFA 2V1YA 2BS4B 1WR6E 1TZOA 1NI3A 4I6PA 1WGGA 4XDCA 2PLPA 4II3B 4LNKA 3TEWA 2SAKA 5AUKA 5IKCM 2KJ6A 4ZRJA 3GOEA 3IT6B 2LGXA 4M01A 3U7DA 2V0GA 3MJWA 4BBNF 3ZNHB 2GMIC 4C00A 4EEWA 3PLVA 3TIXA 1YMHE 1FEHA 3WIMA 4OZBA 3W1YA 5AZHA 3UF8A 2QILA 1RRBA 2EELA 2LZ6A 4RGOS 1E7PB 2GI9A 1P7FA 2KC2A 1XLOA 2V3NA 4DK5A 4AUQC 1ZXHA 1STEA 4WIPA 1E5WA 3PLUA 3W5UB 3QQ8B 4N9F4 1U4AA 2JWZA 5DPTA 1E8YA 5IN7A 4JIOU 3PT2B 4NNJB 4Q2JA 2CKHB 1QILA 4G50A 1V81A 2M0XA 2BBCA 1WYGA 2V4LA 2CHWA 2OOBB 2GB1A 4P16A 3JSVB 3U2SC 2FCQA 2Z0EB 1ZDVA 2KC1A 4YTNB 1BUIC 1D4BA 2X8XX 1HTOA 1SE3A 4NJ7A 3ZDMC 4W9EA 4BAXA 2H88B 2WXIA 2I38A 1RLFA 4EZLA 3R7RA 2YLMA 2UWQA 3MJ5A 2LXCA 1PUTA 2ICIA 2BYVE 3A1QB 1WZ0A 4TMAB 2WNMA 1R7SA 3HVDA 1F9JA 4FJYA 1Q1OA 4NQKE 2Y5PA 4LLGM 3KUDB 1WE7A 2KMCA 3CF6E 3AMZA 5MPOA 4MEMA 2O6VB 4MGKE 3ZVVA 5KHOA 3PSEB 3QC8B 3DVNU 1WX7A 1AWDA 4C7YA 4HROA 2FUG1 1TKEA 3IG3A 4YSYB 3Q3FA 4ZYSA 4W9DA 3ETRA 1VLBA 2MBQA 3APDA 2PE9A 1E8WA 3A9KA 4BZAA 2BB6A 2AL6A 3NRZA 1FCLA 4HEA1 1D5MC 1JWAD 2WP9B 4P1BC 1ZGUB 3VRAB 5DPWA 2BS3B 5BO4B 1IUEA 3KH0A 1PDXA 1H4RA 2WXFA 3AH7A 4WWPA 2LASA 4JE3B 5I4DA 1VZ6A 5HFYA 2L00B 2ZZPB 3APCA 1QKZA 2QC8A 2J42A 3QIJA 4ZRPA 3PZDA 3TJPA 1C1YB 2Z0DB 4XX5A 4KDLB 3ZYYX 2MJDA 3MFGA 1D6EC 1GC7A 3GP7A 4FN2A 4OZCA 2FIDA 4TQ0A 3A4SC 2MCNB 2CR5A 1YD8U 2ASQA 2KDIA 3GZNI 2J53A 2RDHA 1UBIA 3KYDD 3EFCA 2Z59B 4HK2A 1I4RA 2QEJC 3AV8A 2BW2A 2VRRB 1WY8A 3Q69A 2D10A 3D32A 3OWEB 4TQ1A 1OTRB 1KM7A 3L4PA 3BINA 3CWIA 4NZLB 2INPE 2R2QA 2DZKA 2CHXA 3V6CB 3DOWA 1F2RC 1QOFA 4KSKC 4ZOHC 4GLSC 2AQ2B 1XT9B 1MG8A 3MTNB 1IPGA 2AQ3B 3IAS1 1WGDA 3RFZB 2LFIA 2L7RA 4CO7A 3A4RA 2IJ0A 4TV3A 2MBBB 2MP2A 3VAWA 1K50A 4DXGA 2PKOA 4M0WA 1SBBB 2RPQA 2WYQA 3AEGB 4ARIA 1BXTA 3AEAB 3U4EG 1XD3B 1E7VA 3M3JA 2C9WB 2ZW1A 3PTFC 4A55A 2JXTA 3QX1A 1CQVA 1GC6A 1GOZA 4NPNA 3OLMD 3Q8FA 1V8CA 2ON8A 2KQ4X 2BTEA 2CU1A 3DBLI 3Q3MC 1NDDA 1EWCA 1TS2A 3WALA 3ML9A 1ZXIA 3FKYA 3ONSA 4GB9A 4C7ZA 2NTTA 3AE1B 4PS3A 3A9JA 3A9KB 4GIVA 2PEAA 3APFA 1V6EA 3I63C 3ZJVA 2J0MA 3CMMB 3JVZX 2K22A 3AB5A 3H7PB 3ZIMA 3L54A 2KVZA 4W9JA 3SD5A 4FXCA 4KGTA 2DYOA 1T6BX 1XEEA 4GOCA 2KAJA 3ZDTA 2K3UA 1Q0WB 5T8IA 2K8HA 3QA8A 3UIPB 3EHVA 1V97A 3DBHI 5LXIB 2IPKD 1SF0A 5HKHA 3L17A 2GRIA 3M95A 1ZUD2 1R4NI 4ZRQA 3PPAA 2DLBA 1SE9A 3MHSD 2BQQA 4BVUC 2PVGC 2KX3A 1ESFA 4BFRA 2LEKA 3Q8CA 1KRHA 4GDLA 1VJKA 4EUTA 4II2B 4ACFA 2EMSA 3N20C 4YSZB 4BKSA 2K8CA 2IGHA 1UWMA 2KZRA 1GB1A 4GSWA 4W9GA 1JMLA 2WQYB 4ANWA 2J0JA 3U7ZA 5H8YE 3I3TB 2G4DB 3WAOA 2LVQA 2INNE 2IO3B 2TSSA 3NG0A 3KUCB 2HTHA 4F1SA 5LXHA
chains in the Genus database with same CATH topology
4I6PA 1WGGA 4F8CB 2CS4A 5JH5C 4RMAA 4E74A 2LUEA 3H1UA 3ALBA 4II3B 2MBHA 1E90A 2O2VA 1WJNA 2KJ6A 1WMHB 5JZEB 4M8NA 4ZRJA 3GOEA 4XZ4A 2LGXA 3U7DA 3QCAA 3QAQA 4XC2A 2PE6B 2IO0B 3B08A 1EF5A 3MJWA 3QWZB 4BBNF 2MP2B 4IW0A 3ZNHB 2MA9B 4FJZA 4BKSD 3ZNZB 4BKGA 2O6VD 2GBNA 2GMIC 1Z2MA 2JF5A 2KFJA 4IM0A 3PLVA 2KWUB 4M0WB 4OVUA 2KD0A 1QZEA 3JW0X 3TIXA 4IM2A 3WANA 3WIMA 1UD7A 3U30A 1ZW7A 3W1YA 2GBKA 5AZHA 1TGZB 4W9IA 3UF8A 4HCNB 2LD9A 5D7GA 2DZJA 1IP9A 4KVGB 4PYZA 1RRBA 3N30A 2NPTB 4GDKA 3H7PA 2KO3A 2LZ6A 3TL5A 4FA6A 3N32A 2NBUA 4FULA 2KC2A 4ICVA 4CHKA 2RSUA 4JL9A 5CTRC 4B6WA 1YX6B 3N3KB 1P3QU 4DK5A 4AUQC 2RGFA 1X1MA 2IY0B 4KIKA 2JY6A 4ZDVA 3NHEB 2ZPYA 3O65B 1WGYA 1NBFC 5FR6A 4NJ6A 4NQLB 1WJ4A 1GJZA 2K6DB 3DDCB 2I1JA 1E5WA 3PLUA 3OJ3A 2DAJA 3QQ8B 4PS8A 3L0WB 1Y8RC 4N9F4 5CHWA 4HDQA 1LM8B 5E6NA 1U4AA 2JWZA 2NVUI 5DPTA 5LLIA 2DHZA 4WJOA 1L2NA 3PREA 1E8YA 4HDOA 2KDEB 3EFUA 3TBLD 4EOYA 4JIOU 3A9JB 3PT2B 3TCAA 4LJOB 4NNJB 1WJUA 2HD5B 2CKHB 2KFKA 2IY1B 2G4SA 2M8SA 3HK0A 4G50A 4E71A 2A5UA 1V81A 2JT4B 2M0XA 1BT0A 2V4LA 2CHWA 2BWFA 2OOBB 1KOTA 3SDLC 2KTRB 4EZJA 1P98A 4DHZB 2HE7A 1YJ1A 3T8MA 3JSVB 1R4MI 3EC8A 3U8ZA 1V49A 2FCQA 2Z0EB 1L7YA 2KC1A 2N7DA 1XQQA 2W9NA 2XEWA 4KZ0A 1K8RB 4K7WA 4NJ7A 3V60A 3ZDMC 1J8CA 4W9EA 3DBSA 4RM9A 4IC7B 4LCDE 5C1ZA 1S3SG 2C5LC 4W9HA 3DPDA 2KTFA 1RLFA 1WIAA 3RCZA 2ZPNA 1FXTB 3QHTA 1P1AA 4ANXA 4EZLA 3K9OB 1GUAB 3R7RA 2G3QB 2K6QA 2YLMA 2AYOB 2ZNVB 2UWQA 4HLEA 2JZ3B 3VUXA 1LFDA 2D3GA 5AZGA 3ZTDA 2B3AA 4IUMB 4RM8A 2LXCA 2XK5B 4WQOB 4ANUA 2LGDA 4HWIB 2KHWB 4LJPB 4KV2A 2BYVE 4LDTD 2GBJA 3UIOB 3A1QB 4K7SA 1WZ0A 5G2NA 1J0GA 2IZVB 4HPLB 4IWOA 3ZLZA 4GDLB 4WWNA 1F9JA 1YX5B 2KJRA 4FJYA 2FCMA 5IA7A 1Q1OA 4NQKE 5D6JB 3UINB 3VH4B 3KUDB 1WE7A 2C60A 2KMCA 3DVNV 3CF6E 3RUIB 2LWPA 2N4FA 2DENB 4JGHB 4MEMA 2O6VB 5D94A 3K9PB 4MGKE 1WGRA 3ZVVA 2FUHB 5KHOA 3PSEB 3QC8B 3DVNU 1WX7A 3W1SA 3DQVA 3AXCA 2KLGA 2PPHA 3CSTA 3IG3A 1CMXB 3KUZA 1UBQA 2K8BA 3PRPB 3R3MA 2L8JA 2N7EA 3Q3FA 4K81A 4PYUA 4DHZE 3VHTC 4W9DA 3PRZA 2FCSA 2MBQA 2YVCA 3APDA 2UYZB 2D2QA 2NPTA 4IWPA 2PE9A 2PJHA 1E8WA 3A9KA 2AL6A 1HE8A 3AU4A 2GBRA 5JHAA 4GMVA 2BKFA 4M8MA 2IO2B 1RFAA 5AZFA 4DDGD 2J0KA 1ZGUB 2KVRA 2O2VB 2DZIA 1OQYA 5DPWA 3L10B 1TTNA 4MJSA 2GOWA 5BO4B 4W9FA 4G11A 3KH0A 3RZFA 1H4RA 4WWPA 2LASA 3NZSA 2M17A 2L00B 2ZZPB 3APCA 3NS8A 1D3ZA 4I6NB 4F7ZA 5EDSA 4MGZE 2Y5BB 3ZRFA 3VFKA 2AWTA 3QIJA 1WXVA 4OVVA 3HIZA 2C7HA 2ZVOA 3PZDA 3TJPA 2D07B 3S2AA 3WA0A 1C1YB 2ZEQA 3NZUA 3PGEA 4GU2A 3W1SC 4DHJD 3ZUNA 2WWZA 2Z0DB 4XX5A 1J19A 2KNBA 4KDLB 2BF8B 4AP4C 2KANA 4ICUA 1LQBA 3KVFB 4GDKB 3ML8A 2FIFA 2LXAA 1UGMA 4W9CA 4TKNA 2KQ7A 3ZTCA 1GC7A 3M63B 4BBNC 2LI5A 4FN2A 2FAZA 2FIDA 3VTWA 1IYFA 2AEHA 3A4SC 4TQ0A 2MCNB 5DPSA 2CR5A 1EF1A 1YD8U 2ZCCA 1WYWB 3VTUA 1EUVB 2ASQA 2KLCA 2KDIA 2NR2A 1WJ6A 3B0AA 3GZNI 4W9KA 3VXWA 1UBIA 3KYDD 4NAWA 4ANVA 2K25A 2Z59B 4HK2A 1OEYA 2VRRB 1WY8A 4FLHA 4K7UA 2D11A 3ZW3A 1C3TA 3V61A 2D10A 3PHXB 3CSFA 3KW5B 3D32A 5L95C 2WX1A 4TQ1A 2JZZA 1OTRB 1KM7A 1WFYA 3L13A 4KSLC 3BINA 3RYTA 1KLVA 4MGIE 1AARA 4MGYE 5G55A 1WM3A 4G3XB 4GXBA 2R2QA 4DBGA 1OEYJ 2DZMA 4LDTB 2KFKB 3UGBB 1Z5SB 3ZRCA 1E8ZA 2L05A 2DZKA 4TUUA 4GN1A 2CHXA 3V6CB 3DOWA 2NCNA 3AI5A 3DBRI 3L08A 4I6LB 3SHQA 3H6NA 4A3OA 4KSKC 2LJ5A 2EMTA 2JPHA 5TR5A 3AU5A 3QJZA 1XT9B 2C7NB 1MG8A 4DDID 2ZCBA 2V3SA 2MRPA 1IPGA 3MTNB 3QK0A 2BGFA 2NBWB 1WGDA 4KZCA 2A4ZA 1WRDB 2KWVB 2L7RA 3DVGX 2L76A 1VD2A 2KX0A 3NY5A 4MSQB 3HM3A 1V5TA 4CO7A 3A4RA 4MELA 2MWSB 4ZRKA 1WE6A 3V62A 4ZRIA 4EKUA 4EZKA 1E8XA 2KQSA 2DYMA 3IHPC 3UQBA 1WMHA 2JXXA 2MBBB 4TV3A 4NY0A 2IBIB 3ZNID 3IFWB 4AJYB 4J6IA 3VH3B 3ZNGC 3C0RB 2MP2A 3VAWA 2L3ZA 3A33B 1WGHA 3H9DA 4MSMB 2BYEA 3UQAA 3BY4B 1H8CA 2J7QB 4CYEA 5J18A 2RPQA 3PVLA 2MBEA 1OGWA 2WYQA 3HM6X 2FNJB 4IG7B 2DX5B 4IWQA 4DWFA 2N9EB 3PS6A 2ZNVC 3VUYA 5J2RA 2M4NA 2MQJA 2WDTB 2GBMA 2MW5A 1XD3B 1UELA 2DAFA 2MX2A 1E7VA 4FJVB 3M3JA 1V80A 2DYBA 2KWCA 2RD0A 2BKRB 3QARA 3ZO5B 1WXSA 3JYUA 3RD2A 4HXDA 4FADA 2N9XA 4URKA 2C9WB 2KDBA 1WH3A 3PTFC 2LVOA 3QX1A 2KOXA 4AOFA 3RULA 1GC6A 1RAXA 1WR1A 3KYCD 2L0TA 1I42A 2N9PC 4NPNA 3OLMD 1TZ1A 2LRWA 1WZ3A 1A5RA 2KK8A 4B9KA 3EECA 2K1FA 2KDFB 3X0WA 3DVGY 3PRMB 5AEKB 3Q3JA 5E6OA 2CU1A 3DBLI 3PV1A 3RT3B 1NDDA 2JUOA 3OAWA 1JRUA 3WALA 2QHOA 4DHJB 4GGQA 2EKEC 3ML9A 1KJTA 4FHJA 4MM3A 3H7SA 3NOBA 3ONSA 2IO1B 4GB9A 1I35A 1V9JA 4MH0E 2AL3A 4PS3A 4EFOA 4DXAB 1VCBA 1TBEA 1G6JA 3A9JA 3A9KB 4GIVA 2PEAA 3APFA 5IAAC 1V6EA 1WXMA 2KN5A 4P7IA 3X23A 1ZKHA 5CX3A 2J0MA 3RZWC 3CMMB 3JVZX 2BWES 3H7PB 5DPRA 3ZIMA 2OJRA 1GNUA 1UZXB 3L54A 1V2YA 4E3CA 2R2OA 4W9JA 3SD5A 1PQSA 3R7QA 2ZVNA 2DYOA 2JVCA 2KTRA 4K1RB 4MJSB 4KIKB 3JSVA 2N1WA 3P2BA 3IBEA 4G0NB 5CHVC 4GOCA 3VVWB 3WAPA 1V5OA 4HCPB 4FBJB 3DCGA 1WF9A 3ZDTA 1SGHA 1Q0WB 1YIWA 5KHQA 2LRUA 2K8HA 3QA8A 3LJ3A 3UIPB 3VDZA 3EHVA 1P9DU 3DBHI 3M62B 2KJHB 4WJPA 2BYFA 5JHBA 5LXIB 1YQBA 2L0FA 2KMAA 4FHKA 5HKHA 4WWOA 3L17A 2NBVB 5GMVA 5CHFA 3M95A 4HJKA 4YL8A 2MBOA 4MDKE 1R4NI 4WAAA 3VTVA 2HJ8A 3PPAA 2REXA 1Q5WB 1SE9A 3MHSD 2XK5A 4ASWC 2CHZA 3WAMA 4BVUC 2KX3A 3VQIA 4BOSC 2BPSA 2JRIB 1WXAA 2KXJA 3A1QA 3TMPB 3V6EB 4BOZB 3T9LA 4BFRA 4PS7A 5L83A 1WX8A 2MSED 4B95A 1WX9A 3HHMA 4GDLA 4NAWB 4X57B 4A3PA 4BKTA 4EUTA 4II2B 2EMSA 1P0RA 2M1MA 3L16A 1V86A 1EO6A 3OJ4B 2IYDB 2FCNA 4AWJA 2JRHA 1S1QB 3R66C 1NI2A 5C23A 1LXDA 1WI0A 4BKSA 4ZYNA 1UH6A 2K8CA 2KKCA 4JLCA 5E6PA 2KZRA 2O6VA 2NS5A 3LDZE 4HVBA 4GSWA 4IM3A 4W9GA 4ANWA 1ISNA 2J0JA 2N1VA 4WJQA 4W9LA 4HPMB 1M94A 1GG3A 3I3TB 3VUWA 2LVPA 2G4DB 4EEWA 2MLBA 3ECIA 3ZKJC 3B1LX 2XBBC 3WAOA 2LVQA 4KDIC 5DCNA 1T0YA 2G45B 2C7MB 2IO3B 3AULA 2K39A 2WX0A 5J17A 3ENEA 3KUCB 4WJNA 1E7UA 2ZJDA 2RR9A 4F1SA 5D2MB 4JQWC 1WM2A 2I1KA 2LGYA 3SU8X 3PHWB 4A20A 4AJWA 1SIFA 2V1YA 2HTHA 3IVFA 1WR6E 5LXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6P A;  1WGG A;  4F8C B;  2CS4 A;  5JH5 C;  4RMA A;  4E74 A;  2LUE A;  3H1U A;  3ALB A;  4II3 B;  2MBH A;  1E90 A;  2O2V A;  1WJN A;  2KJ6 A;  1WMH B;  5JZE B;  4M8N A;  4ZRJ A;  3GOE A;  4XZ4 A;  2LGX A;  3U7D A;  3QCA A;  3QAQ A;  4XC2 A;  2PE6 B;  2IO0 B;  3B08 A;  1EF5 A;  3MJW A;  3QWZ B;  4BBN F;  2MP2 B;  4IW0 A;  3ZNH B;  2MA9 B;  4FJZ A;  4BKS D;  3ZNZ B;  4BKG A;  2O6V D;  2GBN A;  2GMI C;  1Z2M A;  2JF5 A;  2KFJ A;  4IM0 A;  3PLV A;  2KWU B;  4M0W B;  4OVU A;  2KD0 A;  1QZE A;  3JW0 X;  3TIX A;  4IM2 A;  3WAN A;  3WIM A;  1UD7 A;  3U30 A;  1ZW7 A;  3W1Y A;  2GBK A;  5AZH A;  1TGZ B;  4W9I A;  3UF8 A;  4HCN B;  2LD9 A;  5D7G A;  2DZJ A;  1IP9 A;  4KVG B;  4PYZ A;  1RRB A;  3N30 A;  2NPT B;  4GDK A;  3H7P A;  2KO3 A;  2LZ6 A;  3TL5 A;  4FA6 A;  3N32 A;  2NBU A;  4FUL A;  2KC2 A;  4ICV A;  4CHK A;  2RSU A;  4JL9 A;  5CTR C;  4B6W A;  1YX6 B;  3N3K B;  1P3Q U;  4DK5 A;  4AUQ C;  2RGF A;  1X1M A;  2IY0 B;  4KIK A;  2JY6 A;  4ZDV A;  3NHE B;  2ZPY A;  3O65 B;  1WGY A;  1NBF C;  5FR6 A;  4NJ6 A;  4NQL B;  1WJ4 A;  1GJZ A;  2K6D B;  3DDC B;  2I1J A;  1E5W A;  3PLU A;  3OJ3 A;  2DAJ A;  3QQ8 B;  4PS8 A;  3L0W B;  1Y8R C;  4N9F 4;  5CHW A;  4HDQ A;  1LM8 B;  5E6N A;  1U4A A;  2JWZ A;  2NVU I;  5DPT A;  5LLI A;  2DHZ A;  4WJO A;  1L2N A;  3PRE A;  1E8Y A;  4HDO A;  2KDE B;  3EFU A;  3TBL D;  4EOY A;  4JIO U;  3A9J B;  3PT2 B;  3TCA A;  4LJO B;  4NNJ B;  1WJU A;  2HD5 B;  2CKH B;  2KFK A;  2IY1 B;  2G4S A;  2M8S A;  3HK0 A;  4G50 A;  4E71 A;  2A5U A;  1V81 A;  2JT4 B;  2M0X A;  1BT0 A;  2V4L A;  2CHW A;  2BWF A;  2OOB B;  1KOT A;  3SDL C;  2KTR B;  4EZJ A;  1P98 A;  4DHZ B;  2HE7 A;  1YJ1 A;  3T8M A;  3JSV B;  1R4M I;  3EC8 A;  3U8Z A;  1V49 A;  2FCQ A;  2Z0E B;  1L7Y A;  2KC1 A;  2N7D A;  1XQQ A;  2W9N A;  2XEW A;  4KZ0 A;  1K8R B;  4K7W A;  4NJ7 A;  3V60 A;  3ZDM C;  1J8C A;  4W9E A;  3DBS A;  4RM9 A;  4IC7 B;  4LCD E;  5C1Z A;  1S3S G;  2C5L C;  4W9H A;  3DPD A;  2KTF A;  1RLF A;  1WIA A;  3RCZ A;  2ZPN A;  1FXT B;  3QHT A;  1P1A A;  4ANX A;  4EZL A;  3K9O B;  1GUA B;  3R7R A;  2G3Q B;  2K6Q A;  2YLM A;  2AYO B;  2ZNV B;  2UWQ A;  4HLE A;  2JZ3 B;  3VUX A;  1LFD A;  2D3G A;  5AZG A;  3ZTD A;  2B3A A;  4IUM B;  4RM8 A;  2LXC A;  2XK5 B;  4WQO B;  4ANU A;  2LGD A;  4HWI B;  2KHW B;  4LJP B;  4KV2 A;  2BYV E;  4LDT D;  2GBJ A;  3UIO B;  3A1Q B;  4K7S A;  1WZ0 A;  5G2N A;  1J0G A;  2IZV B;  4HPL B;  4IWO A;  3ZLZ A;  4GDL B;  4WWN A;  1F9J A;  1YX5 B;  2KJR A;  4FJY A;  2FCM A;  5IA7 A;  1Q1O A;  4NQK E;  5D6J B;  3UIN B;  3VH4 B;  3KUD B;  1WE7 A;  2C60 A;  2KMC A;  3DVN V;  3CF6 E;  3RUI B;  2LWP A;  2N4F A;  2DEN B;  4JGH B;  4MEM A;  2O6V B;  5D94 A;  3K9P B;  4MGK E;  1WGR A;  3ZVV A;  2FUH B;  5KHO A;  3PSE B;  3QC8 B;  3DVN U;  1WX7 A;  3W1S A;  3DQV A;  3AXC A;  2KLG A;  2PPH A;  3CST A;  3IG3 A;  1CMX B;  3KUZ A;  1UBQ A;  2K8B A;  3PRP B;  3R3M A;  2L8J A;  2N7E A;  3Q3F A;  4K81 A;  4PYU A;  4DHZ E;  3VHT C;  4W9D A;  3PRZ A;  2FCS A;  2MBQ A;  2YVC A;  3APD A;  2UYZ B;  2D2Q A;  2NPT A;  4IWP A;  2PE9 A;  2PJH A;  1E8W A;  3A9K A;  2AL6 A;  1HE8 A;  3AU4 A;  2GBR A;  5JHA A;  4GMV A;  2BKF A;  4M8M A;  2IO2 B;  1RFA A;  5AZF A;  4DDG D;  2J0K A;  1ZGU B;  2KVR A;  2O2V B;  2DZI A;  1OQY A;  5DPW A;  3L10 B;  1TTN A;  4MJS A;  2GOW A;  5BO4 B;  4W9F A;  4G11 A;  3KH0 A;  3RZF A;  1H4R A;  4WWP A;  2LAS A;  3NZS A;  2M17 A;  2L00 B;  2ZZP B;  3APC A;  3NS8 A;  1D3Z A;  4I6N B;  4F7Z A;  5EDS A;  4MGZ E;  2Y5B B;  3ZRF A;  3VFK A;  2AWT A;  3QIJ A;  1WXV A;  4OVV A;  3HIZ A;  2C7H A;  2ZVO A;  3PZD A;  3TJP A;  2D07 B;  3S2A A;  3WA0 A;  1C1Y B;  2ZEQ A;  3NZU A;  3PGE A;  4GU2 A;  3W1S C;  4DHJ D;  3ZUN A;  2WWZ A;  2Z0D B;  4XX5 A;  1J19 A;  2KNB A;  4KDL B;  2BF8 B;  4AP4 C;  2KAN A;  4ICU A;  1LQB A;  3KVF B;  4GDK B;  3ML8 A;  2FIF A;  2LXA A;  1UGM A;  4W9C A;  4TKN A;  2KQ7 A;  3ZTC A;  1GC7 A;  3M63 B;  4BBN C;  2LI5 A;  4FN2 A;  2FAZ A;  2FID A;  3VTW A;  1IYF A;  2AEH A;  3A4S C;  4TQ0 A;  2MCN B;  5DPS A;  2CR5 A;  1EF1 A;  1YD8 U;  2ZCC A;  1WYW B;  3VTU A;  1EUV B;  2ASQ A;  2KLC A;  2KDI A;  2NR2 A;  1WJ6 A;  3B0A A;  3GZN I;  4W9K A;  3VXW A;  1UBI A;  3KYD D;  4NAW A;  4ANV A;  2K25 A;  2Z59 B;  4HK2 A;  1OEY A;  2VRR B;  1WY8 A;  4FLH A;  4K7U A;  2D11 A;  3ZW3 A;  1C3T A;  3V61 A;  2D10 A;  3PHX B;  3CSF A;  3KW5 B;  3D32 A;  5L95 C;  2WX1 A;  4TQ1 A;  2JZZ A;  1OTR B;  1KM7 A;  1WFY A;  3L13 A;  4KSL C;  3BIN A;  3RYT A;  1KLV A;  4MGI E;  1AAR A;  4MGY E;  5G55 A;  1WM3 A;  4G3X B;  4GXB A;  2R2Q A;  4DBG A;  1OEY J;  2DZM A;  4LDT B;  2KFK B;  3UGB B;  1Z5S B;  3ZRC A;  1E8Z A;  2L05 A;  2DZK A;  4TUU A;  4GN1 A;  2CHX A;  3V6C B;  3DOW A;  2NCN A;  3AI5 A;  3DBR I;  3L08 A;  4I6L B;  3SHQ A;  3H6N A;  4A3O A;  4KSK C;  2LJ5 A;  2EMT A;  2JPH A;  5TR5 A;  3AU5 A;  3QJZ A;  1XT9 B;  2C7N B;  1MG8 A;  4DDI D;  2ZCB A;  2V3S A;  2MRP A;  1IPG A;  3MTN B;  3QK0 A;  2BGF A;  2NBW B;  1WGD A;  4KZC A;  2A4Z A;  1WRD B;  2KWV B;  2L7R A;  3DVG X;  2L76 A;  1VD2 A;  2KX0 A;  3NY5 A;  4MSQ B;  3HM3 A;  1V5T A;  4CO7 A;  3A4R A;  4MEL A;  2MWS B;  4ZRK A;  1WE6 A;  3V62 A;  4ZRI A;  4EKU A;  4EZK A;  1E8X A;  2KQS A;  2DYM A;  3IHP C;  3UQB A;  1WMH A;  2JXX A;  2MBB B;  4TV3 A;  4NY0 A;  2IBI B;  3ZNI D;  3IFW B;  4AJY B;  4J6I A;  3VH3 B;  3ZNG C;  3C0R B;  2MP2 A;  3VAW A;  2L3Z A;  3A33 B;  1WGH A;  3H9D A;  4MSM B;  2BYE A;  3UQA A;  3BY4 B;  1H8C A;  2J7Q B;  4CYE A;  5J18 A;  2RPQ A;  3PVL A;  2MBE A;  1OGW A;  2WYQ A;  3HM6 X;  2FNJ B;  4IG7 B;  2DX5 B;  4IWQ A;  4DWF A;  2N9E B;  3PS6 A;  2ZNV C;  3VUY A;  5J2R A;  2M4N A;  2MQJ A;  2WDT B;  2GBM A;  2MW5 A;  1XD3 B;  1UEL A;  2DAF A;  2MX2 A;  1E7V A;  4FJV B;  3M3J A;  1V80 A;  2DYB A;  2KWC A;  2RD0 A;  2BKR B;  3QAR A;  3ZO5 B;  1WXS A;  3JYU A;  3RD2 A;  4HXD A;  4FAD A;  2N9X A;  4URK A;  2C9W B;  2KDB A;  1WH3 A;  3PTF C;  2LVO A;  3QX1 A;  2KOX A;  4AOF A;  3RUL A;  1GC6 A;  1RAX A;  1WR1 A;  3KYC D;  2L0T A;  1I42 A;  2N9P C;  4NPN A;  3OLM D;  1TZ1 A;  2LRW A;  1WZ3 A;  1A5R A;  2KK8 A;  4B9K A;  3EEC A;  2K1F A;  2KDF B;  3X0W A;  3DVG Y;  3PRM B;  5AEK B;  3Q3J A;  5E6O A;  2CU1 A;  3DBL I;  3PV1 A;  3RT3 B;  1NDD A;  2JUO A;  3OAW A;  1JRU A;  3WAL A;  2QHO A;  4DHJ B;  4GGQ A;  2EKE C;  3ML9 A;  1KJT A;  4FHJ A;  4MM3 A;  3H7S A;  3NOB A;  3ONS A;  2IO1 B;  4GB9 A;  1I35 A;  1V9J A;  4MH0 E;  2AL3 A;  4PS3 A;  4EFO A;  4DXA B;  1VCB A;  1TBE A;  1G6J A;  3A9J A;  3A9K B;  4GIV A;  2PEA A;  3APF A;  5IAA C;  1V6E A;  1WXM A;  2KN5 A;  4P7I A;  3X23 A;  1ZKH A;  5CX3 A;  2J0M A;  3RZW C;  3CMM B;  3JVZ X;  2BWE S;  3H7P B;  5DPR A;  3ZIM A;  2OJR A;  1GNU A;  1UZX B;  3L54 A;  1V2Y A;  4E3C A;  2R2O A;  4W9J A;  3SD5 A;  1PQS A;  3R7Q A;  2ZVN A;  2DYO A;  2JVC A;  2KTR A;  4K1R B;  4MJS B;  4KIK B;  3JSV A;  2N1W A;  3P2B A;  3IBE A;  4G0N B;  5CHV C;  4GOC A;  3VVW B;  3WAP A;  1V5O A;  4HCP B;  4FBJ B;  3DCG A;  1WF9 A;  3ZDT A;  1SGH A;  1Q0W B;  1YIW A;  5KHQ A;  2LRU A;  2K8H A;  3QA8 A;  3LJ3 A;  3UIP B;  3VDZ A;  3EHV A;  1P9D U;  3DBH I;  3M62 B;  2KJH B;  4WJP A;  2BYF A;  5JHB A;  5LXI B;  1YQB A;  2L0F A;  2KMA A;  4FHK A;  5HKH A;  4WWO A;  3L17 A;  2NBV B;  5GMV A;  5CHF A;  3M95 A;  4HJK A;  4YL8 A;  2MBO A;  4MDK E;  1R4N I;  4WAA A;  3VTV A;  2HJ8 A;  3PPA A;  2REX A;  1Q5W B;  1SE9 A;  3MHS D;  2XK5 A;  4ASW C;  2CHZ A;  3WAM A;  4BVU C;  2KX3 A;  3VQI A;  4BOS C;  2BPS A;  2JRI B;  1WXA A;  2KXJ A;  3A1Q A;  3TMP B;  3V6E B;  4BOZ B;  3T9L A;  4BFR A;  4PS7 A;  5L83 A;  1WX8 A;  2MSE D;  4B95 A;  1WX9 A;  3HHM A;  4GDL A;  4NAW B;  4X57 B;  4A3P A;  4BKT A;  4EUT A;  4II2 B;  2EMS A;  1P0R A;  2M1M A;  3L16 A;  1V86 A;  1EO6 A;  3OJ4 B;  2IYD B;  2FCN A;  4AWJ A;  2JRH A;  1S1Q B;  3R66 C;  1NI2 A;  5C23 A;  1LXD A;  1WI0 A;  4BKS A;  4ZYN A;  1UH6 A;  2K8C A;  2KKC A;  4JLC A;  5E6P A;  2KZR A;  2O6V A;  2NS5 A;  3LDZ E;  4HVB A;  4GSW A;  4IM3 A;  4W9G A;  4ANW A;  1ISN A;  2J0J A;  2N1V A;  4WJQ A;  4W9L A;  4HPM B;  1M94 A;  1GG3 A;  3I3T B;  3VUW A;  2LVP A;  2G4D B;  4EEW A;  2MLB A;  3ECI A;  3ZKJ C;  3B1L X;  2XBB C;  3WAO A;  2LVQ A;  4KDI C;  5DCN A;  1T0Y A;  2G45 B;  2C7M B;  2IO3 B;  3AUL A;  2K39 A;  2WX0 A;  5J17 A;  3ENE A;  3KUC B;  4WJN A;  1E7U A;  2ZJD A;  2RR9 A;  4F1S A;  5D2M B;  4JQW C;  1WM2 A;  2I1K A;  2LGY A;  3SU8 X;  3PHW B;  4A20 A;  4AJW A;  1SIF A;  2V1Y A;  2HTH A;  3IVF A;  1WR6 E;  5LXH A; 
#chains in the Genus database with same CATH topology
 4LNI A;  2CS4 A;  1TKY A;  3FIL A;  3H1U A;  3ALB A;  2LUM A;  2MBH A;  1E90 A;  2L52 A;  1UF0 A;  3QAQ A;  2W55 A;  2IO0 B;  3B08 A;  1EF5 A;  1SJH D;  2MP2 B;  4IW0 A;  2MA9 B;  4FJZ A;  3ZNZ B;  2O6V D;  3T3N A;  1RWS A;  1Z2M A;  2V9H A;  2KWU B;  4M0W B;  4OVU A;  4YWG G;  1QZE A;  3J9C A;  3JW0 X;  4IM2 A;  3WAN A;  4P1C C;  1ZW7 A;  4XE0 A;  4W9I A;  3Q6B A;  5D7G A;  1IP9 A;  1FXI A;  3B9J A;  2M19 A;  4GDK A;  4XYC A;  3TL5 A;  2N9L A;  4CHK A;  3TEZ A;  1ZDX A;  3N3K B;  4KIK A;  3NHE B;  2ZPY A;  3O65 B;  1ZOY B;  5FR6 A;  4NJ6 A;  4WUR A;  1GJZ A;  2K6D B;  1ENF A;  3DDC B;  2I1J A;  3RNC C;  2H89 B;  4YXD B;  4OZA A;  1Y8R C;  5EE9 A;  4HDQ A;  2KMM A;  5LLI A;  3AE5 B;  4WJO A;  3PRE A;  3TEY A;  3EFU A;  3A9J B;  1FRD A;  2IY1 B;  2PTL A;  2BYT A;  1NYQ A;  4E71 A;  3AE4 B;  1GPX A;  4EZJ A;  2HE7 A;  1YJ1 A;  1XLQ A;  4KGR A;  1V49 A;  3FC4 A;  3AE3 B;  1L7Y A;  1XQQ A;  2M0A A;  2JU6 X;  4RH6 A;  1DOI A;  2PW9 A;  5C1Z A;  1S3S G;  3P4P B;  3NS1 A;  3RCZ A;  2ZPN A;  1P1A A;  2ZNV B;  4HLE A;  3Q14 C;  2WHI A;  3VUX A;  1LFD A;  3ZTD A;  1A70 A;  4IUM B;  4ANU A;  3SR6 A;  2NTS A;  1JW9 D;  4IWO A;  4GDL B;  4WWN A;  1YX5 B;  2KJR A;  4WWM A;  3RNA C;  3UIN B;  2C60 A;  2WXR A;  3Q8A A;  2DEN B;  4B0E A;  1WGR A;  3NVW A;  3W1S A;  3DQV A;  2KT7 A;  3CST A;  2WXH A;  1UBQ A;  1WSP A;  4KKI A;  2L8J A;  2N7E A;  4PYU A;  3TEX A;  2NPT A;  2DBY A;  4MAC A;  3FIL B;  1RFA A;  5AZF A;  4DDG D;  2J0K A;  2WGS A;  1OQY A;  4MJS A;  3W2D A;  4G11 A;  4M02 A;  1HEZ E;  3ZQ4 A;  3NZS A;  2M17 A;  2AQ1 B;  3KWV A;  1SXT A;  3VFK A;  3LYY A;  4OVV A;  2CJO A;  1EU4 A;  1AYF A;  3S2A A;  2N9K A;  3NZU A;  4GU2 A;  3W1S C;  3ZJT A;  3ZUN A;  1J19 A;  2KNB A;  4ICU A;  3SFD B;  2RDG A;  3KVF B;  4GDK B;  4K3C A;  1R4M B;  2LXA A;  1UGM A;  2QJL A;  4W9C A;  2KQ7 A;  4A6Q A;  3M63 B;  4BBN C;  3NUH B;  5BMH A;  2LI5 A;  1XCQ L;  1JWM D;  2WXM A;  5FK9 C;  1EWY C;  3VTU A;  1WYW B;  1EUV B;  2KLC A;  3B0A A;  1WJ6 A;  2K0P A;  2ONQ A;  4ANV A;  1N6Z A;  2HJ1 A;  3I57 A;  1F1H A;  2OED A;  3NVZ A;  1T0R C;  2WX1 A;  1EU3 A;  1WFY A;  4YTP B;  4KSL C;  1C77 A;  2W82 A;  4G3X B;  1C4A A;  2ZW0 A;  3Q2A C;  4AS1 A;  3LXF A;  4LDT B;  3PZ7 A;  3UGB B;  1TIF A;  2JYE A;  2NCN A;  3AI5 A;  4RGN A;  4I6L B;  1YNT E;  3WCQ A;  2LJ5 A;  1N62 A;  2LHE A;  3MC0 B;  4KZC A;  1WRD B;  2L76 A;  1VD2 A;  1V5T A;  4MEL A;  1K51 A;  4EKU A;  3DWM A;  1WMH A;  1HXY D;  3PO0 A;  2J4X A;  3ZNI D;  1VDV A;  3IFW B;  3VH3 B;  3ZNG C;  1D5Z C;  3A33 B;  2BYE A;  1UGJ A;  4WAF A;  1C4C A;  5J18 A;  3RI7 C;  5HHD G;  4DWF A;  4IWQ A;  4XGA B;  3PS6 A;  1ET9 A;  2RMM A;  2MQJ A;  2WDT B;  2GBM A;  1UNS A;  1UEL A;  2KWC A;  3ZO5 B;  2RD0 A;  3QAR A;  4FAD A;  2YEP F;  4HXD A;  4URK A;  3CIR B;  2MEK A;  2LVO A;  1FM0 D;  3AE2 B;  3RUL A;  1WXQ A;  2RDB C;  3UI3 A;  2INC C;  3W9C B;  1A5R A;  4XWW A;  2KK8 A;  5FR3 A;  3EEC A;  1KTK A;  3PRM B;  5EE0 A;  3Q3J A;  3Q8B A;  3PV1 A;  3URY A;  4PK1 A;  1DYQ A;  2QHO A;  4DHJ B;  4MM3 A;  1VRA B;  2IO1 B;  4RFB A;  1TT5 B;  4ARC A;  3N1Y C;  4MH0 E;  1G6J A;  2FBW B;  1WXM A;  2OHF A;  5CX3 A;  3C19 A;  1C78 A;  3HVZ A;  1F77 A;  1GNU A;  1V2Y A;  1L0V B;  1JAL A;  2ZVN A;  2KTR A;  4MJS B;  4IKG A;  4RF1 A;  1R4N B;  3WAP A;  1V5O A;  4HCP B;  3DCG A;  4DXF A;  1SGH A;  1ZE3 D;  1IBX A;  1AW7 A;  3DBR B;  1SB3 C;  4S17 A;  3SEB A;  2L0F A;  4FHK A;  1TS4 A;  2NBV B;  4YL8 A;  4MDK E;  4WAA A;  2HJ8 A;  1YJI A;  2XK5 A;  2NMQ A;  3RPF C;  1V1P A;  3VQI A;  1D5X C;  3AEE B;  2BPS A;  4PT5 A;  3TMP B;  4BOZ B;  2WDR B;  3TSS A;  4HJG E;  1SSN A;  4X57 B;  2WXO A;  4BKT A;  2D3B A;  1P0R A;  1XLP A;  1MPE A;  3L16 A;  1EO6 A;  1PGB A;  3OJ4 B;  1S1Q B;  5C23 A;  1WI0 A;  4N58 A;  4AQ7 A;  1UH6 A;  4JLC A;  3PZ8 A;  2NS5 A;  3AED B;  5IOI A;  3NJT A;  3E56 A;  4IM3 A;  1ISN A;  1QLB B;  1QOB A;  4W9L A;  3IT4 B;  5BMI A;  3N1X C;  1GG3 A;  1L6U A;  2LVP A;  3VR9 B;  3ZKJ C;  1JWS D;  1SE2 A;  3RMK C;  5DCN A;  1T0Y A;  3AUL A;  2K39 A;  2WX0 A;  4WJN A;  2ZJD A;  5D2M B;  4AJW A;  2I1K A;  4A20 A;  3PHW B;  4L1B A;  3B2G A;  5JH5 C;  4E74 A;  5HI1 A;  2O2V A;  2HDE A;  1WMH B;  3QCA A;  5TSS A;  2QMT A;  4BKS D;  1I4X A;  1JRP A;  2GBN A;  4IM0 A;  2JF5 A;  2KFJ A;  2JZP A;  1J7A A;  1UD7 A;  2GBK A;  1TGZ B;  4YSX B;  2X38 A;  4ZHO A;  2Y3A A;  1KLG D;  1MJD A;  4KVG B;  4PYZ A;  2N7J A;  2KO3 A;  5AUI A;  4FA6 A;  3N32 A;  3V05 A;  2NBU A;  2BVC A;  4FUL A;  3RNG C;  1FCC C;  1B9R A;  2L83 A;  5CTR C;  4B6W A;  2LJI A;  2WXQ A;  2RGF A;  2Z8L A;  3T3O A;  4ZDV A;  1HTQ A;  1B1Z A;  2JYT A;  2IGG A;  4NAM A;  2V4I B;  1CZP A;  1NBF C;  1L5P A;  4NQL B;  1WJ4 A;  4L23 A;  2OJW A;  2DAJ A;  3L0W B;  1XF5 L;  4MM3 B;  3P4Q B;  2NVU I;  1L2N A;  2DHZ A;  5GXG B;  2WDQ B;  4HDO A;  4LK0 M;  4EOY A;  4LJO B;  1WJU A;  2CU3 A;  4WH4 A;  4A9A A;  2KYW A;  2KFK A;  2G4S A;  2M8S A;  3HK0 A;  1JQ4 A;  1FXA A;  2A5U A;  2JT4 B;  1EM7 A;  2W54 A;  4IOI E;  1BT0 A;  1V1O A;  1KOT A;  3SDL C;  2KTR B;  4HKZ E;  4XWT A;  3BII D;  2EKI A;  3R8B A;  3EC8 A;  3U8Z A;  5EE1 A;  2N7D A;  2W9N A;  2VZK B;  4LNN A;  1VZ8 A;  1RYJ A;  3RNB C;  3AN1 A;  3GB1 A;  1XCT L;  2WXK A;  1IBX B;  3P4R B;  4K7W A;  1GB4 A;  4IC7 B;  4LCD E;  2WXP A;  3DPD A;  1WIA A;  1IGD A;  3K9O B;  1GUA B;  2G3Q B;  2K6Q A;  3GE8 C;  2JZ3 B;  1QT9 A;  2ACZ B;  5AZG A;  4C4V A;  2XK5 B;  1V1P B;  4HWI B;  5BMG A;  2KAC A;  1FD6 A;  4KV2 A;  4LDT D;  3UIO B;  2GBJ A;  4K7S A;  2WS3 B;  5G2N A;  1DOY A;  2WXG A;  4HPL B;  3ZLZ A;  1YQ3 B;  5IA7 A;  2GLS A;  1K53 A;  2LWP A;  2N4F A;  4JGH B;  1QQR A;  1SE4 A;  2W3S A;  1TS3 A;  2KLG A;  1BML C;  1FRR A;  2L1A A;  3KUZ A;  1KF6 B;  3PRP B;  4DHZ E;  2G9H D;  1HQR D;  5G5G A;  4IWP A;  2PJH A;  4ZHP A;  1UWX A;  1FPY A;  1VZ7 A;  3AU4 A;  3FAH A;  1WGK A;  4GMV A;  2BKF A;  2UU7 A;  4MH8 A;  2MJ3 A;  4RGM A;  2O2V B;  2KVR A;  2DZI A;  3BWU D;  4DQO C;  4JWS C;  3RZF A;  1MVK A;  1D3Z A;  1MI0 A;  5EDS A;  1PGX A;  2Y5B B;  3HIZ A;  2ZVO A;  1I4P A;  2ZEQ A;  3PGE A;  1T3Q A;  4DHJ D;  2WWZ A;  2BF8 B;  4AP4 C;  2KAN A;  1T0Q C;  1LQB A;  1F52 A;  3TUO A;  1C76 A;  1TKG A;  3ML8 A;  2FIF A;  1FFV A;  1ZPS A;  3ZTC A;  2QSD A;  2V3P A;  4A8X C;  2BT6 A;  2AEH A;  1ACC A;  1IYF A;  2LGS A;  2ZCC A;  1MHH E;  3EA6 A;  2NR2 A;  1OFF A;  3BK2 A;  3VXW A;  5C2T B;  1PGA A;  2RPV A;  2K25 A;  4K7U A;  1C4P A;  2D11 A;  2JWU A;  5JXV A;  1C3T A;  3PHX B;  3DHI C;  5L95 C;  3L13 A;  3RYT A;  1KLV A;  2E6X A;  4MGY E;  1VR9 A;  5G55 A;  3HRD D;  1WM3 A;  3EGR A;  1L6V A;  2MHJ A;  4DBG A;  3W5V B;  2DZM A;  4A90 A;  2KFK B;  1Z5S B;  5LNK 1;  4TUU A;  4A3O A;  3SHQ A;  3GS2 A;  3H6N A;  5D3I B;  2JPH A;  3ZXR A;  5TR5 A;  3QJZ A;  4DDI D;  4RF0 A;  5BYQ A;  2ZCB A;  3QK0 A;  4QAY A;  2BB5 A;  4HRS A;  5D3D A;  3DVG X;  3P1M A;  2KX0 A;  3HM3 A;  1L0Y B;  2WU5 B;  4EZK A;  1K52 A;  3IHP C;  3UQB A;  3KQ4 A;  3N1Z C;  2JX5 A;  2JXX A;  4AJY B;  2IGD A;  4J6I A;  3RNF C;  4N6E B;  3VRB B;  2L3Z A;  4MSM B;  3H9D A;  4RCO A;  1ET6 A;  1H8C A;  1L4Z B;  1NEK B;  2J7Q B;  4CYE A;  4D2K A;  2WXN A;  1M4V A;  4C4V B;  3PVL A;  3GE3 C;  2MBE A;  2FNJ B;  3I9V 1;  4IG7 B;  2N9E B;  5EE3 A;  2MW5 A;  2DAF A;  1V80 A;  2DYB A;  4NJC A;  1WXS A;  3JYU A;  2DNF A;  4JPS A;  1WH3 A;  2KOX A;  1I42 A;  3BVZ A;  1TZ1 A;  1WZ3 A;  1SJE D;  4B9K A;  2K1F A;  2KDF B;  3C8Y A;  3ZJU A;  3X0W A;  3AE9 B;  3Q8E A;  1AN8 A;  5AEK B;  5E6O A;  3OAW A;  4GGQ A;  1TY2 A;  1KJT A;  3NOB A;  3RN9 C;  3P4S B;  1I7H A;  4KX6 B;  1I35 A;  1TS5 A;  2AL3 A;  1VCB A;  1IGC A;  3GZN B;  1SIJ A;  2KN5 A;  1DOX A;  1XXG A;  1DGJ A;  2BWE S;  1YN4 A;  5DPR A;  1UZX B;  2HTM E;  4K3B A;  2BS2 B;  4UDU C;  4O1N A;  4E3C A;  2R2O A;  1PQS A;  3R7Q A;  4K1R B;  4KIK B;  3P2B A;  3IBE A;  5CHV C;  2JSV X;  3VVW B;  4FBJ B;  1Q10 A;  1WF9 A;  2WU2 B;  4OW0 A;  1YIW A;  5KHQ A;  2LRU A;  3NVY A;  2KWD A;  3LJ3 A;  3OG5 A;  1Y56 A;  4R3D A;  4J3O D;  2BYF A;  2DWQ A;  2N0S B;  1MG4 A;  2JQR B;  2KMA A;  4WWO A;  5CHF A;  2PIA A;  2MBO A;  2I2Y A;  1E10 A;  1Q5W B;  3WAM A;  1WXA A;  2KXJ A;  1HZ6 A;  3T9L A;  5L83 A;  2G1E A;  1I4G A;  1F0Z A;  1WX8 A;  2MSE D;  2XN9 C;  4KGS A;  4A3P A;  4M00 A;  2M1M A;  1V86 A;  2QIE B;  2K5P A;  1LXD A;  4ZYN A;  5E6P A;  1QF6 A;  1FFU A;  2VZK D;  4WJQ A;  1M94 A;  3VUW A;  2MLB A;  1QOG A;  3B1L X;  4KDI C;  2G45 B;  2R61 A;  1E7U A;  5C3J B;  2RR9 A;  1JCK B;  1T0S C;  2AX5 A;  3IVF A;  3E9S A;  4ITK A;  4F8C B;  3DBL B;  4RMA A;  2LUE A;  3LB8 C;  3P63 A;  1UUP A;  1WJN A;  5JZE B;  4M8N A;  4XZ4 A;  1CK1 A;  4XC2 A;  2PE6 B;  1N5W A;  3BZD B;  3QWZ B;  3AEB B;  1E0Z A;  1KH0 A;  4BKG A;  4HPP A;  4IDI A;  2KD0 A;  3U30 A;  1E9M A;  1T5X D;  4HCN B;  2LD9 A;  2DZJ A;  1FNU A;  3N30 A;  2NPT B;  4OVZ A;  3H7P A;  1GAQ B;  2MJE A;  4ICV A;  2KN4 A;  2RSU A;  4JL9 A;  1YX6 B;  1P3Q U;  3ZGZ A;  1X1M A;  2IY0 B;  2JY6 A;  3DBH B;  1WGY A;  4YTM B;  1FIQ A;  1TJE A;  2XNA C;  1LO5 D;  3OJ3 A;  4PS8 A;  3B2F A;  5CHW A;  2W3R A;  1FNW A;  4REZ A;  2K9X A;  1LM8 B;  5E6N A;  3AEF B;  4N59 A;  3VR8 B;  2KDE B;  2MH7 A;  2LMC A;  3TBL D;  3TCA A;  3N9Y C;  2HD5 B;  4RGT A;  2D3A A;  3KWL A;  1SEB D;  2BWF A;  5HG2 A;  5H92 C;  3AEC B;  1P98 A;  1N61 A;  1FMA D;  4DHZ B;  2WDV B;  3T8M A;  3ZXV A;  3AM9 A;  3KLS X;  1R4M I;  2Q5W D;  2XEW A;  2IDY A;  4KZ0 A;  1K8R B;  3V60 A;  1J8C A;  3DBS A;  4RM9 A;  4C80 A;  2C5L C;  4W9H A;  2KTF A;  2CJN A;  1FXT B;  3QHT A;  1OQQ A;  4ANX A;  2LGI A;  2AYO B;  2D3G A;  4C56 C;  2B3A A;  4RM8 A;  1YN5 A;  3ABV B;  4WQO B;  1N5X A;  2LGD A;  3R2I A;  2KHW B;  4LJP B;  1J0G A;  1KLU D;  2IZV B;  1TY0 A;  2FCM A;  5D6J B;  3VH4 B;  3P42 A;  1JRO A;  3DVN V;  2LHD A;  3RUI B;  4LNO A;  5D94 A;  3K9P B;  2FUH B;  2IND C;  3RNE C;  3AXC A;  2PPH A;  1J7C A;  1CMX B;  2K8B A;  3R3M A;  4K81 A;  1FNV A;  1JWB D;  3VHT C;  1I4H A;  3U52 E;  3PRZ A;  2WLB A;  2FCS A;  2YVC A;  1TYG B;  2UYZ B;  2D2Q A;  5IO9 A;  1HE8 A;  4LTU A;  2GBR A;  2WXJ A;  1J7B A;  5JHA A;  4M8M A;  4MT5 A;  2IO2 B;  3NZ3 A;  4YT0 B;  1YJJ A;  3H8H A;  2PVO D;  3L10 B;  1TTN A;  2GOW A;  2YEP B;  4W9F A;  1ROE A;  3NS8 A;  4I6N B;  4F7Z A;  2FE8 A;  4MGZ E;  3ZRF A;  1XO3 A;  3AE8 B;  2AWT A;  1WXV A;  2WXL A;  2C7H A;  2D07 B;  3WA0 A;  2KDM A;  4B0M A;  4TKN A;  1I4Q A;  2FAZ A;  3VTW A;  4EE2 A;  5DPS A;  1CJE A;  1EF1 A;  4W9K A;  4NAW A;  1LGR A;  1OEY A;  4FLH A;  1HZ5 A;  3SFE B;  3ZW3 A;  1L0X B;  3V61 A;  3CSF A;  3KW5 B;  5IP4 D;  3HUI A;  2JZZ A;  2QDF A;  1QOA A;  1ZP0 B;  1PYW D;  1RM6 C;  3DHG C;  2PMV A;  4MGI E;  1AAR A;  1RFK A;  4GXB A;  1OEY J;  3ZRC A;  1E8Z A;  1C79 A;  2L05 A;  4GN1 A;  4XDD A;  3L08 A;  3DBR I;  4KKJ A;  2EMT A;  4OHJ A;  3BYY B;  3AU5 A;  1OQR A;  2C7N B;  3MC8 A;  1YQ4 B;  3I5J C;  2V3S A;  2MRP A;  2BGF A;  2NBW B;  3BVG A;  1MFW A;  2A4Z A;  4MSQ B;  2J52 A;  2KWV B;  4DXA B;  3NY5 A;  2MWS B;  4ZRK A;  1WE6 A;  3V62 A;  4ZRI A;  1E8X A;  3IAM 1;  2KQS A;  2DYM A;  4LNF A;  5FKA C;  4NY0 A;  2IBI B;  3C0R B;  4L2Y A;  3DWG C;  1WGH A;  3UQA A;  3BY4 B;  4HKQ A;  2SEB D;  1OGW A;  3HM6 X;  5BYR A;  2DX5 B;  2ZNV C;  5E6J A;  3VUY A;  5J2R A;  2Y5C A;  2M4N A;  4TSS A;  1FO4 A;  2MX2 A;  4FJV B;  2BKR B;  4H2A A;  3RD2 A;  2N9X A;  2KDB A;  3MP9 A;  5BYS A;  3NVV A;  4AOF A;  1RAX A;  2D5G A;  1WR1 A;  3KYC D;  2L0T A;  2N9P C;  4JWU C;  2LRW A;  1JWU D;  3DVG Y;  2VH1 A;  2L32 A;  2B76 B;  3RT3 B;  1KFY B;  2JUO A;  1JRU A;  2M56 B;  2EKE C;  4FHJ A;  3H7S A;  1N63 A;  1P7E A;  1V9J A;  4EFO A;  3R2T A;  1TBE A;  4USA A;  5IAA C;  4P7I A;  3X23 A;  1ZKH A;  3RZW C;  2OJR A;  1NVI D;  3BK1 A;  2QCZ A;  2JVC A;  1WRI A;  4RNA A;  5G5H A;  3BVM A;  3BYT B;  3JSV A;  2N1W A;  1PFD A;  4G0N B;  3MHZ A;  3DHH C;  1HA5 A;  1C9F A;  3VDZ A;  3AE6 B;  1P9D U;  3M62 B;  1L4D B;  2KJH B;  3Q3N C;  4WJP A;  1XLN A;  1MHX A;  5JHB A;  1YQB A;  3EUB 2;  4CQN A;  5GMV A;  4JX1 C;  4HJK A;  1NEN B;  3VTV A;  4P6V F;  2REX A;  4ASW C;  2CHZ A;  4BOS C;  4US8 A;  2JRI B;  3A1Q A;  3V6E B;  1NYR A;  4PS7 A;  4B95 A;  1WX9 A;  1F2R I;  3HHM A;  4NAW B;  1E6E B;  3O13 A;  2IYD B;  2FCN A;  4AWJ A;  2JRH A;  4S0R A;  3R66 C;  1NI2 A;  1YOV B;  2KKC A;  2O6V A;  3LDZ E;  4US9 A;  4HVB A;  3AE7 B;  1N60 A;  3Q3O C;  2N1V A;  4HPM B;  4WQM A;  2VH2 A;  1WWT A;  3IXS A;  3ECI A;  2D3C A;  1YN3 A;  2XBB C;  3V3X A;  2C7M B;  5J17 A;  3MC9 A;  2E3T A;  3ENE A;  3SU8 X;  4JQW C;  1WM2 A;  2LGY A;  1SIF A;  2V1Y A;  2BS4 B;  1WR6 E;  1TZO A;  1NI3 A;  4I6P A;  1WGG A;  4XDC A;  2PLP A;  4II3 B;  4LNK A;  3TEW A;  2SAK A;  5AUK A;  5IKC M;  2KJ6 A;  4ZRJ A;  3GOE A;  3IT6 B;  2LGX A;  4M01 A;  3U7D A;  2V0G A;  3MJW A;  4BBN F;  3ZNH B;  2GMI C;  4C00 A;  4EEW A;  3PLV A;  3TIX A;  1YMH E;  1FEH A;  3WIM A;  4OZB A;  3W1Y A;  5AZH A;  3UF8 A;  2QIL A;  1RRB A;  2EEL A;  2LZ6 A;  4RGO S;  1E7P B;  2GI9 A;  1P7F A;  2KC2 A;  1XLO A;  2V3N A;  4DK5 A;  4AUQ C;  1ZXH A;  1STE A;  4WIP A;  1E5W A;  3PLU A;  3W5U B;  3QQ8 B;  4N9F 4;  1U4A A;  2JWZ A;  5DPT A;  1E8Y A;  5IN7 A;  4JIO U;  3PT2 B;  4NNJ B;  4Q2J A;  2CKH B;  1QIL A;  4G50 A;  1V81 A;  2M0X A;  2BBC A;  1WYG A;  2V4L A;  2CHW A;  2OOB B;  2GB1 A;  4P16 A;  3JSV B;  3U2S C;  2FCQ A;  2Z0E B;  1ZDV A;  2KC1 A;  4YTN B;  1BUI C;  1D4B A;  2X8X X;  1HTO A;  1SE3 A;  4NJ7 A;  3ZDM C;  4W9E A;  4BAX A;  2H88 B;  2WXI A;  2I38 A;  1RLF A;  4EZL A;  3R7R A;  2YLM A;  2UWQ A;  3MJ5 A;  2LXC A;  1PUT A;  2ICI A;  2BYV E;  3A1Q B;  1WZ0 A;  4TMA B;  2WNM A;  1R7S A;  3HVD A;  1F9J A;  4FJY A;  1Q1O A;  4NQK E;  2Y5P A;  4LLG M;  3KUD B;  1WE7 A;  2KMC A;  3CF6 E;  3AMZ A;  5MPO A;  4MEM A;  2O6V B;  4MGK E;  3ZVV A;  5KHO A;  3PSE B;  3QC8 B;  3DVN U;  1WX7 A;  1AWD A;  4C7Y A;  4HRO A;  2FUG 1;  1TKE A;  3IG3 A;  4YSY B;  3Q3F A;  4ZYS A;  4W9D A;  3ETR A;  1VLB A;  2MBQ A;  3APD A;  2PE9 A;  1E8W A;  3A9K A;  4BZA A;  2BB6 A;  2AL6 A;  3NRZ A;  1FCL A;  4HEA 1;  1D5M C;  1JWA D;  2WP9 B;  4P1B C;  1ZGU B;  3VRA B;  5DPW A;  2BS3 B;  5BO4 B;  1IUE A;  3KH0 A;  1PDX A;  1H4R A;  2WXF A;  3AH7 A;  4WWP A;  2LAS A;  4JE3 B;  5I4D A;  1VZ6 A;  5HFY A;  2L00 B;  2ZZP B;  3APC A;  1QKZ A;  2QC8 A;  2J42 A;  3QIJ A;  4ZRP A;  3PZD A;  3TJP A;  1C1Y B;  2Z0D B;  4XX5 A;  4KDL B;  3ZYY X;  2MJD A;  3MFG A;  1D6E C;  1GC7 A;  3GP7 A;  4FN2 A;  4OZC A;  2FID A;  4TQ0 A;  3A4S C;  2MCN B;  2CR5 A;  1YD8 U;  2ASQ A;  2KDI A;  3GZN I;  2J53 A;  2RDH A;  1UBI A;  3KYD D;  3EFC A;  2Z59 B;  4HK2 A;  1I4R A;  2QEJ C;  3AV8 A;  2BW2 A;  2VRR B;  1WY8 A;  3Q69 A;  2D10 A;  3D32 A;  3OWE B;  4TQ1 A;  1OTR B;  1KM7 A;  3L4P A;  3BIN A;  3CWI A;  4NZL B;  2INP E;  2R2Q A;  2DZK A;  2CHX A;  3V6C B;  3DOW A;  1F2R C;  1QOF A;  4KSK C;  4ZOH C;  4GLS C;  2AQ2 B;  1XT9 B;  1MG8 A;  3MTN B;  1IPG A;  2AQ3 B;  3IAS 1;  1WGD A;  3RFZ B;  2LFI A;  2L7R A;  4CO7 A;  3A4R A;  2IJ0 A;  4TV3 A;  2MBB B;  2MP2 A;  3VAW A;  1K50 A;  4DXG A;  2PKO A;  4M0W A;  1SBB B;  2RPQ A;  2WYQ A;  3AEG B;  4ARI A;  1BXT A;  3AEA B;  3U4E G;  1XD3 B;  1E7V A;  3M3J A;  2C9W B;  2ZW1 A;  3PTF C;  4A55 A;  2JXT A;  3QX1 A;  1CQV A;  1GC6 A;  1GOZ A;  4NPN A;  3OLM D;  3Q8F A;  1V8C A;  2ON8 A;  2KQ4 X;  2BTE A;  2CU1 A;  3DBL I;  3Q3M C;  1NDD A;  1EWC A;  1TS2 A;  3WAL A;  3ML9 A;  1ZXI A;  3FKY A;  3ONS A;  4GB9 A;  4C7Z A;  2NTT A;  3AE1 B;  4PS3 A;  3A9J A;  3A9K B;  4GIV A;  2PEA A;  3APF A;  1V6E A;  3I63 C;  3ZJV A;  2J0M A;  3CMM B;  3JVZ X;  2K22 A;  3AB5 A;  3H7P B;  3ZIM A;  3L54 A;  2KVZ A;  4W9J A;  3SD5 A;  4FXC A;  4KGT A;  2DYO A;  1T6B X;  1XEE A;  4GOC A;  2KAJ A;  3ZDT A;  2K3U A;  1Q0W B;  5T8I A;  2K8H A;  3QA8 A;  3UIP B;  3EHV A;  1V97 A;  3DBH I;  5LXI B;  2IPK D;  1SF0 A;  5HKH A;  3L17 A;  2GRI A;  3M95 A;  1ZUD 2;  1R4N I;  4ZRQ A;  3PPA A;  2DLB A;  1SE9 A;  3MHS D;  2BQQ A;  4BVU C;  2PVG C;  2KX3 A;  1ESF A;  4BFR A;  2LEK A;  3Q8C A;  1KRH A;  4GDL A;  1VJK A;  4EUT A;  4II2 B;  4ACF A;  2EMS A;  3N20 C;  4YSZ B;  4BKS A;  2K8C A;  2IGH A;  1UWM A;  2KZR A;  1GB1 A;  4GSW A;  4W9G A;  1JML A;  2WQY B;  4ANW A;  2J0J A;  3U7Z A;  5H8Y E;  3I3T B;  2G4D B;  3WAO A;  2LVQ A;  2INN E;  2IO3 B;  2TSS A;  3NG0 A;  3KUC B;  2HTH A;  4F1S A;  5LXH A; 
#chains in the Genus database with same CATH homology
 4I6P A;  1WGG A;  4F8C B;  2CS4 A;  5JH5 C;  4RMA A;  4E74 A;  2LUE A;  3H1U A;  3ALB A;  4II3 B;  2MBH A;  1E90 A;  2O2V A;  1WJN A;  2KJ6 A;  1WMH B;  5JZE B;  4M8N A;  4ZRJ A;  3GOE A;  4XZ4 A;  2LGX A;  3U7D A;  3QCA A;  3QAQ A;  4XC2 A;  2PE6 B;  2IO0 B;  3B08 A;  1EF5 A;  3MJW A;  3QWZ B;  4BBN F;  2MP2 B;  4IW0 A;  3ZNH B;  2MA9 B;  4FJZ A;  4BKS D;  3ZNZ B;  4BKG A;  2O6V D;  2GBN A;  2GMI C;  1Z2M A;  2JF5 A;  2KFJ A;  4IM0 A;  3PLV A;  2KWU B;  4M0W B;  4OVU A;  2KD0 A;  1QZE A;  3JW0 X;  3TIX A;  4IM2 A;  3WAN A;  3WIM A;  1UD7 A;  3U30 A;  1ZW7 A;  3W1Y A;  2GBK A;  5AZH A;  1TGZ B;  4W9I A;  3UF8 A;  4HCN B;  2LD9 A;  5D7G A;  2DZJ A;  1IP9 A;  4KVG B;  4PYZ A;  1RRB A;  3N30 A;  2NPT B;  4GDK A;  3H7P A;  2KO3 A;  2LZ6 A;  3TL5 A;  4FA6 A;  3N32 A;  2NBU A;  4FUL A;  2KC2 A;  4ICV A;  4CHK A;  2RSU A;  4JL9 A;  5CTR C;  4B6W A;  1YX6 B;  3N3K B;  1P3Q U;  4DK5 A;  4AUQ C;  2RGF A;  1X1M A;  2IY0 B;  4KIK A;  2JY6 A;  4ZDV A;  3NHE B;  2ZPY A;  3O65 B;  1WGY A;  1NBF C;  5FR6 A;  4NJ6 A;  4NQL B;  1WJ4 A;  1GJZ A;  2K6D B;  3DDC B;  2I1J A;  1E5W A;  3PLU A;  3OJ3 A;  2DAJ A;  3QQ8 B;  4PS8 A;  3L0W B;  1Y8R C;  4N9F 4;  5CHW A;  4HDQ A;  1LM8 B;  5E6N A;  1U4A A;  2JWZ A;  2NVU I;  5DPT A;  5LLI A;  2DHZ A;  4WJO A;  1L2N A;  3PRE A;  1E8Y A;  4HDO A;  2KDE B;  3EFU A;  3TBL D;  4EOY A;  4JIO U;  3A9J B;  3PT2 B;  3TCA A;  4LJO B;  4NNJ B;  1WJU A;  2HD5 B;  2CKH B;  2KFK A;  2IY1 B;  2G4S A;  2M8S A;  3HK0 A;  4G50 A;  4E71 A;  2A5U A;  1V81 A;  2JT4 B;  2M0X A;  1BT0 A;  2V4L A;  2CHW A;  2BWF A;  2OOB B;  1KOT A;  3SDL C;  2KTR B;  4EZJ A;  1P98 A;  4DHZ B;  2HE7 A;  1YJ1 A;  3T8M A;  3JSV B;  1R4M I;  3EC8 A;  3U8Z A;  1V49 A;  2FCQ A;  2Z0E B;  1L7Y A;  2KC1 A;  2N7D A;  1XQQ A;  2W9N A;  2XEW A;  4KZ0 A;  1K8R B;  4K7W A;  4NJ7 A;  3V60 A;  3ZDM C;  1J8C A;  4W9E A;  3DBS A;  4RM9 A;  4IC7 B;  4LCD E;  5C1Z A;  1S3S G;  2C5L C;  4W9H A;  3DPD A;  2KTF A;  1RLF A;  1WIA A;  3RCZ A;  2ZPN A;  1FXT B;  3QHT A;  1P1A A;  4ANX A;  4EZL A;  3K9O B;  1GUA B;  3R7R A;  2G3Q B;  2K6Q A;  2YLM A;  2AYO B;  2ZNV B;  2UWQ A;  4HLE A;  2JZ3 B;  3VUX A;  1LFD A;  2D3G A;  5AZG A;  3ZTD A;  2B3A A;  4IUM B;  4RM8 A;  2LXC A;  2XK5 B;  4WQO B;  4ANU A;  2LGD A;  4HWI B;  2KHW B;  4LJP B;  4KV2 A;  2BYV E;  4LDT D;  2GBJ A;  3UIO B;  3A1Q B;  4K7S A;  1WZ0 A;  5G2N A;  1J0G A;  2IZV B;  4HPL B;  4IWO A;  3ZLZ A;  4GDL B;  4WWN A;  1F9J A;  1YX5 B;  2KJR A;  4FJY A;  2FCM A;  5IA7 A;  1Q1O A;  4NQK E;  5D6J B;  3UIN B;  3VH4 B;  3KUD B;  1WE7 A;  2C60 A;  2KMC A;  3DVN V;  3CF6 E;  3RUI B;  2LWP A;  2N4F A;  2DEN B;  4JGH B;  4MEM A;  2O6V B;  5D94 A;  3K9P B;  4MGK E;  1WGR A;  3ZVV A;  2FUH B;  5KHO A;  3PSE B;  3QC8 B;  3DVN U;  1WX7 A;  3W1S A;  3DQV A;  3AXC A;  2KLG A;  2PPH A;  3CST A;  3IG3 A;  1CMX B;  3KUZ A;  1UBQ A;  2K8B A;  3PRP B;  3R3M A;  2L8J A;  2N7E A;  3Q3F A;  4K81 A;  4PYU A;  4DHZ E;  3VHT C;  4W9D A;  3PRZ A;  2FCS A;  2MBQ A;  2YVC A;  3APD A;  2UYZ B;  2D2Q A;  2NPT A;  4IWP A;  2PE9 A;  2PJH A;  1E8W A;  3A9K A;  2AL6 A;  1HE8 A;  3AU4 A;  2GBR A;  5JHA A;  4GMV A;  2BKF A;  4M8M A;  2IO2 B;  1RFA A;  5AZF A;  4DDG D;  2J0K A;  1ZGU B;  2KVR A;  2O2V B;  2DZI A;  1OQY A;  5DPW A;  3L10 B;  1TTN A;  4MJS A;  2GOW A;  5BO4 B;  4W9F A;  4G11 A;  3KH0 A;  3RZF A;  1H4R A;  4WWP A;  2LAS A;  3NZS A;  2M17 A;  2L00 B;  2ZZP B;  3APC A;  3NS8 A;  1D3Z A;  4I6N B;  4F7Z A;  5EDS A;  4MGZ E;  2Y5B B;  3ZRF A;  3VFK A;  2AWT A;  3QIJ A;  1WXV A;  4OVV A;  3HIZ A;  2C7H A;  2ZVO A;  3PZD A;  3TJP A;  2D07 B;  3S2A A;  3WA0 A;  1C1Y B;  2ZEQ A;  3NZU A;  3PGE A;  4GU2 A;  3W1S C;  4DHJ D;  3ZUN A;  2WWZ A;  2Z0D B;  4XX5 A;  1J19 A;  2KNB A;  4KDL B;  2BF8 B;  4AP4 C;  2KAN A;  4ICU A;  1LQB A;  3KVF B;  4GDK B;  3ML8 A;  2FIF A;  2LXA A;  1UGM A;  4W9C A;  4TKN A;  2KQ7 A;  3ZTC A;  1GC7 A;  3M63 B;  4BBN C;  2LI5 A;  4FN2 A;  2FAZ A;  2FID A;  3VTW A;  1IYF A;  2AEH A;  3A4S C;  4TQ0 A;  2MCN B;  5DPS A;  2CR5 A;  1EF1 A;  1YD8 U;  2ZCC A;  1WYW B;  3VTU A;  1EUV B;  2ASQ A;  2KLC A;  2KDI A;  2NR2 A;  1WJ6 A;  3B0A A;  3GZN I;  4W9K A;  3VXW A;  1UBI A;  3KYD D;  4NAW A;  4ANV A;  2K25 A;  2Z59 B;  4HK2 A;  1OEY A;  2VRR B;  1WY8 A;  4FLH A;  4K7U A;  2D11 A;  3ZW3 A;  1C3T A;  3V61 A;  2D10 A;  3PHX B;  3CSF A;  3KW5 B;  3D32 A;  5L95 C;  2WX1 A;  4TQ1 A;  2JZZ A;  1OTR B;  1KM7 A;  1WFY A;  3L13 A;  4KSL C;  3BIN A;  3RYT A;  1KLV A;  4MGI E;  1AAR A;  4MGY E;  5G55 A;  1WM3 A;  4G3X B;  4GXB A;  2R2Q A;  4DBG A;  1OEY J;  2DZM A;  4LDT B;  2KFK B;  3UGB B;  1Z5S B;  3ZRC A;  1E8Z A;  2L05 A;  2DZK A;  4TUU A;  4GN1 A;  2CHX A;  3V6C B;  3DOW A;  2NCN A;  3AI5 A;  3DBR I;  3L08 A;  4I6L B;  3SHQ A;  3H6N A;  4A3O A;  4KSK C;  2LJ5 A;  2EMT A;  2JPH A;  5TR5 A;  3AU5 A;  3QJZ A;  1XT9 B;  2C7N B;  1MG8 A;  4DDI D;  2ZCB A;  2V3S A;  2MRP A;  1IPG A;  3MTN B;  3QK0 A;  2BGF A;  2NBW B;  1WGD A;  4KZC A;  2A4Z A;  1WRD B;  2KWV B;  2L7R A;  3DVG X;  2L76 A;  1VD2 A;  2KX0 A;  3NY5 A;  4MSQ B;  3HM3 A;  1V5T A;  4CO7 A;  3A4R A;  4MEL A;  2MWS B;  4ZRK A;  1WE6 A;  3V62 A;  4ZRI A;  4EKU A;  4EZK A;  1E8X A;  2KQS A;  2DYM A;  3IHP C;  3UQB A;  1WMH A;  2JXX A;  2MBB B;  4TV3 A;  4NY0 A;  2IBI B;  3ZNI D;  3IFW B;  4AJY B;  4J6I A;  3VH3 B;  3ZNG C;  3C0R B;  2MP2 A;  3VAW A;  2L3Z A;  3A33 B;  1WGH A;  3H9D A;  4MSM B;  2BYE A;  3UQA A;  3BY4 B;  1H8C A;  2J7Q B;  4CYE A;  5J18 A;  2RPQ A;  3PVL A;  2MBE A;  1OGW A;  2WYQ A;  3HM6 X;  2FNJ B;  4IG7 B;  2DX5 B;  4IWQ A;  4DWF A;  2N9E B;  3PS6 A;  2ZNV C;  3VUY A;  5J2R A;  2M4N A;  2MQJ A;  2WDT B;  2GBM A;  2MW5 A;  1XD3 B;  1UEL A;  2DAF A;  2MX2 A;  1E7V A;  4FJV B;  3M3J A;  1V80 A;  2DYB A;  2KWC A;  2RD0 A;  2BKR B;  3QAR A;  3ZO5 B;  1WXS A;  3JYU A;  3RD2 A;  4HXD A;  4FAD A;  2N9X A;  4URK A;  2C9W B;  2KDB A;  1WH3 A;  3PTF C;  2LVO A;  3QX1 A;  2KOX A;  4AOF A;  3RUL A;  1GC6 A;  1RAX A;  1WR1 A;  3KYC D;  2L0T A;  1I42 A;  2N9P C;  4NPN A;  3OLM D;  1TZ1 A;  2LRW A;  1WZ3 A;  1A5R A;  2KK8 A;  4B9K A;  3EEC A;  2K1F A;  2KDF B;  3X0W A;  3DVG Y;  3PRM B;  5AEK B;  3Q3J A;  5E6O A;  2CU1 A;  3DBL I;  3PV1 A;  3RT3 B;  1NDD A;  2JUO A;  3OAW A;  1JRU A;  3WAL A;  2QHO A;  4DHJ B;  4GGQ A;  2EKE C;  3ML9 A;  1KJT A;  4FHJ A;  4MM3 A;  3H7S A;  3NOB A;  3ONS A;  2IO1 B;  4GB9 A;  1I35 A;  1V9J A;  4MH0 E;  2AL3 A;  4PS3 A;  4EFO A;  4DXA B;  1VCB A;  1TBE A;  1G6J A;  3A9J A;  3A9K B;  4GIV A;  2PEA A;  3APF A;  5IAA C;  1V6E A;  1WXM A;  2KN5 A;  4P7I A;  3X23 A;  1ZKH A;  5CX3 A;  2J0M A;  3RZW C;  3CMM B;  3JVZ X;  2BWE S;  3H7P B;  5DPR A;  3ZIM A;  2OJR A;  1GNU A;  1UZX B;  3L54 A;  1V2Y A;  4E3C A;  2R2O A;  4W9J A;  3SD5 A;  1PQS A;  3R7Q A;  2ZVN A;  2DYO A;  2JVC A;  2KTR A;  4K1R B;  4MJS B;  4KIK B;  3JSV A;  2N1W A;  3P2B A;  3IBE A;  4G0N B;  5CHV C;  4GOC A;  3VVW B;  3WAP A;  1V5O A;  4HCP B;  4FBJ B;  3DCG A;  1WF9 A;  3ZDT A;  1SGH A;  1Q0W B;  1YIW A;  5KHQ A;  2LRU A;  2K8H A;  3QA8 A;  3LJ3 A;  3UIP B;  3VDZ A;  3EHV A;  1P9D U;  3DBH I;  3M62 B;  2KJH B;  4WJP A;  2BYF A;  5JHB A;  5LXI B;  1YQB A;  2L0F A;  2KMA A;  4FHK A;  5HKH A;  4WWO A;  3L17 A;  2NBV B;  5GMV A;  5CHF A;  3M95 A;  4HJK A;  4YL8 A;  2MBO A;  4MDK E;  1R4N I;  4WAA A;  3VTV A;  2HJ8 A;  3PPA A;  2REX A;  1Q5W B;  1SE9 A;  3MHS D;  2XK5 A;  4ASW C;  2CHZ A;  3WAM A;  4BVU C;  2KX3 A;  3VQI A;  4BOS C;  2BPS A;  2JRI B;  1WXA A;  2KXJ A;  3A1Q A;  3TMP B;  3V6E B;  4BOZ B;  3T9L A;  4BFR A;  4PS7 A;  5L83 A;  1WX8 A;  2MSE D;  4B95 A;  1WX9 A;  3HHM A;  4GDL A;  4NAW B;  4X57 B;  4A3P A;  4BKT A;  4EUT A;  4II2 B;  2EMS A;  1P0R A;  2M1M A;  3L16 A;  1V86 A;  1EO6 A;  3OJ4 B;  2IYD B;  2FCN A;  4AWJ A;  2JRH A;  1S1Q B;  3R66 C;  1NI2 A;  5C23 A;  1LXD A;  1WI0 A;  4BKS A;  4ZYN A;  1UH6 A;  2K8C A;  2KKC A;  4JLC A;  5E6P A;  2KZR A;  2O6V A;  2NS5 A;  3LDZ E;  4HVB A;  4GSW A;  4IM3 A;  4W9G A;  4ANW A;  1ISN A;  2J0J A;  2N1V A;  4WJQ A;  4W9L A;  4HPM B;  1M94 A;  1GG3 A;  3I3T B;  3VUW A;  2LVP A;  2G4D B;  4EEW A;  2MLB A;  3ECI A;  3ZKJ C;  3B1L X;  2XBB C;  3WAO A;  2LVQ A;  4KDI C;  5DCN A;  1T0Y A;  2G45 B;  2C7M B;  2IO3 B;  3AUL A;  2K39 A;  2WX0 A;  5J17 A;  3ENE A;  3KUC B;  4WJN A;  1E7U A;  2ZJD A;  2RR9 A;  4F1S A;  5D2M B;  4JQW C;  1WM2 A;  2I1K A;  2LGY A;  3SU8 X;  3PHW B;  4A20 A;  4AJW A;  1SIF A;  2V1Y A;  2HTH A;  3IVF A;  1WR6 E;  5LXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...