1P98A

High-resolution nmr structure of the ubl-domain of hhr23a
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
78
structure length
78
Chain Sequence
MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UV excision repair protein RAD23 homolog A
publication title Structural determinants for the binding of ubiquitin-like domains to the proteasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 11
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2003-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1p98A00
1V49A 4MDKE 5E6PA 1CMXB 1WMHA 2MBQA 1UELA 2R2OA 3C0RB 2REXA 4TQ0A 4FULA 3VUXA 2YLMA 2FNJB 2FCQA 4FA6A 2K1FA 2N7EA 3VTWA 1C1YB 1WX7A 2KN5A 2V4LA 4MGIE 2IO3B 3SHQA 4GU2A 2V1YA 3B0AA 2M0XA 3MTNB 5KHOA 3VQIA 4PS7A 2MX2A 4M8NA 1EF1A 2PJHA 1F9JA 2K8HA 2JT4B 2KNBA 3APDA 3QAQA 3V61A 4ZRKA 2JZZA 1V5TA 3DBRI 1G6JA 1RFAA 2KFKB 2CHXA 2RD0A 3PLUA 4MELA 2ASQA 3ZDTA 4LCDE 4ASWC 1TGZB 1R4NI 2MBOA 3CF6E 3VAWA 4HJKA 4A3OA 2LGYA 2DZJA 2WYQA 3DVNU 4ICUA 1WH3A 2BWFA 5AEKB 5LXHA 4WAAA 2O6VD 2FCSA 3T9LA 4KSKC 3VDZA 2AL3A 2IO1B 1Q5WB 1V9JA 1XT9B 4GB9A 2CKHB 1RAXA 4BBNF 2KMAA 4ANWA 4FJYA 4M0WB 1E8WA 3APFA 1LM8B 3NOBA 4M8MA 2XBBC 1X1MA 3TIXA 1H8CA 1UGMA 3VH4B 4GDLB 3ZKJC 2DX5B 3R66C 1RLFA 1WXVA 1LQBA 5BO4B 1R4MI 1L7YA 3CSTA 2KHWB 2L8JA 1ZGUB 2IZVB 2L7RA 1WZ3A 3JSVA 3ALBA 5J2RA 1WY8A 2DYMA 3M95A 2MA9B 3QA8A 3CSFA 4W9JA 2MP2A 2I1KA 4GMVA 3AI5A 4W9IA 3IFWB 5G55A 4GGQA 4X57B 2KJ6A 1ISNA 4NNJB 3L10B 2KJRA 4GOCA 3ZNHB 4G0NB 5LLIA 3U8ZA 2NCNA 1YX6B 3PLVA 3ZDMC 4TKNA 2LGDA 3ONSA 4AP4C 4AUQC 3S2AA 3RYTA 3VFKA 3UINB 3QWZB 3O65B 1WJ6A 4A20A 4E74A 2IYDB 2HE7A 1WF9A 3TBLD 3QCAA 4EKUA 4KVGB 2LRWA 2ZCCA 3AU4A 4E3CA 2D10A 1Q0WB 3EC8A 3DBLI 2FCNA 3IG3A 4ZDVA 2MLBA 2K6DB 2MSED 5KHQA 2D11A 2MWSB 4RM9A 5D6JB 1LXDA 5CTRC 3Q3FA 3OAWA 3QC8B 4MM3A 2N1WA 4W9GA 3JSVB 5J17A 1XD3B 3NZSA 4GSWA 4KZ0A 2RSUA 4HDOA 1GC6A 1V80A 4JIOU 3L0WB 2JWZA 2MP2B 2N1VA 2BF8B 2MBHA 2WDTB 4K7WA 3H7PB 4FJZA 1OGWA 2KANA 2GMIC 4BKGA 3KH0A 3WANA 4W9CA 5D7GA 3U30A 2M8SA 2YVCA 1E7VA 2I1JA 5D94A 4BKSD 2KWUB 4WWOA 2JPHA 2UYZB 3KUCB 2K8CA 1WE6A 2KJHB 4DBGA 1A5RA 2Y5BB 3PTFC 3ZO5B 2WWZA 3HM6X 2KVRA 4ANVA 3LDZE 4MSQB 4HXDA 4KZCA 3I3TB 3WAOA 1YJ1A 4GXBA 4A3PA 3PHWB 1IYFA 2KC1A 2KC2A 4NQLB 2NBUA 3BY4B 4LJPB 4ZRIA 4BOSC 2NPTB 3A1QA 3ZRCA 2KWVB 3B1LX 4BFRA 2PE6B 3KYCD 5JHAA 3L54A 4WWPA 3V60A 1IPGA 2MW5A 3W1SA 1WRDB 4BVUC 2MBEA 3H7SA 5D2MB 3APCA 3TMPB 1J8CA 4I6NB 4EZLA 3KYDD 1WJ4A 4PS3A 3H1UA 4OVUA 4XZ4A 3H9DA 4HCPB 3ZTDA 3A9JB 4LDTD 1UBIA 4TUUA 3ML8A 3ZNGC 2Z0EB 3HIZA 4W9LA 2GBKA 4FN2A 2KMCA 1UH6A 2LVPA 3UQBA 1WR6E 3DVGX 5DPTA 2LXAA 4CHKA 4EFOA 2KLGA 3JW0X 5EDSA 4MGZE 2LJ5A 1IP9A 2KX0A 3A1QB 5DCNA 3V62A 4EOYA 2LVQA 2JUOA 2HJ8A 5AZFA 1I35A 3TJPA 3AULA 3QQ8B 3HM3A 1TBEA 1WJUA 1RRBA 1E8ZA 1WMHB 2LZ6A 2CS4A 2MRPA 5E6OA 3RT3B 3DVNV 2JRIB 2LXCA 3GOEA 5CHFA 2B3AA 1T0YA 2DYOA 3VUWA 2MBBB 3L08A 1WXMA 2DAFA 3OJ3A 2JVCA 3AU5A 3ECIA 3T8MA 1WGYA 1M94A 2GBJA 3IBEA 1OEYA 3NHEB 2L05A 4JL9A 4F8CB 1WFYA 5JH5C 2N4FA 2LASA 2C5LC 2N7DA 2Z0DB 4TQ1A 2KK8A 3V6CB 2XK5A 5AZHA 2K25A 2QHOA 5FR6A 1WGGA 2J0MA 2ZVOA 4HPLB 4IWQA 1WM3A 2JXXA 2J0KA 2PEAA 3KUZA 4IUMB 2N9PC 2LWPA 2M17A 2FIFA 4ZRJA 1GJZA 3ZLZA 4EZJA 1E8XA 3UIOB 3DDCB 2EMTA 4II2B 2JF5A 4WWNA 3PREA 5JZEB 2GBNA 4GN1A 4WJNA 1E8YA 2J0JA 4IM3A 4G11A 4ANUA 2C7NB 4B95A 3WIMA 3RZWC 2PPHA 4YL8A 2IY0B 5CHWA 2AYOB 2L0TA 4KIKA 1WGHA 4NPNA 1BT0A 4XC2A 5E6NA 4PYZA 1WXSA 2DZIA 5JHBA 3PVLA 4NAWA 2KTFA 4DHZE 3PRPB 2XK5B 4BKTA 3DCGA 4HLEA 5LXIB 2KLCA 3RULA 1PQSA 2AEHA 4B9KA 4MJSA 2HD5B 2DZKA 1Z5SB 5L83A 4F7ZA 1EF5A 1OQYA 4B6WA 3AXCA 2ZEQA 4ICVA 1S1QB 2FIDA 1E7UA 2ZJDA 3PRZA 1P1AA 2LGXA 3HHMA 2O6VA 3PS6A 3P2BA 1KOTA 1AARA 3IVFA 2O2VA 4WJQA 3WA0A 1TTNA 4MEMA 1GUAB 4GIVA 2KTRA 2NBWB 3GZNI 2IO0B 4KIKB 4II3B 2BYEA 3ZNID 4W9KA 3RUIB 3SDLC 2N9EB 4W9HA 2CHZA 2L76A 4NAWB 4AOFA 4EUTA 3K9OB 1I42A 1WX9A 1UZXB 3NY5A 4DHJB 3DQVA 3NS8A 4IM0A 4DDID 2EMSA 1V2YA 4HDQA 1KLVA 2NR2A 3A4SC 3MJWA 3OJ4B 4KDIC 3PGEA 4MJSB 4W9EA 2J7QB 4HCNB 1V5OA 1YIWA 1S3SG 5CX3A 4ZYNA 1P3QU 3HK0A 4DK5A 4XX5A 4FADA 3ZTCA 1EO6A 2Z59B 5CHVC 3WAMA 4DHZB 2M1MA 1K8RB 2C7MB 4WJPA 1WX8A 1P9DU 2DZMA 2KDEB 2GBMA 3VH3B 3QIJA 3OLMD 4GDKA 4KV2A 2O2VB 4WJOA 1OEYJ 2G4SA 3U7DA 1D3ZA 4CO7A 3KVFB 3A33B 3PZDA 2KTRB 2BKFA 2HTHA 3WAPA 2L3ZA 3W1SC 3H6NA 4BBNC 4K7SA 2KDBA 2KFKA 2KXJA 2ZNVC 3PHXB 3JYUA 3V6EB 4E71A 3M3JA 2VRRB 2GOWA 2BWES 2IBIB 3QARA 3A9KA 4KSLC 4JGHB 3QHTA 3MHSD 4HK2A 3VTUA 3N3KB 3R3MA 3EECA 1V6EA 2D07B 2KX3A 4JQWC 2C60A 2KKCA 1E5WA 2ZVNA 5G2NA 2G3QB 2LI5A 5DPWA 2L0FA 4HWIB 4JLCA 2KQ7A 1SE9A 1NDDA 2NVUI 2KDIA 4FBJB 3ZW3A 4WQOB 2XEWA 4DWFA 1UD7A 3VUYA 4LJOB 2ZNVB 1E90A 3KW5B 3CMMB 3DOWA 2CU1A 4W9FA 3PV1A 3UGBB 3K9PB 4GDLA 4DHJD 4G3XB 1Q1OA 4I6PA 4GDKB 2DAJA 4FLHA 4W9DA 2RGFA 2RR9A 4PYUA 4OVVA 2K8BA 3ZUNA 2BYFA 3VXWA 4BKSA 2GBRA 1WI0A 4NJ7A 2G45B 2V3SA 3B08A 3ZIMA 2KFJA 4MGKE 3EFUA 3Q3JA 3A9KB 2KDFB 1WGRA 1P98A 3R7QA 3ZNZB 4KDLB 1U4AA 3DVGY 3D32A 4HVBA 1C3TA 4FJVB 1OTRB 1EUVB 2AWTA 5DPRA 2ZPNA 3PT2B 3VTVA 1GNUA 2FUHB 2N9XA 3IHPC 2WX1A 4DDGD 4PS8A 1V81A 4AJWA 3SU8X 2JY6A 2KWCA 4I6LB 4NY0A 1JRUA 2A4ZA 3RD2A 1WZ0A 4K81A 2BKRB 3N32A 1TZ1A 2LD9A 2UWQA 3M63B 3PPAA 1WE7A 2K6QA 3RZFA 5IA7A 5TR5A 3L13A 4IW0A 2JRHA 2KOXA 1H4RA 2C7HA 2FCMA 5IAAC 3VVWB 4EZKA 2D2QA 1MG8A 4IWOA 1GC7A 1UBQA 3N30A 4AWJA 2MCNB 3ML9A 4EEWA 4TV3A 3W1YA 4MSMB 2KZRA 2K39A 3H7PA 4URKA 3M62B 5HKHA 2D3GA 1NI2A 4K7UA 1WYWB 2W9NA 4BOZB 1SGHA 4IM2A 4P7IA 3SD5A 1L2NA 1ZW7A 2NBVB 5J18A 1HE8A 2A5UA 1SIFA 2ZCBA 2G4DB 3UIPB 2R2QA 2KD0A 3L17A 3DBHI 2DYBA 2DENB 3TL5A 2ZZPB 5C23A 3ZRFA 1ZKHA 3ZVVA 1WJNA 3UQAA 5L95C 1J0GA 3PSEB 4DXAB 3KUDB 1QZEA 3TCAA 5C1ZA 4FHJA 3QK0A 4MH0E 2CHWA 4RM8A 1WR1A 2M4NA 1KM7A 2MQJA 2KQSA 2AL6A 3NZUA 2NPTA 2KO3A 4IG7B 4LDTB 3QJZA 1FXTB 3A4RA 1YQBA 2JZ3B 4F1SA 2LUEA 4ANXA 4HPMB 2LVOA 5DPSA 3ENEA 1P0RA 3L16A 4G50A 3WALA 1XQQA 1Z2MA 3EHVA 4RMAA 3DBSA 2PE9A 3RCZA 2LRUA 2RPQA 1LFDA 1VCBA 3X0WA 2C9WB 1YD8U 4CYEA 4FHKA 1WM2A 1V86A 2IY1B 2IO2B 3A9JA 2WX0A 1WGDA 3PRMB 1Y8RC 2NS5A 1J19A 1GG3A 2O6VB 2OOBB 4NQKE 2BPSA 3JVZX 2DHZA 2BYVE 4N9F4 1WXAA 1YX5B 4AJYB 4IC7B 3VHTC 2CR5A 2L00B 1NBFC 1VD2A 2ZPYA 3LJ3A 3QX1A 4J6IA 4NJ6A 2FAZA 2EKEC 3BINA 2OJRA 4K1RB 4MGYE 5GMVA 5AZGA 2BGFA 1KJTA 4IWPA 3X23A 3UF8A 3R7RA 1WIAA 3DPDA
chains in the Genus database with same CATH superfamily
3HRDD 2MBQA 1TS2A 2REXA 3VUXA 2FNJB 2FCQA 3U2SC 1WX7A 3SHQA 4MACA 2V1YA 4PS7A 3OG5A 1MVKA 2JZZA 1V5TA 2R61A 1G6JA 2Y3AA 3PLUA 1HEZE 4S0RA 1MFWA 4ASWC 3EA6A 3IAM1 1WH3A 3L4PA 5AEKB 1EM7A 2KQ4X 2O6VD 2PLPA 2FCSA 2SAKA 4WQMA 1MPEA 1VDVA 1V8CA 1XT9B 2ACZB 3KWVA 2OJWA 3TEZA 4FJYA 3TIXA 1X1MA 3VH4B 3ZKJC 2DX5B 3R66C 1LQBA 5BO4B 2L8JA 1ZGUB 2IZVB 1FM0D 3JSVA 2JZPA 3ZGZA 5J2RA 4RGTA 4RGNA 2I1KA 1YJIA 2YEPF 1STEA 3MJ5A 2KJRA 3ZNHB 5LLIA 3U8ZA 3ZDMC 1WRIA 3VFKA 2N7JA 1QF6A 4M02A 2BB5A 2IYDB 2HE7A 2VZKB 4EKUA 2WDQB 1E9MA 2K6DB 4A6QA 4RM9A 2N1WA 2KAJA 3RFZB 3JSVB 3EFCA 2RSUA 4JIOU 3L0WB 4K7WA 5E6JA 3WANA 4UDUC 5D94A 4BKSD 4S17A 1PUTA 1NI3A 3KUCB 1A5RA 2KJHB 4DBGA 3ZO5B 2WWZA 3BYTB 5GXGB 3HM6X 2KVRA 3LDZE 4MSQB 3I3TB 2KC2A 2OHFA 3RNEC 3I63C 3KYCD 1WRDB 2WNMA 2MBEA 3H7SA 4EZLA 1YNTE 5D3DA 4PS3A 1ZPSA 3P42A 4OVUA 2JXTA 2WLBA 4XZ4A 4HCPB 4XWWA 2L83A 3AE5B 1FFUA 4P16A 2BB6A 4W9LA 2KMCA 1UH6A 1WR6E 2LHEA 3DVGX 2NMQA 2LXAA 4CHKA 4EFOA 5EDSA 2LJ5A 5BMIA 5DCNA 5BYRA 2GRIA 2JUOA 1SB3C 2WXFA 3LYYA 2KVZA 2D3CA 1NEKB 2MRPA 3DVNV 2JRIB 2LXCA 5CHFA 3SFDB 5HI1A 1M94A 4JL9A 3NHEB 5JH5C 3Q8EA 4TQ1A 2KK8A 2W3RA 5FK9C 4US8A 4RGOS 5FR6A 1JWUD 3KUZA 3RNBC 3UIOB 2EMTA 2INPE 3GP7A 2GBNA 5D3IB 3RZWC 2KMMA 1NENB 4QAYA 2PPHA 3I57A 5CHWA 1IBXB 4KIKA 1WGHA 3ZYYX 4XWTA 1M4VA 1T5XD 3N1XC 3PRPB 4BKTA 5LXIB 4HRSA 3RULA 5IN7A 2AEHA 2HD5B 2DZKA 1EF5A 2XN9C 2ZEQA 1K51A 1IUEA 2ZJDA 2LGXA 3P2BA 3IVFA 2O2VA 4WJQA 1XCQL 4MEMA 2KTRA 4KIKB 1YQ4B 3EGRA 1OFFA 1TZOA 3ETRA 4W9HA 1N60A 4AOFA 1UZXB 4IM0A 3NS1A 1KLVA 4KDIC 4W9EA 3PGEA 1KRHA 1QKZA 3Q8CA 1PGAA 1ENFA 2VZKD 3BIID 1EO6A 2Z59B 5CHVC 3WAMA 3C8YA 2M56B 1L6VA 1J7CA 1L0YB 4KV2A 4GDKA 2INNE 2O2VB 1PYWD 3KVFB 3KQ4A 2KTRB 2BKFA 2HTHA 3WAPA 4K7SA 5AUKA 2ZNVC 3V6EB 2BS2B 4E71A 3M3JA 3TEXA 2GOWA 2IBIB 4JGHB 3VTUA 2FE8A 2QEJC 2KKCA 1SE2A 2G3QB 2G9HD 2LI5A 4JLCA 2WHIA 4K3CA 2KDIA 2QCZA 2WGSA 3ZW3A 1UD7A 4LNOA 3VUYA 4EE2A 2CU1A 4W9FA 2QILA 3PV1A 1MG4A 2K9XA 4G3XB 1NYQA 4GDKB 4FLHA 2RGFA 4A55A 4PYUA 3RN9C 3ZUNA 2BYFA 2WXGA 1SJED 1WI0A 2V3SA 1Q10A 3Q3JA 3ZNZB 1YOVB 4FJVB 1OTRB 2ZPNA 4OHJA 1L6UA 2INDC 2FUHB 5C3JB 2J52A 1JRUA 1K50A 2A4ZA 2LD9A 3RZFA 1WE7A 2WQYB 1ET6A 1R4MB 3BYYB 2K5PA 3RNFC 1SE4A 3H7PA 2D3GA 1JQ4A 4K7UA 4BOZB 2NBVB 1J7AA 1PGXA 1SIFA 5JXVA 2ZCBA 3UIPB 2HTME 4REZA 2DYBA 2CU3A 3DBHB 2JYTA 1QZEA 3KUDB 3TCAA 1XO3A 2JU6X 4MH0E 2CHWA 1A70A 1WR1A 2M4NA 1KM7A 5H8YE 3NZUA 2KO3A 1FXTB 2QJLA 4HPMB 1FRDA 3B9JA 4G50A 2J4XA 2LFIA 3Q6BA 3RCZA 1LFDA 5G5GA 4CYEA 4FHKA 1WM2A 1VZ8A 2IY1B 1WGDA 1J19A 2O6VB 2OOBB 1GB1A 1TS3A 1WWTA 5BYSA 4AJYB 1UGJA 4B0MA 3TEYA 4GLSC 3AE7B 5TSSA 2EKEC 3Q3NC 1SIJA 2PVOD 4K1RB 5GMVA 1V1PA 1JROA 2ONQA 3R7RA 3T3OA 1I35A 3DPDA 1V49A 4N58A 1CMXB 1WMHA 2R2OA 1UELA 3C0RB 5LNK1 4FULA 3KWLA 1BMLC 1C1YB 2E6XA 2V4LA 3RPFC 3B0AA 2M0XA 5KHOA 3TUOA 3VQIA 4M8NA 4YTNB 1BXTA 2PJHA 2K8HA 3APDA 3AH7A 1RFAA 2CHXA 3DBRB 3MC8A 4J3OD 1V1PB 3Q8BA 5LXHA 1R4NB 3W9CB 3T9LA 4US9A 4XYCA 3P63A 1WGKA 1T0SC 2WXIA 4NJCA 2W54A 2KMAA 1WXQA 3APFA 1LM8B 3RMKC 2MJ3A 3NOBA 4M8MA 1RWSA 4GDLB 3BVGA 1L7YA 3AEAB 1P7EA 2L7RA 1WZ3A 1JCKB 2ZW0A 3M95A 3CSFA 3IXSA 2MHJA 1FXIA 2WDRB 2NTSA 2QC8A 3RI7C 2ICIA 1I4XA 2BBCA 2KT7A 1L5PA 4TKNA 2LGDA 3ONSA 2VH1A 1TY2A 3UINB 3QWZB 3O65B 1WJ6A 4KGRA 5HG2A 3TBLD 4ZHPA 2ZCCA 3BVMA 3IG3A 3Q2AC 4ZDVA 2MSED 5T8IA 3DBLB 4M00A 3QC8B 5CTRC 4DXGA 4GSWA 4KZ0A 2BF8B 4B0EA 1FPYA 4BZAA 1QT9A 1C79A 2KANA 2QDFA 4W9CA 3U30A 2M8SA 2YVCA 2I1JA 4HEA1 4WWOA 2JPHA 2K8CA 1WE6A 2Y5BB 3NUHB 4HKQA 1LGRA 3TEWA 2GI9A 1JRPA 3WAOA 1YJ1A 4A3PA 3PHWB 1IYFA 2KC1A 2NBUA 3BY4B 4BOSC 2NPTB 2W82A 3B1LX 3W5UB 2MW5A 3FAHA 5D2MB 3APCA 4YTPB 3VR9B 4I6NB 4WURA 3KYDD 1WJ4A 3H1UA 3H9DA 3ZTDA 1JALA 3ZNGC 2WU5B 2AQ2B 4TUUA 2Z0EB 3Q8AA 2JQRB 4FN2A 1D5ZC 3HUIA 4ARCA 4MGZE 1IP9A 1SEBD 3P4PB 5G5HA 3AEGB 1RRBA 1E10A 2LZ6A 4C56C 3V05A 3GOEA 1XLQA 2B3AA 1T0RC 2JYEA 2DYOA 3P4QB 3MP9A 3VUWA 1HA5A 2V3PA 1OEYA 2L05A 4F8CB 1WFYA 2N7DA 3V6CB 2KWDA 1ZUD2 2K25A 1WGGA 2ZVOA 4IWQA 1WM3A 2JXXA 3AECB 1HZ6A 2FIFA 2JF5A 4WJNA 3R2IA 1KFYB 4OW0A 4G11A 3BZDB 2C7NB 3N9YC 3WCQA 3WIMA 1FXAA 2INCC 2IY0B 1C4PA 4N59A 2AYOB 2WXOA 1BT0A 4XC2A 4H2AA 1WXSA 3PZ8A 3PVLA 3P1MA 4P6VF 4DHZE 3SR6A 2BQQA 3DCGA 1PQSA 4MJSA 5IP4D 3FC4A 5L83A 2QIEB 1OQYA 1E0ZA 3PO0A 2FIDA 1E7UA 1C4CA 3PS6A 1XEEA 2NBWB 3C19A 2H88B 4W9KA 3SDLC 3GZNB 1TYGB 1YMHE 4LNKA 2M19A 4LNIA 4AQ7A 3NY5A 3DQVA 3LB8C 1V2YA 2NR2A 3MJWA 1GPXA 4MJSB 2J7QB 1YIWA 1QOBA 3HK0A 4DXFA 2J42A 2C7MB 4WJPA 1P9DU 3VH3B 3OLMD 4WJOA 2HDEA 1D3ZA 4CO7A 2L3ZA 3W1SC 2KDBA 2KFKA 5C2TB 3J9CA 3JYUA 4OZBA 2VRRB 3QARA 3A9KA 1HTOA 2PMVA 3EECA 3W2DA 2D07B 4JQWC 3HVDA 1NDDA 1JWSD 4WQOB 4DWFA 4M0WA 2LHDA 3KW5B 3CMMB 3DOWA 1NVID 4DHJD 1CK1A 4I6PA 4W9DA 1B9RA 4OVVA 2CJNA 3VXWA 1SSNA 2D3BA 2KYWA 2WXMA 3A9KB 4KDLB 4KGSA 1U4AA 4RCOA 4NZLB 1ZE3D 4OZCA 1PGBA 2LEKA 3SEBA 3VTVA 2GLSA 2WX1A 4DDGD 4PS8A 4PT5A 1V81A 4AJWA 3SU8X 4I6LB 4NY0A 2N9LA 3RD2A 4K81A 3M63B 2K6QA 3H8HA 2JRHA 2KOXA 2C7HA 2FCMA 5IAAC 3NG0A 1MG8A 1GC7A 1UBQA 2BS4B 4AWJA 4EEWA 4TV3A 4MSMB 2K39A 2M0AA 4A8XC 4URKA 1TKGA 4C80A 2W9NA 1SGHA 2LJIA 2K0PA 4P7IA 1R7SA 1VRAB 1HQRD 2A5UA 1T0QC 2IGHA 3BVZA 2R2QA 2KD0A 3L17A 3DBHI 2ZZPB 3ZRFA 2BT6A 1K53A 2DWQA 3UQAA 5L95C 3PSEB 1RYJA 4RM8A 4KKJA 2HJ1A 2MQJA 2KDMA 2KQSA 4OVZA 4ANXA 4RH6A 1JWAD 2LVOA 1P0RA 3L16A 1N61A 3EHVA 4HJGE 4RMAA 2PE9A 2V9HA 2Y5CA 2RPQA 3FILA 2WS3B 3PZ7A 1V86A 5HFYA 2IO2B 3A9JA 4YSZB 4C7YA 1YX5B 4YTMB 1I7HA 3Q8FA 4IC7B 2L00B 2ZPYA 3LJ3A 3DHHC 2WXQA 2OJRA 1QOAA 3FKYA 2V0GA 2EELA 3AMZA 1ACCA 4FA6A 2YLMA 3FILB 3AM9A 2N7EA 2B76B 3IT6B 4GU2A 3GE8C 3MTNB 1B1ZA 1F9JA 2JT4B 3AV8A 1C77A 2JX5A 4ZRKA 2RDHA 3DBRI 4C7ZA 4DQOC 1L4ZB 1VZ7A 4MELA 2ASQA 1TGZB 1R4NI 2MBOA 3CF6E 4A3OA 4HJKA 4L1BA 1WSPA 3V3XA 2DZJA 1VJKA 2WYQA 4ICUA 2D3AA 4KX6B 2E3TA 2AL3A 1Q5WB 1UWXA 2IJ0A 4GB9A 3GB1A 4N6EB 4BBNF 4P1CC 3IAS1 4MH8A 2XBBC 3NVVA 1RLFA 1WXVA 2WDVB 3AE9B 3ALBA 1WY8A 2DYMA 5EE9A 4W9JA 2PW9A 4JX1C 4GMVA 4W9IA 3AI5A 3IFWB 4X57B 2KJ6A 5IKCM 4GOCA 2NCNA 1YX6B 1TS4A 4AP4C 4ZHOA 3S2AA 1C78A 4A20A 3QCAA 2LRWA 3AU4A 4E3CA 3DBLI 2MLBA 5KHQA 2D11A 1VZ6A 3R2TA 5D6JB 1LXDA 4MM3A 4LNNA 1XD3B 4USAA 1KLGD 4HDOA 1V80A 3TSSA 4XDCA 2JWZA 1YN5A 2N1VA 5BMGA 2WDTB 3H7PB 4FJZA 2GMIC 3VR8B 2IGGA 2UYZB 5IO9A 1ZDXA 3PTFC 2RMMA 4ANVA 3Q69A 4MM3B 1XF5L 4GXBA 2G1EA 3SFEB 2KWVB 2WXKA 4BFRA 2PE6B 3DWGC 3L54A 3V60A 3BK1A 3W1SA 4BVUC 1OQRA 1D4BA 2WP9B 1J8CA 2QSDA 3R8BA 2JWUA 3O13A 1UBIA 4A9AA 1C76A 2GBKA 2LVPA 3UQBA 3P4RB 1EWCA 2KLGA 4AS1A 2KX0A 3V62A 2LVQA 1KLUD 4YT0B 3QQ8B 1WJUA 3KLSX 1WMHB 2CS4A 4ZOHC 5E6OA 3RNAC 4FXCA 1DOYA 2MBBB 3OJ3A 1WXMA 2DAFA 4XE0A 2JVCA 1ZOYB 3AU5A 1WGYA 3IBEA 2Z0DB 2C5LC 3ZJTA 5AZHA 1C4AA 2J0MA 2WU2B 2DBYA 3E9SA 4RF0A 2J0KA 1AWDA 1AW7A 2N9KA 2LWPA 2M17A 1E8XA 2BS3B 2EKIA 5H92C 1JW9D 4II2B 5JZEB 4GN1A 1FD6A 4IM3A 2H89B 4ANUA 1CZPA 1ET9A 1V97A 1FNUA 5E6NA 5FKAC 2DZIA 1XLOA 4NAWA 4HLEA 2KLCA 4B9KA 1Z5SB 2MJEA 4LK0M 1VR9A 3AXCA 4JWUC 4ICVA 3PRZA 1IGDA 3DWMA 3CIRB 1F77A 1TTNA 4GIVA 1OQQA 3GZNI 2IO0B 4IOIE 2N9EB 2CHZA 3E56A 2L76A 4NAWB 3ZQ4A 4EUTA 1I42A 1WX9A 4DHJB 4HDQA 3A4SC 2I38A 2WXNA 4HCNB 1V5OA 1S3SG 5CX3A 3DHGC 3ZTCA 2I2YA 2GB1A 1FIQA 1UUPA 2M1MA 1K8RB 1ZP0B 1WX8A 1MI0A 2WXPA 1ZXIA 2PVGC 3QIJA 3U7DA 1OEYJ 2G4SA 1BUIC 1FRRA 3A33B 2TSSA 3AEBB 4BBNC 3H6NA 4LLGM 2KXJA 2LGSA 4RGMA 4PK1A 4HROA 3QHTA 4HK2A 1EWYC 3R3MA 1I4GA 1V6EA 2C60A 1E5WA 5G2NA 1KF6B 4TSSA 5DPWA 2NVUI 1SE9A 1QOFA 4FBJB 2XEWA 4KKIA 4LJOB 2ZNVB 2BTEA 4XGAB 3UGBB 3K9PB 1FO4A 2DNFA 2BVCA 3B2FA 2GBRA 2G45B 3B08A 2D5GA 2KFJA 3EFUA 4MGKE 2KDFB 3R7QA 3LXFA 4O1NA 1DGJA 3DVGY 2YEPB 2AWTA 5DPRA 1L0VB 4RF1A 1GNUA 2N9XA 3IHPC 4WWMA 4YWGG 3NVWA 1TY0A 1PFDA 2KWCA 4WIPA 2BKRB 1KTKA 2UWQA 3VDZA 3PPAA 1N5WA 5TR5A 3N1ZC 3L13A 1H4RA 4EZKA 3N20C 3N30A 2MCNB 1L4DB 3ML9A 3W1YA 2KZRA 4ARIA 3M62B 5HKHA 1WYWB 1L2NA 1PDXA 5J18A 1N62A 2G4DB 3VRAB 1QQRA 2DENB 5C23A 1ZKHA 3ZVVA 2ZW1A 5C1ZA 4YSXB 3QK0A 3AE6B 1UWMA 3AB5A 4LDTB 3QJZA 1QILA 1YQBA 2JZ3B 3AE3B 4F1SA 2Q5WD 5DPSA 3ENEA 1EU3A 2FUG1 2LRUA 2ON8A 2Z8LA 1N63A 1SE3A 1YD8U 1YQ3B 2WX0A 1F2RI 1NYRA 5FR3A 3ZJVA 2BYVE 1F0ZA 3VHTC 3AN1A 2CR5A 1CJEA 1VD2A 3NVYA 5EE3A 3BINA 2AX5A 4MGYE 1TJEA 4IWPA 2W3SA 3AEEB 1IGCA 4MT5A 4MDKE 5E6PA 2LGIA 1FNVA 1GB4A 4L2YA 4TQ0A 2K1FA 3VTWA 3ABVB 2KN5A 4MGIE 2IO3B 4HPPA 3U4EG 2MX2A 2X38A 1EF1A 5I4DA 1UF0A 2KNBA 3QAQA 3V61A 3GE3C 2KFKB 2LUMA 2RD0A 5IOIA 3ZDTA 4LCDE 3VAWA 1YN4A 2LGYA 3DVNU 2BWFA 1SXTA 1J7BA 4LNFA 4WAAA 4KSKC 1ZDVA 2IO1B 1V9JA 4R3DA 2CKHB 2QMTA 1RAXA 4L23A 4ANWA 4M0WB 1IBXA 1E8WA 2XNAC 1TKYA 1H8CA 1UGMA 2OEDA 1T6BX 1F52A 3DHIC 1R4MI 1TIFA 3CSTA 2KHWB 1AYFA 5MPOA 2MJDA 3QA8A 2MA9B 2MP2A 5G55A 3IT4B 1LO5D 2KN4A 4GGQA 4D2KA 1ISNA 4NNJB 3L10B 4G0NB 1F1HA 5EE0A 3ZXRA 3PLVA 4AUQC 2VH2A 3RYTA 4E74A 1UNSA 3OWEB 1WF9A 2PTLA 1TT5B 3BWUD 4KVGB 2D10A 1Q0WB 3AEFB 3EC8A 2FCNA 2W55A 2MWSB 4LTUA 3Q3FA 3OAWA 4W9GA 2FBWB 5J17A 3NZSA 2BYTA 1GC6A 2MP2B 2MBHA 1OGWA 4BKGA 3KH0A 4JE3B 5D7GA 1E7VA 3NZ3A 2KWUB 1DYQA 1E6EB 4A90A 3U52E 1N6ZA 2KACA 1Y56A 1D6EC 4HXDA 4KZCA 3I9V1 4Q2JA 2SEBD 1QOGA 4NQLB 4LJPB 4ZRIA 4ACFA 3A1QA 3ZRCA 4NAMA 1KH0A 5JHAA 4WWPA 1IPGA 2NTTA 3TMPB 3T3NA 2DLBA 4M01A 4BAXA 1WYGA 3A9JB 4LDTD 2IDYA 3ML8A 3BK2A 2BW2A 3HIZA 1K52A 5DPTA 2LMCA 1XXGA 4XDDA 4RNAA 3JW0X 1JWMD 1GAQB 3A1QB 2K3UA 4EOYA 1SJHD 2HJ8A 5AZFA 2IPKD 3TJPA 3AULA 2L52A 3HM3A 1TBEA 1E8ZA 3RT3B 1D5XC 3AE4B 1T0YA 3L08A 3P4SB 5HHDG 3AE1B 1FCCC 3ECIA 3T8MA 2GBJA 5BMHA 1ESFA 2N4FA 2LASA 2V4IB 4IKGA 2XK5A 2QHOA 4HPLB 2PEAA 1I4QA 4IUMB 2N9PC 3EUB2 1I4PA 4OZAA 4ZRJA 1GJZA 1XCTL 3ZLZA 4EZJA 1T3QA 3DDCB 4WWNA 3PREA 3RNGC 1V1OA 4WAFA 1E8YA 2J0JA 1YN3A 4B95A 4YL8A 2AQ3B 1FCLA 2L0TA 4NPNA 1JWBD 4PYZA 5JHBA 2KTFA 1I4RA 2J53A 5AUIA 2XK5B 4HKZE 4JPSA 1CQVA 3ZXVA 1TS5A 1JMLA 2JSVX 4K3BA 4F7ZA 3URYA 4B6WA 2L1AA 4C4VA 4IDIA 3UI3A 1S1QB 1P1AA 3HHMA 4TMAB 2O6VA 3MC9A 3ZJUA 1KOTA 1AARA 3WA0A 1GUAB 2MH7A 2WXRA 4II3B 2BYEA 5BYQA 3ZNID 3RUIB 4CQNA 3K9OB 3B2GA 3NS8A 1I4HA 4DDID 2EMSA 3OJ4B 1RM6C 3NJTA 4ZYNA 1P3QU 4DK5A 4XX5A 4FADA 4C4VB 4ZYSA 1SBBB 4DHZB 1QLBB 3U7ZA 1XLPA 2WXHA 2DZMA 2KDEB 2GBMA 1FMAD 1HXYD 3N1YC 4YXDB 4YSYB 3NVZA 3PZDA 1ROEA 1GOZA 2N0SB 3PHXB 4P1BC 1XLNA 2PIAA 2BWES 4KSLC 3MHSD 3N3KB 4ZRPA 3W5VB 1FNWA 2KX3A 3I5JC 2ZVNA 2L0FA 4HWIB 2KQ7A 3HVZA 1E90A 2AQ1B 1TKEA 4GDLA 1Q1OA 2DAJA 2RR9A 2K8BA 1DOIA 4BKSA 3MFGA 4NJ7A 3AE8B 3ZIMA 3VRBB 1L0XB 1WGRA 1P98A 1EU4A 3D32A 3Q14C 3Q3OC 4HVBA 1C3TA 1HZ5A 1EUVB 1MHHE 3PT2B 2MEKA 1VLBA 3CWIA 2JY6A 2L32A 1WZ0A 2WXLA 3NRZA 3N32A 1TZ1A 1D5MC 5IA7A 3AE2B 1DOXA 1N5XA 4IW0A 2RDBC 3VVWB 1YJJA 2D2QA 2Y5PA 4IWOA 2IGDA 4ITKA 4JWSC 2V3NA 3RNCC 2PKOA 2K22A 1E7PB 1NI2A 2X8XX 4IM2A 3SD5A 1ZW7A 1MJDA 1HE8A 3MHZA 3TL5A 4RFBA 4ZRQA 1WJNA 1J0GA 4DXAB 4FHJA 1FEHA 3Q3MC 4C00A 2AL6A 2NPTA 4IG7B 1MHXA 3A4RA 1F2RC 5EE1A 1SF0A 3GS2A 2LUEA 2CJOA 2RPVA 1XQQA 1Z2MA 3WALA 3DBSA 1FFVA 1ZXHA 1VCBA 3X0WA 2C9WB 2RDGA 1P7FA 3PRMB 1Y8RC 1RFKA 2UU7A 2NS5A 1HTQA 1GG3A 4KGTA 4NQKE 2BPSA 3MC0B 3JVZX 2DHZA 4N9F4 1WXAA 1NBFC 3QX1A 4J6IA 1AN8A 4NJ6A 2FAZA 1C9FA 5AZGA 2BGFA 1KJTA 3X23A 3UF8A 2WXJA 1WIAA 3AEDB 4WH4A
chains in the Genus database with same CATH topology
1V49A 4MDKE 5E6PA 1CMXB 1WMHA 2MBQA 1UELA 2R2OA 3C0RB 2REXA 4TQ0A 4FULA 3VUXA 2YLMA 2FNJB 2FCQA 4FA6A 2K1FA 2N7EA 3VTWA 1C1YB 1WX7A 2KN5A 2V4LA 4MGIE 2IO3B 3SHQA 4GU2A 2V1YA 3B0AA 2M0XA 3MTNB 5KHOA 3VQIA 4PS7A 2MX2A 4M8NA 1EF1A 2PJHA 1F9JA 2K8HA 2JT4B 2KNBA 3APDA 3QAQA 3V61A 4ZRKA 2JZZA 1V5TA 3DBRI 1G6JA 1RFAA 2KFKB 2CHXA 2RD0A 3PLUA 4MELA 2ASQA 3ZDTA 4LCDE 4ASWC 1TGZB 1R4NI 2MBOA 3CF6E 3VAWA 4HJKA 4A3OA 2LGYA 2DZJA 2WYQA 3DVNU 4ICUA 1WH3A 2BWFA 5AEKB 5LXHA 4WAAA 2O6VD 2FCSA 3T9LA 4KSKC 3VDZA 2AL3A 2IO1B 1Q5WB 1V9JA 1XT9B 4GB9A 2CKHB 1RAXA 4BBNF 2KMAA 4ANWA 4FJYA 4M0WB 1E8WA 3APFA 1LM8B 3NOBA 4M8MA 2XBBC 1X1MA 3TIXA 1H8CA 1UGMA 3VH4B 4GDLB 3ZKJC 2DX5B 3R66C 1RLFA 1WXVA 1LQBA 5BO4B 1R4MI 1L7YA 3CSTA 2KHWB 2L8JA 1ZGUB 2IZVB 2L7RA 1WZ3A 3JSVA 3ALBA 5J2RA 1WY8A 2DYMA 3M95A 2MA9B 3QA8A 3CSFA 4W9JA 2MP2A 2I1KA 4GMVA 3AI5A 4W9IA 3IFWB 5G55A 4GGQA 4X57B 2KJ6A 1ISNA 4NNJB 3L10B 2KJRA 4GOCA 3ZNHB 4G0NB 5LLIA 3U8ZA 2NCNA 1YX6B 3PLVA 3ZDMC 4TKNA 2LGDA 3ONSA 4AP4C 4AUQC 3S2AA 3RYTA 3VFKA 3UINB 3QWZB 3O65B 1WJ6A 4A20A 4E74A 2IYDB 2HE7A 1WF9A 3TBLD 3QCAA 4EKUA 4KVGB 2LRWA 2ZCCA 3AU4A 4E3CA 2D10A 1Q0WB 3EC8A 3DBLI 2FCNA 3IG3A 4ZDVA 2MLBA 2K6DB 2MSED 5KHQA 2D11A 2MWSB 4RM9A 5D6JB 1LXDA 5CTRC 3Q3FA 3OAWA 3QC8B 4MM3A 2N1WA 4W9GA 3JSVB 5J17A 1XD3B 3NZSA 4GSWA 4KZ0A 2RSUA 4HDOA 1GC6A 1V80A 4JIOU 3L0WB 2JWZA 2MP2B 2N1VA 2BF8B 2MBHA 2WDTB 4K7WA 3H7PB 4FJZA 1OGWA 2KANA 2GMIC 4BKGA 3KH0A 3WANA 4W9CA 5D7GA 3U30A 2M8SA 2YVCA 1E7VA 2I1JA 5D94A 4BKSD 2KWUB 4WWOA 2JPHA 2UYZB 3KUCB 2K8CA 1WE6A 2KJHB 4DBGA 1A5RA 2Y5BB 3PTFC 3ZO5B 2WWZA 3HM6X 2KVRA 4ANVA 3LDZE 4MSQB 4HXDA 4KZCA 3I3TB 3WAOA 1YJ1A 4GXBA 4A3PA 3PHWB 1IYFA 2KC1A 2KC2A 4NQLB 2NBUA 3BY4B 4LJPB 4ZRIA 4BOSC 2NPTB 3A1QA 3ZRCA 2KWVB 3B1LX 4BFRA 2PE6B 3KYCD 5JHAA 3L54A 4WWPA 3V60A 1IPGA 2MW5A 3W1SA 1WRDB 4BVUC 2MBEA 3H7SA 5D2MB 3APCA 3TMPB 1J8CA 4I6NB 4EZLA 3KYDD 1WJ4A 4PS3A 3H1UA 4OVUA 4XZ4A 3H9DA 4HCPB 3ZTDA 3A9JB 4LDTD 1UBIA 4TUUA 3ML8A 3ZNGC 2Z0EB 3HIZA 4W9LA 2GBKA 4FN2A 2KMCA 1UH6A 2LVPA 3UQBA 1WR6E 3DVGX 5DPTA 2LXAA 4CHKA 4EFOA 2KLGA 3JW0X 5EDSA 4MGZE 2LJ5A 1IP9A 2KX0A 3A1QB 5DCNA 3V62A 4EOYA 2LVQA 2JUOA 2HJ8A 5AZFA 1I35A 3TJPA 3AULA 3QQ8B 3HM3A 1TBEA 1WJUA 1RRBA 1E8ZA 1WMHB 2LZ6A 2CS4A 2MRPA 5E6OA 3RT3B 3DVNV 2JRIB 2LXCA 3GOEA 5CHFA 2B3AA 1T0YA 2DYOA 3VUWA 2MBBB 3L08A 1WXMA 2DAFA 3OJ3A 2JVCA 3AU5A 3ECIA 3T8MA 1WGYA 1M94A 2GBJA 3IBEA 1OEYA 3NHEB 2L05A 4JL9A 4F8CB 1WFYA 5JH5C 2N4FA 2LASA 2C5LC 2N7DA 2Z0DB 4TQ1A 2KK8A 3V6CB 2XK5A 5AZHA 2K25A 2QHOA 5FR6A 1WGGA 2J0MA 2ZVOA 4HPLB 4IWQA 1WM3A 2JXXA 2J0KA 2PEAA 3KUZA 4IUMB 2N9PC 2LWPA 2M17A 2FIFA 4ZRJA 1GJZA 3ZLZA 4EZJA 1E8XA 3UIOB 3DDCB 2EMTA 4II2B 2JF5A 4WWNA 3PREA 5JZEB 2GBNA 4GN1A 4WJNA 1E8YA 2J0JA 4IM3A 4G11A 4ANUA 2C7NB 4B95A 3WIMA 3RZWC 2PPHA 4YL8A 2IY0B 5CHWA 2AYOB 2L0TA 4KIKA 1WGHA 4NPNA 1BT0A 4XC2A 5E6NA 4PYZA 1WXSA 2DZIA 5JHBA 3PVLA 4NAWA 2KTFA 4DHZE 3PRPB 2XK5B 4BKTA 3DCGA 4HLEA 5LXIB 2KLCA 3RULA 1PQSA 2AEHA 4B9KA 4MJSA 2HD5B 2DZKA 1Z5SB 5L83A 4F7ZA 1EF5A 1OQYA 4B6WA 3AXCA 2ZEQA 4ICVA 1S1QB 2FIDA 1E7UA 2ZJDA 3PRZA 1P1AA 2LGXA 3HHMA 2O6VA 3PS6A 3P2BA 1KOTA 1AARA 3IVFA 2O2VA 4WJQA 3WA0A 1TTNA 4MEMA 1GUAB 4GIVA 2KTRA 2NBWB 3GZNI 2IO0B 4KIKB 4II3B 2BYEA 3ZNID 4W9KA 3RUIB 3SDLC 2N9EB 4W9HA 2CHZA 2L76A 4NAWB 4AOFA 4EUTA 3K9OB 1I42A 1WX9A 1UZXB 3NY5A 4DHJB 3DQVA 3NS8A 4IM0A 4DDID 2EMSA 1V2YA 4HDQA 1KLVA 2NR2A 3A4SC 3MJWA 3OJ4B 4KDIC 3PGEA 4MJSB 4W9EA 2J7QB 4HCNB 1V5OA 1YIWA 1S3SG 5CX3A 4ZYNA 1P3QU 3HK0A 4DK5A 4XX5A 4FADA 3ZTCA 1EO6A 2Z59B 5CHVC 3WAMA 4DHZB 2M1MA 1K8RB 2C7MB 4WJPA 1WX8A 1P9DU 2DZMA 2KDEB 2GBMA 3VH3B 3QIJA 3OLMD 4GDKA 4KV2A 2O2VB 4WJOA 1OEYJ 2G4SA 3U7DA 1D3ZA 4CO7A 3KVFB 3A33B 3PZDA 2KTRB 2BKFA 2HTHA 3WAPA 2L3ZA 3W1SC 3H6NA 4BBNC 4K7SA 2KDBA 2KFKA 2KXJA 2ZNVC 3PHXB 3JYUA 3V6EB 4E71A 3M3JA 2VRRB 2GOWA 2BWES 2IBIB 3QARA 3A9KA 4KSLC 4JGHB 3QHTA 3MHSD 4HK2A 3VTUA 3N3KB 3R3MA 3EECA 1V6EA 2D07B 2KX3A 4JQWC 2C60A 2KKCA 1E5WA 2ZVNA 5G2NA 2G3QB 2LI5A 5DPWA 2L0FA 4HWIB 4JLCA 2KQ7A 1SE9A 1NDDA 2NVUI 2KDIA 4FBJB 3ZW3A 4WQOB 2XEWA 4DWFA 1UD7A 3VUYA 4LJOB 2ZNVB 1E90A 3KW5B 3CMMB 3DOWA 2CU1A 4W9FA 3PV1A 3UGBB 3K9PB 4GDLA 4DHJD 4G3XB 1Q1OA 4I6PA 4GDKB 2DAJA 4FLHA 4W9DA 2RGFA 2RR9A 4PYUA 4OVVA 2K8BA 3ZUNA 2BYFA 3VXWA 4BKSA 2GBRA 1WI0A 4NJ7A 2G45B 2V3SA 3B08A 3ZIMA 2KFJA 4MGKE 3EFUA 3Q3JA 3A9KB 2KDFB 1WGRA 1P98A 3R7QA 3ZNZB 4KDLB 1U4AA 3DVGY 3D32A 4HVBA 1C3TA 4FJVB 1OTRB 1EUVB 2AWTA 5DPRA 2ZPNA 3PT2B 3VTVA 1GNUA 2FUHB 2N9XA 3IHPC 2WX1A 4DDGD 4PS8A 1V81A 4AJWA 3SU8X 2JY6A 2KWCA 4I6LB 4NY0A 1JRUA 2A4ZA 3RD2A 1WZ0A 4K81A 2BKRB 3N32A 1TZ1A 2LD9A 2UWQA 3M63B 3PPAA 1WE7A 2K6QA 3RZFA 5IA7A 5TR5A 3L13A 4IW0A 2JRHA 2KOXA 1H4RA 2C7HA 2FCMA 5IAAC 3VVWB 4EZKA 2D2QA 1MG8A 4IWOA 1GC7A 1UBQA 3N30A 4AWJA 2MCNB 3ML9A 4EEWA 4TV3A 3W1YA 4MSMB 2KZRA 2K39A 3H7PA 4URKA 3M62B 5HKHA 2D3GA 1NI2A 4K7UA 1WYWB 2W9NA 4BOZB 1SGHA 4IM2A 4P7IA 3SD5A 1L2NA 1ZW7A 2NBVB 5J18A 1HE8A 2A5UA 1SIFA 2ZCBA 2G4DB 3UIPB 2R2QA 2KD0A 3L17A 3DBHI 2DYBA 2DENB 3TL5A 2ZZPB 5C23A 3ZRFA 1ZKHA 3ZVVA 1WJNA 3UQAA 5L95C 1J0GA 3PSEB 4DXAB 3KUDB 1QZEA 3TCAA 5C1ZA 4FHJA 3QK0A 4MH0E 2CHWA 4RM8A 1WR1A 2M4NA 1KM7A 2MQJA 2KQSA 2AL6A 3NZUA 2NPTA 2KO3A 4IG7B 4LDTB 3QJZA 1FXTB 3A4RA 1YQBA 2JZ3B 4F1SA 2LUEA 4ANXA 4HPMB 2LVOA 5DPSA 3ENEA 1P0RA 3L16A 4G50A 3WALA 1XQQA 1Z2MA 3EHVA 4RMAA 3DBSA 2PE9A 3RCZA 2LRUA 2RPQA 1LFDA 1VCBA 3X0WA 2C9WB 1YD8U 4CYEA 4FHKA 1WM2A 1V86A 2IY1B 2IO2B 3A9JA 2WX0A 1WGDA 3PRMB 1Y8RC 2NS5A 1J19A 1GG3A 2O6VB 2OOBB 4NQKE 2BPSA 3JVZX 2DHZA 2BYVE 4N9F4 1WXAA 1YX5B 4AJYB 4IC7B 3VHTC 2CR5A 2L00B 1NBFC 1VD2A 2ZPYA 3LJ3A 3QX1A 4J6IA 4NJ6A 2FAZA 2EKEC 3BINA 2OJRA 4K1RB 4MGYE 5GMVA 5AZGA 2BGFA 1KJTA 4IWPA 3X23A 3UF8A 3R7RA 1WIAA 3DPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V49 A;  4MDK E;  5E6P A;  1CMX B;  1WMH A;  2MBQ A;  1UEL A;  2R2O A;  3C0R B;  2REX A;  4TQ0 A;  4FUL A;  3VUX A;  2YLM A;  2FNJ B;  2FCQ A;  4FA6 A;  2K1F A;  2N7E A;  3VTW A;  1C1Y B;  1WX7 A;  2KN5 A;  2V4L A;  4MGI E;  2IO3 B;  3SHQ A;  4GU2 A;  2V1Y A;  3B0A A;  2M0X A;  3MTN B;  5KHO A;  3VQI A;  4PS7 A;  2MX2 A;  4M8N A;  1EF1 A;  2PJH A;  1F9J A;  2K8H A;  2JT4 B;  2KNB A;  3APD A;  3QAQ A;  3V61 A;  4ZRK A;  2JZZ A;  1V5T A;  3DBR I;  1G6J A;  1RFA A;  2KFK B;  2CHX A;  2RD0 A;  3PLU A;  4MEL A;  2ASQ A;  3ZDT A;  4LCD E;  4ASW C;  1TGZ B;  1R4N I;  2MBO A;  3CF6 E;  3VAW A;  4HJK A;  4A3O A;  2LGY A;  2DZJ A;  2WYQ A;  3DVN U;  4ICU A;  1WH3 A;  2BWF A;  5AEK B;  5LXH A;  4WAA A;  2O6V D;  2FCS A;  3T9L A;  4KSK C;  3VDZ A;  2AL3 A;  2IO1 B;  1Q5W B;  1V9J A;  1XT9 B;  4GB9 A;  2CKH B;  1RAX A;  4BBN F;  2KMA A;  4ANW A;  4FJY A;  4M0W B;  1E8W A;  3APF A;  1LM8 B;  3NOB A;  4M8M A;  2XBB C;  1X1M A;  3TIX A;  1H8C A;  1UGM A;  3VH4 B;  4GDL B;  3ZKJ C;  2DX5 B;  3R66 C;  1RLF A;  1WXV A;  1LQB A;  5BO4 B;  1R4M I;  1L7Y A;  3CST A;  2KHW B;  2L8J A;  1ZGU B;  2IZV B;  2L7R A;  1WZ3 A;  3JSV A;  3ALB A;  5J2R A;  1WY8 A;  2DYM A;  3M95 A;  2MA9 B;  3QA8 A;  3CSF A;  4W9J A;  2MP2 A;  2I1K A;  4GMV A;  3AI5 A;  4W9I A;  3IFW B;  5G55 A;  4GGQ A;  4X57 B;  2KJ6 A;  1ISN A;  4NNJ B;  3L10 B;  2KJR A;  4GOC A;  3ZNH B;  4G0N B;  5LLI A;  3U8Z A;  2NCN A;  1YX6 B;  3PLV A;  3ZDM C;  4TKN A;  2LGD A;  3ONS A;  4AP4 C;  4AUQ C;  3S2A A;  3RYT A;  3VFK A;  3UIN B;  3QWZ B;  3O65 B;  1WJ6 A;  4A20 A;  4E74 A;  2IYD B;  2HE7 A;  1WF9 A;  3TBL D;  3QCA A;  4EKU A;  4KVG B;  2LRW A;  2ZCC A;  3AU4 A;  4E3C A;  2D10 A;  1Q0W B;  3EC8 A;  3DBL I;  2FCN A;  3IG3 A;  4ZDV A;  2MLB A;  2K6D B;  2MSE D;  5KHQ A;  2D11 A;  2MWS B;  4RM9 A;  5D6J B;  1LXD A;  5CTR C;  3Q3F A;  3OAW A;  3QC8 B;  4MM3 A;  2N1W A;  4W9G A;  3JSV B;  5J17 A;  1XD3 B;  3NZS A;  4GSW A;  4KZ0 A;  2RSU A;  4HDO A;  1GC6 A;  1V80 A;  4JIO U;  3L0W B;  2JWZ A;  2MP2 B;  2N1V A;  2BF8 B;  2MBH A;  2WDT B;  4K7W A;  3H7P B;  4FJZ A;  1OGW A;  2KAN A;  2GMI C;  4BKG A;  3KH0 A;  3WAN A;  4W9C A;  5D7G A;  3U30 A;  2M8S A;  2YVC A;  1E7V A;  2I1J A;  5D94 A;  4BKS D;  2KWU B;  4WWO A;  2JPH A;  2UYZ B;  3KUC B;  2K8C A;  1WE6 A;  2KJH B;  4DBG A;  1A5R A;  2Y5B B;  3PTF C;  3ZO5 B;  2WWZ A;  3HM6 X;  2KVR A;  4ANV A;  3LDZ E;  4MSQ B;  4HXD A;  4KZC A;  3I3T B;  3WAO A;  1YJ1 A;  4GXB A;  4A3P A;  3PHW B;  1IYF A;  2KC1 A;  2KC2 A;  4NQL B;  2NBU A;  3BY4 B;  4LJP B;  4ZRI A;  4BOS C;  2NPT B;  3A1Q A;  3ZRC A;  2KWV B;  3B1L X;  4BFR A;  2PE6 B;  3KYC D;  5JHA A;  3L54 A;  4WWP A;  3V60 A;  1IPG A;  2MW5 A;  3W1S A;  1WRD B;  4BVU C;  2MBE A;  3H7S A;  5D2M B;  3APC A;  3TMP B;  1J8C A;  4I6N B;  4EZL A;  3KYD D;  1WJ4 A;  4PS3 A;  3H1U A;  4OVU A;  4XZ4 A;  3H9D A;  4HCP B;  3ZTD A;  3A9J B;  4LDT D;  1UBI A;  4TUU A;  3ML8 A;  3ZNG C;  2Z0E B;  3HIZ A;  4W9L A;  2GBK A;  4FN2 A;  2KMC A;  1UH6 A;  2LVP A;  3UQB A;  1WR6 E;  3DVG X;  5DPT A;  2LXA A;  4CHK A;  4EFO A;  2KLG A;  3JW0 X;  5EDS A;  4MGZ E;  2LJ5 A;  1IP9 A;  2KX0 A;  3A1Q B;  5DCN A;  3V62 A;  4EOY A;  2LVQ A;  2JUO A;  2HJ8 A;  5AZF A;  1I35 A;  3TJP A;  3AUL A;  3QQ8 B;  3HM3 A;  1TBE A;  1WJU A;  1RRB A;  1E8Z A;  1WMH B;  2LZ6 A;  2CS4 A;  2MRP A;  5E6O A;  3RT3 B;  3DVN V;  2JRI B;  2LXC A;  3GOE A;  5CHF A;  2B3A A;  1T0Y A;  2DYO A;  3VUW A;  2MBB B;  3L08 A;  1WXM A;  2DAF A;  3OJ3 A;  2JVC A;  3AU5 A;  3ECI A;  3T8M A;  1WGY A;  1M94 A;  2GBJ A;  3IBE A;  1OEY A;  3NHE B;  2L05 A;  4JL9 A;  4F8C B;  1WFY A;  5JH5 C;  2N4F A;  2LAS A;  2C5L C;  2N7D A;  2Z0D B;  4TQ1 A;  2KK8 A;  3V6C B;  2XK5 A;  5AZH A;  2K25 A;  2QHO A;  5FR6 A;  1WGG A;  2J0M A;  2ZVO A;  4HPL B;  4IWQ A;  1WM3 A;  2JXX A;  2J0K A;  2PEA A;  3KUZ A;  4IUM B;  2N9P C;  2LWP A;  2M17 A;  2FIF A;  4ZRJ A;  1GJZ A;  3ZLZ A;  4EZJ A;  1E8X A;  3UIO B;  3DDC B;  2EMT A;  4II2 B;  2JF5 A;  4WWN A;  3PRE A;  5JZE B;  2GBN A;  4GN1 A;  4WJN A;  1E8Y A;  2J0J A;  4IM3 A;  4G11 A;  4ANU A;  2C7N B;  4B95 A;  3WIM A;  3RZW C;  2PPH A;  4YL8 A;  2IY0 B;  5CHW A;  2AYO B;  2L0T A;  4KIK A;  1WGH A;  4NPN A;  1BT0 A;  4XC2 A;  5E6N A;  4PYZ A;  1WXS A;  2DZI A;  5JHB A;  3PVL A;  4NAW A;  2KTF A;  4DHZ E;  3PRP B;  2XK5 B;  4BKT A;  3DCG A;  4HLE A;  5LXI B;  2KLC A;  3RUL A;  1PQS A;  2AEH A;  4B9K A;  4MJS A;  2HD5 B;  2DZK A;  1Z5S B;  5L83 A;  4F7Z A;  1EF5 A;  1OQY A;  4B6W A;  3AXC A;  2ZEQ A;  4ICV A;  1S1Q B;  2FID A;  1E7U A;  2ZJD A;  3PRZ A;  1P1A A;  2LGX A;  3HHM A;  2O6V A;  3PS6 A;  3P2B A;  1KOT A;  1AAR A;  3IVF A;  2O2V A;  4WJQ A;  3WA0 A;  1TTN A;  4MEM A;  1GUA B;  4GIV A;  2KTR A;  2NBW B;  3GZN I;  2IO0 B;  4KIK B;  4II3 B;  2BYE A;  3ZNI D;  4W9K A;  3RUI B;  3SDL C;  2N9E B;  4W9H A;  2CHZ A;  2L76 A;  4NAW B;  4AOF A;  4EUT A;  3K9O B;  1I42 A;  1WX9 A;  1UZX B;  3NY5 A;  4DHJ B;  3DQV A;  3NS8 A;  4IM0 A;  4DDI D;  2EMS A;  1V2Y A;  4HDQ A;  1KLV A;  2NR2 A;  3A4S C;  3MJW A;  3OJ4 B;  4KDI C;  3PGE A;  4MJS B;  4W9E A;  2J7Q B;  4HCN B;  1V5O A;  1YIW A;  1S3S G;  5CX3 A;  4ZYN A;  1P3Q U;  3HK0 A;  4DK5 A;  4XX5 A;  4FAD A;  3ZTC A;  1EO6 A;  2Z59 B;  5CHV C;  3WAM A;  4DHZ B;  2M1M A;  1K8R B;  2C7M B;  4WJP A;  1WX8 A;  1P9D U;  2DZM A;  2KDE B;  2GBM A;  3VH3 B;  3QIJ A;  3OLM D;  4GDK A;  4KV2 A;  2O2V B;  4WJO A;  1OEY J;  2G4S A;  3U7D A;  1D3Z A;  4CO7 A;  3KVF B;  3A33 B;  3PZD A;  2KTR B;  2BKF A;  2HTH A;  3WAP A;  2L3Z A;  3W1S C;  3H6N A;  4BBN C;  4K7S A;  2KDB A;  2KFK A;  2KXJ A;  2ZNV C;  3PHX B;  3JYU A;  3V6E B;  4E71 A;  3M3J A;  2VRR B;  2GOW A;  2BWE S;  2IBI B;  3QAR A;  3A9K A;  4KSL C;  4JGH B;  3QHT A;  3MHS D;  4HK2 A;  3VTU A;  3N3K B;  3R3M A;  3EEC A;  1V6E A;  2D07 B;  2KX3 A;  4JQW C;  2C60 A;  2KKC A;  1E5W A;  2ZVN A;  5G2N A;  2G3Q B;  2LI5 A;  5DPW A;  2L0F A;  4HWI B;  4JLC A;  2KQ7 A;  1SE9 A;  1NDD A;  2NVU I;  2KDI A;  4FBJ B;  3ZW3 A;  4WQO B;  2XEW A;  4DWF A;  1UD7 A;  3VUY A;  4LJO B;  2ZNV B;  1E90 A;  3KW5 B;  3CMM B;  3DOW A;  2CU1 A;  4W9F A;  3PV1 A;  3UGB B;  3K9P B;  4GDL A;  4DHJ D;  4G3X B;  1Q1O A;  4I6P A;  4GDK B;  2DAJ A;  4FLH A;  4W9D A;  2RGF A;  2RR9 A;  4PYU A;  4OVV A;  2K8B A;  3ZUN A;  2BYF A;  3VXW A;  4BKS A;  2GBR A;  1WI0 A;  4NJ7 A;  2G45 B;  2V3S A;  3B08 A;  3ZIM A;  2KFJ A;  4MGK E;  3EFU A;  3Q3J A;  3A9K B;  2KDF B;  1WGR A;  1P98 A;  3R7Q A;  3ZNZ B;  4KDL B;  1U4A A;  3DVG Y;  3D32 A;  4HVB A;  1C3T A;  4FJV B;  1OTR B;  1EUV B;  2AWT A;  5DPR A;  2ZPN A;  3PT2 B;  3VTV A;  1GNU A;  2FUH B;  2N9X A;  3IHP C;  2WX1 A;  4DDG D;  4PS8 A;  1V81 A;  4AJW A;  3SU8 X;  2JY6 A;  2KWC A;  4I6L B;  4NY0 A;  1JRU A;  2A4Z A;  3RD2 A;  1WZ0 A;  4K81 A;  2BKR B;  3N32 A;  1TZ1 A;  2LD9 A;  2UWQ A;  3M63 B;  3PPA A;  1WE7 A;  2K6Q A;  3RZF A;  5IA7 A;  5TR5 A;  3L13 A;  4IW0 A;  2JRH A;  2KOX A;  1H4R A;  2C7H A;  2FCM A;  5IAA C;  3VVW B;  4EZK A;  2D2Q A;  1MG8 A;  4IWO A;  1GC7 A;  1UBQ A;  3N30 A;  4AWJ A;  2MCN B;  3ML9 A;  4EEW A;  4TV3 A;  3W1Y A;  4MSM B;  2KZR A;  2K39 A;  3H7P A;  4URK A;  3M62 B;  5HKH A;  2D3G A;  1NI2 A;  4K7U A;  1WYW B;  2W9N A;  4BOZ B;  1SGH A;  4IM2 A;  4P7I A;  3SD5 A;  1L2N A;  1ZW7 A;  2NBV B;  5J18 A;  1HE8 A;  2A5U A;  1SIF A;  2ZCB A;  2G4D B;  3UIP B;  2R2Q A;  2KD0 A;  3L17 A;  3DBH I;  2DYB A;  2DEN B;  3TL5 A;  2ZZP B;  5C23 A;  3ZRF A;  1ZKH A;  3ZVV A;  1WJN A;  3UQA A;  5L95 C;  1J0G A;  3PSE B;  4DXA B;  3KUD B;  1QZE A;  3TCA A;  5C1Z A;  4FHJ A;  3QK0 A;  4MH0 E;  2CHW A;  4RM8 A;  1WR1 A;  2M4N A;  1KM7 A;  2MQJ A;  2KQS A;  2AL6 A;  3NZU A;  2NPT A;  2KO3 A;  4IG7 B;  4LDT B;  3QJZ A;  1FXT B;  3A4R A;  1YQB A;  2JZ3 B;  4F1S A;  2LUE A;  4ANX A;  4HPM B;  2LVO A;  5DPS A;  3ENE A;  1P0R A;  3L16 A;  4G50 A;  3WAL A;  1XQQ A;  1Z2M A;  3EHV A;  4RMA A;  3DBS A;  2PE9 A;  3RCZ A;  2LRU A;  2RPQ A;  1LFD A;  1VCB A;  3X0W A;  2C9W B;  1YD8 U;  4CYE A;  4FHK A;  1WM2 A;  1V86 A;  2IY1 B;  2IO2 B;  3A9J A;  2WX0 A;  1WGD A;  3PRM B;  1Y8R C;  2NS5 A;  1J19 A;  1GG3 A;  2O6V B;  2OOB B;  4NQK E;  2BPS A;  3JVZ X;  2DHZ A;  2BYV E;  4N9F 4;  1WXA A;  1YX5 B;  4AJY B;  4IC7 B;  3VHT C;  2CR5 A;  2L00 B;  1NBF C;  1VD2 A;  2ZPY A;  3LJ3 A;  3QX1 A;  4J6I A;  4NJ6 A;  2FAZ A;  2EKE C;  3BIN A;  2OJR A;  4K1R B;  4MGY E;  5GMV A;  5AZG A;  2BGF A;  1KJT A;  4IWP A;  3X23 A;  3UF8 A;  3R7R A;  1WIA A;  3DPD A; 
#chains in the Genus database with same CATH topology
 3HRD D;  2MBQ A;  1TS2 A;  2REX A;  3VUX A;  2FNJ B;  2FCQ A;  3U2S C;  1WX7 A;  3SHQ A;  4MAC A;  2V1Y A;  4PS7 A;  3OG5 A;  1MVK A;  2JZZ A;  1V5T A;  2R61 A;  1G6J A;  2Y3A A;  3PLU A;  1HEZ E;  4S0R A;  1MFW A;  4ASW C;  3EA6 A;  3IAM 1;  1WH3 A;  3L4P A;  5AEK B;  1EM7 A;  2KQ4 X;  2O6V D;  2PLP A;  2FCS A;  2SAK A;  4WQM A;  1MPE A;  1VDV A;  1V8C A;  1XT9 B;  2ACZ B;  3KWV A;  2OJW A;  3TEZ A;  4FJY A;  3TIX A;  1X1M A;  3VH4 B;  3ZKJ C;  2DX5 B;  3R66 C;  1LQB A;  5BO4 B;  2L8J A;  1ZGU B;  2IZV B;  1FM0 D;  3JSV A;  2JZP A;  3ZGZ A;  5J2R A;  4RGT A;  4RGN A;  2I1K A;  1YJI A;  2YEP F;  1STE A;  3MJ5 A;  2KJR A;  3ZNH B;  5LLI A;  3U8Z A;  3ZDM C;  1WRI A;  3VFK A;  2N7J A;  1QF6 A;  4M02 A;  2BB5 A;  2IYD B;  2HE7 A;  2VZK B;  4EKU A;  2WDQ B;  1E9M A;  2K6D B;  4A6Q A;  4RM9 A;  2N1W A;  2KAJ A;  3RFZ B;  3JSV B;  3EFC A;  2RSU A;  4JIO U;  3L0W B;  4K7W A;  5E6J A;  3WAN A;  4UDU C;  5D94 A;  4BKS D;  4S17 A;  1PUT A;  1NI3 A;  3KUC B;  1A5R A;  2KJH B;  4DBG A;  3ZO5 B;  2WWZ A;  3BYT B;  5GXG B;  3HM6 X;  2KVR A;  3LDZ E;  4MSQ B;  3I3T B;  2KC2 A;  2OHF A;  3RNE C;  3I63 C;  3KYC D;  1WRD B;  2WNM A;  2MBE A;  3H7S A;  4EZL A;  1YNT E;  5D3D A;  4PS3 A;  1ZPS A;  3P42 A;  4OVU A;  2JXT A;  2WLB A;  4XZ4 A;  4HCP B;  4XWW A;  2L83 A;  3AE5 B;  1FFU A;  4P16 A;  2BB6 A;  4W9L A;  2KMC A;  1UH6 A;  1WR6 E;  2LHE A;  3DVG X;  2NMQ A;  2LXA A;  4CHK A;  4EFO A;  5EDS A;  2LJ5 A;  5BMI A;  5DCN A;  5BYR A;  2GRI A;  2JUO A;  1SB3 C;  2WXF A;  3LYY A;  2KVZ A;  2D3C A;  1NEK B;  2MRP A;  3DVN V;  2JRI B;  2LXC A;  5CHF A;  3SFD B;  5HI1 A;  1M94 A;  4JL9 A;  3NHE B;  5JH5 C;  3Q8E A;  4TQ1 A;  2KK8 A;  2W3R A;  5FK9 C;  4US8 A;  4RGO S;  5FR6 A;  1JWU D;  3KUZ A;  3RNB C;  3UIO B;  2EMT A;  2INP E;  3GP7 A;  2GBN A;  5D3I B;  3RZW C;  2KMM A;  1NEN B;  4QAY A;  2PPH A;  3I57 A;  5CHW A;  1IBX B;  4KIK A;  1WGH A;  3ZYY X;  4XWT A;  1M4V A;  1T5X D;  3N1X C;  3PRP B;  4BKT A;  5LXI B;  4HRS A;  3RUL A;  5IN7 A;  2AEH A;  2HD5 B;  2DZK A;  1EF5 A;  2XN9 C;  2ZEQ A;  1K51 A;  1IUE A;  2ZJD A;  2LGX A;  3P2B A;  3IVF A;  2O2V A;  4WJQ A;  1XCQ L;  4MEM A;  2KTR A;  4KIK B;  1YQ4 B;  3EGR A;  1OFF A;  1TZO A;  3ETR A;  4W9H A;  1N60 A;  4AOF A;  1UZX B;  4IM0 A;  3NS1 A;  1KLV A;  4KDI C;  4W9E A;  3PGE A;  1KRH A;  1QKZ A;  3Q8C A;  1PGA A;  1ENF A;  2VZK D;  3BII D;  1EO6 A;  2Z59 B;  5CHV C;  3WAM A;  3C8Y A;  2M56 B;  1L6V A;  1J7C A;  1L0Y B;  4KV2 A;  4GDK A;  2INN E;  2O2V B;  1PYW D;  3KVF B;  3KQ4 A;  2KTR B;  2BKF A;  2HTH A;  3WAP A;  4K7S A;  5AUK A;  2ZNV C;  3V6E B;  2BS2 B;  4E71 A;  3M3J A;  3TEX A;  2GOW A;  2IBI B;  4JGH B;  3VTU A;  2FE8 A;  2QEJ C;  2KKC A;  1SE2 A;  2G3Q B;  2G9H D;  2LI5 A;  4JLC A;  2WHI A;  4K3C A;  2KDI A;  2QCZ A;  2WGS A;  3ZW3 A;  1UD7 A;  4LNO A;  3VUY A;  4EE2 A;  2CU1 A;  4W9F A;  2QIL A;  3PV1 A;  1MG4 A;  2K9X A;  4G3X B;  1NYQ A;  4GDK B;  4FLH A;  2RGF A;  4A55 A;  4PYU A;  3RN9 C;  3ZUN A;  2BYF A;  2WXG A;  1SJE D;  1WI0 A;  2V3S A;  1Q10 A;  3Q3J A;  3ZNZ B;  1YOV B;  4FJV B;  1OTR B;  2ZPN A;  4OHJ A;  1L6U A;  2IND C;  2FUH B;  5C3J B;  2J52 A;  1JRU A;  1K50 A;  2A4Z A;  2LD9 A;  3RZF A;  1WE7 A;  2WQY B;  1ET6 A;  1R4M B;  3BYY B;  2K5P A;  3RNF C;  1SE4 A;  3H7P A;  2D3G A;  1JQ4 A;  4K7U A;  4BOZ B;  2NBV B;  1J7A A;  1PGX A;  1SIF A;  5JXV A;  2ZCB A;  3UIP B;  2HTM E;  4REZ A;  2DYB A;  2CU3 A;  3DBH B;  2JYT A;  1QZE A;  3KUD B;  3TCA A;  1XO3 A;  2JU6 X;  4MH0 E;  2CHW A;  1A70 A;  1WR1 A;  2M4N A;  1KM7 A;  5H8Y E;  3NZU A;  2KO3 A;  1FXT B;  2QJL A;  4HPM B;  1FRD A;  3B9J A;  4G50 A;  2J4X A;  2LFI A;  3Q6B A;  3RCZ A;  1LFD A;  5G5G A;  4CYE A;  4FHK A;  1WM2 A;  1VZ8 A;  2IY1 B;  1WGD A;  1J19 A;  2O6V B;  2OOB B;  1GB1 A;  1TS3 A;  1WWT A;  5BYS A;  4AJY B;  1UGJ A;  4B0M A;  3TEY A;  4GLS C;  3AE7 B;  5TSS A;  2EKE C;  3Q3N C;  1SIJ A;  2PVO D;  4K1R B;  5GMV A;  1V1P A;  1JRO A;  2ONQ A;  3R7R A;  3T3O A;  1I35 A;  3DPD A;  1V49 A;  4N58 A;  1CMX B;  1WMH A;  2R2O A;  1UEL A;  3C0R B;  5LNK 1;  4FUL A;  3KWL A;  1BML C;  1C1Y B;  2E6X A;  2V4L A;  3RPF C;  3B0A A;  2M0X A;  5KHO A;  3TUO A;  3VQI A;  4M8N A;  4YTN B;  1BXT A;  2PJH A;  2K8H A;  3APD A;  3AH7 A;  1RFA A;  2CHX A;  3DBR B;  3MC8 A;  4J3O D;  1V1P B;  3Q8B A;  5LXH A;  1R4N B;  3W9C B;  3T9L A;  4US9 A;  4XYC A;  3P63 A;  1WGK A;  1T0S C;  2WXI A;  4NJC A;  2W54 A;  2KMA A;  1WXQ A;  3APF A;  1LM8 B;  3RMK C;  2MJ3 A;  3NOB A;  4M8M A;  1RWS A;  4GDL B;  3BVG A;  1L7Y A;  3AEA B;  1P7E A;  2L7R A;  1WZ3 A;  1JCK B;  2ZW0 A;  3M95 A;  3CSF A;  3IXS A;  2MHJ A;  1FXI A;  2WDR B;  2NTS A;  2QC8 A;  3RI7 C;  2ICI A;  1I4X A;  2BBC A;  2KT7 A;  1L5P A;  4TKN A;  2LGD A;  3ONS A;  2VH1 A;  1TY2 A;  3UIN B;  3QWZ B;  3O65 B;  1WJ6 A;  4KGR A;  5HG2 A;  3TBL D;  4ZHP A;  2ZCC A;  3BVM A;  3IG3 A;  3Q2A C;  4ZDV A;  2MSE D;  5T8I A;  3DBL B;  4M00 A;  3QC8 B;  5CTR C;  4DXG A;  4GSW A;  4KZ0 A;  2BF8 B;  4B0E A;  1FPY A;  4BZA A;  1QT9 A;  1C79 A;  2KAN A;  2QDF A;  4W9C A;  3U30 A;  2M8S A;  2YVC A;  2I1J A;  4HEA 1;  4WWO A;  2JPH A;  2K8C A;  1WE6 A;  2Y5B B;  3NUH B;  4HKQ A;  1LGR A;  3TEW A;  2GI9 A;  1JRP A;  3WAO A;  1YJ1 A;  4A3P A;  3PHW B;  1IYF A;  2KC1 A;  2NBU A;  3BY4 B;  4BOS C;  2NPT B;  2W82 A;  3B1L X;  3W5U B;  2MW5 A;  3FAH A;  5D2M B;  3APC A;  4YTP B;  3VR9 B;  4I6N B;  4WUR A;  3KYD D;  1WJ4 A;  3H1U A;  3H9D A;  3ZTD A;  1JAL A;  3ZNG C;  2WU5 B;  2AQ2 B;  4TUU A;  2Z0E B;  3Q8A A;  2JQR B;  4FN2 A;  1D5Z C;  3HUI A;  4ARC A;  4MGZ E;  1IP9 A;  1SEB D;  3P4P B;  5G5H A;  3AEG B;  1RRB A;  1E10 A;  2LZ6 A;  4C56 C;  3V05 A;  3GOE A;  1XLQ A;  2B3A A;  1T0R C;  2JYE A;  2DYO A;  3P4Q B;  3MP9 A;  3VUW A;  1HA5 A;  2V3P A;  1OEY A;  2L05 A;  4F8C B;  1WFY A;  2N7D A;  3V6C B;  2KWD A;  1ZUD 2;  2K25 A;  1WGG A;  2ZVO A;  4IWQ A;  1WM3 A;  2JXX A;  3AEC B;  1HZ6 A;  2FIF A;  2JF5 A;  4WJN A;  3R2I A;  1KFY B;  4OW0 A;  4G11 A;  3BZD B;  2C7N B;  3N9Y C;  3WCQ A;  3WIM A;  1FXA A;  2INC C;  2IY0 B;  1C4P A;  4N59 A;  2AYO B;  2WXO A;  1BT0 A;  4XC2 A;  4H2A A;  1WXS A;  3PZ8 A;  3PVL A;  3P1M A;  4P6V F;  4DHZ E;  3SR6 A;  2BQQ A;  3DCG A;  1PQS A;  4MJS A;  5IP4 D;  3FC4 A;  5L83 A;  2QIE B;  1OQY A;  1E0Z A;  3PO0 A;  2FID A;  1E7U A;  1C4C A;  3PS6 A;  1XEE A;  2NBW B;  3C19 A;  2H88 B;  4W9K A;  3SDL C;  3GZN B;  1TYG B;  1YMH E;  4LNK A;  2M19 A;  4LNI A;  4AQ7 A;  3NY5 A;  3DQV A;  3LB8 C;  1V2Y A;  2NR2 A;  3MJW A;  1GPX A;  4MJS B;  2J7Q B;  1YIW A;  1QOB A;  3HK0 A;  4DXF A;  2J42 A;  2C7M B;  4WJP A;  1P9D U;  3VH3 B;  3OLM D;  4WJO A;  2HDE A;  1D3Z A;  4CO7 A;  2L3Z A;  3W1S C;  2KDB A;  2KFK A;  5C2T B;  3J9C A;  3JYU A;  4OZB A;  2VRR B;  3QAR A;  3A9K A;  1HTO A;  2PMV A;  3EEC A;  3W2D A;  2D07 B;  4JQW C;  3HVD A;  1NDD A;  1JWS D;  4WQO B;  4DWF A;  4M0W A;  2LHD A;  3KW5 B;  3CMM B;  3DOW A;  1NVI D;  4DHJ D;  1CK1 A;  4I6P A;  4W9D A;  1B9R A;  4OVV A;  2CJN A;  3VXW A;  1SSN A;  2D3B A;  2KYW A;  2WXM A;  3A9K B;  4KDL B;  4KGS A;  1U4A A;  4RCO A;  4NZL B;  1ZE3 D;  4OZC A;  1PGB A;  2LEK A;  3SEB A;  3VTV A;  2GLS A;  2WX1 A;  4DDG D;  4PS8 A;  4PT5 A;  1V81 A;  4AJW A;  3SU8 X;  4I6L B;  4NY0 A;  2N9L A;  3RD2 A;  4K81 A;  3M63 B;  2K6Q A;  3H8H A;  2JRH A;  2KOX A;  2C7H A;  2FCM A;  5IAA C;  3NG0 A;  1MG8 A;  1GC7 A;  1UBQ A;  2BS4 B;  4AWJ A;  4EEW A;  4TV3 A;  4MSM B;  2K39 A;  2M0A A;  4A8X C;  4URK A;  1TKG A;  4C80 A;  2W9N A;  1SGH A;  2LJI A;  2K0P A;  4P7I A;  1R7S A;  1VRA B;  1HQR D;  2A5U A;  1T0Q C;  2IGH A;  3BVZ A;  2R2Q A;  2KD0 A;  3L17 A;  3DBH I;  2ZZP B;  3ZRF A;  2BT6 A;  1K53 A;  2DWQ A;  3UQA A;  5L95 C;  3PSE B;  1RYJ A;  4RM8 A;  4KKJ A;  2HJ1 A;  2MQJ A;  2KDM A;  2KQS A;  4OVZ A;  4ANX A;  4RH6 A;  1JWA D;  2LVO A;  1P0R A;  3L16 A;  1N61 A;  3EHV A;  4HJG E;  4RMA A;  2PE9 A;  2V9H A;  2Y5C A;  2RPQ A;  3FIL A;  2WS3 B;  3PZ7 A;  1V86 A;  5HFY A;  2IO2 B;  3A9J A;  4YSZ B;  4C7Y A;  1YX5 B;  4YTM B;  1I7H A;  3Q8F A;  4IC7 B;  2L00 B;  2ZPY A;  3LJ3 A;  3DHH C;  2WXQ A;  2OJR A;  1QOA A;  3FKY A;  2V0G A;  2EEL A;  3AMZ A;  1ACC A;  4FA6 A;  2YLM A;  3FIL B;  3AM9 A;  2N7E A;  2B76 B;  3IT6 B;  4GU2 A;  3GE8 C;  3MTN B;  1B1Z A;  1F9J A;  2JT4 B;  3AV8 A;  1C77 A;  2JX5 A;  4ZRK A;  2RDH A;  3DBR I;  4C7Z A;  4DQO C;  1L4Z B;  1VZ7 A;  4MEL A;  2ASQ A;  1TGZ B;  1R4N I;  2MBO A;  3CF6 E;  4A3O A;  4HJK A;  4L1B A;  1WSP A;  3V3X A;  2DZJ A;  1VJK A;  2WYQ A;  4ICU A;  2D3A A;  4KX6 B;  2E3T A;  2AL3 A;  1Q5W B;  1UWX A;  2IJ0 A;  4GB9 A;  3GB1 A;  4N6E B;  4BBN F;  4P1C C;  3IAS 1;  4MH8 A;  2XBB C;  3NVV A;  1RLF A;  1WXV A;  2WDV B;  3AE9 B;  3ALB A;  1WY8 A;  2DYM A;  5EE9 A;  4W9J A;  2PW9 A;  4JX1 C;  4GMV A;  4W9I A;  3AI5 A;  3IFW B;  4X57 B;  2KJ6 A;  5IKC M;  4GOC A;  2NCN A;  1YX6 B;  1TS4 A;  4AP4 C;  4ZHO A;  3S2A A;  1C78 A;  4A20 A;  3QCA A;  2LRW A;  3AU4 A;  4E3C A;  3DBL I;  2MLB A;  5KHQ A;  2D11 A;  1VZ6 A;  3R2T A;  5D6J B;  1LXD A;  4MM3 A;  4LNN A;  1XD3 B;  4USA A;  1KLG D;  4HDO A;  1V80 A;  3TSS A;  4XDC A;  2JWZ A;  1YN5 A;  2N1V A;  5BMG A;  2WDT B;  3H7P B;  4FJZ A;  2GMI C;  3VR8 B;  2IGG A;  2UYZ B;  5IO9 A;  1ZDX A;  3PTF C;  2RMM A;  4ANV A;  3Q69 A;  4MM3 B;  1XF5 L;  4GXB A;  2G1E A;  3SFE B;  2KWV B;  2WXK A;  4BFR A;  2PE6 B;  3DWG C;  3L54 A;  3V60 A;  3BK1 A;  3W1S A;  4BVU C;  1OQR A;  1D4B A;  2WP9 B;  1J8C A;  2QSD A;  3R8B A;  2JWU A;  3O13 A;  1UBI A;  4A9A A;  1C76 A;  2GBK A;  2LVP A;  3UQB A;  3P4R B;  1EWC A;  2KLG A;  4AS1 A;  2KX0 A;  3V62 A;  2LVQ A;  1KLU D;  4YT0 B;  3QQ8 B;  1WJU A;  3KLS X;  1WMH B;  2CS4 A;  4ZOH C;  5E6O A;  3RNA C;  4FXC A;  1DOY A;  2MBB B;  3OJ3 A;  1WXM A;  2DAF A;  4XE0 A;  2JVC A;  1ZOY B;  3AU5 A;  1WGY A;  3IBE A;  2Z0D B;  2C5L C;  3ZJT A;  5AZH A;  1C4A A;  2J0M A;  2WU2 B;  2DBY A;  3E9S A;  4RF0 A;  2J0K A;  1AWD A;  1AW7 A;  2N9K A;  2LWP A;  2M17 A;  1E8X A;  2BS3 B;  2EKI A;  5H92 C;  1JW9 D;  4II2 B;  5JZE B;  4GN1 A;  1FD6 A;  4IM3 A;  2H89 B;  4ANU A;  1CZP A;  1ET9 A;  1V97 A;  1FNU A;  5E6N A;  5FKA C;  2DZI A;  1XLO A;  4NAW A;  4HLE A;  2KLC A;  4B9K A;  1Z5S B;  2MJE A;  4LK0 M;  1VR9 A;  3AXC A;  4JWU C;  4ICV A;  3PRZ A;  1IGD A;  3DWM A;  3CIR B;  1F77 A;  1TTN A;  4GIV A;  1OQQ A;  3GZN I;  2IO0 B;  4IOI E;  2N9E B;  2CHZ A;  3E56 A;  2L76 A;  4NAW B;  3ZQ4 A;  4EUT A;  1I42 A;  1WX9 A;  4DHJ B;  4HDQ A;  3A4S C;  2I38 A;  2WXN A;  4HCN B;  1V5O A;  1S3S G;  5CX3 A;  3DHG C;  3ZTC A;  2I2Y A;  2GB1 A;  1FIQ A;  1UUP A;  2M1M A;  1K8R B;  1ZP0 B;  1WX8 A;  1MI0 A;  2WXP A;  1ZXI A;  2PVG C;  3QIJ A;  3U7D A;  1OEY J;  2G4S A;  1BUI C;  1FRR A;  3A33 B;  2TSS A;  3AEB B;  4BBN C;  3H6N A;  4LLG M;  2KXJ A;  2LGS A;  4RGM A;  4PK1 A;  4HRO A;  3QHT A;  4HK2 A;  1EWY C;  3R3M A;  1I4G A;  1V6E A;  2C60 A;  1E5W A;  5G2N A;  1KF6 B;  4TSS A;  5DPW A;  2NVU I;  1SE9 A;  1QOF A;  4FBJ B;  2XEW A;  4KKI A;  4LJO B;  2ZNV B;  2BTE A;  4XGA B;  3UGB B;  3K9P B;  1FO4 A;  2DNF A;  2BVC A;  3B2F A;  2GBR A;  2G45 B;  3B08 A;  2D5G A;  2KFJ A;  3EFU A;  4MGK E;  2KDF B;  3R7Q A;  3LXF A;  4O1N A;  1DGJ A;  3DVG Y;  2YEP B;  2AWT A;  5DPR A;  1L0V B;  4RF1 A;  1GNU A;  2N9X A;  3IHP C;  4WWM A;  4YWG G;  3NVW A;  1TY0 A;  1PFD A;  2KWC A;  4WIP A;  2BKR B;  1KTK A;  2UWQ A;  3VDZ A;  3PPA A;  1N5W A;  5TR5 A;  3N1Z C;  3L13 A;  1H4R A;  4EZK A;  3N20 C;  3N30 A;  2MCN B;  1L4D B;  3ML9 A;  3W1Y A;  2KZR A;  4ARI A;  3M62 B;  5HKH A;  1WYW B;  1L2N A;  1PDX A;  5J18 A;  1N62 A;  2G4D B;  3VRA B;  1QQR A;  2DEN B;  5C23 A;  1ZKH A;  3ZVV A;  2ZW1 A;  5C1Z A;  4YSX B;  3QK0 A;  3AE6 B;  1UWM A;  3AB5 A;  4LDT B;  3QJZ A;  1QIL A;  1YQB A;  2JZ3 B;  3AE3 B;  4F1S A;  2Q5W D;  5DPS A;  3ENE A;  1EU3 A;  2FUG 1;  2LRU A;  2ON8 A;  2Z8L A;  1N63 A;  1SE3 A;  1YD8 U;  1YQ3 B;  2WX0 A;  1F2R I;  1NYR A;  5FR3 A;  3ZJV A;  2BYV E;  1F0Z A;  3VHT C;  3AN1 A;  2CR5 A;  1CJE A;  1VD2 A;  3NVY A;  5EE3 A;  3BIN A;  2AX5 A;  4MGY E;  1TJE A;  4IWP A;  2W3S A;  3AEE B;  1IGC A;  4MT5 A;  4MDK E;  5E6P A;  2LGI A;  1FNV A;  1GB4 A;  4L2Y A;  4TQ0 A;  2K1F A;  3VTW A;  3ABV B;  2KN5 A;  4MGI E;  2IO3 B;  4HPP A;  3U4E G;  2MX2 A;  2X38 A;  1EF1 A;  5I4D A;  1UF0 A;  2KNB A;  3QAQ A;  3V61 A;  3GE3 C;  2KFK B;  2LUM A;  2RD0 A;  5IOI A;  3ZDT A;  4LCD E;  3VAW A;  1YN4 A;  2LGY A;  3DVN U;  2BWF A;  1SXT A;  1J7B A;  4LNF A;  4WAA A;  4KSK C;  1ZDV A;  2IO1 B;  1V9J A;  4R3D A;  2CKH B;  2QMT A;  1RAX A;  4L23 A;  4ANW A;  4M0W B;  1IBX A;  1E8W A;  2XNA C;  1TKY A;  1H8C A;  1UGM A;  2OED A;  1T6B X;  1F52 A;  3DHI C;  1R4M I;  1TIF A;  3CST A;  2KHW B;  1AYF A;  5MPO A;  2MJD A;  3QA8 A;  2MA9 B;  2MP2 A;  5G55 A;  3IT4 B;  1LO5 D;  2KN4 A;  4GGQ A;  4D2K A;  1ISN A;  4NNJ B;  3L10 B;  4G0N B;  1F1H A;  5EE0 A;  3ZXR A;  3PLV A;  4AUQ C;  2VH2 A;  3RYT A;  4E74 A;  1UNS A;  3OWE B;  1WF9 A;  2PTL A;  1TT5 B;  3BWU D;  4KVG B;  2D10 A;  1Q0W B;  3AEF B;  3EC8 A;  2FCN A;  2W55 A;  2MWS B;  4LTU A;  3Q3F A;  3OAW A;  4W9G A;  2FBW B;  5J17 A;  3NZS A;  2BYT A;  1GC6 A;  2MP2 B;  2MBH A;  1OGW A;  4BKG A;  3KH0 A;  4JE3 B;  5D7G A;  1E7V A;  3NZ3 A;  2KWU B;  1DYQ A;  1E6E B;  4A90 A;  3U52 E;  1N6Z A;  2KAC A;  1Y56 A;  1D6E C;  4HXD A;  4KZC A;  3I9V 1;  4Q2J A;  2SEB D;  1QOG A;  4NQL B;  4LJP B;  4ZRI A;  4ACF A;  3A1Q A;  3ZRC A;  4NAM A;  1KH0 A;  5JHA A;  4WWP A;  1IPG A;  2NTT A;  3TMP B;  3T3N A;  2DLB A;  4M01 A;  4BAX A;  1WYG A;  3A9J B;  4LDT D;  2IDY A;  3ML8 A;  3BK2 A;  2BW2 A;  3HIZ A;  1K52 A;  5DPT A;  2LMC A;  1XXG A;  4XDD A;  4RNA A;  3JW0 X;  1JWM D;  1GAQ B;  3A1Q B;  2K3U A;  4EOY A;  1SJH D;  2HJ8 A;  5AZF A;  2IPK D;  3TJP A;  3AUL A;  2L52 A;  3HM3 A;  1TBE A;  1E8Z A;  3RT3 B;  1D5X C;  3AE4 B;  1T0Y A;  3L08 A;  3P4S B;  5HHD G;  3AE1 B;  1FCC C;  3ECI A;  3T8M A;  2GBJ A;  5BMH A;  1ESF A;  2N4F A;  2LAS A;  2V4I B;  4IKG A;  2XK5 A;  2QHO A;  4HPL B;  2PEA A;  1I4Q A;  4IUM B;  2N9P C;  3EUB 2;  1I4P A;  4OZA A;  4ZRJ A;  1GJZ A;  1XCT L;  3ZLZ A;  4EZJ A;  1T3Q A;  3DDC B;  4WWN A;  3PRE A;  3RNG C;  1V1O A;  4WAF A;  1E8Y A;  2J0J A;  1YN3 A;  4B95 A;  4YL8 A;  2AQ3 B;  1FCL A;  2L0T A;  4NPN A;  1JWB D;  4PYZ A;  5JHB A;  2KTF A;  1I4R A;  2J53 A;  5AUI A;  2XK5 B;  4HKZ E;  4JPS A;  1CQV A;  3ZXV A;  1TS5 A;  1JML A;  2JSV X;  4K3B A;  4F7Z A;  3URY A;  4B6W A;  2L1A A;  4C4V A;  4IDI A;  3UI3 A;  1S1Q B;  1P1A A;  3HHM A;  4TMA B;  2O6V A;  3MC9 A;  3ZJU A;  1KOT A;  1AAR A;  3WA0 A;  1GUA B;  2MH7 A;  2WXR A;  4II3 B;  2BYE A;  5BYQ A;  3ZNI D;  3RUI B;  4CQN A;  3K9O B;  3B2G A;  3NS8 A;  1I4H A;  4DDI D;  2EMS A;  3OJ4 B;  1RM6 C;  3NJT A;  4ZYN A;  1P3Q U;  4DK5 A;  4XX5 A;  4FAD A;  4C4V B;  4ZYS A;  1SBB B;  4DHZ B;  1QLB B;  3U7Z A;  1XLP A;  2WXH A;  2DZM A;  2KDE B;  2GBM A;  1FMA D;  1HXY D;  3N1Y C;  4YXD B;  4YSY B;  3NVZ A;  3PZD A;  1ROE A;  1GOZ A;  2N0S B;  3PHX B;  4P1B C;  1XLN A;  2PIA A;  2BWE S;  4KSL C;  3MHS D;  3N3K B;  4ZRP A;  3W5V B;  1FNW A;  2KX3 A;  3I5J C;  2ZVN A;  2L0F A;  4HWI B;  2KQ7 A;  3HVZ A;  1E90 A;  2AQ1 B;  1TKE A;  4GDL A;  1Q1O A;  2DAJ A;  2RR9 A;  2K8B A;  1DOI A;  4BKS A;  3MFG A;  4NJ7 A;  3AE8 B;  3ZIM A;  3VRB B;  1L0X B;  1WGR A;  1P98 A;  1EU4 A;  3D32 A;  3Q14 C;  3Q3O C;  4HVB A;  1C3T A;  1HZ5 A;  1EUV B;  1MHH E;  3PT2 B;  2MEK A;  1VLB A;  3CWI A;  2JY6 A;  2L32 A;  1WZ0 A;  2WXL A;  3NRZ A;  3N32 A;  1TZ1 A;  1D5M C;  5IA7 A;  3AE2 B;  1DOX A;  1N5X A;  4IW0 A;  2RDB C;  3VVW B;  1YJJ A;  2D2Q A;  2Y5P A;  4IWO A;  2IGD A;  4ITK A;  4JWS C;  2V3N A;  3RNC C;  2PKO A;  2K22 A;  1E7P B;  1NI2 A;  2X8X X;  4IM2 A;  3SD5 A;  1ZW7 A;  1MJD A;  1HE8 A;  3MHZ A;  3TL5 A;  4RFB A;  4ZRQ A;  1WJN A;  1J0G A;  4DXA B;  4FHJ A;  1FEH A;  3Q3M C;  4C00 A;  2AL6 A;  2NPT A;  4IG7 B;  1MHX A;  3A4R A;  1F2R C;  5EE1 A;  1SF0 A;  3GS2 A;  2LUE A;  2CJO A;  2RPV A;  1XQQ A;  1Z2M A;  3WAL A;  3DBS A;  1FFV A;  1ZXH A;  1VCB A;  3X0W A;  2C9W B;  2RDG A;  1P7F A;  3PRM B;  1Y8R C;  1RFK A;  2UU7 A;  2NS5 A;  1HTQ A;  1GG3 A;  4KGT A;  4NQK E;  2BPS A;  3MC0 B;  3JVZ X;  2DHZ A;  4N9F 4;  1WXA A;  1NBF C;  3QX1 A;  4J6I A;  1AN8 A;  4NJ6 A;  2FAZ A;  1C9F A;  5AZG A;  2BGF A;  1KJT A;  3X23 A;  3UF8 A;  2WXJ A;  1WIA A;  3AED B;  4WH4 A; 
#chains in the Genus database with same CATH homology
 1V49 A;  4MDK E;  5E6P A;  1CMX B;  1WMH A;  2MBQ A;  1UEL A;  2R2O A;  3C0R B;  2REX A;  4TQ0 A;  4FUL A;  3VUX A;  2YLM A;  2FNJ B;  2FCQ A;  4FA6 A;  2K1F A;  2N7E A;  3VTW A;  1C1Y B;  1WX7 A;  2KN5 A;  2V4L A;  4MGI E;  2IO3 B;  3SHQ A;  4GU2 A;  2V1Y A;  3B0A A;  2M0X A;  3MTN B;  5KHO A;  3VQI A;  4PS7 A;  2MX2 A;  4M8N A;  1EF1 A;  2PJH A;  1F9J A;  2K8H A;  2JT4 B;  2KNB A;  3APD A;  3QAQ A;  3V61 A;  4ZRK A;  2JZZ A;  1V5T A;  3DBR I;  1G6J A;  1RFA A;  2KFK B;  2CHX A;  2RD0 A;  3PLU A;  4MEL A;  2ASQ A;  3ZDT A;  4LCD E;  4ASW C;  1TGZ B;  1R4N I;  2MBO A;  3CF6 E;  3VAW A;  4HJK A;  4A3O A;  2LGY A;  2DZJ A;  2WYQ A;  3DVN U;  4ICU A;  1WH3 A;  2BWF A;  5AEK B;  5LXH A;  4WAA A;  2O6V D;  2FCS A;  3T9L A;  4KSK C;  3VDZ A;  2AL3 A;  2IO1 B;  1Q5W B;  1V9J A;  1XT9 B;  4GB9 A;  2CKH B;  1RAX A;  4BBN F;  2KMA A;  4ANW A;  4FJY A;  4M0W B;  1E8W A;  3APF A;  1LM8 B;  3NOB A;  4M8M A;  2XBB C;  1X1M A;  3TIX A;  1H8C A;  1UGM A;  3VH4 B;  4GDL B;  3ZKJ C;  2DX5 B;  3R66 C;  1RLF A;  1WXV A;  1LQB A;  5BO4 B;  1R4M I;  1L7Y A;  3CST A;  2KHW B;  2L8J A;  1ZGU B;  2IZV B;  2L7R A;  1WZ3 A;  3JSV A;  3ALB A;  5J2R A;  1WY8 A;  2DYM A;  3M95 A;  2MA9 B;  3QA8 A;  3CSF A;  4W9J A;  2MP2 A;  2I1K A;  4GMV A;  3AI5 A;  4W9I A;  3IFW B;  5G55 A;  4GGQ A;  4X57 B;  2KJ6 A;  1ISN A;  4NNJ B;  3L10 B;  2KJR A;  4GOC A;  3ZNH B;  4G0N B;  5LLI A;  3U8Z A;  2NCN A;  1YX6 B;  3PLV A;  3ZDM C;  4TKN A;  2LGD A;  3ONS A;  4AP4 C;  4AUQ C;  3S2A A;  3RYT A;  3VFK A;  3UIN B;  3QWZ B;  3O65 B;  1WJ6 A;  4A20 A;  4E74 A;  2IYD B;  2HE7 A;  1WF9 A;  3TBL D;  3QCA A;  4EKU A;  4KVG B;  2LRW A;  2ZCC A;  3AU4 A;  4E3C A;  2D10 A;  1Q0W B;  3EC8 A;  3DBL I;  2FCN A;  3IG3 A;  4ZDV A;  2MLB A;  2K6D B;  2MSE D;  5KHQ A;  2D11 A;  2MWS B;  4RM9 A;  5D6J B;  1LXD A;  5CTR C;  3Q3F A;  3OAW A;  3QC8 B;  4MM3 A;  2N1W A;  4W9G A;  3JSV B;  5J17 A;  1XD3 B;  3NZS A;  4GSW A;  4KZ0 A;  2RSU A;  4HDO A;  1GC6 A;  1V80 A;  4JIO U;  3L0W B;  2JWZ A;  2MP2 B;  2N1V A;  2BF8 B;  2MBH A;  2WDT B;  4K7W A;  3H7P B;  4FJZ A;  1OGW A;  2KAN A;  2GMI C;  4BKG A;  3KH0 A;  3WAN A;  4W9C A;  5D7G A;  3U30 A;  2M8S A;  2YVC A;  1E7V A;  2I1J A;  5D94 A;  4BKS D;  2KWU B;  4WWO A;  2JPH A;  2UYZ B;  3KUC B;  2K8C A;  1WE6 A;  2KJH B;  4DBG A;  1A5R A;  2Y5B B;  3PTF C;  3ZO5 B;  2WWZ A;  3HM6 X;  2KVR A;  4ANV A;  3LDZ E;  4MSQ B;  4HXD A;  4KZC A;  3I3T B;  3WAO A;  1YJ1 A;  4GXB A;  4A3P A;  3PHW B;  1IYF A;  2KC1 A;  2KC2 A;  4NQL B;  2NBU A;  3BY4 B;  4LJP B;  4ZRI A;  4BOS C;  2NPT B;  3A1Q A;  3ZRC A;  2KWV B;  3B1L X;  4BFR A;  2PE6 B;  3KYC D;  5JHA A;  3L54 A;  4WWP A;  3V60 A;  1IPG A;  2MW5 A;  3W1S A;  1WRD B;  4BVU C;  2MBE A;  3H7S A;  5D2M B;  3APC A;  3TMP B;  1J8C A;  4I6N B;  4EZL A;  3KYD D;  1WJ4 A;  4PS3 A;  3H1U A;  4OVU A;  4XZ4 A;  3H9D A;  4HCP B;  3ZTD A;  3A9J B;  4LDT D;  1UBI A;  4TUU A;  3ML8 A;  3ZNG C;  2Z0E B;  3HIZ A;  4W9L A;  2GBK A;  4FN2 A;  2KMC A;  1UH6 A;  2LVP A;  3UQB A;  1WR6 E;  3DVG X;  5DPT A;  2LXA A;  4CHK A;  4EFO A;  2KLG A;  3JW0 X;  5EDS A;  4MGZ E;  2LJ5 A;  1IP9 A;  2KX0 A;  3A1Q B;  5DCN A;  3V62 A;  4EOY A;  2LVQ A;  2JUO A;  2HJ8 A;  5AZF A;  1I35 A;  3TJP A;  3AUL A;  3QQ8 B;  3HM3 A;  1TBE A;  1WJU A;  1RRB A;  1E8Z A;  1WMH B;  2LZ6 A;  2CS4 A;  2MRP A;  5E6O A;  3RT3 B;  3DVN V;  2JRI B;  2LXC A;  3GOE A;  5CHF A;  2B3A A;  1T0Y A;  2DYO A;  3VUW A;  2MBB B;  3L08 A;  1WXM A;  2DAF A;  3OJ3 A;  2JVC A;  3AU5 A;  3ECI A;  3T8M A;  1WGY A;  1M94 A;  2GBJ A;  3IBE A;  1OEY A;  3NHE B;  2L05 A;  4JL9 A;  4F8C B;  1WFY A;  5JH5 C;  2N4F A;  2LAS A;  2C5L C;  2N7D A;  2Z0D B;  4TQ1 A;  2KK8 A;  3V6C B;  2XK5 A;  5AZH A;  2K25 A;  2QHO A;  5FR6 A;  1WGG A;  2J0M A;  2ZVO A;  4HPL B;  4IWQ A;  1WM3 A;  2JXX A;  2J0K A;  2PEA A;  3KUZ A;  4IUM B;  2N9P C;  2LWP A;  2M17 A;  2FIF A;  4ZRJ A;  1GJZ A;  3ZLZ A;  4EZJ A;  1E8X A;  3UIO B;  3DDC B;  2EMT A;  4II2 B;  2JF5 A;  4WWN A;  3PRE A;  5JZE B;  2GBN A;  4GN1 A;  4WJN A;  1E8Y A;  2J0J A;  4IM3 A;  4G11 A;  4ANU A;  2C7N B;  4B95 A;  3WIM A;  3RZW C;  2PPH A;  4YL8 A;  2IY0 B;  5CHW A;  2AYO B;  2L0T A;  4KIK A;  1WGH A;  4NPN A;  1BT0 A;  4XC2 A;  5E6N A;  4PYZ A;  1WXS A;  2DZI A;  5JHB A;  3PVL A;  4NAW A;  2KTF A;  4DHZ E;  3PRP B;  2XK5 B;  4BKT A;  3DCG A;  4HLE A;  5LXI B;  2KLC A;  3RUL A;  1PQS A;  2AEH A;  4B9K A;  4MJS A;  2HD5 B;  2DZK A;  1Z5S B;  5L83 A;  4F7Z A;  1EF5 A;  1OQY A;  4B6W A;  3AXC A;  2ZEQ A;  4ICV A;  1S1Q B;  2FID A;  1E7U A;  2ZJD A;  3PRZ A;  1P1A A;  2LGX A;  3HHM A;  2O6V A;  3PS6 A;  3P2B A;  1KOT A;  1AAR A;  3IVF A;  2O2V A;  4WJQ A;  3WA0 A;  1TTN A;  4MEM A;  1GUA B;  4GIV A;  2KTR A;  2NBW B;  3GZN I;  2IO0 B;  4KIK B;  4II3 B;  2BYE A;  3ZNI D;  4W9K A;  3RUI B;  3SDL C;  2N9E B;  4W9H A;  2CHZ A;  2L76 A;  4NAW B;  4AOF A;  4EUT A;  3K9O B;  1I42 A;  1WX9 A;  1UZX B;  3NY5 A;  4DHJ B;  3DQV A;  3NS8 A;  4IM0 A;  4DDI D;  2EMS A;  1V2Y A;  4HDQ A;  1KLV A;  2NR2 A;  3A4S C;  3MJW A;  3OJ4 B;  4KDI C;  3PGE A;  4MJS B;  4W9E A;  2J7Q B;  4HCN B;  1V5O A;  1YIW A;  1S3S G;  5CX3 A;  4ZYN A;  1P3Q U;  3HK0 A;  4DK5 A;  4XX5 A;  4FAD A;  3ZTC A;  1EO6 A;  2Z59 B;  5CHV C;  3WAM A;  4DHZ B;  2M1M A;  1K8R B;  2C7M B;  4WJP A;  1WX8 A;  1P9D U;  2DZM A;  2KDE B;  2GBM A;  3VH3 B;  3QIJ A;  3OLM D;  4GDK A;  4KV2 A;  2O2V B;  4WJO A;  1OEY J;  2G4S A;  3U7D A;  1D3Z A;  4CO7 A;  3KVF B;  3A33 B;  3PZD A;  2KTR B;  2BKF A;  2HTH A;  3WAP A;  2L3Z A;  3W1S C;  3H6N A;  4BBN C;  4K7S A;  2KDB A;  2KFK A;  2KXJ A;  2ZNV C;  3PHX B;  3JYU A;  3V6E B;  4E71 A;  3M3J A;  2VRR B;  2GOW A;  2BWE S;  2IBI B;  3QAR A;  3A9K A;  4KSL C;  4JGH B;  3QHT A;  3MHS D;  4HK2 A;  3VTU A;  3N3K B;  3R3M A;  3EEC A;  1V6E A;  2D07 B;  2KX3 A;  4JQW C;  2C60 A;  2KKC A;  1E5W A;  2ZVN A;  5G2N A;  2G3Q B;  2LI5 A;  5DPW A;  2L0F A;  4HWI B;  4JLC A;  2KQ7 A;  1SE9 A;  1NDD A;  2NVU I;  2KDI A;  4FBJ B;  3ZW3 A;  4WQO B;  2XEW A;  4DWF A;  1UD7 A;  3VUY A;  4LJO B;  2ZNV B;  1E90 A;  3KW5 B;  3CMM B;  3DOW A;  2CU1 A;  4W9F A;  3PV1 A;  3UGB B;  3K9P B;  4GDL A;  4DHJ D;  4G3X B;  1Q1O A;  4I6P A;  4GDK B;  2DAJ A;  4FLH A;  4W9D A;  2RGF A;  2RR9 A;  4PYU A;  4OVV A;  2K8B A;  3ZUN A;  2BYF A;  3VXW A;  4BKS A;  2GBR A;  1WI0 A;  4NJ7 A;  2G45 B;  2V3S A;  3B08 A;  3ZIM A;  2KFJ A;  4MGK E;  3EFU A;  3Q3J A;  3A9K B;  2KDF B;  1WGR A;  1P98 A;  3R7Q A;  3ZNZ B;  4KDL B;  1U4A A;  3DVG Y;  3D32 A;  4HVB A;  1C3T A;  4FJV B;  1OTR B;  1EUV B;  2AWT A;  5DPR A;  2ZPN A;  3PT2 B;  3VTV A;  1GNU A;  2FUH B;  2N9X A;  3IHP C;  2WX1 A;  4DDG D;  4PS8 A;  1V81 A;  4AJW A;  3SU8 X;  2JY6 A;  2KWC A;  4I6L B;  4NY0 A;  1JRU A;  2A4Z A;  3RD2 A;  1WZ0 A;  4K81 A;  2BKR B;  3N32 A;  1TZ1 A;  2LD9 A;  2UWQ A;  3M63 B;  3PPA A;  1WE7 A;  2K6Q A;  3RZF A;  5IA7 A;  5TR5 A;  3L13 A;  4IW0 A;  2JRH A;  2KOX A;  1H4R A;  2C7H A;  2FCM A;  5IAA C;  3VVW B;  4EZK A;  2D2Q A;  1MG8 A;  4IWO A;  1GC7 A;  1UBQ A;  3N30 A;  4AWJ A;  2MCN B;  3ML9 A;  4EEW A;  4TV3 A;  3W1Y A;  4MSM B;  2KZR A;  2K39 A;  3H7P A;  4URK A;  3M62 B;  5HKH A;  2D3G A;  1NI2 A;  4K7U A;  1WYW B;  2W9N A;  4BOZ B;  1SGH A;  4IM2 A;  4P7I A;  3SD5 A;  1L2N A;  1ZW7 A;  2NBV B;  5J18 A;  1HE8 A;  2A5U A;  1SIF A;  2ZCB A;  2G4D B;  3UIP B;  2R2Q A;  2KD0 A;  3L17 A;  3DBH I;  2DYB A;  2DEN B;  3TL5 A;  2ZZP B;  5C23 A;  3ZRF A;  1ZKH A;  3ZVV A;  1WJN A;  3UQA A;  5L95 C;  1J0G A;  3PSE B;  4DXA B;  3KUD B;  1QZE A;  3TCA A;  5C1Z A;  4FHJ A;  3QK0 A;  4MH0 E;  2CHW A;  4RM8 A;  1WR1 A;  2M4N A;  1KM7 A;  2MQJ A;  2KQS A;  2AL6 A;  3NZU A;  2NPT A;  2KO3 A;  4IG7 B;  4LDT B;  3QJZ A;  1FXT B;  3A4R A;  1YQB A;  2JZ3 B;  4F1S A;  2LUE A;  4ANX A;  4HPM B;  2LVO A;  5DPS A;  3ENE A;  1P0R A;  3L16 A;  4G50 A;  3WAL A;  1XQQ A;  1Z2M A;  3EHV A;  4RMA A;  3DBS A;  2PE9 A;  3RCZ A;  2LRU A;  2RPQ A;  1LFD A;  1VCB A;  3X0W A;  2C9W B;  1YD8 U;  4CYE A;  4FHK A;  1WM2 A;  1V86 A;  2IY1 B;  2IO2 B;  3A9J A;  2WX0 A;  1WGD A;  3PRM B;  1Y8R C;  2NS5 A;  1J19 A;  1GG3 A;  2O6V B;  2OOB B;  4NQK E;  2BPS A;  3JVZ X;  2DHZ A;  2BYV E;  4N9F 4;  1WXA A;  1YX5 B;  4AJY B;  4IC7 B;  3VHT C;  2CR5 A;  2L00 B;  1NBF C;  1VD2 A;  2ZPY A;  3LJ3 A;  3QX1 A;  4J6I A;  4NJ6 A;  2FAZ A;  2EKE C;  3BIN A;  2OJR A;  4K1R B;  4MGY E;  5GMV A;  5AZG A;  2BGF A;  1KJT A;  4IWP A;  3X23 A;  3UF8 A;  3R7R A;  1WIA A;  3DPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...