1P98A

High-resolution nmr structure of the ubl-domain of hhr23a
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
78
structure length
78
Chain Sequence
b'MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UV excision repair protein RAD23 homolog A
molecule tags Replication
source organism Homo sapiens
publication title Structural determinants for the binding of ubiquitin-like domains to the proteasome.
pubmed doi rcsb
total genus 11
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2003-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1p98A00
2IY0B 4KDIC 2XBBC 2C7NB 3VXWA 4KV2A 3L54A 4ANXA 2N9EB 1LXDA 3L08A 1V81A 2KWCA 2D3GA 3WAMA 3W1YA 2LASA 2DZIA 5GMVA 4BBNC 4DHZE 4ZRJA 3VH4B 4DXAB 4N9F4 1WZ0A 3UIPB 4TQ0A 4JIOU 4BBNF 1WX7A 4HWIB 2C5LC 2GMIC 5E6OA 2JT4B 4FHKA 2BYEA 2PE6B 3HK0A 3ZDTA 1WMHB 2KANA 1T0YA 4PYUA 3V6EB 1UGMA 4NAWA 1D3ZA 2LXCA 1KJTA 2KN5A 2BYFA 3NOBA 3ZTCA 3CMMB 3RCZA 2AEHA 3OJ4B 4II3B 4B95A 3NY5A 2D11A 4TQ1A 3R3MA 3WIMA 3UQAA 4FHJA 5KHQA 2LJ5A 1WFYA 3KYCD 2GBRA 2LZ6A 4HLEA 1KLVA 1NI2A 4FN2A 4EKUA 4ZYNA 1WIAA 3X0WA 3LDZE 2LUEA 1ZW7A 4NJ7A 3A1QB 3I3TB 1FXTB 2FCMA 3ML9A 3NHEB 2K39A 4FJVB 3DVNU 2R2QA 3KW5B 1IPGA 4FULA 2K25A 3QIJA 1I35A 1L2NA 3IFWB 2DZKA 4FLHA 4KZCA 1Q1OA 2KLCA 4XX5A 1IYFA 4DDGD 3H1UA 2D2QA 1GNUA 5J2RA 4WQOB 2IO2B 4RM9A 5JZEB 5DPWA 2WX1A 2V4LA 2KWUB 1ZKHA 1I42A 3D32A 2MP2A 2KQSA 4LDTD 3UGBB 3VUYA 2AYOB 4PS7A 3PZDA 3EFUA 3GOEA 2JRIB 2C9WB 2GBKA 2C7HA 5JHAA 4W9DA 2ZNVB 4LCDE 5CHFA 2GBNA 2D07B 3VUWA 2DYOA 4K7WA 3W1SC 4BKSA 2YVCA 2KD0A 3TMPB 3PGEA 4W9JA 1WMHA 2ASQA 2JXXA 2O6VB 1V5TA 1F9JA 3GZNI 2UWQA 2DHZA 1YX6B 1WM2A 2MLBA 3QCAA 1E8ZA 4IM2A 3MHSD 4MSMB 3ZKJC 4LJPB 1V5OA 3IG3A 4W9GA 1H4RA 2J0JA 3APCA 1J19A 2PJHA 2EMSA 3VFKA 3VTVA 1P0RA 3RZFA 4AOFA 1P9DU 3QWZB 1RLFA 2FIDA 2VRRB 3PHXB 3NZUA 2CS4A 1WH3A 4ANWA 4URKA 2ZEQA 2IYDB 4DHJB 2KNBA 4JQWC 1YJ1A 1E7UA 2BWES 2XK5B 4AJYB 2PPHA 4ASWC 3PVLA 3H7PB 4F1SA 3VDZA 5LLIA 3ZRCA 2KX0A 3NS8A 2MRPA 5D7GA 2N7DA 2JVCA 2ZPNA 4W9CA 4W9KA 1YQBA 3V61A 4ANUA 5AEKB 1K8RB 4MELA 1HE8A 1RFAA 2G3QB 5CHVC 4DHJD 2MX2A 1QZEA 3O65B 1TZ1A 2FNJB 2KC2A 3NZSA 3SU8X 3VVWB 1OQYA 2PE9A 2ZCCA 3DQVA 4EZJA 1V49A 4G0NB 5DPSA 3L13A 3ZTDA 5HKHA 3PRPB 1S3SG 3QAQA 4GXBA 5KHOA 2LWPA 4XC2A 2O6VD 3KUZA 3EECA 2MBOA 4CHKA 1X1MA 2G45B 2WX0A 3JYUA 2V1YA 2AWTA 3VAWA 1WE6A 2KZRA 1J8CA 2K6DB 2RR9A 3H7PA 3HM6X 1CMXB 4ICVA 4WWNA 2JRHA 2JUOA 2NPTB 1Y8RC 4GGQA 4CO7A 1EUVB 4A20A 2IBIB 2KXJA 5J18A 2G4SA 3TBLD 2HTHA 1WGYA 2FIFA 1UD7A 1YIWA 3P2BA 2MQJA 3VHTC 3AI5A 3SD5A 3K9OB 3QJZA 3WAOA 1E5WA 3JW0X 2NR2A 4LDTB 3ZDMC 3ECIA 3ZNZB 3KUDB 1C3TA 4FJYA 1WX9A 4IUMB 3KVFB 2KHWB 3DBLI 5L95C 5CHWA 2K6QA 2KTRA 2LD9A 4EZKA 2WYQA 2NBWB 5LXIB 3Q3JA 2KTRB 1Q0WB 2KFJA 2LRWA 2MBEA 3A9KA 5G2NA 2KMAA 5DPRA 2ZVNA 2IO0B 3RULA 2JWZA 2KWVB 3DBHI 2N9PC 5AZGA 2JZ3B 3V6CB 4F8CB 4IWPA 3L0WB 4YL8A 4ZRKA 1YX5B 4DDID 1IP9A 5CX3A 4GU2A 2DZMA 3C0RB 1WF9A 3HM3A 4I6PA 4XZ4A 1WJ6A 4WAAA 2N7EA 3V60A 2EKEC 3VTUA 4AP4C 2LGYA 3T8MA 4FBJB 4G11A 3DOWA 3H6NA 2A5UA 2KDBA 4MSQB 3EC8A 2WWZA 4MJSA 2HJ8A 3R7QA 4A3OA 2IO1B 1L7YA 1EO6A 1TGZB 3TCAA 2REXA 3WANA 4AWJA 2KJHB 4WJPA 3VH3B 1WGHA 5L83A 1OTRB 1WGRA 3R7RA 4MGKE 1GC7A 2MA9B 3ONSA 3KH0A 2CHZA 4I6NB 3SHQA 2CR5A 4E71A 4MJSB 4RM8A 2V3SA 1WXSA 3A9JA 4IW0A 4MH0E 3RT3B 2KKCA 2RGFA 5G55A 2UYZB 2K1FA 4EFOA 1MG8A 2N1VA 3PRZA 1M94A 3EHVA 4HCPB 3AULA 4WWPA 3ZNHB 5C1ZA 3M95A 4GDKB 5D2MB 2O2VA 1V86A 3ZO5B 1RRBA 1E8XA 2MBHA 4HDQA 1C1YB 3KYDD 5DPTA 1Z5SB 2LVQA 3A4SC 1EF1A 4MDKE 2DYMA 2EMTA 2L7RA 4TKNA 4GN1A 3A9KB 1UH6A 4K7SA 1WR6E 1WX8A 4FJZA 2KO3A 5FR6A 5C23A 4HVBA 4ICUA 2L05A 3VUXA 2R2OA 1Z2MA 1V2YA 1WZ3A 5TR5A 5E6PA 2BF8B 1EF5A 2KOXA 4E74A 3KUCB 1LM8B 1GUAB 1SGHA 4M0WB 4TV3A 4F7ZA 2W9NA 1ZGUB 3RYTA 1WRDB 1TBEA 2BWFA 3BY4B 2L76A 4HPLB 2I1KA 2AL6A 4HCNB 3A1QA 3ML8A 2CU1A 4KSKC 3SDLC 4MM3A 3L17A 1WGGA 2MBQA 2DAJA 4AUQC 1WI0A 1UBIA 1WY8A 2M8SA 4GOCA 5IA7A 3QHTA 2MCNB 3UIOB 1SE9A 4KIKB 2CHXA 2KLGA 2KMCA 2L3ZA 3ZRFA 3DDCB 1WR1A 2ZPYA 1KOTA 4X57B 1WXMA 4I6LB 1V6EA 4IC7B 2NPTA 5E6NA 4IM3A 3RUIB 1R4NI 3IHPC 3UF8A 3ZVVA 4J6IA 1WJUA 2KJ6A 2MP2B 4HDOA 3WAPA 1VCBA 2LGXA 3CSFA 2XK5A 3L10B 4KIKA 2IY1B 2HD5B 3U8ZA 4M8NA 1V9JA 2FCQA 4K7UA 1WM3A 4EOYA 4ZDVA 4NAWB 3HHMA 4NQKE 2LVOA 3ENEA 3DBSA 1UELA 3VQIA 2DZJA 3W1SA 2NBVB 1A5RA 3A33B 3RD2A 2XEWA 1R4MI 1WJNA 3AU4A 1Q5WB 4GDLA 2DX5B 3ZUNA 4NQLB 1V80A 2C60A 3DPDA 1WXVA 4GMVA 4HK2A 4BOSC 3H7SA 4A3PA 4WJQA 1E90A 1U4AA 2FCSA 2KTFA 3PLUA 4JLCA 1VD2A 5AZFA 3PV1A 2HE7A 3H9DA 3QA8A 2KJRA 3WA0A 1PQSA 2ZNVC 2NS5A 4HJKA 3ZNGC 2AL3A 2Z59B 3QX1A 2KDFB 3ZNID 3APDA 4MEMA 4MGIE 2L8JA 3DCGA 4JL9A 4WJNA 4K81A 2A4ZA 4GDKA 2KDIA 3MJWA 2LVPA 4HPMB 2I1JA 2LXAA 5D6JB 4IWQA 3Q3FA 1E7VA 2N9XA 3WALA 4II2B 1WGDA 4W9FA 3B08A 3QARA 1YD8U 3T9LA 3PTFC 4BVUC 2ZVOA 1LFDA 2MW5A 2NVUI 3A4RA 1S1QB 2G4DB 2NBUA 2M4NA 1GG3A 2ZCBA 5DCNA 2Y5BB 2J0KA 3N32A 5D94A 2K8CA 2NCNA 3U7DA 3ZLZA 4DHZB 2KC1A 4NPNA 2RD0A 3A9JB 1XQQA 3AXCA 2GBJA 3L16A 3PT2B 4MGZE 2JY6A 5IAAC 3PLVA 4E3CA 4EUTA 1UZXB 4FA6A 3TIXA 5J17A 1SIFA 3OLMD 2KFKB 4P7IA 2YLMA 4K1RB 5BO4B 1G6JA 1GJZA 3PHWB 4GIVA 2RSUA 4NNJB 2K8BA 4B6WA 4BKTA 4BOZB 4W9HA 2KK8A 4GDLB 1OEYJ 2Z0DB 3VTWA 4ZRIA 3IBEA 2MSED 4ANVA 2OOBB 2Z0EB 2M0XA 3JVZX 3PPAA 2GBMA 2OJRA 4IM0A 4BKGA 1H8CA 2IO3B 3OAWA 2PEAA 2O2VB 4KDLB 1WXAA 1ISNA 3DVGX 2KQ7A 4JGHB 4MGYE 4KSLC 5JH5C 4HXDA 5EDSA 1KM7A 1WE7A 2JF5A 3ALBA 3JSVB 3CF6E 3DVNV 3MTNB 2KX3A 4KZ0A 2M17A 2KVRA 4NY0A 5AZHA 1TTNA 4PS3A 3TJPA 1J0GA 4W9IA 4PYZA 5JHBA 1XT9B 1P3QU 3QQ8B 2JZZA 2QHOA 4TUUA 4W9EA 1NDDA 2BKRB 2CHWA 4WJOA 4EZLA 3HIZA 4GSWA 2LRUA 3UINB 2B3AA 3V62A 4BKSD 2JPHA 2J0MA 4B9KA 2L00B 1LQBA 3CSTA 2LGDA 3PREA 4GB9A 2CKHB 3M3JA 1UBQA 4IG7B 2BPSA 3QK0A 4RMAA 3TL5A 1OGWA 2ZZPB 4DK5A 2L0FA 2O6VA 1P98A 1E8YA 3DVGY 3IVFA 3B0AA 3QC8B 2KFKA 2M1MA 4OVUA 2C7MB 4G50A 3AU5A 3K9PB 1BT0A 1AARA 2DYBA 3PRMB 3R66C 2IZVB 1WYWB 4PS8A 1GC6A 2DENB 4BFRA 5LXHA 2KDEB 2BYVE 3ZW3A 2L0TA 2LI5A 2RPQA 2MWSB 5CTRC 2J7QB 3PS6A 1XD3B 3JSVA 1E8WA 4AJWA 3ZIMA 3APFA 1P1AA 4DWFA 3U30A 2K8HA 4KVGB 2FAZA 3RZWC 4LJOB 3LJ3A 3N30A 2WDTB 2D10A 3S2AA 3B1LX 1RAXA 2FUHB 3BINA 3M63B 3UQBA 1NBFC 2GOWA 2DAFA 2BGFA 4FADA 4G3XB 2N1WA 4OVVA 4EEWA 1JRUA 2FCNA 2MBBB 2ZJDA 3DBRI 4WWOA 2BKFA 1OEYA 3N3KB 3OJ3A 4M8MA 3M62B 3X23A 4W9LA 4CYEA 4DBGA 1WJ4A 2N4FA 4IWOA 3PSEB 4NJ6A
chains in the Genus database with same CATH superfamily
1T6BX 3VXWA 3L54A 4ANXA 4DQOC 2KQ4X 1V81A 3WAMA 3P4QB 1SEBD 3DBLB 4HKZE 2LASA 3HVDA 3SEBA 4DHZE 3GE8C 3IT4B 1D6EC 2VH2A 2C5LC 2GMIC 4KGSA 2JT4B 2BYEA 3IXSA 1C4CA 3HK0A 3ZDTA 3AEAB 3V6EB 1I4HA 1ZP0B 4LK0M 3ZTCA 3U2SC 3OJ4B 2JXTA 2VZKB 2BB6A 2QSDA 2ACZB 4LNIA 3KYCD 2PW9A 1NI2A 2E3TA 2AQ2B 3LDZE 3EFCA 3A1QB 3I3TB 2LHDA 2FCMA 2WP9B 3ML9A 2K39A 3DVNU 4FULA 3IFWB 1ZE3D 4KZCA 2KLCA 4XX5A 4DDGD 1WWTA 1L5PA 3O13A 1I42A 2MP2A 3V3XA 4ZRQA 4WURA 2C7HA 4W9DA 2LFIA 2GBNA 3VUWA 4K7WA 5E6JA 1NI3A 3PGEA 3J9CA 2O6VB 1V5TA 2ZW1A 3GZNI 2UWQA 4JX1C 2DHZA 1FIQA 4MSMB 4N6EB 3Q14C 4AOFA 1RLFA 3PHXB 2CU3A 3NZUA 1WH3A 2KWDA 1AW7A 2IYDB 4DHJB 3TSSA 2KNBA 4LNFA 1J7AA 1E7UA 2BS3B 2BWES 1K51A 3MC0B 4LLGM 3ZRCA 3NS8A 5D7GA 2IPKD 1HTQA 3V61A 4W9KA 1HE8A 1VZ8A 4DHJD 3O65B 4Q2JA 1MFWA 2KC2A 3NZSA 1KLUD 2L83A 3ZJTA 5DPSA 4GXBA 5KHOA 5BMHA 2O6VD 3EECA 2MBOA 2K3UA 2INPE 1XO3A 2AWTA 1J8CA 1L6UA 1T3QA 3T3NA 4ICVA 5BYSA 1C79A 1C9FA 1B1ZA 4TMAB 2X8XX 2HTHA 3P2BA 3PZ7A 2X38A 3SD5A 5HG2A 3QJZA 3JW0X 4LDTB 1F2RC 1WX9A 3IAS1 2KHWB 4REZA 2KTRA 4EZKA 3Q3JA 2KFJA 2MBEA 4KKJA 5G2NA 1UF0A 2ZVNA 2IO0B 2BBCA 4F8CB 1IUEA 4IWPA 4ZRKA 1YQ4B 5G5HA 1IP9A 4F7ZA 3HM3A 4I6PA 1QILA 2N7EA 4G11A 3H6NA 2KDBA 3R7QA 2QMTA 3TCAA 2PIAA 3VH3B 1WGRA 4MGKE 1QOGA 3KH0A 5BMGA 3AEFB 4E71A 4MH0E 3NZ3A 4S17A 2RGFA 1TIFA 2L52A 5BYQA 3EA6A 4HCPB 3FILA 5D2MB 1E8XA 2MBHA 3B2GA 4NZLB 1Z5SB 3HRDD 4MDKE 1R7SA 2DYMA 3Q2AC 4FJZA 1SSNA 1WZ3A 5TR5A 5JXVA 3KUCB 1LM8B 4B0MA 4TV3A 3RNCC 3Q69A 2BWFA 1SB3C 2L76A 4HPLB 2MEKA 1VZ7A 2WXIA 2CU1A 2IGGA 1WGGA 2MBQA 3AB5A 1L6VA 4AUQC 1WI0A 1L4DB 1UBIA 2M8SA 2WDRB 5IA7A 3UIOB 1E6EB 1WR1A 4HKQA 2ZPYA 1V6EA 5E6NA 2WGSA 3RUIB 3DHHC 2WXLA 3ZVVA 4C80A 3GZNB 2XK5A 4KIKA 1E10A 1HEZE 4C4VB 1V9JA 4K7UA 4EOYA 4ZDVA 3BVGA 3BK2A 2JX5A 4HPPA 1YN5A 3B2FA 2DZJA 3W1SA 2WXGA 3RD2A 2D3AA 5MPOA 2DWQA 3AU4A 3AM9A 1Q5WB 3ZUNA 1BUIC 4JWSC 1V80A 1FCLA 3CIRB 4MH8A 1VD2A 3GP7A 3PV1A 3W9CB 1XXGA 3QA8A 1PQSA 2AL3A 1AN8A 1UWXA 4YTPB 1NVID 1TS5A 3MJWA 1EU4A 2LVPA 4N59A 1WGKA 4NAMA 2MH7A 3WALA 1YOVB 3VRBB 2MW5A 3DWMA 1S1QB 1I4PA 2NCNA 4PK1A 2TSSA 1XQQA 3AXCA 2UU7A 1I4QA 2W82A 4E3CA 1FXAA 1UZXB 3TIXA 1SIFA 2J42A 2W3SA 2KFKB 4RNAA 5AUIA 1A70A 2K8BA 2KMMA 4DHZB 4BOZB 1OEYJ 3IBEA 2M19A 3AECB 4XWWA 3JVZX 1NENB 1PYWD 1ZXHA 1DGJA 2V4IB 2O2VB 4KDLB 2RDBC 3DVGX 2KACA 2E6XA 5EDSA 1KM7A 1TS2A 1WE7A 2JF5A 3ALBA 1HXYD 4B0EA 2KX3A 4M00A 1TTNA 1E9MA 3PZ8A 3QQ8B 1XT9B 2D3BA 4WJOA 2XN9C 3C8YA 4GSWA 1C4AA 3OG5A 3V62A 2VH1A 4M01A 2CJOA 3PREA 1V1PA 3QK0A 4RMAA 4DXGA 5FKAC 1E8YA 3DVGY 4OVUA 2C7MB 1KRHA 3R66C 1N5XA 4PS8A 1FMAD 4M02A 1GC6A 1P7FA 1VLBA 2KDEB 2L0TA 4LTUA 2LI5A 4WH4A 2J7QB 5G5GA 3PS6A 3I57A 1E0ZA 2INCC 4AJWA 1I4RA 4DWFA 3U30A 2FAZA 3RZWC 4LJOB 3LJ3A 3W5UB 3B1LX 3UQBA 4D2KA 4S0RA 4FADA 4OVVA 4RCOA 2Y5CA 2MBBB 2WXNA 1GAQB 1C76A 4F1SA 4WWOA 2BYTA 4OW0A 1HA5A 4HJGE 3L08A 4WIPA 1NYQA 3W1YA 4BBNC 3VH4B 4DXAB 4N9F4 1WZ0A 3UIPB 4BBNF 5E6OA 2WU5B 3SR6A 1RFKA 1WMHB 2KANA 1HZ5A 2MHJA 3IT6B 4H2AA 3B9JA 3NOBA 3CMMB 3RCZA 2AEHA 3FAHA 4XDCA 4II3B 1VZ6A 2D11A 3R3MA 1FNWA 5KHQA 2LJ5A 1XEEA 2GBRA 1WIAA 3AEGB 3KWVA 2LUEA 1ZW7A 4USAA 2WDVB 4KGTA 1FXTB 3NHEB 3KW5B 1I35A 2K25A 3QIJA 1Q10A 2DZKA 4FLHA 1PDXA 4WQOB 2IO2B 1IBXB 5JZEB 3MFGA 4LDTD 2KQSA 1ZXIA 3EFUA 2AQ3B 1TJEA 2C9WB 3E9SA 1TYGB 5IO9A 3AV8A 2LEKA 2ZNVB 3U52E 1TS3A 2D07B 2DYOA 3W1SC 4BKSA 2YVCA 2ASQA 1T0QC 1UWMA 3P42A 3MHSD 3ZKJC 3DWGC 4LJPB 2PLPA 2YEPF 1BMLC 4W9GA 3APCA 3VTVA 1P0RA 2FIDA 2CS4A 4ANWA 2ONQA 1I4GA 5IP4D 3AEEB 4ASWC 2JYEA 2KX0A 3E56A 2JVCA 4MELA 2HDEA 5CHVC 2MX2A 1QZEA 2K5PA 1TZ1A 3SU8X 3VVWB 3GB1A 2PE9A 4EZJA 1V49A 4YWGG 1QQRA 3L13A 3PRPB 5FK9C 4XC2A 1DOXA 1T5XD 4CHKA 5BMIA 3H7PA 2NMQA 4XWTA 4GGQA 1FFVA 1GB1A 1WGYA 2FIFA 2V3NA 1UD7A 2MQJA 4HEA1 3K9OB 5EE1A 3TUOA 2NR2A 1K53A 1RYJA 2EELA 2J52A 3KUDB 4A90A 4BAXA 2K6QA 4ARIA 2WYQA 5LXIB 3AN1A 2KMAA 5DPRA 1TY2A 4ITKA 2KWVB 3DBHI 2N9PC 5AZGA 3UI3A 1TS4A 4YL8A 1WYGA 4DDID 4GU2A 3C0RB 4WAAA 4AP4C 2LGYA 2A5UA 3EC8A 2LUMA 2WWZA 4O1NA 4A3OA 2IO1B 1L7YA 3WANA 2KJHB 4WJPA 5L83A 1OTRB 5GXGB 3SFEB 1M4VA 2H89B 3NS1A 1C4PA 1UNSA 2UYZB 2K1FA 1PFDA 4MM3B 4OZCA 3AULA 3M95A 2O2VA 1FFUA 4HDQA 1C1YB 3KYDD 2LVQA 2RPVA 2M0AA 2HTME 3AEBB 1UH6A 4K7SA 3ZJVA 3TEZA 1WX8A 5FR6A 4HVBA 4ICUA 1Z2MA 1V2YA 5E6PA 1JQ4A 3BZDB 5FR3A 4US9A 2W9NA 2FBWB 2I1KA 2AL6A 1I7HA 3A1QA 4MM3A 2VZKD 3QHTA 2WS3B 3R2TA 2MCNB 2ZW0A 2KLGA 2KMCA 3DDCB 4AS1A 4X57B 2GRIA 3UF8A 4J6IA 2KJ6A 2PVGC 4HDOA 3CSFA 2IY1B 4ZRPA 2DNFA 1UGJA 4M8NA 1KTKA 2LHEA 3VQIA 2KVZA 2RDGA 3NG0A 3R2IA 2DX5B 4OZBA 2C60A 4NQLB 4BOSC 3H7SA 1E90A 2FCSA 2KTFA 3PLUA 1N60A 4JLCA 2IDYA 5C3JB 2KJRA 3WA0A 3EGRA 2PVOD 3ZNGC 1FXIA 1XCTL 2KDFB 3ZNID 1JCKB 3APDA 4MEMA 4MGIE 3DCGA 1OQQA 4K81A 2KDIA 3AE5B 4IWQA 3DBHB 1FM0D 3Q3NC 2BW2A 4R3DA 2INNE 1WGDA 4II2B 4K3BA 3PTFC 2WLBA 2G4DB 2NBUA 2Z8LA 1GG3A 2ZCBA 2QEJC 5DCNA 2Y5BB 2J0KA 5D94A 2RD0A 3L16A 2BB5A 3PT2B 3OLMD 2YLMA 4TSSA 5BO4B 2N0SB 2RSUA 4B6WA 4BKTA 2KK8A 1CK1A 4ZRIA 3HVZA 3PPAA 4L23A 1H8CA 2IO3B 3OAWA 2PEAA 3GE3C 4MGYE 4JGHB 4ZYSA 4WWMA 4P6VF 3JSVB 4KX6B 3CF6E 4NY0A 3T3OA 5AZHA 1HTOA 4PYZA 1P3QU 2JZZA 2QHOA 4W9EA 4TUUA 1NDDA 2CHWA 3AE4B 3DHIC 1FNVA 2OHFA 3L4PA 3AE2B 2JPHA 4B9KA 2L00B 1J7CA 3BYYB 2LGDA 4GB9A 1FRDA 1UBQA 1WSPA 3RNBC 4RGMA 4DK5A 2GI9A 1P98A 3B0AA 2KFKA 3Q8BA 3K9PB 2KYWA 1AARA 2R61A 1T0SC 4BFRA 1FPYA 5CTRC 2WQYB 3JSVA 1ACCA 3ZIMA 1IBXA 5HHDG 1MHHE 4XGAB 3BINA 4OHJA 3M63B 2BT6A 2GOWA 1YJIA 2BGFA 3FILB 4G3XB 4EEWA 2FCNA 4L1BA 3BIID 3DBRI 2BKFA 3OJ3A 4M8MA 3RULA 1QLBB 1D5MC 2XBBC 2C7NB 4KV2A 1FCCC 2N9EB 2KWCA 2BS4B 2D3GA 1FO4A 3NVYA 4P1BC 4TQ0A 4JIOU 1WX7A 1N61A 4HWIB 1N5WA 3OWEB 5EE0A 3MC8A 2KDMA 1T0YA 4PYUA 1MJDA 1UGMA 1D3ZA 2L1AA 2LXCA 1KJTA 2KN5A 2BYFA 1AWDA 4FHJA 1WFYA 1TY0A 1TT5B 3ZYYX 4EKUA 4ZYNA 5AUKA 1GOZA 4ZHOA 3U4EG 4YTMB 3N9YC 1QT9A 2WXJA 4FJVB 1IPGA 4WAFA 5J2RA 5EE3A 3LYYA 4RM9A 2WX1A 2V4LA 2WNMA 1RM6C 4A55A 3UGBB 4PS7A 1TZOA 3IAM1 2GBKA 5JHAA 4LCDE 5CHFA 4RGTA 2KD0A 3TMPB 5C2TB 4W9JA 1WMHA 2JXXA 1F77A 1YX6B 1WM2A 2MLBA 4IM2A 2W54A 3TEYA 1H4RA 1J19A 2EMSA 3QWZB 2CJNA 2K22A 1YJ1A 2BS2B 2WXQA 2XK5B 4AJYB 2PPHA 1MHXA 2MRPA 4US8A 2N7DA 3ABVB 2ZPNA 4W9CA 5AEKB 1K8RB 1RFAA 1L0YB 3Q3OC 3P1MA 1VR9A 3MC9A 1ROEA 1E7PB 1V8CA 2ZCCA 2KT7A 2YEPB 3ZTDA 1S3SG 3QAQA 3AE1B 1MI0A 4RF0A 2G45B 2WX0A 1JWSD 3JYUA 4YTNB 3VAWA 2KZRA 2RR9A 1CMXB 4WWNA 2JRHA 2NPTB 3LB8C 3RNEC 2KXJA 5J18A 2GLSA 1JALA 4OZAA 3ZGZA 1XCQL 3I5JC 3ZDMC 1C78A 1SXTA 4M0WA 1C3TA 3KVFB 5L95C 5CHWA 1C77A 2LD9A 1Q0WB 3A9KA 4RGNA 3Q8FA 3RNAC 1AYFA 3V6CB 3AE7B 5HI1A 1QOAA 1ET9A 2BVCA 4XZ4A 2DZMA 1WF9A 1YJJA 1WJ6A 3VTUA 3V60A 2EKEC 1VDVA 1TKEA 3T8MA 4FBJB 1QOFA 4MJSA 1EO6A 4A9AA 1TKGA 4XYCA 3R7RA 1GC7A 1BXTA 2MA9B 1SE2A 3ONSA 4RGOS 4ACFA 4I6NB 1K50A 2CR5A 2N7JA 4MJSB 4RM8A 1F2RI 2V3SA 3A9JA 2KKCA 2BTEA 5G55A 3MJ5A 2N1VA 1M94A 4WWPA 3ZNHB 1JWMD 3ZO5B 1EF1A 1STEA 4TKNA 2FUG1 4GN1A 5IN7A 1WR6E 2KO3A 5C23A 3Q8EA 1J7BA 1IGCA 1JRPA 1HZ6A 2KOXA 1SGHA 2W55A 4M0WB 3P4RB 2JU6X 1WRDB 1TBEA 4GLSC 3BY4B 4OVZA 3RN9C 3GS2A 4KSKC 3ML8A 3SDLC 1WY8A 2NTTA 1SE9A 4KIKB 2CHXA 3ZRFA 1LO5D 1KFYB 1WXMA 4IC7B 1R4NI 2RMMA 1WJUA 3WAPA 2LGXA 2HD5B 3U8ZA 4DXFA 4A6QA 3N1XC 3Q3MC 1N63A 4RF1A 3R8BA 3RI7C 3ENEA 3VR8B 2QCZA 4IOIE 1A5RA 4QAYA 2XEWA 1OQRA 1WJNA 4GDLA 2FE8A 3ZXVA 2WXMA 4HK2A 3DPDA 1WXVA 2SAKA 4A3PA 4WJQA 1U4AA 2QC8A 2AX5A 5AZFA 3H9DA 1XF5L 2ZNVC 3QX1A 4WJNA 3BK1A 4RFBA 1D4BA 2LGSA 2I1JA 2D5GA 1E7VA 2N9XA 1NEKB 2ICIA 4IDIA 1YD8U 2ZVOA 1LFDA 3A4RA 3BVMA 2M4NA 4C00A 2K8CA 3U7DA 1WXQA 4NPNA 2N9KA 4MGZE 4EUTA 5IAAC 5J17A 4XDDA 4P7IA 3MP9A 1GJZA 4GIVA 1CJEA 4J3OD 4ANVA 3VTWA 2Y3AA 2OOBB 2Z0EB 1PGXA 1F0ZA 3EUB2 5D3IB 1QF6A 2AQ1B 4IM0A 3KLSX 1WXAA 2JYTA 1FEHA 4KSLC 5HFYA 5JH5C 4HXDA 3NVWA 2I2YA 5TSSA 1ZDVA 4KZ0A 2M17A 4KGRA 1VRAB 1UUPA 3TJPA 4W9IA 1N62A 2DBYA 2WXFA 3SFDB 1PGAA 5LNK1 2HJ1A 2K9XA 3AE8B 3UINB 2B3AA 4YXDB 3CSTA 4EE2A 1JWUD 3N1ZC 4IG7B 1ENFA 1OGWA 2O6VA 1YN3A 3IVFA 2M1MA 4G50A 1BT0A 4LNKA 1K52A 2K0PA 1R4NB 1SE3A 2DENB 3I63C 5LXHA 3RMKC 3FKYA 1V1OA 3V05A 2IJ0A 2MWSB 4LNOA 1E8WA 4L2YA 4HRSA 1CZPA 3APFA 2K8HA 4KVGB 5D3DA 2D10A 3S2AA 3I9V1 1KH0A 3KWLA 1JRUA 3CWIA 5BYRA 3FC4A 1DOIA 3M62B 4W9LA 2N4FA 4NJ6A 2IY0B 4KDIC 4JWUC 1D5ZC 1JWBD 1YQ3B 1LXDA 1MPEA 3NUHB 5GMVA 2DZIA 2LJIA 4ZRJA 2NTSA 2J4XA 5EE9A 1XLQA 3DBRB 5H8YE 2QJLA 4FHKA 2PE6B 1JW9D 4ARCA 4NAWA 2XNAC 2LMCA 2DLBA 4B95A 3NY5A 4TQ1A 3WIMA 1FNUA 3UQAA 4AQ7A 4HLEA 2LZ6A 3AH7A 3URYA 1KLVA 4FN2A 4MT5A 2QDFA 3X0WA 4MACA 4RH6A 3AE3B 1WRIA 4NJ7A 2Y5PA 4LNNA 1F52A 2R2QA 4C56C 1L2NA 1Q1OA 3TEXA 1IYFA 3H1UA 2D2QA 1GNUA 4JE3B 5DPWA 2KWUB 1ZKHA 3D32A 3VUYA 2AYOB 3PZDA 3GOEA 2JRIB 1MG4A 1YMHE 1YNTE 1ZPSA 2JZPA 1F9JA 4YSZB 4KKIA 3QCAA 1E8ZA 1EWYC 2PMVA 1IGDA 1V5OA 3IG3A 1QOBA 2J0JA 1EWCA 2PJHA 3VFKA 2J53A 3RZFA 1P9DU 2ON8A 2VRRB 4URKA 1JROA 1ZOYB 1JWAD 2ZEQA 4JQWC 3ETRA 1B9RA 3PVLA 3H7PB 1ET6A 2WDQB 3MHZA 5LLIA 3VDZA 1XLNA 1D5XC 4ANUA 2H88B 1YQBA 4HROA 2G3QB 2FNJB 3RNGC 2OJWA 1OQYA 3DQVA 3PO0A 1V1PB 4G0NB 3W2DA 5HKHA 3KQ4A 1T0RC 2LWPA 3KUZA 1X1MA 2V1YA 1WE6A 2QIEB 3ZXRA 2K6DB 3HM6X 3DHGC 2JUOA 4CO7A 1Y8RC 1EUVB 2BQQA 1ZDXA 4A20A 2IBIB 3Q8AA 3P4SB 1SE4A 2G4SA 3TBLD 1YIWA 3VHTC 3AI5A 1JMLA 2EKIA 3WAOA 1E5WA 3ECIA 3AEDB 3ZNZB 3Q8CA 1XLOA 4FJYA 4IUMB 3DBLI 4K3CA 1KLGD 5T8IA 3P4PB 1GB4A 5IOIA 1Y56A 2NBWB 2KTRB 1L4ZB 2LRWA 4NJCA 5H92C 2MJEA 3Q6BA 2V0GA 2GB1A 2JWZA 4CQNA 2JZ3B 3L0WB 3N20C 1SIJA 1YX5B 1SJHD 5CX3A 2INDC 2KAJA 3DOWA 4YT0B 4MSQB 2HJ8A 2WU2B 4C7ZA 1TGZB 4PT5A 1ZUD2 2REXA 4AWJA 1I4XA 1WGHA 2LGIA 3TEWA 3RFZB 2CHZA 3SHQA 1WXSA 4IW0A 3RT3B 3NVZA 4EFOA 1MG8A 3PRZA 3EHVA 5C1ZA 4GDKB 5I4DA 1V86A 2W3RA 3RNFC 1RRBA 5DPTA 2V3PA 3A4SC 2L7RA 2EMTA 3A9KB 3WCQA 2OEDA 3AMZA 2L05A 3VUXA 3P63A 2R2OA 2MJ3A 3C19A 3VRAB 2BF8B 1EF5A 3RPFC 4E74A 1GUAB 2JQRB 3W5VB 3VR9B 3RYTA 1ZGUB 3BYTB 4HCNB 2Q5WD 3L17A 4P1CC 2DAJA 1GPXA 1V97A 4GOCA 3AE9B 3N1YC 3HUIA 2IGDA 1CQVA 2JWUA 2L3ZA 2G1EA 1KOTA 3NJTA 4I6LB 2NPTA 4IM3A 2PTLA 3IHPC 1FRRA 2MP2B 1DOYA 1RWSA 1VCBA 3L10B 4IKGA 1SF0A 2FCQA 1WM3A 3ZQ4A 4NAWB 2WXOA 3HHMA 1QKZA 4NQKE 2LVOA 4UDUC 3DBSA 1UELA 1OFFA 2V9HA 2NBVB 3A33B 1R4MI 2WXKA 4XE0A 4YSYB 2WXHA 4GMVA 2B76B 2HE7A 2L32A 2WXRA 2NS5A 4HJKA 1EU3A 3U7ZA 2Z59B 3H8HA 4JL9A 2L8JA 2A4ZA 4GDKA 3BWUD 4HPMB 2LXAA 5D6JB 4WQMA 3Q3FA 4FXCA 2I38A 2MJDA 2N9LA 4W9FA 3B08A 3QARA 3T9LA 4BVUC 1YN4A 1KF6B 2NVUI 2M56B 4C4VA 3N32A 3ZLZA 2KC1A 4N58A 3A9JB 2GBJA 2JY6A 3PLVA 4FA6A 4K1RB 2RDHA 4ZOHC 1G6JA 3PHWB 4NNJB 4W9HA 4GDLB 2Z0DB 2MSED 1PGBA 2M0XA 2GBMA 2OJRA 4BKGA 1ISNA 2KQ7A 1L0XB 2JSVX 1SBBB 3NRZA 2SEBD 3DVNV 3MTNB 2KVRA 1L0VB 3NVVA 4PS3A 4A8XC 1J0GA 5JHBA 2KN4A 2G9HD 1XLPA 2QILA 2BKRB 1EM7A 4EZLA 3HIZA 2LRUA 4BKSD 2D3CA 2J0MA 1DYQA 1LQBA 1HQRD 4ZHPA 1TKYA 5IKCM 2CKHB 3M3JA 3BVZA 4JPSA 2WHIA 2BPSA 3TL5A 1MVKA 2ZZPB 2L0FA 3QC8B 1F1HA 3AU5A 2DYBA 3PRMB 2IGHA 2IZVB 1WYWB 1NYRA 2BYVE 1P7EA 3ZW3A 1SJED 2RPQA 2WXPA 1XD3B 1ESFA 1P1AA 4BZAA 3N30A 2WDTB 1N6ZA 4P16A 1RAXA 2FUHB 2PKOA 1NBFC 4YSXB 1VJKA 3ZJUA 4C7YA 2DAFA 2N1WA 1FD6A 3AE6B 1R4MB 1LGRA 1PUTA 3LXFA 2ZJDA 3X23A 3N3KB 1OEYA 4CYEA 4DBGA 1WJ4A 4IWOA 3PSEB
chains in the Genus database with same CATH topology
2IY0B 4KDIC 2XBBC 2C7NB 3VXWA 4KV2A 3L54A 4ANXA 2N9EB 1LXDA 3L08A 1V81A 2KWCA 2D3GA 3WAMA 3W1YA 2LASA 2DZIA 5GMVA 4BBNC 4DHZE 4ZRJA 3VH4B 4DXAB 4N9F4 1WZ0A 3UIPB 4TQ0A 4JIOU 4BBNF 1WX7A 4HWIB 2C5LC 2GMIC 5E6OA 2JT4B 4FHKA 2BYEA 2PE6B 3HK0A 3ZDTA 1WMHB 2KANA 1T0YA 4PYUA 3V6EB 1UGMA 4NAWA 1D3ZA 2LXCA 1KJTA 2KN5A 2BYFA 3NOBA 3ZTCA 3CMMB 3RCZA 2AEHA 3OJ4B 4II3B 4B95A 3NY5A 2D11A 4TQ1A 3R3MA 3WIMA 3UQAA 4FHJA 5KHQA 2LJ5A 1WFYA 3KYCD 2GBRA 2LZ6A 4HLEA 1KLVA 1NI2A 4FN2A 4EKUA 4ZYNA 1WIAA 3X0WA 3LDZE 2LUEA 1ZW7A 4NJ7A 3A1QB 3I3TB 1FXTB 2FCMA 3ML9A 3NHEB 2K39A 4FJVB 3DVNU 2R2QA 3KW5B 1IPGA 4FULA 2K25A 3QIJA 1I35A 1L2NA 3IFWB 2DZKA 4FLHA 4KZCA 1Q1OA 2KLCA 4XX5A 1IYFA 4DDGD 3H1UA 2D2QA 1GNUA 5J2RA 4WQOB 2IO2B 4RM9A 5JZEB 5DPWA 2WX1A 2V4LA 2KWUB 1ZKHA 1I42A 3D32A 2MP2A 2KQSA 4LDTD 3UGBB 3VUYA 2AYOB 4PS7A 3PZDA 3EFUA 3GOEA 2JRIB 2C9WB 2GBKA 2C7HA 5JHAA 4W9DA 2ZNVB 4LCDE 5CHFA 2GBNA 2D07B 3VUWA 2DYOA 4K7WA 3W1SC 4BKSA 2YVCA 2KD0A 3TMPB 3PGEA 4W9JA 1WMHA 2ASQA 2JXXA 2O6VB 1V5TA 1F9JA 3GZNI 2UWQA 2DHZA 1YX6B 1WM2A 2MLBA 3QCAA 1E8ZA 4IM2A 3MHSD 4MSMB 3ZKJC 4LJPB 1V5OA 3IG3A 4W9GA 1H4RA 2J0JA 3APCA 1J19A 2PJHA 2EMSA 3VFKA 3VTVA 1P0RA 3RZFA 4AOFA 1P9DU 3QWZB 1RLFA 2FIDA 2VRRB 3PHXB 3NZUA 2CS4A 1WH3A 4ANWA 4URKA 2ZEQA 2IYDB 4DHJB 2KNBA 4JQWC 1YJ1A 1E7UA 2BWES 2XK5B 4AJYB 2PPHA 4ASWC 3PVLA 3H7PB 4F1SA 3VDZA 5LLIA 3ZRCA 2KX0A 3NS8A 2MRPA 5D7GA 2N7DA 2JVCA 2ZPNA 4W9CA 4W9KA 1YQBA 3V61A 4ANUA 5AEKB 1K8RB 4MELA 1HE8A 1RFAA 2G3QB 5CHVC 4DHJD 2MX2A 1QZEA 3O65B 1TZ1A 2FNJB 2KC2A 3NZSA 3SU8X 3VVWB 1OQYA 2PE9A 2ZCCA 3DQVA 4EZJA 1V49A 4G0NB 5DPSA 3L13A 3ZTDA 5HKHA 3PRPB 1S3SG 3QAQA 4GXBA 5KHOA 2LWPA 4XC2A 2O6VD 3KUZA 3EECA 2MBOA 4CHKA 1X1MA 2G45B 2WX0A 3JYUA 2V1YA 2AWTA 3VAWA 1WE6A 2KZRA 1J8CA 2K6DB 2RR9A 3H7PA 3HM6X 1CMXB 4ICVA 4WWNA 2JRHA 2JUOA 2NPTB 1Y8RC 4GGQA 4CO7A 1EUVB 4A20A 2IBIB 2KXJA 5J18A 2G4SA 3TBLD 2HTHA 1WGYA 2FIFA 1UD7A 1YIWA 3P2BA 2MQJA 3VHTC 3AI5A 3SD5A 3K9OB 3QJZA 3WAOA 1E5WA 3JW0X 2NR2A 4LDTB 3ZDMC 3ECIA 3ZNZB 3KUDB 1C3TA 4FJYA 1WX9A 4IUMB 3KVFB 2KHWB 3DBLI 5L95C 5CHWA 2K6QA 2KTRA 2LD9A 4EZKA 2WYQA 2NBWB 5LXIB 3Q3JA 2KTRB 1Q0WB 2KFJA 2LRWA 2MBEA 3A9KA 5G2NA 2KMAA 5DPRA 2ZVNA 2IO0B 3RULA 2JWZA 2KWVB 3DBHI 2N9PC 5AZGA 2JZ3B 3V6CB 4F8CB 4IWPA 3L0WB 4YL8A 4ZRKA 1YX5B 4DDID 1IP9A 5CX3A 4GU2A 2DZMA 3C0RB 1WF9A 3HM3A 4I6PA 4XZ4A 1WJ6A 4WAAA 2N7EA 3V60A 2EKEC 3VTUA 4AP4C 2LGYA 3T8MA 4FBJB 4G11A 3DOWA 3H6NA 2A5UA 2KDBA 4MSQB 3EC8A 2WWZA 4MJSA 2HJ8A 3R7QA 4A3OA 2IO1B 1L7YA 1EO6A 1TGZB 3TCAA 2REXA 3WANA 4AWJA 2KJHB 4WJPA 3VH3B 1WGHA 5L83A 1OTRB 1WGRA 3R7RA 4MGKE 1GC7A 2MA9B 3ONSA 3KH0A 2CHZA 4I6NB 3SHQA 2CR5A 4E71A 4MJSB 4RM8A 2V3SA 1WXSA 3A9JA 4IW0A 4MH0E 3RT3B 2KKCA 2RGFA 5G55A 2UYZB 2K1FA 4EFOA 1MG8A 2N1VA 3PRZA 1M94A 3EHVA 4HCPB 3AULA 4WWPA 3ZNHB 5C1ZA 3M95A 4GDKB 5D2MB 2O2VA 1V86A 3ZO5B 1RRBA 1E8XA 2MBHA 4HDQA 1C1YB 3KYDD 5DPTA 1Z5SB 2LVQA 3A4SC 1EF1A 4MDKE 2DYMA 2EMTA 2L7RA 4TKNA 4GN1A 3A9KB 1UH6A 4K7SA 1WR6E 1WX8A 4FJZA 2KO3A 5FR6A 5C23A 4HVBA 4ICUA 2L05A 3VUXA 2R2OA 1Z2MA 1V2YA 1WZ3A 5TR5A 5E6PA 2BF8B 1EF5A 2KOXA 4E74A 3KUCB 1LM8B 1GUAB 1SGHA 4M0WB 4TV3A 4F7ZA 2W9NA 1ZGUB 3RYTA 1WRDB 1TBEA 2BWFA 3BY4B 2L76A 4HPLB 2I1KA 2AL6A 4HCNB 3A1QA 3ML8A 2CU1A 4KSKC 3SDLC 4MM3A 3L17A 1WGGA 2MBQA 2DAJA 4AUQC 1WI0A 1UBIA 1WY8A 2M8SA 4GOCA 5IA7A 3QHTA 2MCNB 3UIOB 1SE9A 4KIKB 2CHXA 2KLGA 2KMCA 2L3ZA 3ZRFA 3DDCB 1WR1A 2ZPYA 1KOTA 4X57B 1WXMA 4I6LB 1V6EA 4IC7B 2NPTA 5E6NA 4IM3A 3RUIB 1R4NI 3IHPC 3UF8A 3ZVVA 4J6IA 1WJUA 2KJ6A 2MP2B 4HDOA 3WAPA 1VCBA 2LGXA 3CSFA 2XK5A 3L10B 4KIKA 2IY1B 2HD5B 3U8ZA 4M8NA 1V9JA 2FCQA 4K7UA 1WM3A 4EOYA 4ZDVA 4NAWB 3HHMA 4NQKE 2LVOA 3ENEA 3DBSA 1UELA 3VQIA 2DZJA 3W1SA 2NBVB 1A5RA 3A33B 3RD2A 2XEWA 1R4MI 1WJNA 3AU4A 1Q5WB 4GDLA 2DX5B 3ZUNA 4NQLB 1V80A 2C60A 3DPDA 1WXVA 4GMVA 4HK2A 4BOSC 3H7SA 4A3PA 4WJQA 1E90A 1U4AA 2FCSA 2KTFA 3PLUA 4JLCA 1VD2A 5AZFA 3PV1A 2HE7A 3H9DA 3QA8A 2KJRA 3WA0A 1PQSA 2ZNVC 2NS5A 4HJKA 3ZNGC 2AL3A 2Z59B 3QX1A 2KDFB 3ZNID 3APDA 4MEMA 4MGIE 2L8JA 3DCGA 4JL9A 4WJNA 4K81A 2A4ZA 4GDKA 2KDIA 3MJWA 2LVPA 4HPMB 2I1JA 2LXAA 5D6JB 4IWQA 3Q3FA 1E7VA 2N9XA 3WALA 4II2B 1WGDA 4W9FA 3B08A 3QARA 1YD8U 3T9LA 3PTFC 4BVUC 2ZVOA 1LFDA 2MW5A 2NVUI 3A4RA 1S1QB 2G4DB 2NBUA 2M4NA 1GG3A 2ZCBA 5DCNA 2Y5BB 2J0KA 3N32A 5D94A 2K8CA 2NCNA 3U7DA 3ZLZA 4DHZB 2KC1A 4NPNA 2RD0A 3A9JB 1XQQA 3AXCA 2GBJA 3L16A 3PT2B 4MGZE 2JY6A 5IAAC 3PLVA 4E3CA 4EUTA 1UZXB 4FA6A 3TIXA 5J17A 1SIFA 3OLMD 2KFKB 4P7IA 2YLMA 4K1RB 5BO4B 1G6JA 1GJZA 3PHWB 4GIVA 2RSUA 4NNJB 2K8BA 4B6WA 4BKTA 4BOZB 4W9HA 2KK8A 4GDLB 1OEYJ 2Z0DB 3VTWA 4ZRIA 3IBEA 2MSED 4ANVA 2OOBB 2Z0EB 2M0XA 3JVZX 3PPAA 2GBMA 2OJRA 4IM0A 4BKGA 1H8CA 2IO3B 3OAWA 2PEAA 2O2VB 4KDLB 1WXAA 1ISNA 3DVGX 2KQ7A 4JGHB 4MGYE 4KSLC 5JH5C 4HXDA 5EDSA 1KM7A 1WE7A 2JF5A 3ALBA 3JSVB 3CF6E 3DVNV 3MTNB 2KX3A 4KZ0A 2M17A 2KVRA 4NY0A 5AZHA 1TTNA 4PS3A 3TJPA 1J0GA 4W9IA 4PYZA 5JHBA 1XT9B 1P3QU 3QQ8B 2JZZA 2QHOA 4TUUA 4W9EA 1NDDA 2BKRB 2CHWA 4WJOA 4EZLA 3HIZA 4GSWA 2LRUA 3UINB 2B3AA 3V62A 4BKSD 2JPHA 2J0MA 4B9KA 2L00B 1LQBA 3CSTA 2LGDA 3PREA 4GB9A 2CKHB 3M3JA 1UBQA 4IG7B 2BPSA 3QK0A 4RMAA 3TL5A 1OGWA 2ZZPB 4DK5A 2L0FA 2O6VA 1P98A 1E8YA 3DVGY 3IVFA 3B0AA 3QC8B 2KFKA 2M1MA 4OVUA 2C7MB 4G50A 3AU5A 3K9PB 1BT0A 1AARA 2DYBA 3PRMB 3R66C 2IZVB 1WYWB 4PS8A 1GC6A 2DENB 4BFRA 5LXHA 2KDEB 2BYVE 3ZW3A 2L0TA 2LI5A 2RPQA 2MWSB 5CTRC 2J7QB 3PS6A 1XD3B 3JSVA 1E8WA 4AJWA 3ZIMA 3APFA 1P1AA 4DWFA 3U30A 2K8HA 4KVGB 2FAZA 3RZWC 4LJOB 3LJ3A 3N30A 2WDTB 2D10A 3S2AA 3B1LX 1RAXA 2FUHB 3BINA 3M63B 3UQBA 1NBFC 2GOWA 2DAFA 2BGFA 4FADA 4G3XB 2N1WA 4OVVA 4EEWA 1JRUA 2FCNA 2MBBB 2ZJDA 3DBRI 4WWOA 2BKFA 1OEYA 3N3KB 3OJ3A 4M8MA 3M62B 3X23A 4W9LA 4CYEA 4DBGA 1WJ4A 2N4FA 4IWOA 3PSEB 4NJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IY0 B;  4KDI C;  2XBB C;  2C7N B;  3VXW A;  4KV2 A;  3L54 A;  4ANX A;  2N9E B;  1LXD A;  3L08 A;  1V81 A;  2KWC A;  2D3G A;  3WAM A;  3W1Y A;  2LAS A;  2DZI A;  5GMV A;  4BBN C;  4DHZ E;  4ZRJ A;  3VH4 B;  4DXA B;  4N9F 4;  1WZ0 A;  3UIP B;  4TQ0 A;  4JIO U;  4BBN F;  1WX7 A;  4HWI B;  2C5L C;  2GMI C;  5E6O A;  2JT4 B;  4FHK A;  2BYE A;  2PE6 B;  3HK0 A;  3ZDT A;  1WMH B;  2KAN A;  1T0Y A;  4PYU A;  3V6E B;  1UGM A;  4NAW A;  1D3Z A;  2LXC A;  1KJT A;  2KN5 A;  2BYF A;  3NOB A;  3ZTC A;  3CMM B;  3RCZ A;  2AEH A;  3OJ4 B;  4II3 B;  4B95 A;  3NY5 A;  2D11 A;  4TQ1 A;  3R3M A;  3WIM A;  3UQA A;  4FHJ A;  5KHQ A;  2LJ5 A;  1WFY A;  3KYC D;  2GBR A;  2LZ6 A;  4HLE A;  1KLV A;  1NI2 A;  4FN2 A;  4EKU A;  4ZYN A;  1WIA A;  3X0W A;  3LDZ E;  2LUE A;  1ZW7 A;  4NJ7 A;  3A1Q B;  3I3T B;  1FXT B;  2FCM A;  3ML9 A;  3NHE B;  2K39 A;  4FJV B;  3DVN U;  2R2Q A;  3KW5 B;  1IPG A;  4FUL A;  2K25 A;  3QIJ A;  1I35 A;  1L2N A;  3IFW B;  2DZK A;  4FLH A;  4KZC A;  1Q1O A;  2KLC A;  4XX5 A;  1IYF A;  4DDG D;  3H1U A;  2D2Q A;  1GNU A;  5J2R A;  4WQO B;  2IO2 B;  4RM9 A;  5JZE B;  5DPW A;  2WX1 A;  2V4L A;  2KWU B;  1ZKH A;  1I42 A;  3D32 A;  2MP2 A;  2KQS A;  4LDT D;  3UGB B;  3VUY A;  2AYO B;  4PS7 A;  3PZD A;  3EFU A;  3GOE A;  2JRI B;  2C9W B;  2GBK A;  2C7H A;  5JHA A;  4W9D A;  2ZNV B;  4LCD E;  5CHF A;  2GBN A;  2D07 B;  3VUW A;  2DYO A;  4K7W A;  3W1S C;  4BKS A;  2YVC A;  2KD0 A;  3TMP B;  3PGE A;  4W9J A;  1WMH A;  2ASQ A;  2JXX A;  2O6V B;  1V5T A;  1F9J A;  3GZN I;  2UWQ A;  2DHZ A;  1YX6 B;  1WM2 A;  2MLB A;  3QCA A;  1E8Z A;  4IM2 A;  3MHS D;  4MSM B;  3ZKJ C;  4LJP B;  1V5O A;  3IG3 A;  4W9G A;  1H4R A;  2J0J A;  3APC A;  1J19 A;  2PJH A;  2EMS A;  3VFK A;  3VTV A;  1P0R A;  3RZF A;  4AOF A;  1P9D U;  3QWZ B;  1RLF A;  2FID A;  2VRR B;  3PHX B;  3NZU A;  2CS4 A;  1WH3 A;  4ANW A;  4URK A;  2ZEQ A;  2IYD B;  4DHJ B;  2KNB A;  4JQW C;  1YJ1 A;  1E7U A;  2BWE S;  2XK5 B;  4AJY B;  2PPH A;  4ASW C;  3PVL A;  3H7P B;  4F1S A;  3VDZ A;  5LLI A;  3ZRC A;  2KX0 A;  3NS8 A;  2MRP A;  5D7G A;  2N7D A;  2JVC A;  2ZPN A;  4W9C A;  4W9K A;  1YQB A;  3V61 A;  4ANU A;  5AEK B;  1K8R B;  4MEL A;  1HE8 A;  1RFA A;  2G3Q B;  5CHV C;  4DHJ D;  2MX2 A;  1QZE A;  3O65 B;  1TZ1 A;  2FNJ B;  2KC2 A;  3NZS A;  3SU8 X;  3VVW B;  1OQY A;  2PE9 A;  2ZCC A;  3DQV A;  4EZJ A;  1V49 A;  4G0N B;  5DPS A;  3L13 A;  3ZTD A;  5HKH A;  3PRP B;  1S3S G;  3QAQ A;  4GXB A;  5KHO A;  2LWP A;  4XC2 A;  2O6V D;  3KUZ A;  3EEC A;  2MBO A;  4CHK A;  1X1M A;  2G45 B;  2WX0 A;  3JYU A;  2V1Y A;  2AWT A;  3VAW A;  1WE6 A;  2KZR A;  1J8C A;  2K6D B;  2RR9 A;  3H7P A;  3HM6 X;  1CMX B;  4ICV A;  4WWN A;  2JRH A;  2JUO A;  2NPT B;  1Y8R C;  4GGQ A;  4CO7 A;  1EUV B;  4A20 A;  2IBI B;  2KXJ A;  5J18 A;  2G4S A;  3TBL D;  2HTH A;  1WGY A;  2FIF A;  1UD7 A;  1YIW A;  3P2B A;  2MQJ A;  3VHT C;  3AI5 A;  3SD5 A;  3K9O B;  3QJZ A;  3WAO A;  1E5W A;  3JW0 X;  2NR2 A;  4LDT B;  3ZDM C;  3ECI A;  3ZNZ B;  3KUD B;  1C3T A;  4FJY A;  1WX9 A;  4IUM B;  3KVF B;  2KHW B;  3DBL I;  5L95 C;  5CHW A;  2K6Q A;  2KTR A;  2LD9 A;  4EZK A;  2WYQ A;  2NBW B;  5LXI B;  3Q3J A;  2KTR B;  1Q0W B;  2KFJ A;  2LRW A;  2MBE A;  3A9K A;  5G2N A;  2KMA A;  5DPR A;  2ZVN A;  2IO0 B;  3RUL A;  2JWZ A;  2KWV B;  3DBH I;  2N9P C;  5AZG A;  2JZ3 B;  3V6C B;  4F8C B;  4IWP A;  3L0W B;  4YL8 A;  4ZRK A;  1YX5 B;  4DDI D;  1IP9 A;  5CX3 A;  4GU2 A;  2DZM A;  3C0R B;  1WF9 A;  3HM3 A;  4I6P A;  4XZ4 A;  1WJ6 A;  4WAA A;  2N7E A;  3V60 A;  2EKE C;  3VTU A;  4AP4 C;  2LGY A;  3T8M A;  4FBJ B;  4G11 A;  3DOW A;  3H6N A;  2A5U A;  2KDB A;  4MSQ B;  3EC8 A;  2WWZ A;  4MJS A;  2HJ8 A;  3R7Q A;  4A3O A;  2IO1 B;  1L7Y A;  1EO6 A;  1TGZ B;  3TCA A;  2REX A;  3WAN A;  4AWJ A;  2KJH B;  4WJP A;  3VH3 B;  1WGH A;  5L83 A;  1OTR B;  1WGR A;  3R7R A;  4MGK E;  1GC7 A;  2MA9 B;  3ONS A;  3KH0 A;  2CHZ A;  4I6N B;  3SHQ A;  2CR5 A;  4E71 A;  4MJS B;  4RM8 A;  2V3S A;  1WXS A;  3A9J A;  4IW0 A;  4MH0 E;  3RT3 B;  2KKC A;  2RGF A;  5G55 A;  2UYZ B;  2K1F A;  4EFO A;  1MG8 A;  2N1V A;  3PRZ A;  1M94 A;  3EHV A;  4HCP B;  3AUL A;  4WWP A;  3ZNH B;  5C1Z A;  3M95 A;  4GDK B;  5D2M B;  2O2V A;  1V86 A;  3ZO5 B;  1RRB A;  1E8X A;  2MBH A;  4HDQ A;  1C1Y B;  3KYD D;  5DPT A;  1Z5S B;  2LVQ A;  3A4S C;  1EF1 A;  4MDK E;  2DYM A;  2EMT A;  2L7R A;  4TKN A;  4GN1 A;  3A9K B;  1UH6 A;  4K7S A;  1WR6 E;  1WX8 A;  4FJZ A;  2KO3 A;  5FR6 A;  5C23 A;  4HVB A;  4ICU A;  2L05 A;  3VUX A;  2R2O A;  1Z2M A;  1V2Y A;  1WZ3 A;  5TR5 A;  5E6P A;  2BF8 B;  1EF5 A;  2KOX A;  4E74 A;  3KUC B;  1LM8 B;  1GUA B;  1SGH A;  4M0W B;  4TV3 A;  4F7Z A;  2W9N A;  1ZGU B;  3RYT A;  1WRD B;  1TBE A;  2BWF A;  3BY4 B;  2L76 A;  4HPL B;  2I1K A;  2AL6 A;  4HCN B;  3A1Q A;  3ML8 A;  2CU1 A;  4KSK C;  3SDL C;  4MM3 A;  3L17 A;  1WGG A;  2MBQ A;  2DAJ A;  4AUQ C;  1WI0 A;  1UBI A;  1WY8 A;  2M8S A;  4GOC A;  5IA7 A;  3QHT A;  2MCN B;  3UIO B;  1SE9 A;  4KIK B;  2CHX A;  2KLG A;  2KMC A;  2L3Z A;  3ZRF A;  3DDC B;  1WR1 A;  2ZPY A;  1KOT A;  4X57 B;  1WXM A;  4I6L B;  1V6E A;  4IC7 B;  2NPT A;  5E6N A;  4IM3 A;  3RUI B;  1R4N I;  3IHP C;  3UF8 A;  3ZVV A;  4J6I A;  1WJU A;  2KJ6 A;  2MP2 B;  4HDO A;  3WAP A;  1VCB A;  2LGX A;  3CSF A;  2XK5 A;  3L10 B;  4KIK A;  2IY1 B;  2HD5 B;  3U8Z A;  4M8N A;  1V9J A;  2FCQ A;  4K7U A;  1WM3 A;  4EOY A;  4ZDV A;  4NAW B;  3HHM A;  4NQK E;  2LVO A;  3ENE A;  3DBS A;  1UEL A;  3VQI A;  2DZJ A;  3W1S A;  2NBV B;  1A5R A;  3A33 B;  3RD2 A;  2XEW A;  1R4M I;  1WJN A;  3AU4 A;  1Q5W B;  4GDL A;  2DX5 B;  3ZUN A;  4NQL B;  1V80 A;  2C60 A;  3DPD A;  1WXV A;  4GMV A;  4HK2 A;  4BOS C;  3H7S A;  4A3P A;  4WJQ A;  1E90 A;  1U4A A;  2FCS A;  2KTF A;  3PLU A;  4JLC A;  1VD2 A;  5AZF A;  3PV1 A;  2HE7 A;  3H9D A;  3QA8 A;  2KJR A;  3WA0 A;  1PQS A;  2ZNV C;  2NS5 A;  4HJK A;  3ZNG C;  2AL3 A;  2Z59 B;  3QX1 A;  2KDF B;  3ZNI D;  3APD A;  4MEM A;  4MGI E;  2L8J A;  3DCG A;  4JL9 A;  4WJN A;  4K81 A;  2A4Z A;  4GDK A;  2KDI A;  3MJW A;  2LVP A;  4HPM B;  2I1J A;  2LXA A;  5D6J B;  4IWQ A;  3Q3F A;  1E7V A;  2N9X A;  3WAL A;  4II2 B;  1WGD A;  4W9F A;  3B08 A;  3QAR A;  1YD8 U;  3T9L A;  3PTF C;  4BVU C;  2ZVO A;  1LFD A;  2MW5 A;  2NVU I;  3A4R A;  1S1Q B;  2G4D B;  2NBU A;  2M4N A;  1GG3 A;  2ZCB A;  5DCN A;  2Y5B B;  2J0K A;  3N32 A;  5D94 A;  2K8C A;  2NCN A;  3U7D A;  3ZLZ A;  4DHZ B;  2KC1 A;  4NPN A;  2RD0 A;  3A9J B;  1XQQ A;  3AXC A;  2GBJ A;  3L16 A;  3PT2 B;  4MGZ E;  2JY6 A;  5IAA C;  3PLV A;  4E3C A;  4EUT A;  1UZX B;  4FA6 A;  3TIX A;  5J17 A;  1SIF A;  3OLM D;  2KFK B;  4P7I A;  2YLM A;  4K1R B;  5BO4 B;  1G6J A;  1GJZ A;  3PHW B;  4GIV A;  2RSU A;  4NNJ B;  2K8B A;  4B6W A;  4BKT A;  4BOZ B;  4W9H A;  2KK8 A;  4GDL B;  1OEY J;  2Z0D B;  3VTW A;  4ZRI A;  3IBE A;  2MSE D;  4ANV A;  2OOB B;  2Z0E B;  2M0X A;  3JVZ X;  3PPA A;  2GBM A;  2OJR A;  4IM0 A;  4BKG A;  1H8C A;  2IO3 B;  3OAW A;  2PEA A;  2O2V B;  4KDL B;  1WXA A;  1ISN A;  3DVG X;  2KQ7 A;  4JGH B;  4MGY E;  4KSL C;  5JH5 C;  4HXD A;  5EDS A;  1KM7 A;  1WE7 A;  2JF5 A;  3ALB A;  3JSV B;  3CF6 E;  3DVN V;  3MTN B;  2KX3 A;  4KZ0 A;  2M17 A;  2KVR A;  4NY0 A;  5AZH A;  1TTN A;  4PS3 A;  3TJP A;  1J0G A;  4W9I A;  4PYZ A;  5JHB A;  1XT9 B;  1P3Q U;  3QQ8 B;  2JZZ A;  2QHO A;  4TUU A;  4W9E A;  1NDD A;  2BKR B;  2CHW A;  4WJO A;  4EZL A;  3HIZ A;  4GSW A;  2LRU A;  3UIN B;  2B3A A;  3V62 A;  4BKS D;  2JPH A;  2J0M A;  4B9K A;  2L00 B;  1LQB A;  3CST A;  2LGD A;  3PRE A;  4GB9 A;  2CKH B;  3M3J A;  1UBQ A;  4IG7 B;  2BPS A;  3QK0 A;  4RMA A;  3TL5 A;  1OGW A;  2ZZP B;  4DK5 A;  2L0F A;  2O6V A;  1P98 A;  1E8Y A;  3DVG Y;  3IVF A;  3B0A A;  3QC8 B;  2KFK A;  2M1M A;  4OVU A;  2C7M B;  4G50 A;  3AU5 A;  3K9P B;  1BT0 A;  1AAR A;  2DYB A;  3PRM B;  3R66 C;  2IZV B;  1WYW B;  4PS8 A;  1GC6 A;  2DEN B;  4BFR A;  5LXH A;  2KDE B;  2BYV E;  3ZW3 A;  2L0T A;  2LI5 A;  2RPQ A;  2MWS B;  5CTR C;  2J7Q B;  3PS6 A;  1XD3 B;  3JSV A;  1E8W A;  4AJW A;  3ZIM A;  3APF A;  1P1A A;  4DWF A;  3U30 A;  2K8H A;  4KVG B;  2FAZ A;  3RZW C;  4LJO B;  3LJ3 A;  3N30 A;  2WDT B;  2D10 A;  3S2A A;  3B1L X;  1RAX A;  2FUH B;  3BIN A;  3M63 B;  3UQB A;  1NBF C;  2GOW A;  2DAF A;  2BGF A;  4FAD A;  4G3X B;  2N1W A;  4OVV A;  4EEW A;  1JRU A;  2FCN A;  2MBB B;  2ZJD A;  3DBR I;  4WWO A;  2BKF A;  1OEY A;  3N3K B;  3OJ3 A;  4M8M A;  3M62 B;  3X23 A;  4W9L A;  4CYE A;  4DBG A;  1WJ4 A;  2N4F A;  4IWO A;  3PSE B;  4NJ6 A; 
#chains in the Genus database with same CATH topology
 1T6B X;  3VXW A;  3L54 A;  4ANX A;  4DQO C;  2KQ4 X;  1V81 A;  3WAM A;  3P4Q B;  1SEB D;  3DBL B;  4HKZ E;  2LAS A;  3HVD A;  3SEB A;  4DHZ E;  3GE8 C;  3IT4 B;  1D6E C;  2VH2 A;  2C5L C;  2GMI C;  4KGS A;  2JT4 B;  2BYE A;  3IXS A;  1C4C A;  3HK0 A;  3ZDT A;  3AEA B;  3V6E B;  1I4H A;  1ZP0 B;  4LK0 M;  3ZTC A;  3U2S C;  3OJ4 B;  2JXT A;  2VZK B;  2BB6 A;  2QSD A;  2ACZ B;  4LNI A;  3KYC D;  2PW9 A;  1NI2 A;  2E3T A;  2AQ2 B;  3LDZ E;  3EFC A;  3A1Q B;  3I3T B;  2LHD A;  2FCM A;  2WP9 B;  3ML9 A;  2K39 A;  3DVN U;  4FUL A;  3IFW B;  1ZE3 D;  4KZC A;  2KLC A;  4XX5 A;  4DDG D;  1WWT A;  1L5P A;  3O13 A;  1I42 A;  2MP2 A;  3V3X A;  4ZRQ A;  4WUR A;  2C7H A;  4W9D A;  2LFI A;  2GBN A;  3VUW A;  4K7W A;  5E6J A;  1NI3 A;  3PGE A;  3J9C A;  2O6V B;  1V5T A;  2ZW1 A;  3GZN I;  2UWQ A;  4JX1 C;  2DHZ A;  1FIQ A;  4MSM B;  4N6E B;  3Q14 C;  4AOF A;  1RLF A;  3PHX B;  2CU3 A;  3NZU A;  1WH3 A;  2KWD A;  1AW7 A;  2IYD B;  4DHJ B;  3TSS A;  2KNB A;  4LNF A;  1J7A A;  1E7U A;  2BS3 B;  2BWE S;  1K51 A;  3MC0 B;  4LLG M;  3ZRC A;  3NS8 A;  5D7G A;  2IPK D;  1HTQ A;  3V61 A;  4W9K A;  1HE8 A;  1VZ8 A;  4DHJ D;  3O65 B;  4Q2J A;  1MFW A;  2KC2 A;  3NZS A;  1KLU D;  2L83 A;  3ZJT A;  5DPS A;  4GXB A;  5KHO A;  5BMH A;  2O6V D;  3EEC A;  2MBO A;  2K3U A;  2INP E;  1XO3 A;  2AWT A;  1J8C A;  1L6U A;  1T3Q A;  3T3N A;  4ICV A;  5BYS A;  1C79 A;  1C9F A;  1B1Z A;  4TMA B;  2X8X X;  2HTH A;  3P2B A;  3PZ7 A;  2X38 A;  3SD5 A;  5HG2 A;  3QJZ A;  3JW0 X;  4LDT B;  1F2R C;  1WX9 A;  3IAS 1;  2KHW B;  4REZ A;  2KTR A;  4EZK A;  3Q3J A;  2KFJ A;  2MBE A;  4KKJ A;  5G2N A;  1UF0 A;  2ZVN A;  2IO0 B;  2BBC A;  4F8C B;  1IUE A;  4IWP A;  4ZRK A;  1YQ4 B;  5G5H A;  1IP9 A;  4F7Z A;  3HM3 A;  4I6P A;  1QIL A;  2N7E A;  4G11 A;  3H6N A;  2KDB A;  3R7Q A;  2QMT A;  3TCA A;  2PIA A;  3VH3 B;  1WGR A;  4MGK E;  1QOG A;  3KH0 A;  5BMG A;  3AEF B;  4E71 A;  4MH0 E;  3NZ3 A;  4S17 A;  2RGF A;  1TIF A;  2L52 A;  5BYQ A;  3EA6 A;  4HCP B;  3FIL A;  5D2M B;  1E8X A;  2MBH A;  3B2G A;  4NZL B;  1Z5S B;  3HRD D;  4MDK E;  1R7S A;  2DYM A;  3Q2A C;  4FJZ A;  1SSN A;  1WZ3 A;  5TR5 A;  5JXV A;  3KUC B;  1LM8 B;  4B0M A;  4TV3 A;  3RNC C;  3Q69 A;  2BWF A;  1SB3 C;  2L76 A;  4HPL B;  2MEK A;  1VZ7 A;  2WXI A;  2CU1 A;  2IGG A;  1WGG A;  2MBQ A;  3AB5 A;  1L6V A;  4AUQ C;  1WI0 A;  1L4D B;  1UBI A;  2M8S A;  2WDR B;  5IA7 A;  3UIO B;  1E6E B;  1WR1 A;  4HKQ A;  2ZPY A;  1V6E A;  5E6N A;  2WGS A;  3RUI B;  3DHH C;  2WXL A;  3ZVV A;  4C80 A;  3GZN B;  2XK5 A;  4KIK A;  1E10 A;  1HEZ E;  4C4V B;  1V9J A;  4K7U A;  4EOY A;  4ZDV A;  3BVG A;  3BK2 A;  2JX5 A;  4HPP A;  1YN5 A;  3B2F A;  2DZJ A;  3W1S A;  2WXG A;  3RD2 A;  2D3A A;  5MPO A;  2DWQ A;  3AU4 A;  3AM9 A;  1Q5W B;  3ZUN A;  1BUI C;  4JWS C;  1V80 A;  1FCL A;  3CIR B;  4MH8 A;  1VD2 A;  3GP7 A;  3PV1 A;  3W9C B;  1XXG A;  3QA8 A;  1PQS A;  2AL3 A;  1AN8 A;  1UWX A;  4YTP B;  1NVI D;  1TS5 A;  3MJW A;  1EU4 A;  2LVP A;  4N59 A;  1WGK A;  4NAM A;  2MH7 A;  3WAL A;  1YOV B;  3VRB B;  2MW5 A;  3DWM A;  1S1Q B;  1I4P A;  2NCN A;  4PK1 A;  2TSS A;  1XQQ A;  3AXC A;  2UU7 A;  1I4Q A;  2W82 A;  4E3C A;  1FXA A;  1UZX B;  3TIX A;  1SIF A;  2J42 A;  2W3S A;  2KFK B;  4RNA A;  5AUI A;  1A70 A;  2K8B A;  2KMM A;  4DHZ B;  4BOZ B;  1OEY J;  3IBE A;  2M19 A;  3AEC B;  4XWW A;  3JVZ X;  1NEN B;  1PYW D;  1ZXH A;  1DGJ A;  2V4I B;  2O2V B;  4KDL B;  2RDB C;  3DVG X;  2KAC A;  2E6X A;  5EDS A;  1KM7 A;  1TS2 A;  1WE7 A;  2JF5 A;  3ALB A;  1HXY D;  4B0E A;  2KX3 A;  4M00 A;  1TTN A;  1E9M A;  3PZ8 A;  3QQ8 B;  1XT9 B;  2D3B A;  4WJO A;  2XN9 C;  3C8Y A;  4GSW A;  1C4A A;  3OG5 A;  3V62 A;  2VH1 A;  4M01 A;  2CJO A;  3PRE A;  1V1P A;  3QK0 A;  4RMA A;  4DXG A;  5FKA C;  1E8Y A;  3DVG Y;  4OVU A;  2C7M B;  1KRH A;  3R66 C;  1N5X A;  4PS8 A;  1FMA D;  4M02 A;  1GC6 A;  1P7F A;  1VLB A;  2KDE B;  2L0T A;  4LTU A;  2LI5 A;  4WH4 A;  2J7Q B;  5G5G A;  3PS6 A;  3I57 A;  1E0Z A;  2INC C;  4AJW A;  1I4R A;  4DWF A;  3U30 A;  2FAZ A;  3RZW C;  4LJO B;  3LJ3 A;  3W5U B;  3B1L X;  3UQB A;  4D2K A;  4S0R A;  4FAD A;  4OVV A;  4RCO A;  2Y5C A;  2MBB B;  2WXN A;  1GAQ B;  1C76 A;  4F1S A;  4WWO A;  2BYT A;  4OW0 A;  1HA5 A;  4HJG E;  3L08 A;  4WIP A;  1NYQ A;  3W1Y A;  4BBN C;  3VH4 B;  4DXA B;  4N9F 4;  1WZ0 A;  3UIP B;  4BBN F;  5E6O A;  2WU5 B;  3SR6 A;  1RFK A;  1WMH B;  2KAN A;  1HZ5 A;  2MHJ A;  3IT6 B;  4H2A A;  3B9J A;  3NOB A;  3CMM B;  3RCZ A;  2AEH A;  3FAH A;  4XDC A;  4II3 B;  1VZ6 A;  2D11 A;  3R3M A;  1FNW A;  5KHQ A;  2LJ5 A;  1XEE A;  2GBR A;  1WIA A;  3AEG B;  3KWV A;  2LUE A;  1ZW7 A;  4USA A;  2WDV B;  4KGT A;  1FXT B;  3NHE B;  3KW5 B;  1I35 A;  2K25 A;  3QIJ A;  1Q10 A;  2DZK A;  4FLH A;  1PDX A;  4WQO B;  2IO2 B;  1IBX B;  5JZE B;  3MFG A;  4LDT D;  2KQS A;  1ZXI A;  3EFU A;  2AQ3 B;  1TJE A;  2C9W B;  3E9S A;  1TYG B;  5IO9 A;  3AV8 A;  2LEK A;  2ZNV B;  3U52 E;  1TS3 A;  2D07 B;  2DYO A;  3W1S C;  4BKS A;  2YVC A;  2ASQ A;  1T0Q C;  1UWM A;  3P42 A;  3MHS D;  3ZKJ C;  3DWG C;  4LJP B;  2PLP A;  2YEP F;  1BML C;  4W9G A;  3APC A;  3VTV A;  1P0R A;  2FID A;  2CS4 A;  4ANW A;  2ONQ A;  1I4G A;  5IP4 D;  3AEE B;  4ASW C;  2JYE A;  2KX0 A;  3E56 A;  2JVC A;  4MEL A;  2HDE A;  5CHV C;  2MX2 A;  1QZE A;  2K5P A;  1TZ1 A;  3SU8 X;  3VVW B;  3GB1 A;  2PE9 A;  4EZJ A;  1V49 A;  4YWG G;  1QQR A;  3L13 A;  3PRP B;  5FK9 C;  4XC2 A;  1DOX A;  1T5X D;  4CHK A;  5BMI A;  3H7P A;  2NMQ A;  4XWT A;  4GGQ A;  1FFV A;  1GB1 A;  1WGY A;  2FIF A;  2V3N A;  1UD7 A;  2MQJ A;  4HEA 1;  3K9O B;  5EE1 A;  3TUO A;  2NR2 A;  1K53 A;  1RYJ A;  2EEL A;  2J52 A;  3KUD B;  4A90 A;  4BAX A;  2K6Q A;  4ARI A;  2WYQ A;  5LXI B;  3AN1 A;  2KMA A;  5DPR A;  1TY2 A;  4ITK A;  2KWV B;  3DBH I;  2N9P C;  5AZG A;  3UI3 A;  1TS4 A;  4YL8 A;  1WYG A;  4DDI D;  4GU2 A;  3C0R B;  4WAA A;  4AP4 C;  2LGY A;  2A5U A;  3EC8 A;  2LUM A;  2WWZ A;  4O1N A;  4A3O A;  2IO1 B;  1L7Y A;  3WAN A;  2KJH B;  4WJP A;  5L83 A;  1OTR B;  5GXG B;  3SFE B;  1M4V A;  2H89 B;  3NS1 A;  1C4P A;  1UNS A;  2UYZ B;  2K1F A;  1PFD A;  4MM3 B;  4OZC A;  3AUL A;  3M95 A;  2O2V A;  1FFU A;  4HDQ A;  1C1Y B;  3KYD D;  2LVQ A;  2RPV A;  2M0A A;  2HTM E;  3AEB B;  1UH6 A;  4K7S A;  3ZJV A;  3TEZ A;  1WX8 A;  5FR6 A;  4HVB A;  4ICU A;  1Z2M A;  1V2Y A;  5E6P A;  1JQ4 A;  3BZD B;  5FR3 A;  4US9 A;  2W9N A;  2FBW B;  2I1K A;  2AL6 A;  1I7H A;  3A1Q A;  4MM3 A;  2VZK D;  3QHT A;  2WS3 B;  3R2T A;  2MCN B;  2ZW0 A;  2KLG A;  2KMC A;  3DDC B;  4AS1 A;  4X57 B;  2GRI A;  3UF8 A;  4J6I A;  2KJ6 A;  2PVG C;  4HDO A;  3CSF A;  2IY1 B;  4ZRP A;  2DNF A;  1UGJ A;  4M8N A;  1KTK A;  2LHE A;  3VQI A;  2KVZ A;  2RDG A;  3NG0 A;  3R2I A;  2DX5 B;  4OZB A;  2C60 A;  4NQL B;  4BOS C;  3H7S A;  1E90 A;  2FCS A;  2KTF A;  3PLU A;  1N60 A;  4JLC A;  2IDY A;  5C3J B;  2KJR A;  3WA0 A;  3EGR A;  2PVO D;  3ZNG C;  1FXI A;  1XCT L;  2KDF B;  3ZNI D;  1JCK B;  3APD A;  4MEM A;  4MGI E;  3DCG A;  1OQQ A;  4K81 A;  2KDI A;  3AE5 B;  4IWQ A;  3DBH B;  1FM0 D;  3Q3N C;  2BW2 A;  4R3D A;  2INN E;  1WGD A;  4II2 B;  4K3B A;  3PTF C;  2WLB A;  2G4D B;  2NBU A;  2Z8L A;  1GG3 A;  2ZCB A;  2QEJ C;  5DCN A;  2Y5B B;  2J0K A;  5D94 A;  2RD0 A;  3L16 A;  2BB5 A;  3PT2 B;  3OLM D;  2YLM A;  4TSS A;  5BO4 B;  2N0S B;  2RSU A;  4B6W A;  4BKT A;  2KK8 A;  1CK1 A;  4ZRI A;  3HVZ A;  3PPA A;  4L23 A;  1H8C A;  2IO3 B;  3OAW A;  2PEA A;  3GE3 C;  4MGY E;  4JGH B;  4ZYS A;  4WWM A;  4P6V F;  3JSV B;  4KX6 B;  3CF6 E;  4NY0 A;  3T3O A;  5AZH A;  1HTO A;  4PYZ A;  1P3Q U;  2JZZ A;  2QHO A;  4W9E A;  4TUU A;  1NDD A;  2CHW A;  3AE4 B;  3DHI C;  1FNV A;  2OHF A;  3L4P A;  3AE2 B;  2JPH A;  4B9K A;  2L00 B;  1J7C A;  3BYY B;  2LGD A;  4GB9 A;  1FRD A;  1UBQ A;  1WSP A;  3RNB C;  4RGM A;  4DK5 A;  2GI9 A;  1P98 A;  3B0A A;  2KFK A;  3Q8B A;  3K9P B;  2KYW A;  1AAR A;  2R61 A;  1T0S C;  4BFR A;  1FPY A;  5CTR C;  2WQY B;  3JSV A;  1ACC A;  3ZIM A;  1IBX A;  5HHD G;  1MHH E;  4XGA B;  3BIN A;  4OHJ A;  3M63 B;  2BT6 A;  2GOW A;  1YJI A;  2BGF A;  3FIL B;  4G3X B;  4EEW A;  2FCN A;  4L1B A;  3BII D;  3DBR I;  2BKF A;  3OJ3 A;  4M8M A;  3RUL A;  1QLB B;  1D5M C;  2XBB C;  2C7N B;  4KV2 A;  1FCC C;  2N9E B;  2KWC A;  2BS4 B;  2D3G A;  1FO4 A;  3NVY A;  4P1B C;  4TQ0 A;  4JIO U;  1WX7 A;  1N61 A;  4HWI B;  1N5W A;  3OWE B;  5EE0 A;  3MC8 A;  2KDM A;  1T0Y A;  4PYU A;  1MJD A;  1UGM A;  1D3Z A;  2L1A A;  2LXC A;  1KJT A;  2KN5 A;  2BYF A;  1AWD A;  4FHJ A;  1WFY A;  1TY0 A;  1TT5 B;  3ZYY X;  4EKU A;  4ZYN A;  5AUK A;  1GOZ A;  4ZHO A;  3U4E G;  4YTM B;  3N9Y C;  1QT9 A;  2WXJ A;  4FJV B;  1IPG A;  4WAF A;  5J2R A;  5EE3 A;  3LYY A;  4RM9 A;  2WX1 A;  2V4L A;  2WNM A;  1RM6 C;  4A55 A;  3UGB B;  4PS7 A;  1TZO A;  3IAM 1;  2GBK A;  5JHA A;  4LCD E;  5CHF A;  4RGT A;  2KD0 A;  3TMP B;  5C2T B;  4W9J A;  1WMH A;  2JXX A;  1F77 A;  1YX6 B;  1WM2 A;  2MLB A;  4IM2 A;  2W54 A;  3TEY A;  1H4R A;  1J19 A;  2EMS A;  3QWZ B;  2CJN A;  2K22 A;  1YJ1 A;  2BS2 B;  2WXQ A;  2XK5 B;  4AJY B;  2PPH A;  1MHX A;  2MRP A;  4US8 A;  2N7D A;  3ABV B;  2ZPN A;  4W9C A;  5AEK B;  1K8R B;  1RFA A;  1L0Y B;  3Q3O C;  3P1M A;  1VR9 A;  3MC9 A;  1ROE A;  1E7P B;  1V8C A;  2ZCC A;  2KT7 A;  2YEP B;  3ZTD A;  1S3S G;  3QAQ A;  3AE1 B;  1MI0 A;  4RF0 A;  2G45 B;  2WX0 A;  1JWS D;  3JYU A;  4YTN B;  3VAW A;  2KZR A;  2RR9 A;  1CMX B;  4WWN A;  2JRH A;  2NPT B;  3LB8 C;  3RNE C;  2KXJ A;  5J18 A;  2GLS A;  1JAL A;  4OZA A;  3ZGZ A;  1XCQ L;  3I5J C;  3ZDM C;  1C78 A;  1SXT A;  4M0W A;  1C3T A;  3KVF B;  5L95 C;  5CHW A;  1C77 A;  2LD9 A;  1Q0W B;  3A9K A;  4RGN A;  3Q8F A;  3RNA C;  1AYF A;  3V6C B;  3AE7 B;  5HI1 A;  1QOA A;  1ET9 A;  2BVC A;  4XZ4 A;  2DZM A;  1WF9 A;  1YJJ A;  1WJ6 A;  3VTU A;  3V60 A;  2EKE C;  1VDV A;  1TKE A;  3T8M A;  4FBJ B;  1QOF A;  4MJS A;  1EO6 A;  4A9A A;  1TKG A;  4XYC A;  3R7R A;  1GC7 A;  1BXT A;  2MA9 B;  1SE2 A;  3ONS A;  4RGO S;  4ACF A;  4I6N B;  1K50 A;  2CR5 A;  2N7J A;  4MJS B;  4RM8 A;  1F2R I;  2V3S A;  3A9J A;  2KKC A;  2BTE A;  5G55 A;  3MJ5 A;  2N1V A;  1M94 A;  4WWP A;  3ZNH B;  1JWM D;  3ZO5 B;  1EF1 A;  1STE A;  4TKN A;  2FUG 1;  4GN1 A;  5IN7 A;  1WR6 E;  2KO3 A;  5C23 A;  3Q8E A;  1J7B A;  1IGC A;  1JRP A;  1HZ6 A;  2KOX A;  1SGH A;  2W55 A;  4M0W B;  3P4R B;  2JU6 X;  1WRD B;  1TBE A;  4GLS C;  3BY4 B;  4OVZ A;  3RN9 C;  3GS2 A;  4KSK C;  3ML8 A;  3SDL C;  1WY8 A;  2NTT A;  1SE9 A;  4KIK B;  2CHX A;  3ZRF A;  1LO5 D;  1KFY B;  1WXM A;  4IC7 B;  1R4N I;  2RMM A;  1WJU A;  3WAP A;  2LGX A;  2HD5 B;  3U8Z A;  4DXF A;  4A6Q A;  3N1X C;  3Q3M C;  1N63 A;  4RF1 A;  3R8B A;  3RI7 C;  3ENE A;  3VR8 B;  2QCZ A;  4IOI E;  1A5R A;  4QAY A;  2XEW A;  1OQR A;  1WJN A;  4GDL A;  2FE8 A;  3ZXV A;  2WXM A;  4HK2 A;  3DPD A;  1WXV A;  2SAK A;  4A3P A;  4WJQ A;  1U4A A;  2QC8 A;  2AX5 A;  5AZF A;  3H9D A;  1XF5 L;  2ZNV C;  3QX1 A;  4WJN A;  3BK1 A;  4RFB A;  1D4B A;  2LGS A;  2I1J A;  2D5G A;  1E7V A;  2N9X A;  1NEK B;  2ICI A;  4IDI A;  1YD8 U;  2ZVO A;  1LFD A;  3A4R A;  3BVM A;  2M4N A;  4C00 A;  2K8C A;  3U7D A;  1WXQ A;  4NPN A;  2N9K A;  4MGZ E;  4EUT A;  5IAA C;  5J17 A;  4XDD A;  4P7I A;  3MP9 A;  1GJZ A;  4GIV A;  1CJE A;  4J3O D;  4ANV A;  3VTW A;  2Y3A A;  2OOB B;  2Z0E B;  1PGX A;  1F0Z A;  3EUB 2;  5D3I B;  1QF6 A;  2AQ1 B;  4IM0 A;  3KLS X;  1WXA A;  2JYT A;  1FEH A;  4KSL C;  5HFY A;  5JH5 C;  4HXD A;  3NVW A;  2I2Y A;  5TSS A;  1ZDV A;  4KZ0 A;  2M17 A;  4KGR A;  1VRA B;  1UUP A;  3TJP A;  4W9I A;  1N62 A;  2DBY A;  2WXF A;  3SFD B;  1PGA A;  5LNK 1;  2HJ1 A;  2K9X A;  3AE8 B;  3UIN B;  2B3A A;  4YXD B;  3CST A;  4EE2 A;  1JWU D;  3N1Z C;  4IG7 B;  1ENF A;  1OGW A;  2O6V A;  1YN3 A;  3IVF A;  2M1M A;  4G50 A;  1BT0 A;  4LNK A;  1K52 A;  2K0P A;  1R4N B;  1SE3 A;  2DEN B;  3I63 C;  5LXH A;  3RMK C;  3FKY A;  1V1O A;  3V05 A;  2IJ0 A;  2MWS B;  4LNO A;  1E8W A;  4L2Y A;  4HRS A;  1CZP A;  3APF A;  2K8H A;  4KVG B;  5D3D A;  2D10 A;  3S2A A;  3I9V 1;  1KH0 A;  3KWL A;  1JRU A;  3CWI A;  5BYR A;  3FC4 A;  1DOI A;  3M62 B;  4W9L A;  2N4F A;  4NJ6 A;  2IY0 B;  4KDI C;  4JWU C;  1D5Z C;  1JWB D;  1YQ3 B;  1LXD A;  1MPE A;  3NUH B;  5GMV A;  2DZI A;  2LJI A;  4ZRJ A;  2NTS A;  2J4X A;  5EE9 A;  1XLQ A;  3DBR B;  5H8Y E;  2QJL A;  4FHK A;  2PE6 B;  1JW9 D;  4ARC A;  4NAW A;  2XNA C;  2LMC A;  2DLB A;  4B95 A;  3NY5 A;  4TQ1 A;  3WIM A;  1FNU A;  3UQA A;  4AQ7 A;  4HLE A;  2LZ6 A;  3AH7 A;  3URY A;  1KLV A;  4FN2 A;  4MT5 A;  2QDF A;  3X0W A;  4MAC A;  4RH6 A;  3AE3 B;  1WRI A;  4NJ7 A;  2Y5P A;  4LNN A;  1F52 A;  2R2Q A;  4C56 C;  1L2N A;  1Q1O A;  3TEX A;  1IYF A;  3H1U A;  2D2Q A;  1GNU A;  4JE3 B;  5DPW A;  2KWU B;  1ZKH A;  3D32 A;  3VUY A;  2AYO B;  3PZD A;  3GOE A;  2JRI B;  1MG4 A;  1YMH E;  1YNT E;  1ZPS A;  2JZP A;  1F9J A;  4YSZ B;  4KKI A;  3QCA A;  1E8Z A;  1EWY C;  2PMV A;  1IGD A;  1V5O A;  3IG3 A;  1QOB A;  2J0J A;  1EWC A;  2PJH A;  3VFK A;  2J53 A;  3RZF A;  1P9D U;  2ON8 A;  2VRR B;  4URK A;  1JRO A;  1ZOY B;  1JWA D;  2ZEQ A;  4JQW C;  3ETR A;  1B9R A;  3PVL A;  3H7P B;  1ET6 A;  2WDQ B;  3MHZ A;  5LLI A;  3VDZ A;  1XLN A;  1D5X C;  4ANU A;  2H88 B;  1YQB A;  4HRO A;  2G3Q B;  2FNJ B;  3RNG C;  2OJW A;  1OQY A;  3DQV A;  3PO0 A;  1V1P B;  4G0N B;  3W2D A;  5HKH A;  3KQ4 A;  1T0R C;  2LWP A;  3KUZ A;  1X1M A;  2V1Y A;  1WE6 A;  2QIE B;  3ZXR A;  2K6D B;  3HM6 X;  3DHG C;  2JUO A;  4CO7 A;  1Y8R C;  1EUV B;  2BQQ A;  1ZDX A;  4A20 A;  2IBI B;  3Q8A A;  3P4S B;  1SE4 A;  2G4S A;  3TBL D;  1YIW A;  3VHT C;  3AI5 A;  1JML A;  2EKI A;  3WAO A;  1E5W A;  3ECI A;  3AED B;  3ZNZ B;  3Q8C A;  1XLO A;  4FJY A;  4IUM B;  3DBL I;  4K3C A;  1KLG D;  5T8I A;  3P4P B;  1GB4 A;  5IOI A;  1Y56 A;  2NBW B;  2KTR B;  1L4Z B;  2LRW A;  4NJC A;  5H92 C;  2MJE A;  3Q6B A;  2V0G A;  2GB1 A;  2JWZ A;  4CQN A;  2JZ3 B;  3L0W B;  3N20 C;  1SIJ A;  1YX5 B;  1SJH D;  5CX3 A;  2IND C;  2KAJ A;  3DOW A;  4YT0 B;  4MSQ B;  2HJ8 A;  2WU2 B;  4C7Z A;  1TGZ B;  4PT5 A;  1ZUD 2;  2REX A;  4AWJ A;  1I4X A;  1WGH A;  2LGI A;  3TEW A;  3RFZ B;  2CHZ A;  3SHQ A;  1WXS A;  4IW0 A;  3RT3 B;  3NVZ A;  4EFO A;  1MG8 A;  3PRZ A;  3EHV A;  5C1Z A;  4GDK B;  5I4D A;  1V86 A;  2W3R A;  3RNF C;  1RRB A;  5DPT A;  2V3P A;  3A4S C;  2L7R A;  2EMT A;  3A9K B;  3WCQ A;  2OED A;  3AMZ A;  2L05 A;  3VUX A;  3P63 A;  2R2O A;  2MJ3 A;  3C19 A;  3VRA B;  2BF8 B;  1EF5 A;  3RPF C;  4E74 A;  1GUA B;  2JQR B;  3W5V B;  3VR9 B;  3RYT A;  1ZGU B;  3BYT B;  4HCN B;  2Q5W D;  3L17 A;  4P1C C;  2DAJ A;  1GPX A;  1V97 A;  4GOC A;  3AE9 B;  3N1Y C;  3HUI A;  2IGD A;  1CQV A;  2JWU A;  2L3Z A;  2G1E A;  1KOT A;  3NJT A;  4I6L B;  2NPT A;  4IM3 A;  2PTL A;  3IHP C;  1FRR A;  2MP2 B;  1DOY A;  1RWS A;  1VCB A;  3L10 B;  4IKG A;  1SF0 A;  2FCQ A;  1WM3 A;  3ZQ4 A;  4NAW B;  2WXO A;  3HHM A;  1QKZ A;  4NQK E;  2LVO A;  4UDU C;  3DBS A;  1UEL A;  1OFF A;  2V9H A;  2NBV B;  3A33 B;  1R4M I;  2WXK A;  4XE0 A;  4YSY B;  2WXH A;  4GMV A;  2B76 B;  2HE7 A;  2L32 A;  2WXR A;  2NS5 A;  4HJK A;  1EU3 A;  3U7Z A;  2Z59 B;  3H8H A;  4JL9 A;  2L8J A;  2A4Z A;  4GDK A;  3BWU D;  4HPM B;  2LXA A;  5D6J B;  4WQM A;  3Q3F A;  4FXC A;  2I38 A;  2MJD A;  2N9L A;  4W9F A;  3B08 A;  3QAR A;  3T9L A;  4BVU C;  1YN4 A;  1KF6 B;  2NVU I;  2M56 B;  4C4V A;  3N32 A;  3ZLZ A;  2KC1 A;  4N58 A;  3A9J B;  2GBJ A;  2JY6 A;  3PLV A;  4FA6 A;  4K1R B;  2RDH A;  4ZOH C;  1G6J A;  3PHW B;  4NNJ B;  4W9H A;  4GDL B;  2Z0D B;  2MSE D;  1PGB A;  2M0X A;  2GBM A;  2OJR A;  4BKG A;  1ISN A;  2KQ7 A;  1L0X B;  2JSV X;  1SBB B;  3NRZ A;  2SEB D;  3DVN V;  3MTN B;  2KVR A;  1L0V B;  3NVV A;  4PS3 A;  4A8X C;  1J0G A;  5JHB A;  2KN4 A;  2G9H D;  1XLP A;  2QIL A;  2BKR B;  1EM7 A;  4EZL A;  3HIZ A;  2LRU A;  4BKS D;  2D3C A;  2J0M A;  1DYQ A;  1LQB A;  1HQR D;  4ZHP A;  1TKY A;  5IKC M;  2CKH B;  3M3J A;  3BVZ A;  4JPS A;  2WHI A;  2BPS A;  3TL5 A;  1MVK A;  2ZZP B;  2L0F A;  3QC8 B;  1F1H A;  3AU5 A;  2DYB A;  3PRM B;  2IGH A;  2IZV B;  1WYW B;  1NYR A;  2BYV E;  1P7E A;  3ZW3 A;  1SJE D;  2RPQ A;  2WXP A;  1XD3 B;  1ESF A;  1P1A A;  4BZA A;  3N30 A;  2WDT B;  1N6Z A;  4P16 A;  1RAX A;  2FUH B;  2PKO A;  1NBF C;  4YSX B;  1VJK A;  3ZJU A;  4C7Y A;  2DAF A;  2N1W A;  1FD6 A;  3AE6 B;  1R4M B;  1LGR A;  1PUT A;  3LXF A;  2ZJD A;  3X23 A;  3N3K B;  1OEY A;  4CYE A;  4DBG A;  1WJ4 A;  4IWO A;  3PSE B; 
#chains in the Genus database with same CATH homology
 2IY0 B;  4KDI C;  2XBB C;  2C7N B;  3VXW A;  4KV2 A;  3L54 A;  4ANX A;  2N9E B;  1LXD A;  3L08 A;  1V81 A;  2KWC A;  2D3G A;  3WAM A;  3W1Y A;  2LAS A;  2DZI A;  5GMV A;  4BBN C;  4DHZ E;  4ZRJ A;  3VH4 B;  4DXA B;  4N9F 4;  1WZ0 A;  3UIP B;  4TQ0 A;  4JIO U;  4BBN F;  1WX7 A;  4HWI B;  2C5L C;  2GMI C;  5E6O A;  2JT4 B;  4FHK A;  2BYE A;  2PE6 B;  3HK0 A;  3ZDT A;  1WMH B;  2KAN A;  1T0Y A;  4PYU A;  3V6E B;  1UGM A;  4NAW A;  1D3Z A;  2LXC A;  1KJT A;  2KN5 A;  2BYF A;  3NOB A;  3ZTC A;  3CMM B;  3RCZ A;  2AEH A;  3OJ4 B;  4II3 B;  4B95 A;  3NY5 A;  2D11 A;  4TQ1 A;  3R3M A;  3WIM A;  3UQA A;  4FHJ A;  5KHQ A;  2LJ5 A;  1WFY A;  3KYC D;  2GBR A;  2LZ6 A;  4HLE A;  1KLV A;  1NI2 A;  4FN2 A;  4EKU A;  4ZYN A;  1WIA A;  3X0W A;  3LDZ E;  2LUE A;  1ZW7 A;  4NJ7 A;  3A1Q B;  3I3T B;  1FXT B;  2FCM A;  3ML9 A;  3NHE B;  2K39 A;  4FJV B;  3DVN U;  2R2Q A;  3KW5 B;  1IPG A;  4FUL A;  2K25 A;  3QIJ A;  1I35 A;  1L2N A;  3IFW B;  2DZK A;  4FLH A;  4KZC A;  1Q1O A;  2KLC A;  4XX5 A;  1IYF A;  4DDG D;  3H1U A;  2D2Q A;  1GNU A;  5J2R A;  4WQO B;  2IO2 B;  4RM9 A;  5JZE B;  5DPW A;  2WX1 A;  2V4L A;  2KWU B;  1ZKH A;  1I42 A;  3D32 A;  2MP2 A;  2KQS A;  4LDT D;  3UGB B;  3VUY A;  2AYO B;  4PS7 A;  3PZD A;  3EFU A;  3GOE A;  2JRI B;  2C9W B;  2GBK A;  2C7H A;  5JHA A;  4W9D A;  2ZNV B;  4LCD E;  5CHF A;  2GBN A;  2D07 B;  3VUW A;  2DYO A;  4K7W A;  3W1S C;  4BKS A;  2YVC A;  2KD0 A;  3TMP B;  3PGE A;  4W9J A;  1WMH A;  2ASQ A;  2JXX A;  2O6V B;  1V5T A;  1F9J A;  3GZN I;  2UWQ A;  2DHZ A;  1YX6 B;  1WM2 A;  2MLB A;  3QCA A;  1E8Z A;  4IM2 A;  3MHS D;  4MSM B;  3ZKJ C;  4LJP B;  1V5O A;  3IG3 A;  4W9G A;  1H4R A;  2J0J A;  3APC A;  1J19 A;  2PJH A;  2EMS A;  3VFK A;  3VTV A;  1P0R A;  3RZF A;  4AOF A;  1P9D U;  3QWZ B;  1RLF A;  2FID A;  2VRR B;  3PHX B;  3NZU A;  2CS4 A;  1WH3 A;  4ANW A;  4URK A;  2ZEQ A;  2IYD B;  4DHJ B;  2KNB A;  4JQW C;  1YJ1 A;  1E7U A;  2BWE S;  2XK5 B;  4AJY B;  2PPH A;  4ASW C;  3PVL A;  3H7P B;  4F1S A;  3VDZ A;  5LLI A;  3ZRC A;  2KX0 A;  3NS8 A;  2MRP A;  5D7G A;  2N7D A;  2JVC A;  2ZPN A;  4W9C A;  4W9K A;  1YQB A;  3V61 A;  4ANU A;  5AEK B;  1K8R B;  4MEL A;  1HE8 A;  1RFA A;  2G3Q B;  5CHV C;  4DHJ D;  2MX2 A;  1QZE A;  3O65 B;  1TZ1 A;  2FNJ B;  2KC2 A;  3NZS A;  3SU8 X;  3VVW B;  1OQY A;  2PE9 A;  2ZCC A;  3DQV A;  4EZJ A;  1V49 A;  4G0N B;  5DPS A;  3L13 A;  3ZTD A;  5HKH A;  3PRP B;  1S3S G;  3QAQ A;  4GXB A;  5KHO A;  2LWP A;  4XC2 A;  2O6V D;  3KUZ A;  3EEC A;  2MBO A;  4CHK A;  1X1M A;  2G45 B;  2WX0 A;  3JYU A;  2V1Y A;  2AWT A;  3VAW A;  1WE6 A;  2KZR A;  1J8C A;  2K6D B;  2RR9 A;  3H7P A;  3HM6 X;  1CMX B;  4ICV A;  4WWN A;  2JRH A;  2JUO A;  2NPT B;  1Y8R C;  4GGQ A;  4CO7 A;  1EUV B;  4A20 A;  2IBI B;  2KXJ A;  5J18 A;  2G4S A;  3TBL D;  2HTH A;  1WGY A;  2FIF A;  1UD7 A;  1YIW A;  3P2B A;  2MQJ A;  3VHT C;  3AI5 A;  3SD5 A;  3K9O B;  3QJZ A;  3WAO A;  1E5W A;  3JW0 X;  2NR2 A;  4LDT B;  3ZDM C;  3ECI A;  3ZNZ B;  3KUD B;  1C3T A;  4FJY A;  1WX9 A;  4IUM B;  3KVF B;  2KHW B;  3DBL I;  5L95 C;  5CHW A;  2K6Q A;  2KTR A;  2LD9 A;  4EZK A;  2WYQ A;  2NBW B;  5LXI B;  3Q3J A;  2KTR B;  1Q0W B;  2KFJ A;  2LRW A;  2MBE A;  3A9K A;  5G2N A;  2KMA A;  5DPR A;  2ZVN A;  2IO0 B;  3RUL A;  2JWZ A;  2KWV B;  3DBH I;  2N9P C;  5AZG A;  2JZ3 B;  3V6C B;  4F8C B;  4IWP A;  3L0W B;  4YL8 A;  4ZRK A;  1YX5 B;  4DDI D;  1IP9 A;  5CX3 A;  4GU2 A;  2DZM A;  3C0R B;  1WF9 A;  3HM3 A;  4I6P A;  4XZ4 A;  1WJ6 A;  4WAA A;  2N7E A;  3V60 A;  2EKE C;  3VTU A;  4AP4 C;  2LGY A;  3T8M A;  4FBJ B;  4G11 A;  3DOW A;  3H6N A;  2A5U A;  2KDB A;  4MSQ B;  3EC8 A;  2WWZ A;  4MJS A;  2HJ8 A;  3R7Q A;  4A3O A;  2IO1 B;  1L7Y A;  1EO6 A;  1TGZ B;  3TCA A;  2REX A;  3WAN A;  4AWJ A;  2KJH B;  4WJP A;  3VH3 B;  1WGH A;  5L83 A;  1OTR B;  1WGR A;  3R7R A;  4MGK E;  1GC7 A;  2MA9 B;  3ONS A;  3KH0 A;  2CHZ A;  4I6N B;  3SHQ A;  2CR5 A;  4E71 A;  4MJS B;  4RM8 A;  2V3S A;  1WXS A;  3A9J A;  4IW0 A;  4MH0 E;  3RT3 B;  2KKC A;  2RGF A;  5G55 A;  2UYZ B;  2K1F A;  4EFO A;  1MG8 A;  2N1V A;  3PRZ A;  1M94 A;  3EHV A;  4HCP B;  3AUL A;  4WWP A;  3ZNH B;  5C1Z A;  3M95 A;  4GDK B;  5D2M B;  2O2V A;  1V86 A;  3ZO5 B;  1RRB A;  1E8X A;  2MBH A;  4HDQ A;  1C1Y B;  3KYD D;  5DPT A;  1Z5S B;  2LVQ A;  3A4S C;  1EF1 A;  4MDK E;  2DYM A;  2EMT A;  2L7R A;  4TKN A;  4GN1 A;  3A9K B;  1UH6 A;  4K7S A;  1WR6 E;  1WX8 A;  4FJZ A;  2KO3 A;  5FR6 A;  5C23 A;  4HVB A;  4ICU A;  2L05 A;  3VUX A;  2R2O A;  1Z2M A;  1V2Y A;  1WZ3 A;  5TR5 A;  5E6P A;  2BF8 B;  1EF5 A;  2KOX A;  4E74 A;  3KUC B;  1LM8 B;  1GUA B;  1SGH A;  4M0W B;  4TV3 A;  4F7Z A;  2W9N A;  1ZGU B;  3RYT A;  1WRD B;  1TBE A;  2BWF A;  3BY4 B;  2L76 A;  4HPL B;  2I1K A;  2AL6 A;  4HCN B;  3A1Q A;  3ML8 A;  2CU1 A;  4KSK C;  3SDL C;  4MM3 A;  3L17 A;  1WGG A;  2MBQ A;  2DAJ A;  4AUQ C;  1WI0 A;  1UBI A;  1WY8 A;  2M8S A;  4GOC A;  5IA7 A;  3QHT A;  2MCN B;  3UIO B;  1SE9 A;  4KIK B;  2CHX A;  2KLG A;  2KMC A;  2L3Z A;  3ZRF A;  3DDC B;  1WR1 A;  2ZPY A;  1KOT A;  4X57 B;  1WXM A;  4I6L B;  1V6E A;  4IC7 B;  2NPT A;  5E6N A;  4IM3 A;  3RUI B;  1R4N I;  3IHP C;  3UF8 A;  3ZVV A;  4J6I A;  1WJU A;  2KJ6 A;  2MP2 B;  4HDO A;  3WAP A;  1VCB A;  2LGX A;  3CSF A;  2XK5 A;  3L10 B;  4KIK A;  2IY1 B;  2HD5 B;  3U8Z A;  4M8N A;  1V9J A;  2FCQ A;  4K7U A;  1WM3 A;  4EOY A;  4ZDV A;  4NAW B;  3HHM A;  4NQK E;  2LVO A;  3ENE A;  3DBS A;  1UEL A;  3VQI A;  2DZJ A;  3W1S A;  2NBV B;  1A5R A;  3A33 B;  3RD2 A;  2XEW A;  1R4M I;  1WJN A;  3AU4 A;  1Q5W B;  4GDL A;  2DX5 B;  3ZUN A;  4NQL B;  1V80 A;  2C60 A;  3DPD A;  1WXV A;  4GMV A;  4HK2 A;  4BOS C;  3H7S A;  4A3P A;  4WJQ A;  1E90 A;  1U4A A;  2FCS A;  2KTF A;  3PLU A;  4JLC A;  1VD2 A;  5AZF A;  3PV1 A;  2HE7 A;  3H9D A;  3QA8 A;  2KJR A;  3WA0 A;  1PQS A;  2ZNV C;  2NS5 A;  4HJK A;  3ZNG C;  2AL3 A;  2Z59 B;  3QX1 A;  2KDF B;  3ZNI D;  3APD A;  4MEM A;  4MGI E;  2L8J A;  3DCG A;  4JL9 A;  4WJN A;  4K81 A;  2A4Z A;  4GDK A;  2KDI A;  3MJW A;  2LVP A;  4HPM B;  2I1J A;  2LXA A;  5D6J B;  4IWQ A;  3Q3F A;  1E7V A;  2N9X A;  3WAL A;  4II2 B;  1WGD A;  4W9F A;  3B08 A;  3QAR A;  1YD8 U;  3T9L A;  3PTF C;  4BVU C;  2ZVO A;  1LFD A;  2MW5 A;  2NVU I;  3A4R A;  1S1Q B;  2G4D B;  2NBU A;  2M4N A;  1GG3 A;  2ZCB A;  5DCN A;  2Y5B B;  2J0K A;  3N32 A;  5D94 A;  2K8C A;  2NCN A;  3U7D A;  3ZLZ A;  4DHZ B;  2KC1 A;  4NPN A;  2RD0 A;  3A9J B;  1XQQ A;  3AXC A;  2GBJ A;  3L16 A;  3PT2 B;  4MGZ E;  2JY6 A;  5IAA C;  3PLV A;  4E3C A;  4EUT A;  1UZX B;  4FA6 A;  3TIX A;  5J17 A;  1SIF A;  3OLM D;  2KFK B;  4P7I A;  2YLM A;  4K1R B;  5BO4 B;  1G6J A;  1GJZ A;  3PHW B;  4GIV A;  2RSU A;  4NNJ B;  2K8B A;  4B6W A;  4BKT A;  4BOZ B;  4W9H A;  2KK8 A;  4GDL B;  1OEY J;  2Z0D B;  3VTW A;  4ZRI A;  3IBE A;  2MSE D;  4ANV A;  2OOB B;  2Z0E B;  2M0X A;  3JVZ X;  3PPA A;  2GBM A;  2OJR A;  4IM0 A;  4BKG A;  1H8C A;  2IO3 B;  3OAW A;  2PEA A;  2O2V B;  4KDL B;  1WXA A;  1ISN A;  3DVG X;  2KQ7 A;  4JGH B;  4MGY E;  4KSL C;  5JH5 C;  4HXD A;  5EDS A;  1KM7 A;  1WE7 A;  2JF5 A;  3ALB A;  3JSV B;  3CF6 E;  3DVN V;  3MTN B;  2KX3 A;  4KZ0 A;  2M17 A;  2KVR A;  4NY0 A;  5AZH A;  1TTN A;  4PS3 A;  3TJP A;  1J0G A;  4W9I A;  4PYZ A;  5JHB A;  1XT9 B;  1P3Q U;  3QQ8 B;  2JZZ A;  2QHO A;  4TUU A;  4W9E A;  1NDD A;  2BKR B;  2CHW A;  4WJO A;  4EZL A;  3HIZ A;  4GSW A;  2LRU A;  3UIN B;  2B3A A;  3V62 A;  4BKS D;  2JPH A;  2J0M A;  4B9K A;  2L00 B;  1LQB A;  3CST A;  2LGD A;  3PRE A;  4GB9 A;  2CKH B;  3M3J A;  1UBQ A;  4IG7 B;  2BPS A;  3QK0 A;  4RMA A;  3TL5 A;  1OGW A;  2ZZP B;  4DK5 A;  2L0F A;  2O6V A;  1P98 A;  1E8Y A;  3DVG Y;  3IVF A;  3B0A A;  3QC8 B;  2KFK A;  2M1M A;  4OVU A;  2C7M B;  4G50 A;  3AU5 A;  3K9P B;  1BT0 A;  1AAR A;  2DYB A;  3PRM B;  3R66 C;  2IZV B;  1WYW B;  4PS8 A;  1GC6 A;  2DEN B;  4BFR A;  5LXH A;  2KDE B;  2BYV E;  3ZW3 A;  2L0T A;  2LI5 A;  2RPQ A;  2MWS B;  5CTR C;  2J7Q B;  3PS6 A;  1XD3 B;  3JSV A;  1E8W A;  4AJW A;  3ZIM A;  3APF A;  1P1A A;  4DWF A;  3U30 A;  2K8H A;  4KVG B;  2FAZ A;  3RZW C;  4LJO B;  3LJ3 A;  3N30 A;  2WDT B;  2D10 A;  3S2A A;  3B1L X;  1RAX A;  2FUH B;  3BIN A;  3M63 B;  3UQB A;  1NBF C;  2GOW A;  2DAF A;  2BGF A;  4FAD A;  4G3X B;  2N1W A;  4OVV A;  4EEW A;  1JRU A;  2FCN A;  2MBB B;  2ZJD A;  3DBR I;  4WWO A;  2BKF A;  1OEY A;  3N3K B;  3OJ3 A;  4M8M A;  3M62 B;  3X23 A;  4W9L A;  4CYE A;  4DBG A;  1WJ4 A;  2N4F A;  4IWO A;  3PSE B;  4NJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...