1P99A

1.7a crystal structure of protein pg110 from staphylococcus aureus
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
255
structure length
255
Chain Sequence
KVTIGVASNDTKAWEKVKELAKKDDIDVEIKHFSDYNLPNKALNDGDIDMNAFQHFAFLDQYKKAHKGTKISALSTTVLAPLGIYSDKIKDVKKVKDGAKVVIPNDVSNQARALKLLEAAGLIKLKKDFGLAGTVKDITSNPKHLKITAVDAQQTARALSDVDIAVINNGVATKAGKDPKNDPIFLEKSNSDAVKPYINIVAVNDKDLDNKTYAKIVELYHSKEAQKALQEDVKDGEKPVNLSKDEIKAIETSLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The membrane-associated lipoprotein-9 GmpC from Staphylococcus aureus binds the dipeptide GlyMet via side chain interactions.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein PG110
total genus 82
structure length 255
sequence length 255
ec nomenclature
pdb deposition date 2003-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03180 Lipoprotein_9 NLPA lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1p99A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1p99A02
1LGBC 5LOMA 4HCWA 4GVOA 2X7QA 1UIVA 2O1LA 3C35A 4Q5TA 1QULA 4N07A 4NE4A 3CIJA 3SEYA 4ELQA 3IX1A 2OZZA 4ZEIA 2FA7A 4QFKA 4F39A 4FEBA 4QFLA 4JB7A 1MG1A 2DE2A 1Y20A 2O7UA 4EF1A 1FTOA 2I48A 3H6WA 4IO6A 1FQCA 3C4MA 5DT6A 4C1TA 4IY5A 4ESXA 3H3GA 2V3QA 3SEVA 3QSLA 3TODA 4QHQA 4XKRA 5CI5A 1PB7A 3LSFB 3FJ7A 3RN8A 1QUJA 3L6HA 2IEEA 2Z22A 3P7IA 1OVBA 2HEUA 3K2DA 3MWBA 3RTFB 1H44A 1B05A 5ISUA 3GLBA 1FTKA 5J1DA 1Y3PA 2O68A 3GZGA 4OYVA 3HO7A 2DP8A 5EYFA 3B6TA 2YPNA 3PGFA 1WODA 3HHFA 2XXHA 4BDMA 1GVCA 1LBBA 2VHAA 2XXXA 4PE5B 4IO3A 3TKDA 1XC1A 5AA2A 3U92A 2OJTA 1OVTA 1TT1A 1MH3A 1YTVA 3H6UA 3TCFA 2DYXA 1FQEA 3SETA 1SBPA 3TCHA 1QVSA 5FTHA 1USYE 2OWTA 3A09A 4GOTA 1BLFA 3MZBA 4EXLA 1B0HA 3V5AA 4Q0CA 4G68B 1M5CA 1B4HA 1MY2A 2I6EA 2ONKE 3MBPA 3K1PA 4PP0A 3SEUA 4IO4A 4QFNA 1QJMA 3THIA 1B7ZA 3MZ1A 4G68A 4RPOA 4YKPA 3TTKA 3H7MA 2ANJA 1MQJA 5DVFA 3U1OA 1B4ZA 1Y3QA 2AL5A 4Z0IA 1EH3A 1URGA 2QS1A 5HM4B 4AB6A 4LZ7A 1TFDA 5I59A 3OENA 1UTHB 2AYSA 4NF8A 5K2XA 3T93B 1O63A 1TXFA 4QSCA 1N3WA 3QUFA 4F1UA 4F2QA 5F7VA 5CMKA 1ZIUA 4OENA 4NF8B 5FHOA 1II5A 2VD2A 2YLNA 4NMYA 3WAFA 1J1NA 4RY1A 3TPAA 1LSTA 2B3FA 3T66A 4LATA 2RINA 3G3FA 3N5LA 4LVQA 4FATA 2NOOA 4RJZA 5TP9A 1B6HA 2DE3A 4OFJA 2LAOA 1N3XA 3OD7A 2QS3A 3IR1A 4GQOA 1NNPA 3KOTA 3K00A 1MY4A 1WDNA 1UTBB 4OERA 3K6VA 4RK9A 3PPPA 4THIA 4OMBA 3FV2A 4HW8A 4N6PA 5CMBA 4RK2A 2CZLA 2UVHA 1MH4A 2ALUA 3TDJA 4DCYA 5IKBA 3IJOB 4R72A 5I56B 1B52A 3D4GA 4ZEDA 4WEDA 4RPNA 3T9UA 3PMVA 3VDFA 1RKMA 1KWHA 1D4NA 3CFZA 1USYH 2ESNA 3PD9A 1B5IA 3TYHA 2ZMBA 4M4GA 1XT8A 4U2RA 1AOVA 3U94A 2M8CA 3FVOA 2XXWA 4RA1A 2XHDA 3GBAA 1IITA 4LP2B 2Q2CA 1PB9A 3EN3A 3MPLA 1Y1MA 4QSEA 1B1XA 4XKQA 4YB6A 1SVXB 3O6HA 1B0LA 2AIXA 2VGQA 5IAIA 4HTGA 4GFRA 4R2FA 1NFTA 3W9VA 5L9MA 3C33A 3EHTA 3LSWA 2B3BA 1POTA 2DS9A 3ZKLA 1IXGA 5I2NA 5KCJB 1JVXA 3S9LC 3D4CA 4DDDA 5CM6A 2DVCA 3OXNA 1JNFA 1OLAA 2V3UA 3PU5A 4G77A 4FAJA 1ELJA 2G93A 3I3VA 3IORA 2XXPA 1B2HA 2DWHA 1O64A 2HFBA 3FUZA 3IOWA 1Y9UA 4IO2A 2H5YA 4POXA 3U72A 3ONMA 2ONRA 2O84X 3PUYE 4PFWA 3TTNA 3ILTB 4LONB 3OOAA 2HAVA 3H06B 4OVJA 2YJPA 3IJXB 4YKKA 1N0TA 2QL3A 2ZYKA 1M5DA 1P1UA 4O3BA 3SERA 4FECA 4GWOA 3PPOA 1MPBA 3USDA 5A5XA 1PEBA 3EQ1A 1DSNA 1BP5A 1IUDA 1MY1A 4KCCA 3PUXE 2XX7A 3TAJA 4F19A 2RCBA 4GRKA 3TEPA 2ONSA 3T9HB 1GTKA 3UIFA 1MDQA 2ZYMA 4ESWA 2XXIA 1XOCA 3O28A 4HS7A 3O6GA 4O3CA 5DEXA 2QPQA 3I6VA 4JWYA 1N7XA 4ND9A 3TZAA 4YMAA 2NUVA 3TUSA 1D9YA 1B9JA 1YPNA 4YICA 3ZSFA 3ODBA 3SKPA 3OEMA 5H8HA 3UGWA 2Y7KA 3KJTA 1MQDA 2PMSA 3RT8A 1PBQA 3G3JA 3TTRA 3MVZA 4F22A 1MXZA 5H8HB 3IAZA 3IL1B 2Q9TA 1FTLA 2RCAA 3S2VA 4G8MA 3MQ9A 2F78A 1US5A 3OSRA 1OMPA 2I0CA 4JWXA 2QSXA 4IY6A 5CBRA 4G68C 1NKXA 3B6WA 4WKMA 4NF5A 4PQJA 5KDTA 3N6TA 2V93A 4GIZA 5ITOA 2F97A 2PX1A 5H8FB 5BUUA 4OHNA 3MPKA 4U22A 3JYRA 4LQ2A 1JW1A 1NH8A 3K1MA 4EQBA 4PFUA 5AA4B 3G7WA 1B7UA 1FTMA 4OETA 4OXVA 3V83A 1P1NA 3I5OA 4NF6B 1H76A 2H9BA 3OO9A 4GF8A 3KBRA 4R6YA 4KPTA 4GXSB 3PPQA 4RXLA 2REJA 2W7YA 3IK6B 3T9XB 3DELB 3JV9A 3DP8A 4NF6A 4NF4B 4KFQA 4JWOA 4FIMA 3DM0A 2RC7A 2E0SA 2KLFA 2QMXA 4ZS9A 3RY3A 1H3DA 1URDA 3E9XA 4KYSA 4NF4A 3CRBA 4OZ9A 4I9DA 3R7XA 4LQ5A 4P0IA 3UN6A 5I84A 1A8EA 1QW0A 3OO7A 5TPAB 3SESA 4EXKA 5AE4A 1AH5A 4GD5A 4JDFA 3PPNA 2X7PA 4QFOA 1FQFA 2XXQA 3HSTA 2Q8JA 1SW5A 1LBCA 3IOTA 2I4BA 3K01A 2Q88A 2R6GE 5DTBA 1SW4A 3Q27A 4GL0A 2A5TA 3E4RA 3ILUB 4IO7A 4R74A 2F7BA 4U23A 5F1QA 1B40A 1DTGA 4R9FA 4DIGA 2FNCA 4IGRA 2F34A 2O51A 2V84A 2Y7WA 3FXQA 4AB5A 1EZ9A 1FQBA 1WVJA 3KSXA 3OO6A 4XTCQ 3FVGA 5AA1A 2F6PA 4F3GA 3VVDA 4DLDA 3WAEA 5KZTA 1MPDA 4H8JA 4QF9A 1CE2A 1JETA 1R1NA 3L6GA 3MP6A 3VVEA 2XD2A 1XVYA 4ELRA 5I58A 3SDFA 2I49A 3FATA 2O7IA 3K02A 3K6XA 5HBCA 3OEKA 3KZGA 4I1DA 4U1OA 2RC8A 2XD3A 4UA8A 4E0XA 3TFLA 3EF7A 3KSJA 1A7LA 1IEJA 3R6UA 1LB9A 1LLSA 2FYIA 3DLNA 4ZEKA 3O29A 3B6QA 3MVXA 4DZ1A 1BKAA 1GR2A 3FV1A 3G3IA 1RYXA 2V25A 1ZMGA 1LAGE 1PB8A 1XS5A 4FE8A 4ZE8A 4N13A 4H8IA 2H25A 4OQOA 1A54A 3H03A 3KJ7A 2IA4A 4UACA 3RGYA 4OWDA 3HPIA 1AMFA 3LSLA 2Y7IA 5AA2D 1A99A 2I3WA 1PC3A 4Q8RA 3DP6A 2I4CA 1T0KA 1JEUA 4ELOA 2REGA 1ANFA 1FW0A 2VOZA 2HQ0A 3E13X 3BKIB 4FEDA 1L5TA 3SEXA 2D21A 3QK6A 3C32A 1BTJA 4KR5A 4OTEA 1B58A 4EQ7A 3A3CA 3QYTA 1S7YA 2UVGA 2HAUA 4Z7EA 4H6DA 5TU0A 2HCAA 1IXCA 2O1MA 3FGSA 4H65A 2CMOA 4U1ZA 1AL3A 3O9PA 1DPEA 4KYEA 4KD5A 2DVZA 4I62A 1SW2A 1TFAA 2XX9A 2QS2A 3S4UA 5ICTA 2WKYA 5KDTB 3PUZE 3PV0E 1LCTA 1VSOA 2B65A 3KEIA 1IXIA 1A8FA 3O6IA 1B1HA 3PUWE 3SEWA 4R9GA 1I6AA 1IQ7A 2V3TA 3M8UA 4JSOA 4EUOA 1DTZA 3MP8A 1MXUA 1EZOA 1CB6A 4YKIA 1MXYA 3CG3A 5CC2A 3TTLA 4OESA 3FD3A 1R6ZA 1EZPA 1MQHA 4QSDA 4ZDMA 3ZKKA 1DPPA 1FCKA 5B70A 3OMBA 3KGCA 3T9VA 2GFEA 2XXUA 3FIRA 4NF5B 1NNFA 1OLCA 3UORA 1LAXA 2OK2A 1B46A 4MLQA 4PETA 4KYDA 5CMMA 3HV1A 4NWDA 4R6KA 2HZLA 2DXYA 4HCYA 4OEVA 4DCXA 4TQUQ 5I57B 1AIVA 5AA2B 2Y84A 3C36A 3N6UA 2HZKA 1SYHA 2XXRA 2F35A 4R6HA 2X26A 4F2OA 3N26A 1A55A 2DOJA 3VXCA 1LCFA 1QKAA 1I69A 1MDP1 4ELPA 1H43A 4MF3A 4K3FA 3TCGA 3S9EA 4O3AA 3MVYA 2RF1A 4X1DA 5EHSA 3W9WA 5I59B 4G4PA 3TQWA 3HN0A 4BDNA 4WEPA 3CFLA 4H67A 3IB2A 3TQLA 4JXIA 4F3SA 3V8XB 2Z8DA 3QUJA 2P2AA 1YAEA 4H5FA 1PBPA 4MFIA 4H5GA 3V89B 4TLLB 3LSXA 1P1OA 3KN7A 5BWJA 3PD8A 4IGTA 3EPEA 3G3KA 3H4ZA 2PT1A 3MP1A 4ZZEA 3QIMA 4U21A 3RNNA 2F36A 1ZU0A 2P1SA 3F11A 3AXFA 4MH5A 5CMCA 4GL8A 5JTYA 3CR9A 4PFTA 2Z23A 4F29A 3S9NC 1VE4A 4LUBA 4YKJA 1MXVA 5H8QA 5JK4A 1SI1A 2GHBA 2PT2A 4OFOA 1NNKA 1A40A 2D5WA 1JEVA 2VP1A 4L17A 3Q28A 5HPQA 4KCDA 2DWAA 2XXYA 4FORA 5DVIA 5FHNA 4X1BA 2GH9A 2ZYOA 3M3LA 3U8QA 5I56A 1OQGA 3PMXA 4F3BA 3K0VA 1H45A 1B3GA 5CRYA 4DXBA 1RYOA 1ATGA 2BJJX 5ICQA 4NEDA 1FQDA 4BDOA 4F3PA 3QAXA 2RC9A 1ZJLA 1NMUA 1LAHE 5ITPA 5K2YA 3R26A 2F5XA 1JW5A 4GXAA 1I6QA 1N76A 1N7WA 2DWJA 2F8DA 3C34A 4KI0E 1R9QA 3FXUA 1ZLQA 5AA3A 1FTJA 4F1VA 3H6VA 1QKBA 1IXHA 1IZ1A 1ZTYA 1MRPA 4KQPA 4U4XA 1P1WA 1B5JA 4X48A 2NWJA 3RLFE 2AL4A 1VR5A 2NVUB 2DWIA 2F7CA 2Q89A 3MW0A 3CG1A 4G2ZA 5I2KB 4ZZAA 3RPWA 1NH7A 1LFGA 5KCJA 1B3EA 4P0GA 4TLMB 3TTMA 3FASA 4RYAA 1MY0A 1MM7A 1Y3NA 2F7AA 2I0BA 3FZVA 1SDXA 4YB5A 1GGGA 2QS4A 3C9HA 2ZNUA 4OFLA 3K1NA 4DXCA 5B7DA 1QUKA 1B51A 3KFMA 4G8HA 1Z7ME 2UVJA 2HXWA 3GBBA 1NL5A 3KN3A 1HSLA 3LR1A 1OQHA 4ONYA 2THIA 1VFDA 3IOUA 2NXOA 4LA9A 3MAMA 2D3IA 4YAHX 4BDQA 2ZNTA 3TMGA 1GV8A 1R9LA 4DE8A 2PBWA 3JZJA 5DEXB 3VFJA 1HSEA 5A5XB 1SYIA 3S9MC 2H4IA 1B7HA 3O97A 1MQIA 1POY1 1QUIA 1P1QA 4GLIA 3Q25A 3MUQA 4IB2A 4XKNA 1M5FA 5L9OA 1MS7A 1NNTA 2H98A 2OBGA 4KHZE 2R71A 3IO4A 1US4A 1LFHA 3ECRA 1TWYA 3U93A 4ISUA 5FTIA 1B5HA 2XXTA 3IB1A 1UIUA 4MLVA 3RQTA 1Y4CA 4Q30B 3RUMA 3QXMA 5JEIA 2ABHA 1I6BA 1O7TA 2UVIA 2ZNSA 4XKPA 5ELVA 5DVJA 4LZ5A 3VLUA 3C31A 3BBRA 4NTLA 4EDPA 2I58A 3MC2A 5DYHA 4F1YA 2PYYA 3UP9A 3CFXA 2F6GA 3UA8A 5H8FA 4X9TA 3RT6B 1M5BA 2OWSA 4C1UA 3M3FA 1M5EA 1UQWA 1MY3A 1Q35A 4ZEBA 4XIGQ 2Z8EA 4QFPA 3FJGA 3HHGA 3KOSA 3G3HA 3UK4A 3VLVA 2OCUA 4P11A 3VVFA 5I57A 2VD3A 4DXUA 1SQYA 1XHYA 2XXVA 1S9TA 2QJEA 4R75A 1YCJA 3GXAA 5AA4A 1Z7NE 1UTHA 3CSGA 4EF2A 5I58B 2GHAA 1ZKBA 4JBZA 5H8SA 4XXUA 3VV5A 2PVUA 2DQVA 2UYFA 1DMBA 3EHUA 4YZZA 4QRZA 5TPAA 3H6TA 3FJMA 4LZ8A 3W15C 1URSA 3OO8A 4R73A 2RKMA 3KN8A 4BDLA 4BDRA 1N84A 2OLBA 3LUYA 3LBSA 4JSDA 4WXJA 3A3UA 1JVYA 4OEUA 1Y4TA 3MJNA 4PFYA 1IIWA 4F31B 1LFIA 1EU8A 1MM6A 1MXWA 5M2VA 2ZYNA 3LC8A 1B32A 3K6WA 1MXXA 2A5SA 2UXAA 5H8NA 4RNSA 1D3KA 3PUVE 2QRYA 5L8DA 3BFTA 1JQFA 5JTYB 5CBSA 3MZ9A 4U4SA 2QMWA 5TP9B 4C0RA 5H8NB 4ECFA 4POWA 2R9JA 1DOTA 4E0WA 2Z8FA 1VFEA 2H99A 1XVXA 4MBPA 5H8QB 3O2AA 1LAFE 3RTWB 4NWCA 3TELA 2Y7PA 1F9BA 4EQ9A 2A5TB 3PPRA 3CSBA 5EHMA 2DSFA 3K6UA 3CVGA 4M1VA 1P99A 1UTBA 5FHMA 2O69A 3IOVA 3BFUA 3FXRA 2P0SA 2GRVA 4F18A 4AQ4A 4H0WA 1D9VA 1JW4A 2I3VA 3T22A 3E3KA 3IO6A 3K4UA 3M3KA 3IB0A 3OSQA 3VE1B 1S50A 2XX8A 3N94A 1SD3A 1MQGA 3KG2A 1PDAA 2Y7RA 2G29A 3O66A 3B7DA 4YMBA 1ZBMA 1B3FA 2DE4A 3Q29A 4I8CA 4ZEFA 3VLWA 3VXBA 3T96B 3OELA 4G8NA 1B3HA 1N04A 2ZXTA 5L9SA 1B3LA 4ZECA 1MPCA 1Y1ZA 4H1XA 5I2KA 3FVNA 2O6AA 2Q2AA 3DP4A 3Q26A 3G3GA 4IO5A 3FVKA 3MVWA 4FJPA 4R2BA 1BIYA 2DXRA 2UYEA 3CI8A 3EHSA 3PMWA 5I2NB 1OIBA 4BLAA 4ZE9A 3ZS6A 4TOZA 4YU0A 4YB7A 1SW1A 1LB8A 1HSJA 3HCQA 1FQAA 2E1SA 1Q1KA 1SI0A
chains in the Genus database with same CATH superfamily
4HCWA 1UIVA 2O1LA 3CIJA 2OZZA 4F39A 4JB7A 2DE2A 1FRPA 2QVVA 1FQCA 5DT6A 2VT5A 4PGPA 3LSFB 3RY3A 2IEEA 2HEUA 3MWBA 5J1DA 1Y3PA 4MNIA 2DP8A 3B6TA 4HE0A 5AA2A 4IO3A 1XC1A 2XWIA 4X04A 2KR0A 4OVQA 3SETA 3EKIA 5FTHA 4Q0CA 4G68B 3SEUA 3THIA 4UABA 3H7MA 1MQJA 1B4ZA 1URGA 4NF8A 1O63A 1TXFA 4QSCA 5CMKA 1II5A 3TPAA 4LATA 1KZ8A 5LTCA 4LVQA 2NOOA 2DE3A 4OFJA 2LAOA 3IR1A 1FPGA 3K00A 1MY4A 4RK9A 4THIA 3FV2A 3IJOB 4RPNA 3T9UA 3VDFA 3CFZA 1KWHA 1D4NA 4U2RA 1AOVA 3FVOA 3EN3A 4YB6A 4MJOA 1B1XA 1SVXB 2VGQA 4HTGA 3W9VA 5L9MA 2DS9A 3ZKLA 5I2NA 1JVXA 1JNFA 1ELJA 3I3VA 4C1TA 3IORA 3IOWA 2HFBA 3FUZA 1Y9UA 2H5YA 3PUYE 2QL3A 4O3BA 4FECA 1DSNA 1BP5A 4F19A 3PUXE 3TAJA 4GRKA 3T9HB 1MDQA 1XOCA 4O3CA 4ND9A 3TUSA 1D9YA 1YPNA 3SKPA 5H8HA 2Y7KA 1PBQA 4F22A 1MXZA 4PGNA 2QVRA 1US5A 2I0CA 4JWXA 2QSXA 4IY6A 1NKXA 4GX6A 5KDTA 3N6TA 2F97A 4U22A 1JW1A 4OETA 1B7UA 4OXVA 3V83A 3I5OA 4NF6B 4GXSB 3IK6B 3T9XB 1LEVA 2QMXA 3T0JA 4I9DA 1Q9DA 2X7PA 3IOTA 2I4BA 2Q88A 3E4RA 3ILUB 4DIGA 2F34A 2Y7WA 2F3BA 3KSXA 1FTAA 4MEVA 3WAEA 3VVEA 1R1NA 3L6GA 2XD2A 1XVYA 2I49A 2MKZA 3OEKA 4I1DA 1LLSA 3DLNA 5KZTA 2V25A 1LAGE 4N13A 4H8IA 4OWDA 2Y7IA 1DBZA 3DP6A 2I4CA 1JEUA 4ELOA 4EQ7A 4OTEA 1S7YA 2O1MA 2CMOA 1AL3A 3O9PA 2DVZA 1SW2A 2QS2A 3S4UA 3PV0E 1VSOA 1A8FA 3PUWE 1I6AA 2V3TA 4EUOA 1EZOA 1INPA 1MXYA 3CG3A 5IZ3A 3RPLB 1FCKA 5ET8A 1SPIA 3VXBA 5KDTB 4KYDA 4DCXA 4HCYA 4TQUQ 1AIVA 5AA2B 2Y84A 3N6UA 2HZKA 4R6HA 2DOJA 1LCFA 1MDP1 1H43A 4O3AA 2RF1A 5I59B 4G4PA 4BDNA 4WEPA 4H67A 4OVSA 4JXIA 4F3SA 1YAEA 4H5GA 3V89B 1P1OA 1LBXA 3EPEA 3G3KA 1DK4A 2PT1A 3MP1A 4U21A 4NN3A 4MH5A 1CNQA 1VE4A 1MXVA 5JK4A 2GHBA 2PT2A 1NV3A 2ZYOA 3U8QA 3K0VA 4I3YA 4DXBA 5CRYA 4PAKA 1FQDA 2CEXA 2RC9A 5ITPA 2F5XA 3C34A 1N76A 1KA1A 5AA3A 4U4XA 4X48A 2BJIA 2NWJA 3RLFE 2AL4A 2NVUB 2DWIA 4ZZAA 1NH7A 1B3EA 4RYAA 4DI3D 2F7AA 2I0BA 3C9HA 5B7DA 1NUWA 2XWOA 1HSLA 3IOUA 4LA9A 4BDQA 4DE8A 3JZJA 1FSAA 1SYIA 1POY1 4GLIA 2OBGA 1FBDA 2R71A 3U93A 4MLVA 3RUMA 4Q30B 3QXMA 1I6BA 1O7TA 2UVIA 3VLUA 3C31A 2I58A 3QMFA 4F1YA 3CFXA 2F6GA 3M3FA 1M5EA 1MY3A 1Q35A 4ZEBA 4QFPA 3HHGA 3GXAA 2GHAA 3VV5A 2DQVA 2UYFA 5TPAA 3H6TA 3B8BA 3LUYA 4JSDA 3A3UA 4PFYA 1LFIA 1MM6A 3LC8A 1B32A 4AS4A 2A5SA 1D3KA 5L8DA 5JTYB 3PTYA 3MZ9A 4HE1A 2QMWA 2R9JA 1DOTA 4E0WA 2Z8FA 4MBPA 1F9BA 3PPRA 4M1VA 4X8RA 3IOVA 3BFUA 1FPEA 3T22A 3IO6A 4N17A 3VE1B 1FBCA 3N94A 1ZBMA 4I8CA 4G8NA 2ZXTA 4ZECA 3G3GA 5IM2A 3MVWA 5I7IA 4ZE9A 4YB7A 4KD5A 2E1SA 2Z23A 1LGBC 4GVOA 4N81A 4O8MA 4Q5TA 1QULA 4N07A 4NE4A 4ELQA 3IX1A 2FA7A 4QFKA 4FEBA 1Y20A 2O7UA 2I48A 3H6WA 4IO6A 4ESXA 3SEVA 3RN8A 1OVBA 2ZZVA 3GLBA 1FTKA 4N15A 3GZGA 3HO7A 2YPNA 1LBBA 2XXXA 4PE5B 3U92A 4IR8A 1MH3A 4NG7A 2DYXA 1RDYA 1USYE 2F3DA 4GOTA 3V5AA 2I6EA 1B4HA 2ONKE 3K1PA 4PP0A 4IO4A 1NV7A 3TTKA 4YKPA 3U1OA 2AL5A 1EH3A 5I59A 4PAFA 2AYSA 1N3WA 3QUFA 2VD2A 4XEQA 4RY1A 1LSTA 2B3FA 5A5LA 1N3XA 3OD7A 2XWKA 1NNPA 3KOTA 5CMBA 2PCRA 5EQAA 1B52A 1FBFA 1B5IA 2ZMBA 1XT8A 4GBWA 2Q2CA 1Y1MA 4XKQA 2DDKA 3O6HA 4JVIA 4OVPA 5IAIA 4GFRA 1NFTA 3EHTA 3IFCA 1POTA 5FBPA 4DDDA 1NUXA 2DVCA 2V3UA 2G93A 4IO2A 1O64A 4P3LA 4HE2A 2ONRA 4PFWA 4LONB 3OOAA 1N0TA 2HXRA 1P1UA 3SERA 3PPOA 3B50A 2ONSA 4ESWA 3I6VA 2NUVA 4YICA 1B9JA 3ODBA 1MQDA 3G3JA 3IAZA 3S2VA 3MQ9A 2CEYA 2F78A 4G68C 2V93A 4GIZA 5ITOA 2PX1A 5BUUA 3MPKA 4LQ2A 1NH8A 1H76A 3PPQA 2REJA 2W7YA 3JV9A 3DP8A 1LBYA 4KFQA 2RC7A 4PF6A 4ZS9A 4H46A 4NF4A 4OZ9A 5I84A 2P3VA 4P0IA 5TPAB 1QW0A 3OO7A 3SESA 4JDFA 4PAIA 4LN5A 4QFOA 3HSTA 1LBCA 5DTBA 1SW4A 3Q27A 4GL0A 4R74A 1LBZA 2O51A 3FXQA 1RDZA 5AA1A 2R8TA 3MP6A 3FATA 3K02A 2O7IA 3KZGA 4UA8A 4E0XA 3KC0A 4GWYA 2FYIA 3B6QA 3MVXA 3G3IA 4GBVA 2H25A 4OQOA 4PF8A 4UACA 5EQ8A 2WEFA 2I3WA 1PC3A 4HXVA 1ANFA 2VOZA 2HQ0A 5I5PA 4GWXA 2D21A 3C32A 1BTJA 3A3CA 4H6DA 2HCAA 2QFLA 3FGSA 4H65A 4KYEA 1DPEA 4I62A 5EYHA 1TFAA 2PFYA 2B65A 3E79A 1IQ7A 2KQZA 3M8UA 4JSOA 2CZHA 1FBGA 3FD3A 1EZPA 4QSDA 1DPPA 2JJKA 3OMBA 3T9VA 3FIRA 2OK2A 4MLQA 4PETA 4OEVA 2DXYA 5I57B 4F2OA 3VXCA 4ELPA 1QKAA 1I69A 3MVYA 3HN0A 2WBBA 3CFLA 3TQLA 5ET6A 4H5FA 4MFIA 1PBPA 5BWJA 3KN7A 2FIEA 3MSTA 4ZZEA 2F36A 3RYDA 3AXFA 5CMCA 4PFTA 5H8QA 1NNKA 2D5WA 4L17A 4KCDA 2DWAA 2XXYA 4FORA 4P47A 5FHNA 2GH9A 3M3LA 3PMXA 5I3SA 1H45A 1B3GA 4JVCA 1ATGA 4BDOA 3QAXA 1YXIA 1LAHE 3R26A 4I3EA 1N7WA 1FTJA 3H6VA 1QKBA 1IXHA 1IZ1A 1NV6A 1B5JA 1VR5A 2F7CA 2Q89A 3LV0A 1LFGA 3TTMA 3SZPA 2HPGA 3FZVA 2QS4A 2ZNUA 4OFLA 3K1NA 1B51A 4N8GA 1NL5A 4ONYA 4MAGA 1EYKA 5IZ1A 5DEXB 3HFUA 4NAPA 1B7HA 3O97A 4XKNA 1MQIA 1P1QA 3MUQA 1NNTA 4KHZE 3IO4A 3ECRA 4ISUA 5FTIA 1B5HA 4F3PA 1Y4CA 5DYHA 3MC2A 3UP9A 2WX9A 4XIGQ 3G3HA 3VLVA 2OCUA 2VD3A 4N6DA 5EQ7A 1S9TA 2QJEA 5H8SA 3E78A 2PVUA 1URSA 1EYIA 4R73A 3KN8A 4BDLA 4OA4A 4OEUA 1JVYA 4NQ8A 1IIWA 2ZYNA 1FPJA 1MXXA 2B4MA 3PUVE 2QRYA 4U4SA 5TP9B 1VFEA 3LUZA 1XVXA 3RTWB 3O2AA 4FAJA 4NWCA 1BK4A 3CSBA 5FHMA 1UTBA 2P0SA 2GRVA 4H0WA 4GWWA 3ROJA 2I3VA 3K4UA 3IB0A 1PDAA 2G29A 3O66A 3B7DA 4YMBA 3OELA 1MPCA 3Q26A 4FJPA 2DXRA 1OIBA 4TOZA 3HCQA 3VVDA 2X7QA 3KBZA 3C35A 4QFLA 4EF1A 4IY5A 2Q74A 3TODA 5CI5A 3FJ7A 3L6HA 2Z22A 3P7IA 5LDZA 5EYFA 1WODA 1K9ZA 3HHFA 4BDMA 2VHAA 1OVTA 1TT1A 3H6UA 1SBPA 3TCHA 3D1RA 2OWTA 3A09A 1BLFA 3MZBA 4EXLA 1B0HA 1M5CA 1MY2A 3MBPA 1B7ZA 4JVDA 5DVFA 1Y3QA 4Z0IA 1FBHA 4LZ7A 1TFDA 1UTHB 3T93B 2V4CA 4F2QA 4OENA 5FHOA 2YLNA 2FHYA 3WAFA 3T66A 2RINA 3G3FA 3N5LA 4FATA 5TP9A 1B6HA 4MCOA 4P9KA 2QS3A 4GWZA 1WDNA 1UTBB 3K6VA 2XWVA 3PPPA 5J16A 4RK2A 2CZLA 4DCYA 4R72A 2FVZA 3D4GA 1XI6A 3TYHA 4M4GA 3GBAA 4QSEA 4LP2B 1PB9A 3S9LC 3OXNA 1OLAA 4KQPA 2XXPA 1B2HA 2DWHA 4POXA 2O84X 3FBPA 4OVJA 1M5DA 4GWOA 1FBEA 1LBVA 5A5XA 1MY1A 4KCCA 1QGXA 2RCBA 4NGUA 2ZYMA 2XXIA 5IGAA 3O28A 4HS7A 5DEXA 4JWYA 3ZSFA 3OEMA 2PMSA 1NI9A 4MHFA 2Q9TA 1FTLA 1FPIA 1OMPA 5CBRA 2XXKA 1FJ6A 4NF5A 3JYRA 4EQBA 4PFUA 1P1NA 4R6YA 2H9BA 4GF8A 4RXLA 3KBRA 3IFAA 4MIJA 3DELB 4NF4B 3CRBA 1FPKA 3UN6A 4LQ5A 5AE4A 1AH5A 3PPNA 1FQFA 2XXQA 2CZIA 4IO7A 2P3NA 1DTGA 4R9FA 4IGRA 4AB5A 1EZ9A 3OO6A 4XTCQ 4F3GA 3K6XA 2RC8A 2XD3A 3EF7A 3KSJA 4ZEKA 4DI4B 3O29A 1BKAA 3FV1A 1ZMGA 1PB8A 1XS5A 3KJ7A 3LSLA 1A99A 1T0KA 2REGA 4FEDA 1L5TA 3BKIB 5CBSA 3QK6A 1FPDA 4KR5A 1B58A 4QBAA 3QYTA 2UVGA 2HAUA 1IXCA 1YZ0A 4MX6A 5ICTA 2WKYA 3PUZE 1YYZA 1LCTA 3KEIA 1IXIA 3SEWA 4R9GA 5ESYA 5ET7A 3MP8A 1MXUA 4YKIA 4XFEA 4O7IA 3TTLA 4OESA 3ZKKA 5B70A 2QVUA 2Q8MA 2GFEA 2XXUA 4NF5B 4MMPA 4GWUA 3UORA 3ZS6A 5CMMA 3HV1A 4R6KA 4GWSA 1AWBA 3C36A 4P1EA 2XXRA 2F35A 2X26A 4MF3A 4K3FA 4N4UA 5EHSA 4N6KA 3V8XB 2P2AA 3LSXA 1ZU0A 3F11A 5JTYA 4GL8A 3CR9A 2PFZA 4F29A 4YKJA 2CZKA 1NV4A 1JEVA 4PTKA 4X1BA 1KA0A 4NHBA 5I56A 1OQGA 4F3BA 1RYOA 5K2YA 1G0IA 3ISPA 1I6QA 4KI0E 4OANA 2F8DA 1R9QA 1FBPA 4OVTA 2Y5LA 3RPWA 4NF0A 3CG1A 4P0GA 4PDHA 3FASA 1MY0A 1MM7A 4YB5A 1SDXA 3KFMA 4G8HA 1Z7ME 2VPNA 4PE3A 2UVJA 1JP4A 3A29A 3GBBA 3KN3A 1OQHA 3MAMA 2D3IA 4YAHX 2ZNTA 3TMGA 1GV8A 1FPFA 1R9LA 5A5XB 3S9MC 2HHMA 2H4IA 1QUIA 5L9OA 4PFIA 1M5FA 4GX3A 3IB1A 1UIUA 5DW8A 3CHGA 2ZNSA 4XKPA 5ELVA 3BBRA 4NTLA 1NV2A 3RPLA 2PYYA 4XF5A 3UA8A 5H8FA 1UQWA 3KOSA 3UK4A 4P11A 3VVFA 1XHYA 4R75A 1YCJA 1Z7NE 4EF2A 1ZKBA 4JBZA 4YZZA 1DMBA 4QRZA 4P8BA 4LZ8A 3OO8A 4WXJA 3LBSA 4F31B 1EU8A 3K6WA 4RNSA 1JQFA 4C0RA 5H8NB 4ECFA 4POWA 2H99A 5ET5A 1LAFE 4EQ9A 2DSFA 3K6UA 1P99A 2O69A 3FXRA 4AQ4A 2OWZA 1D9VA 1JW4A 3E3KA 3BIGA 3M3KA 3OSQA 2XX8A 3KG2A 4ZEFA 3VLWA 1IMFA 3T96B 1N04A 1Y1ZA 4H1XA 3FVNA 2O6AA 4IO5A 3FVKA 2UYEA 3CI8A 4BLAA 4YU0A 1LB8A 2AIXA 1Q1KA 1NV5A 1FJ9A 3SEYA 1MG1A 1FTOA 3C4MA 3H3GA 2V3QA 3QSLA 2WYKA 4QHQA 4XKRA 1PB7A 1QUJA 3RTFB 5ISUA 3K2DA 1H44A 1B05A 2O68A 4OYVA 3PGFA 2XXHA 2OJTA 1YTVA 1FQEA 1QVSA 4I40A 1NUYA 1EYJA 4QFNA 1QJMA 3MZ1A 4G68A 4RPOA 2ANJA 2L5VA 2QS1A 5HM4B 4AB6A 3OENA 2Y5KA 5F24A 1IMBA 5K2XA 5F7VA 1ZIUA 4NF8B 4NMYA 1J1NA 3BIHA 4RJZA 1DCUA 4GQOA 2B4LA 4OERA 4OMBA 4HW8A 4N6PA 2GQ1A 1FPBA 3TDJA 2UVHA 1MH4A 2ALUA 5IKBA 5I56B 4KXPA 4ZEDA 4WEDA 3PMVA 5LOMA 1RKMA 3PD9A 1USYH 2ESNA 3U94A 2M8CA 2XXWA 4RA1A 2XHDA 3TCFA 1IITA 3MPLA 1B0LA 4R2FA 3C33A 3LSWA 2B3BA 1IXGA 5KCJB 3D4CA 5CM6A 3PU5A 4G77A 4BDRA 3U72A 2OX3A 3ONMA 3TTNA 3ILTB 2HAVA 3H06B 4YKKA 2YJPA 3IJXB 2ZYKA 1MPBA 3USDA 1PEBA 3EQ1A 1IUDA 2XX7A 3TEPA 2WBDA 1GTKA 3UIFA 4H45A 3O6GA 3TZAA 2QPQA 1N7XA 4YMAA 4N8YA 3UGWA 3KJTA 5IZZA 3TTRA 3RT8A 4N91A 3MVZA 5H8HB 3IL1B 2RCAA 4G8MA 3OSRA 4WKMA 3B6WA 4PQJA 4PFBA 5H8FB 4OHNA 3K1MA 5AA4B 3G7WA 1FTMA 3OO9A 4KPTA 1IMEA 4NF6A 1NUZA 4JWOA 4FIMA 3DM0A 2E0SA 2KLFA 4ELRA 1H3DA 1URDA 3E9XA 4KYSA 3R7XA 3GYYA 1A8EA 4EXKA 4GD5A 1LBWA 4FBPA 4MNPA 2Q8JA 1SW5A 3K01A 2R6GE 4U23A 5T3JA 2A5TA 2F7BA 5F1QA 1B40A 2FNCA 2V84A 3NOHA 1FQBA 1WVJA 3FVGA 2F6PA 1IMDA 4DLDA 1MPDA 4H8JA 4QF9A 1CE2A 1JETA 5EYGA 3SDFA 4PDDA 5HBCA 4U1OA 3TFLA 3R6UA 1A7LA 1IEJA 1LB9A 4F1UA 4DZ1A 1GR2A 1RYXA 4FE8A 4ZE8A 1A54A 3H03A 3RGYA 2IA4A 4G61A 3HPIA 1AMFA 5AA2D 4OVRA 4Q8RA 4PFRA 3SEXA 1FW0A 3E13X 3MYUA 4Z7EA 5TU0A 4U1ZA 4P1LA 3T1BA 3KC1A 2XA5A 2XX9A 1VDWA 3O6IA 1B1HA 4O94A 1DTZA 1CB6A 5CC2A 4P56A 1R6ZA 1MQHA 4ZDMA 2ZZWA 3KGCA 5IZ3B 1NNFA 1OLCA 1LAXA 1GVCA 1FPLA 1B46A 1RDXA 3TKDA 4NWDA 2HZLA 1SYHA 3N26A 1A55A 3TCGA 4NX1A 3S9EA 3W9WA 4X1DA 4QXDA 3TQWA 3IB2A 4AS5A 2Z8DA 3QUJA 5I58A 4TLLB 3PD8A 4IGTA 3H4ZA 3QIMA 3RNNA 2P1SA 3S9NC 4LUBA 1SI1A 4OFOA 2VP1A 1A40A 5HPQA 3Q28A 5DVIA 2BJJX 5ICQA 4NEDA 1ZJLA 1NMUA 1JW5A 4GX4A 4GXAA 2DWJA 3FXUA 1ZLQA 4F1VA 1ZTYA 4PCDA 1MRPA 1P1WA 2VPOA 2FIXA 5I2KB 4G2ZA 3MW0A 5KCJA 4O7MA 4TLMB 1Y3NA 4DXCA 1GGGA 1QUKA 2HXWA 3LR1A 2THIA 1VFDA 2NXOA 4PBHA 2PBWA 3VFJA 1HSEA 4ZEIA 2ZZXA 3Q25A 4IB2A 1MS7A 2H98A 1US4A 1LFHA 1IMCA 1TWYA 1G0HA 2XXTA 5JEIA 3RQTA 2ABHA 5DVJA 4LZ5A 4EDPA 1IMAA 4PC9A 4X9TA 3RT6B 1M5BA 2OWSA 4C1UA 2Z8EA 3FJGA 5I57A 4DXUA 1SQYA 2XXVA 1K9YA 2FBPA 5AA4A 1UTHA 3CSGA 5I58B 4XXUA 3EHUA 3FJMA 3W15C 2RKMA 1N84A 2OLBA 1Y4TA 3MJNA 5M2VA 1MXWA 3U65A 3FXBA 2UXAA 5H8NA 3BFTA 4PBQA 5H8QB 3TELA 2Y7PA 2A5TB 5EHMA 3CVGA 4F18A 1D9QA 1S50A 1SD3A 1MQGA 2Y7RA 1B3FA 2DE4A 2WYPA 3Q29A 5EQ9A 5L9SA 1B3HA 1NV0A 1B3LA 5I2KA 2Q2AA 3DP4A 1NV1A 4R2BA 1BIYA 3EHSA 4MNCA 5I2NB 3PMWA 1SW1A 1HSJA 1FQAA 1SI0A
chains in the Genus database with same CATH topology
1LGBC 5LOMA 4HCWA 4GVOA 2X7QA 1UIVA 2O1LA 3C35A 4Q5TA 1QULA 4N07A 4NE4A 3CIJA 3SEYA 4ELQA 3IX1A 2OZZA 4ZEIA 2FA7A 4QFKA 4F39A 4FEBA 4QFLA 4JB7A 1MG1A 2DE2A 1Y20A 2O7UA 4EF1A 1FTOA 2I48A 3H6WA 4IO6A 1FQCA 3C4MA 5DT6A 4C1TA 4IY5A 4ESXA 3H3GA 2V3QA 3SEVA 3QSLA 3TODA 4QHQA 4XKRA 5CI5A 1PB7A 3LSFB 3FJ7A 3RN8A 1QUJA 3L6HA 2IEEA 2Z22A 3P7IA 1OVBA 2HEUA 3K2DA 3MWBA 3RTFB 1H44A 1B05A 5ISUA 3GLBA 1FTKA 5J1DA 1Y3PA 2O68A 3GZGA 4OYVA 3HO7A 2DP8A 5EYFA 3B6TA 2YPNA 3PGFA 1WODA 3HHFA 2XXHA 4BDMA 1GVCA 1LBBA 2VHAA 2XXXA 4PE5B 4IO3A 3TKDA 1XC1A 5AA2A 3U92A 2OJTA 1OVTA 1TT1A 1MH3A 1YTVA 3H6UA 3TCFA 2DYXA 1FQEA 3SETA 1SBPA 3TCHA 1QVSA 5FTHA 1USYE 2OWTA 3A09A 4GOTA 1BLFA 3MZBA 4EXLA 1B0HA 3V5AA 4Q0CA 4G68B 1M5CA 1B4HA 1MY2A 2I6EA 2ONKE 3MBPA 3K1PA 4PP0A 3SEUA 4IO4A 4QFNA 1QJMA 3THIA 1B7ZA 3MZ1A 4G68A 4RPOA 4YKPA 3TTKA 3H7MA 2ANJA 1MQJA 5DVFA 3U1OA 1B4ZA 1Y3QA 2AL5A 4Z0IA 1EH3A 1URGA 2QS1A 5HM4B 4AB6A 4LZ7A 1TFDA 5I59A 3OENA 1UTHB 2AYSA 4NF8A 5K2XA 3T93B 1O63A 1TXFA 4QSCA 1N3WA 3QUFA 4F1UA 4F2QA 5F7VA 5CMKA 1ZIUA 4OENA 4NF8B 5FHOA 1II5A 2VD2A 2YLNA 4NMYA 3WAFA 1J1NA 4RY1A 3TPAA 1LSTA 2B3FA 3T66A 4LATA 2RINA 3G3FA 3N5LA 4LVQA 4FATA 2NOOA 4RJZA 5TP9A 1B6HA 2DE3A 4OFJA 2LAOA 1N3XA 3OD7A 2QS3A 3IR1A 4GQOA 1NNPA 3KOTA 3K00A 1MY4A 1WDNA 1UTBB 4OERA 3K6VA 4RK9A 3PPPA 4THIA 4OMBA 3FV2A 4HW8A 4N6PA 5CMBA 4RK2A 2CZLA 2UVHA 1MH4A 2ALUA 3TDJA 4DCYA 5IKBA 3IJOB 4R72A 5I56B 1B52A 3D4GA 4ZEDA 4WEDA 4RPNA 3T9UA 3PMVA 3VDFA 1RKMA 1KWHA 1D4NA 3CFZA 1USYH 2ESNA 3PD9A 1B5IA 3TYHA 2ZMBA 4M4GA 1XT8A 4U2RA 1AOVA 3U94A 2M8CA 3FVOA 2XXWA 4RA1A 2XHDA 3GBAA 1IITA 4LP2B 2Q2CA 1PB9A 3EN3A 3MPLA 1Y1MA 4QSEA 1B1XA 4XKQA 4YB6A 1SVXB 3O6HA 1B0LA 2AIXA 2VGQA 5IAIA 4HTGA 4GFRA 4R2FA 1NFTA 3W9VA 5L9MA 3C33A 3EHTA 3LSWA 2B3BA 1POTA 2DS9A 3ZKLA 1IXGA 5I2NA 5KCJB 1JVXA 3S9LC 3D4CA 4DDDA 5CM6A 2DVCA 3OXNA 1JNFA 1OLAA 2V3UA 3PU5A 4G77A 4FAJA 1ELJA 2G93A 3I3VA 3IORA 2XXPA 1B2HA 2DWHA 1O64A 2HFBA 3FUZA 3IOWA 1Y9UA 4IO2A 2H5YA 4POXA 3U72A 3ONMA 2ONRA 2O84X 3PUYE 4PFWA 3TTNA 3ILTB 4LONB 3OOAA 2HAVA 3H06B 4OVJA 2YJPA 3IJXB 4YKKA 1N0TA 2QL3A 2ZYKA 1M5DA 1P1UA 4O3BA 3SERA 4FECA 4GWOA 3PPOA 1MPBA 3USDA 5A5XA 1PEBA 3EQ1A 1DSNA 1BP5A 1IUDA 1MY1A 4KCCA 3PUXE 2XX7A 3TAJA 4F19A 2RCBA 4GRKA 3TEPA 2ONSA 3T9HB 1GTKA 3UIFA 1MDQA 2ZYMA 4ESWA 2XXIA 1XOCA 3O28A 4HS7A 3O6GA 4O3CA 5DEXA 2QPQA 3I6VA 4JWYA 1N7XA 4ND9A 3TZAA 4YMAA 2NUVA 3TUSA 1D9YA 1B9JA 1YPNA 4YICA 3ZSFA 3ODBA 3SKPA 3OEMA 5H8HA 3UGWA 2Y7KA 3KJTA 1MQDA 2PMSA 3RT8A 1PBQA 3G3JA 3TTRA 3MVZA 4F22A 1MXZA 5H8HB 3IAZA 3IL1B 2Q9TA 1FTLA 2RCAA 3S2VA 4G8MA 3MQ9A 2F78A 1US5A 3OSRA 1OMPA 2I0CA 4JWXA 2QSXA 4IY6A 5CBRA 4G68C 1NKXA 3B6WA 4WKMA 4NF5A 4PQJA 5KDTA 3N6TA 2V93A 4GIZA 5ITOA 2F97A 2PX1A 5H8FB 5BUUA 4OHNA 3MPKA 4U22A 3JYRA 4LQ2A 1JW1A 1NH8A 3K1MA 4EQBA 4PFUA 5AA4B 3G7WA 1B7UA 1FTMA 4OETA 4OXVA 3V83A 1P1NA 3I5OA 4NF6B 1H76A 2H9BA 3OO9A 4GF8A 3KBRA 4R6YA 4KPTA 4GXSB 3PPQA 4RXLA 2REJA 2W7YA 3IK6B 3T9XB 3DELB 3JV9A 3DP8A 4NF6A 4NF4B 4KFQA 4JWOA 4FIMA 3DM0A 2RC7A 2E0SA 2KLFA 2QMXA 4ZS9A 3RY3A 1H3DA 1URDA 3E9XA 4KYSA 4NF4A 3CRBA 4OZ9A 4I9DA 3R7XA 4LQ5A 4P0IA 3UN6A 5I84A 1A8EA 1QW0A 3OO7A 5TPAB 3SESA 4EXKA 5AE4A 1AH5A 4GD5A 4JDFA 3PPNA 2X7PA 4QFOA 1FQFA 2XXQA 3HSTA 2Q8JA 1SW5A 1LBCA 3IOTA 2I4BA 3K01A 2Q88A 2R6GE 5DTBA 1SW4A 3Q27A 4GL0A 2A5TA 3E4RA 3ILUB 4IO7A 4R74A 2F7BA 4U23A 5F1QA 1B40A 1DTGA 4R9FA 4DIGA 2FNCA 4IGRA 2F34A 2O51A 2V84A 2Y7WA 3FXQA 4AB5A 1EZ9A 1FQBA 1WVJA 3KSXA 3OO6A 4XTCQ 3FVGA 5AA1A 2F6PA 4F3GA 3VVDA 4DLDA 3WAEA 5KZTA 1MPDA 4H8JA 4QF9A 1CE2A 1JETA 1R1NA 3L6GA 3MP6A 3VVEA 2XD2A 1XVYA 4ELRA 5I58A 3SDFA 2I49A 3FATA 2O7IA 3K02A 3K6XA 5HBCA 3OEKA 3KZGA 4I1DA 4U1OA 2RC8A 2XD3A 4UA8A 4E0XA 3TFLA 3EF7A 3KSJA 1A7LA 1IEJA 3R6UA 1LB9A 1LLSA 2FYIA 3DLNA 4ZEKA 3O29A 3B6QA 3MVXA 4DZ1A 1BKAA 1GR2A 3FV1A 3G3IA 1RYXA 2V25A 1ZMGA 1LAGE 1PB8A 1XS5A 4FE8A 4ZE8A 4N13A 4H8IA 2H25A 4OQOA 1A54A 3H03A 3KJ7A 2IA4A 4UACA 3RGYA 4OWDA 3HPIA 1AMFA 3LSLA 2Y7IA 5AA2D 1A99A 2I3WA 1PC3A 4Q8RA 3DP6A 2I4CA 1T0KA 1JEUA 4ELOA 2REGA 1ANFA 1FW0A 2VOZA 2HQ0A 3E13X 3BKIB 4FEDA 1L5TA 3SEXA 2D21A 3QK6A 3C32A 1BTJA 4KR5A 4OTEA 1B58A 4EQ7A 3A3CA 3QYTA 1S7YA 2UVGA 2HAUA 4Z7EA 4H6DA 5TU0A 2HCAA 1IXCA 2O1MA 3FGSA 4H65A 2CMOA 4U1ZA 1AL3A 3O9PA 1DPEA 4KYEA 4KD5A 2DVZA 4I62A 1SW2A 1TFAA 2XX9A 2QS2A 3S4UA 5ICTA 2WKYA 5KDTB 3PUZE 3PV0E 1LCTA 1VSOA 2B65A 3KEIA 1IXIA 1A8FA 3O6IA 1B1HA 3PUWE 3SEWA 4R9GA 1I6AA 1IQ7A 2V3TA 3M8UA 4JSOA 4EUOA 1DTZA 3MP8A 1MXUA 1EZOA 1CB6A 4YKIA 1MXYA 3CG3A 5CC2A 3TTLA 4OESA 3FD3A 1R6ZA 1EZPA 1MQHA 4QSDA 4ZDMA 3ZKKA 1DPPA 1FCKA 5B70A 3OMBA 3KGCA 3T9VA 2GFEA 2XXUA 3FIRA 4NF5B 1NNFA 1OLCA 3UORA 1LAXA 2OK2A 1B46A 4MLQA 4PETA 4KYDA 5CMMA 3HV1A 4NWDA 4R6KA 2HZLA 2DXYA 4HCYA 4OEVA 4DCXA 4TQUQ 5I57B 1AIVA 5AA2B 2Y84A 3C36A 3N6UA 2HZKA 1SYHA 2XXRA 2F35A 4R6HA 2X26A 4F2OA 3N26A 1A55A 2DOJA 3VXCA 1LCFA 1QKAA 1I69A 1MDP1 4ELPA 1H43A 4MF3A 4K3FA 3TCGA 3S9EA 4O3AA 3MVYA 2RF1A 4X1DA 5EHSA 3W9WA 5I59B 4G4PA 3TQWA 3HN0A 4BDNA 4WEPA 3CFLA 4H67A 3IB2A 3TQLA 4JXIA 4F3SA 3V8XB 2Z8DA 3QUJA 2P2AA 1YAEA 4H5FA 1PBPA 4MFIA 4H5GA 3V89B 4TLLB 3LSXA 1P1OA 3KN7A 5BWJA 3PD8A 4IGTA 3EPEA 3G3KA 3H4ZA 2PT1A 3MP1A 4ZZEA 3QIMA 4U21A 3RNNA 2F36A 1ZU0A 2P1SA 3F11A 3AXFA 4MH5A 5CMCA 4GL8A 5JTYA 3CR9A 4PFTA 2Z23A 4F29A 3S9NC 1VE4A 4LUBA 4YKJA 1MXVA 5H8QA 5JK4A 1SI1A 2GHBA 2PT2A 4OFOA 1NNKA 1A40A 2D5WA 1JEVA 2VP1A 4L17A 3Q28A 5HPQA 4KCDA 2DWAA 2XXYA 4FORA 5DVIA 5FHNA 4X1BA 2GH9A 2ZYOA 3M3LA 3U8QA 5I56A 1OQGA 3PMXA 4F3BA 3K0VA 1H45A 1B3GA 5CRYA 4DXBA 1RYOA 1ATGA 2BJJX 5ICQA 4NEDA 1FQDA 4BDOA 4F3PA 3QAXA 2RC9A 1ZJLA 1NMUA 1LAHE 5ITPA 5K2YA 3R26A 2F5XA 1JW5A 4GXAA 1I6QA 1N76A 1N7WA 2DWJA 2F8DA 3C34A 4KI0E 1R9QA 3FXUA 1ZLQA 5AA3A 1FTJA 4F1VA 3H6VA 1QKBA 1IXHA 1IZ1A 1ZTYA 1MRPA 4KQPA 4U4XA 1P1WA 1B5JA 4X48A 2NWJA 3RLFE 2AL4A 1VR5A 2NVUB 2DWIA 2F7CA 2Q89A 3MW0A 3CG1A 4G2ZA 5I2KB 4ZZAA 3RPWA 1NH7A 1LFGA 5KCJA 1B3EA 4P0GA 4TLMB 3TTMA 3FASA 4RYAA 1MY0A 1MM7A 1Y3NA 2F7AA 2I0BA 3FZVA 1SDXA 4YB5A 1GGGA 2QS4A 3C9HA 2ZNUA 4OFLA 3K1NA 4DXCA 5B7DA 1QUKA 1B51A 3KFMA 4G8HA 1Z7ME 2UVJA 2HXWA 3GBBA 1NL5A 3KN3A 1HSLA 3LR1A 1OQHA 4ONYA 2THIA 1VFDA 3IOUA 2NXOA 4LA9A 3MAMA 2D3IA 4YAHX 4BDQA 2ZNTA 3TMGA 1GV8A 1R9LA 4DE8A 2PBWA 3JZJA 5DEXB 3VFJA 1HSEA 5A5XB 1SYIA 3S9MC 2H4IA 1B7HA 3O97A 1MQIA 1POY1 1QUIA 1P1QA 4GLIA 3Q25A 3MUQA 4IB2A 4XKNA 1M5FA 5L9OA 1MS7A 1NNTA 2H98A 2OBGA 4KHZE 2R71A 3IO4A 1US4A 1LFHA 3ECRA 1TWYA 3U93A 4ISUA 5FTIA 1B5HA 2XXTA 3IB1A 1UIUA 4MLVA 3RQTA 1Y4CA 4Q30B 3RUMA 3QXMA 5JEIA 2ABHA 1I6BA 1O7TA 2UVIA 2ZNSA 4XKPA 5ELVA 5DVJA 4LZ5A 3VLUA 3C31A 3BBRA 4NTLA 4EDPA 2I58A 3MC2A 5DYHA 4F1YA 2PYYA 3UP9A 3CFXA 2F6GA 3UA8A 5H8FA 4X9TA 3RT6B 1M5BA 2OWSA 4C1UA 3M3FA 1M5EA 1UQWA 1MY3A 1Q35A 4ZEBA 4XIGQ 2Z8EA 4QFPA 3FJGA 3HHGA 3KOSA 3G3HA 3UK4A 3VLVA 2OCUA 4P11A 3VVFA 5I57A 2VD3A 4DXUA 1SQYA 1XHYA 2XXVA 1S9TA 2QJEA 4R75A 1YCJA 3GXAA 5AA4A 1Z7NE 1UTHA 3CSGA 4EF2A 5I58B 2GHAA 1ZKBA 4JBZA 5H8SA 4XXUA 3VV5A 2PVUA 2DQVA 2UYFA 1DMBA 3EHUA 4YZZA 4QRZA 5TPAA 3H6TA 3FJMA 4LZ8A 3W15C 1URSA 3OO8A 4R73A 2RKMA 3KN8A 4BDLA 4BDRA 1N84A 2OLBA 3LUYA 3LBSA 4JSDA 4WXJA 3A3UA 1JVYA 4OEUA 1Y4TA 3MJNA 4PFYA 1IIWA 4F31B 1LFIA 1EU8A 1MM6A 1MXWA 5M2VA 2ZYNA 3LC8A 1B32A 3K6WA 1MXXA 2A5SA 2UXAA 5H8NA 4RNSA 1D3KA 3PUVE 2QRYA 5L8DA 3BFTA 1JQFA 5JTYB 5CBSA 3MZ9A 4U4SA 2QMWA 5TP9B 4C0RA 5H8NB 4ECFA 4POWA 2R9JA 1DOTA 4E0WA 2Z8FA 1VFEA 2H99A 1XVXA 4MBPA 5H8QB 3O2AA 1LAFE 3RTWB 4NWCA 3TELA 2Y7PA 1F9BA 4EQ9A 2A5TB 3PPRA 3CSBA 5EHMA 2DSFA 3K6UA 3CVGA 4M1VA 1P99A 1UTBA 5FHMA 2O69A 3IOVA 3BFUA 3FXRA 2P0SA 2GRVA 4F18A 4AQ4A 4H0WA 1D9VA 1JW4A 2I3VA 3T22A 3E3KA 3IO6A 3K4UA 3M3KA 3IB0A 3OSQA 3VE1B 1S50A 2XX8A 3N94A 1SD3A 1MQGA 3KG2A 1PDAA 2Y7RA 2G29A 3O66A 3B7DA 4YMBA 1ZBMA 1B3FA 2DE4A 3Q29A 4I8CA 4ZEFA 3VLWA 3VXBA 3T96B 3OELA 4G8NA 1B3HA 1N04A 2ZXTA 5L9SA 1B3LA 4ZECA 1MPCA 1Y1ZA 4H1XA 5I2KA 3FVNA 2O6AA 2Q2AA 3DP4A 3Q26A 3G3GA 4IO5A 3FVKA 3MVWA 4FJPA 4R2BA 1BIYA 2DXRA 2UYEA 3CI8A 3EHSA 3PMWA 5I2NB 1OIBA 4BLAA 4ZE9A 3ZS6A 4TOZA 4YU0A 4YB7A 1SW1A 1LB8A 1HSJA 3HCQA 1FQAA 2E1SA 1Q1KA 1SI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LGB C;  5LOM A;  4HCW A;  4GVO A;  2X7Q A;  1UIV A;  2O1L A;  3C35 A;  4Q5T A;  1QUL A;  4N07 A;  4NE4 A;  3CIJ A;  3SEY A;  4ELQ A;  3IX1 A;  2OZZ A;  4ZEI A;  2FA7 A;  4QFK A;  4F39 A;  4FEB A;  4QFL A;  4JB7 A;  1MG1 A;  2DE2 A;  1Y20 A;  2O7U A;  4EF1 A;  1FTO A;  2I48 A;  3H6W A;  4IO6 A;  1FQC A;  3C4M A;  5DT6 A;  4C1T A;  4IY5 A;  4ESX A;  3H3G A;  2V3Q A;  3SEV A;  3QSL A;  3TOD A;  4QHQ A;  4XKR A;  5CI5 A;  1PB7 A;  3LSF B;  3FJ7 A;  3RN8 A;  1QUJ A;  3L6H A;  2IEE A;  2Z22 A;  3P7I A;  1OVB A;  2HEU A;  3K2D A;  3MWB A;  3RTF B;  1H44 A;  1B05 A;  5ISU A;  3GLB A;  1FTK A;  5J1D A;  1Y3P A;  2O68 A;  3GZG A;  4OYV A;  3HO7 A;  2DP8 A;  5EYF A;  3B6T A;  2YPN A;  3PGF A;  1WOD A;  3HHF A;  2XXH A;  4BDM A;  1GVC A;  1LBB A;  2VHA A;  2XXX A;  4PE5 B;  4IO3 A;  3TKD A;  1XC1 A;  5AA2 A;  3U92 A;  2OJT A;  1OVT A;  1TT1 A;  1MH3 A;  1YTV A;  3H6U A;  3TCF A;  2DYX A;  1FQE A;  3SET A;  1SBP A;  3TCH A;  1QVS A;  5FTH A;  1USY E;  2OWT A;  3A09 A;  4GOT A;  1BLF A;  3MZB A;  4EXL A;  1B0H A;  3V5A A;  4Q0C A;  4G68 B;  1M5C A;  1B4H A;  1MY2 A;  2I6E A;  2ONK E;  3MBP A;  3K1P A;  4PP0 A;  3SEU A;  4IO4 A;  4QFN A;  1QJM A;  3THI A;  1B7Z A;  3MZ1 A;  4G68 A;  4RPO A;  4YKP A;  3TTK A;  3H7M A;  2ANJ A;  1MQJ A;  5DVF A;  3U1O A;  1B4Z A;  1Y3Q A;  2AL5 A;  4Z0I A;  1EH3 A;  1URG A;  2QS1 A;  5HM4 B;  4AB6 A;  4LZ7 A;  1TFD A;  5I59 A;  3OEN A;  1UTH B;  2AYS A;  4NF8 A;  5K2X A;  3T93 B;  1O63 A;  1TXF A;  4QSC A;  1N3W A;  3QUF A;  4F1U A;  4F2Q A;  5F7V A;  5CMK A;  1ZIU A;  4OEN A;  4NF8 B;  5FHO A;  1II5 A;  2VD2 A;  2YLN A;  4NMY A;  3WAF A;  1J1N A;  4RY1 A;  3TPA A;  1LST A;  2B3F A;  3T66 A;  4LAT A;  2RIN A;  3G3F A;  3N5L A;  4LVQ A;  4FAT A;  2NOO A;  4RJZ A;  5TP9 A;  1B6H A;  2DE3 A;  4OFJ A;  2LAO A;  1N3X A;  3OD7 A;  2QS3 A;  3IR1 A;  4GQO A;  1NNP A;  3KOT A;  3K00 A;  1MY4 A;  1WDN A;  1UTB B;  4OER A;  3K6V A;  4RK9 A;  3PPP A;  4THI A;  4OMB A;  3FV2 A;  4HW8 A;  4N6P A;  5CMB A;  4RK2 A;  2CZL A;  2UVH A;  1MH4 A;  2ALU A;  3TDJ A;  4DCY A;  5IKB A;  3IJO B;  4R72 A;  5I56 B;  1B52 A;  3D4G A;  4ZED A;  4WED A;  4RPN A;  3T9U A;  3PMV A;  3VDF A;  1RKM A;  1KWH A;  1D4N A;  3CFZ A;  1USY H;  2ESN A;  3PD9 A;  1B5I A;  3TYH A;  2ZMB A;  4M4G A;  1XT8 A;  4U2R A;  1AOV A;  3U94 A;  2M8C A;  3FVO A;  2XXW A;  4RA1 A;  2XHD A;  3GBA A;  1IIT A;  4LP2 B;  2Q2C A;  1PB9 A;  3EN3 A;  3MPL A;  1Y1M A;  4QSE A;  1B1X A;  4XKQ A;  4YB6 A;  1SVX B;  3O6H A;  1B0L A;  2AIX A;  2VGQ A;  5IAI A;  4HTG A;  4GFR A;  4R2F A;  1NFT A;  3W9V A;  5L9M A;  3C33 A;  3EHT A;  3LSW A;  2B3B A;  1POT A;  2DS9 A;  3ZKL A;  1IXG A;  5I2N A;  5KCJ B;  1JVX A;  3S9L C;  3D4C A;  4DDD A;  5CM6 A;  2DVC A;  3OXN A;  1JNF A;  1OLA A;  2V3U A;  3PU5 A;  4G77 A;  4FAJ A;  1ELJ A;  2G93 A;  3I3V A;  3IOR A;  2XXP A;  1B2H A;  2DWH A;  1O64 A;  2HFB A;  3FUZ A;  3IOW A;  1Y9U A;  4IO2 A;  2H5Y A;  4POX A;  3U72 A;  3ONM A;  2ONR A;  2O84 X;  3PUY E;  4PFW A;  3TTN A;  3ILT B;  4LON B;  3OOA A;  2HAV A;  3H06 B;  4OVJ A;  2YJP A;  3IJX B;  4YKK A;  1N0T A;  2QL3 A;  2ZYK A;  1M5D A;  1P1U A;  4O3B A;  3SER A;  4FEC A;  4GWO A;  3PPO A;  1MPB A;  3USD A;  5A5X A;  1PEB A;  3EQ1 A;  1DSN A;  1BP5 A;  1IUD A;  1MY1 A;  4KCC A;  3PUX E;  2XX7 A;  3TAJ A;  4F19 A;  2RCB A;  4GRK A;  3TEP A;  2ONS A;  3T9H B;  1GTK A;  3UIF A;  1MDQ A;  2ZYM A;  4ESW A;  2XXI A;  1XOC A;  3O28 A;  4HS7 A;  3O6G A;  4O3C A;  5DEX A;  2QPQ A;  3I6V A;  4JWY A;  1N7X A;  4ND9 A;  3TZA A;  4YMA A;  2NUV A;  3TUS A;  1D9Y A;  1B9J A;  1YPN A;  4YIC A;  3ZSF A;  3ODB A;  3SKP A;  3OEM A;  5H8H A;  3UGW A;  2Y7K A;  3KJT A;  1MQD A;  2PMS A;  3RT8 A;  1PBQ A;  3G3J A;  3TTR A;  3MVZ A;  4F22 A;  1MXZ A;  5H8H B;  3IAZ A;  3IL1 B;  2Q9T A;  1FTL A;  2RCA A;  3S2V A;  4G8M A;  3MQ9 A;  2F78 A;  1US5 A;  3OSR A;  1OMP A;  2I0C A;  4JWX A;  2QSX A;  4IY6 A;  5CBR A;  4G68 C;  1NKX A;  3B6W A;  4WKM A;  4NF5 A;  4PQJ A;  5KDT A;  3N6T A;  2V93 A;  4GIZ A;  5ITO A;  2F97 A;  2PX1 A;  5H8F B;  5BUU A;  4OHN A;  3MPK A;  4U22 A;  3JYR A;  4LQ2 A;  1JW1 A;  1NH8 A;  3K1M A;  4EQB A;  4PFU A;  5AA4 B;  3G7W A;  1B7U A;  1FTM A;  4OET A;  4OXV A;  3V83 A;  1P1N A;  3I5O A;  4NF6 B;  1H76 A;  2H9B A;  3OO9 A;  4GF8 A;  3KBR A;  4R6Y A;  4KPT A;  4GXS B;  3PPQ A;  4RXL A;  2REJ A;  2W7Y A;  3IK6 B;  3T9X B;  3DEL B;  3JV9 A;  3DP8 A;  4NF6 A;  4NF4 B;  4KFQ A;  4JWO A;  4FIM A;  3DM0 A;  2RC7 A;  2E0S A;  2KLF A;  2QMX A;  4ZS9 A;  3RY3 A;  1H3D A;  1URD A;  3E9X A;  4KYS A;  4NF4 A;  3CRB A;  4OZ9 A;  4I9D A;  3R7X A;  4LQ5 A;  4P0I A;  3UN6 A;  5I84 A;  1A8E A;  1QW0 A;  3OO7 A;  5TPA B;  3SES A;  4EXK A;  5AE4 A;  1AH5 A;  4GD5 A;  4JDF A;  3PPN A;  2X7P A;  4QFO A;  1FQF A;  2XXQ A;  3HST A;  2Q8J A;  1SW5 A;  1LBC A;  3IOT A;  2I4B A;  3K01 A;  2Q88 A;  2R6G E;  5DTB A;  1SW4 A;  3Q27 A;  4GL0 A;  2A5T A;  3E4R A;  3ILU B;  4IO7 A;  4R74 A;  2F7B A;  4U23 A;  5F1Q A;  1B40 A;  1DTG A;  4R9F A;  4DIG A;  2FNC A;  4IGR A;  2F34 A;  2O51 A;  2V84 A;  2Y7W A;  3FXQ A;  4AB5 A;  1EZ9 A;  1FQB A;  1WVJ A;  3KSX A;  3OO6 A;  4XTC Q;  3FVG A;  5AA1 A;  2F6P A;  4F3G A;  3VVD A;  4DLD A;  3WAE A;  5KZT A;  1MPD A;  4H8J A;  4QF9 A;  1CE2 A;  1JET A;  1R1N A;  3L6G A;  3MP6 A;  3VVE A;  2XD2 A;  1XVY A;  4ELR A;  5I58 A;  3SDF A;  2I49 A;  3FAT A;  2O7I A;  3K02 A;  3K6X A;  5HBC A;  3OEK A;  3KZG A;  4I1D A;  4U1O A;  2RC8 A;  2XD3 A;  4UA8 A;  4E0X A;  3TFL A;  3EF7 A;  3KSJ A;  1A7L A;  1IEJ A;  3R6U A;  1LB9 A;  1LLS A;  2FYI A;  3DLN A;  4ZEK A;  3O29 A;  3B6Q A;  3MVX A;  4DZ1 A;  1BKA A;  1GR2 A;  3FV1 A;  3G3I A;  1RYX A;  2V25 A;  1ZMG A;  1LAG E;  1PB8 A;  1XS5 A;  4FE8 A;  4ZE8 A;  4N13 A;  4H8I A;  2H25 A;  4OQO A;  1A54 A;  3H03 A;  3KJ7 A;  2IA4 A;  4UAC A;  3RGY A;  4OWD A;  3HPI A;  1AMF A;  3LSL A;  2Y7I A;  5AA2 D;  1A99 A;  2I3W A;  1PC3 A;  4Q8R A;  3DP6 A;  2I4C A;  1T0K A;  1JEU A;  4ELO A;  2REG A;  1ANF A;  1FW0 A;  2VOZ A;  2HQ0 A;  3E13 X;  3BKI B;  4FED A;  1L5T A;  3SEX A;  2D21 A;  3QK6 A;  3C32 A;  1BTJ A;  4KR5 A;  4OTE A;  1B58 A;  4EQ7 A;  3A3C A;  3QYT A;  1S7Y A;  2UVG A;  2HAU A;  4Z7E A;  4H6D A;  5TU0 A;  2HCA A;  1IXC A;  2O1M A;  3FGS A;  4H65 A;  2CMO A;  4U1Z A;  1AL3 A;  3O9P A;  1DPE A;  4KYE A;  4KD5 A;  2DVZ A;  4I62 A;  1SW2 A;  1TFA A;  2XX9 A;  2QS2 A;  3S4U A;  5ICT A;  2WKY A;  5KDT B;  3PUZ E;  3PV0 E;  1LCT A;  1VSO A;  2B65 A;  3KEI A;  1IXI A;  1A8F A;  3O6I A;  1B1H A;  3PUW E;  3SEW A;  4R9G A;  1I6A A;  1IQ7 A;  2V3T A;  3M8U A;  4JSO A;  4EUO A;  1DTZ A;  3MP8 A;  1MXU A;  1EZO A;  1CB6 A;  4YKI A;  1MXY A;  3CG3 A;  5CC2 A;  3TTL A;  4OES A;  3FD3 A;  1R6Z A;  1EZP A;  1MQH A;  4QSD A;  4ZDM A;  3ZKK A;  1DPP A;  1FCK A;  5B70 A;  3OMB A;  3KGC A;  3T9V A;  2GFE A;  2XXU A;  3FIR A;  4NF5 B;  1NNF A;  1OLC A;  3UOR A;  1LAX A;  2OK2 A;  1B46 A;  4MLQ A;  4PET A;  4KYD A;  5CMM A;  3HV1 A;  4NWD A;  4R6K A;  2HZL A;  2DXY A;  4HCY A;  4OEV A;  4DCX A;  4TQU Q;  5I57 B;  1AIV A;  5AA2 B;  2Y84 A;  3C36 A;  3N6U A;  2HZK A;  1SYH A;  2XXR A;  2F35 A;  4R6H A;  2X26 A;  4F2O A;  3N26 A;  1A55 A;  2DOJ A;  3VXC A;  1LCF A;  1QKA A;  1I69 A;  1MDP 1;  4ELP A;  1H43 A;  4MF3 A;  4K3F A;  3TCG A;  3S9E A;  4O3A A;  3MVY A;  2RF1 A;  4X1D A;  5EHS A;  3W9W A;  5I59 B;  4G4P A;  3TQW A;  3HN0 A;  4BDN A;  4WEP A;  3CFL A;  4H67 A;  3IB2 A;  3TQL A;  4JXI A;  4F3S A;  3V8X B;  2Z8D A;  3QUJ A;  2P2A A;  1YAE A;  4H5F A;  1PBP A;  4MFI A;  4H5G A;  3V89 B;  4TLL B;  3LSX A;  1P1O A;  3KN7 A;  5BWJ A;  3PD8 A;  4IGT A;  3EPE A;  3G3K A;  3H4Z A;  2PT1 A;  3MP1 A;  4ZZE A;  3QIM A;  4U21 A;  3RNN A;  2F36 A;  1ZU0 A;  2P1S A;  3F11 A;  3AXF A;  4MH5 A;  5CMC A;  4GL8 A;  5JTY A;  3CR9 A;  4PFT A;  2Z23 A;  4F29 A;  3S9N C;  1VE4 A;  4LUB A;  4YKJ A;  1MXV A;  5H8Q A;  5JK4 A;  1SI1 A;  2GHB A;  2PT2 A;  4OFO A;  1NNK A;  1A40 A;  2D5W A;  1JEV A;  2VP1 A;  4L17 A;  3Q28 A;  5HPQ A;  4KCD A;  2DWA A;  2XXY A;  4FOR A;  5DVI A;  5FHN A;  4X1B A;  2GH9 A;  2ZYO A;  3M3L A;  3U8Q A;  5I56 A;  1OQG A;  3PMX A;  4F3B A;  3K0V A;  1H45 A;  1B3G A;  5CRY A;  4DXB A;  1RYO A;  1ATG A;  2BJJ X;  5ICQ A;  4NED A;  1FQD A;  4BDO A;  4F3P A;  3QAX A;  2RC9 A;  1ZJL A;  1NMU A;  1LAH E;  5ITP A;  5K2Y A;  3R26 A;  2F5X A;  1JW5 A;  4GXA A;  1I6Q A;  1N76 A;  1N7W A;  2DWJ A;  2F8D A;  3C34 A;  4KI0 E;  1R9Q A;  3FXU A;  1ZLQ A;  5AA3 A;  1FTJ A;  4F1V A;  3H6V A;  1QKB A;  1IXH A;  1IZ1 A;  1ZTY A;  1MRP A;  4KQP A;  4U4X A;  1P1W A;  1B5J A;  4X48 A;  2NWJ A;  3RLF E;  2AL4 A;  1VR5 A;  2NVU B;  2DWI A;  2F7C A;  2Q89 A;  3MW0 A;  3CG1 A;  4G2Z A;  5I2K B;  4ZZA A;  3RPW A;  1NH7 A;  1LFG A;  5KCJ A;  1B3E A;  4P0G A;  4TLM B;  3TTM A;  3FAS A;  4RYA A;  1MY0 A;  1MM7 A;  1Y3N A;  2F7A A;  2I0B A;  3FZV A;  1SDX A;  4YB5 A;  1GGG A;  2QS4 A;  3C9H A;  2ZNU A;  4OFL A;  3K1N A;  4DXC A;  5B7D A;  1QUK A;  1B51 A;  3KFM A;  4G8H A;  1Z7M E;  2UVJ A;  2HXW A;  3GBB A;  1NL5 A;  3KN3 A;  1HSL A;  3LR1 A;  1OQH A;  4ONY A;  2THI A;  1VFD A;  3IOU A;  2NXO A;  4LA9 A;  3MAM A;  2D3I A;  4YAH X;  4BDQ A;  2ZNT A;  3TMG A;  1GV8 A;  1R9L A;  4DE8 A;  2PBW A;  3JZJ A;  5DEX B;  3VFJ A;  1HSE A;  5A5X B;  1SYI A;  3S9M C;  2H4I A;  1B7H A;  3O97 A;  1MQI A;  1POY 1;  1QUI A;  1P1Q A;  4GLI A;  3Q25 A;  3MUQ A;  4IB2 A;  4XKN A;  1M5F A;  5L9O A;  1MS7 A;  1NNT A;  2H98 A;  2OBG A;  4KHZ E;  2R71 A;  3IO4 A;  1US4 A;  1LFH A;  3ECR A;  1TWY A;  3U93 A;  4ISU A;  5FTI A;  1B5H A;  2XXT A;  3IB1 A;  1UIU A;  4MLV A;  3RQT A;  1Y4C A;  4Q30 B;  3RUM A;  3QXM A;  5JEI A;  2ABH A;  1I6B A;  1O7T A;  2UVI A;  2ZNS A;  4XKP A;  5ELV A;  5DVJ A;  4LZ5 A;  3VLU A;  3C31 A;  3BBR A;  4NTL A;  4EDP A;  2I58 A;  3MC2 A;  5DYH A;  4F1Y A;  2PYY A;  3UP9 A;  3CFX A;  2F6G A;  3UA8 A;  5H8F A;  4X9T A;  3RT6 B;  1M5B A;  2OWS A;  4C1U A;  3M3F A;  1M5E A;  1UQW A;  1MY3 A;  1Q35 A;  4ZEB A;  4XIG Q;  2Z8E A;  4QFP A;  3FJG A;  3HHG A;  3KOS A;  3G3H A;  3UK4 A;  3VLV A;  2OCU A;  4P11 A;  3VVF A;  5I57 A;  2VD3 A;  4DXU A;  1SQY A;  1XHY A;  2XXV A;  1S9T A;  2QJE A;  4R75 A;  1YCJ A;  3GXA A;  5AA4 A;  1Z7N E;  1UTH A;  3CSG A;  4EF2 A;  5I58 B;  2GHA A;  1ZKB A;  4JBZ A;  5H8S A;  4XXU A;  3VV5 A;  2PVU A;  2DQV A;  2UYF A;  1DMB A;  3EHU A;  4YZZ A;  4QRZ A;  5TPA A;  3H6T A;  3FJM A;  4LZ8 A;  3W15 C;  1URS A;  3OO8 A;  4R73 A;  2RKM A;  3KN8 A;  4BDL A;  4BDR A;  1N84 A;  2OLB A;  3LUY A;  3LBS A;  4JSD A;  4WXJ A;  3A3U A;  1JVY A;  4OEU A;  1Y4T A;  3MJN A;  4PFY A;  1IIW A;  4F31 B;  1LFI A;  1EU8 A;  1MM6 A;  1MXW A;  5M2V A;  2ZYN A;  3LC8 A;  1B32 A;  3K6W A;  1MXX A;  2A5S A;  2UXA A;  5H8N A;  4RNS A;  1D3K A;  3PUV E;  2QRY A;  5L8D A;  3BFT A;  1JQF A;  5JTY B;  5CBS A;  3MZ9 A;  4U4S A;  2QMW A;  5TP9 B;  4C0R A;  5H8N B;  4ECF A;  4POW A;  2R9J A;  1DOT A;  4E0W A;  2Z8F A;  1VFE A;  2H99 A;  1XVX A;  4MBP A;  5H8Q B;  3O2A A;  1LAF E;  3RTW B;  4NWC A;  3TEL A;  2Y7P A;  1F9B A;  4EQ9 A;  2A5T B;  3PPR A;  3CSB A;  5EHM A;  2DSF A;  3K6U A;  3CVG A;  4M1V A;  1P99 A;  1UTB A;  5FHM A;  2O69 A;  3IOV A;  3BFU A;  3FXR A;  2P0S A;  2GRV A;  4F18 A;  4AQ4 A;  4H0W A;  1D9V A;  1JW4 A;  2I3V A;  3T22 A;  3E3K A;  3IO6 A;  3K4U A;  3M3K A;  3IB0 A;  3OSQ A;  3VE1 B;  1S50 A;  2XX8 A;  3N94 A;  1SD3 A;  1MQG A;  3KG2 A;  1PDA A;  2Y7R A;  2G29 A;  3O66 A;  3B7D A;  4YMB A;  1ZBM A;  1B3F A;  2DE4 A;  3Q29 A;  4I8C A;  4ZEF A;  3VLW A;  3VXB A;  3T96 B;  3OEL A;  4G8N A;  1B3H A;  1N04 A;  2ZXT A;  5L9S A;  1B3L A;  4ZEC A;  1MPC A;  1Y1Z A;  4H1X A;  5I2K A;  3FVN A;  2O6A A;  2Q2A A;  3DP4 A;  3Q26 A;  3G3G A;  4IO5 A;  3FVK A;  3MVW A;  4FJP A;  4R2B A;  1BIY A;  2DXR A;  2UYE A;  3CI8 A;  3EHS A;  3PMW A;  5I2N B;  1OIB A;  4BLA A;  4ZE9 A;  3ZS6 A;  4TOZ A;  4YU0 A;  4YB7 A;  1SW1 A;  1LB8 A;  1HSJ A;  3HCQ A;  1FQA A;  2E1S A;  1Q1K A;  1SI0 A; 
#chains in the Genus database with same CATH topology
 4HCW A;  1UIV A;  2O1L A;  3CIJ A;  2OZZ A;  4F39 A;  4JB7 A;  2DE2 A;  1FRP A;  2QVV A;  1FQC A;  5DT6 A;  2VT5 A;  4PGP A;  3LSF B;  3RY3 A;  2IEE A;  2HEU A;  3MWB A;  5J1D A;  1Y3P A;  4MNI A;  2DP8 A;  3B6T A;  4HE0 A;  5AA2 A;  4IO3 A;  1XC1 A;  2XWI A;  4X04 A;  2KR0 A;  4OVQ A;  3SET A;  3EKI A;  5FTH A;  4Q0C A;  4G68 B;  3SEU A;  3THI A;  4UAB A;  3H7M A;  1MQJ A;  1B4Z A;  1URG A;  4NF8 A;  1O63 A;  1TXF A;  4QSC A;  5CMK A;  1II5 A;  3TPA A;  4LAT A;  1KZ8 A;  5LTC A;  4LVQ A;  2NOO A;  2DE3 A;  4OFJ A;  2LAO A;  3IR1 A;  1FPG A;  3K00 A;  1MY4 A;  4RK9 A;  4THI A;  3FV2 A;  3IJO B;  4RPN A;  3T9U A;  3VDF A;  3CFZ A;  1KWH A;  1D4N A;  4U2R A;  1AOV A;  3FVO A;  3EN3 A;  4YB6 A;  4MJO A;  1B1X A;  1SVX B;  2VGQ A;  4HTG A;  3W9V A;  5L9M A;  2DS9 A;  3ZKL A;  5I2N A;  1JVX A;  1JNF A;  1ELJ A;  3I3V A;  4C1T A;  3IOR A;  3IOW A;  2HFB A;  3FUZ A;  1Y9U A;  2H5Y A;  3PUY E;  2QL3 A;  4O3B A;  4FEC A;  1DSN A;  1BP5 A;  4F19 A;  3PUX E;  3TAJ A;  4GRK A;  3T9H B;  1MDQ A;  1XOC A;  4O3C A;  4ND9 A;  3TUS A;  1D9Y A;  1YPN A;  3SKP A;  5H8H A;  2Y7K A;  1PBQ A;  4F22 A;  1MXZ A;  4PGN A;  2QVR A;  1US5 A;  2I0C A;  4JWX A;  2QSX A;  4IY6 A;  1NKX A;  4GX6 A;  5KDT A;  3N6T A;  2F97 A;  4U22 A;  1JW1 A;  4OET A;  1B7U A;  4OXV A;  3V83 A;  3I5O A;  4NF6 B;  4GXS B;  3IK6 B;  3T9X B;  1LEV A;  2QMX A;  3T0J A;  4I9D A;  1Q9D A;  2X7P A;  3IOT A;  2I4B A;  2Q88 A;  3E4R A;  3ILU B;  4DIG A;  2F34 A;  2Y7W A;  2F3B A;  3KSX A;  1FTA A;  4MEV A;  3WAE A;  3VVE A;  1R1N A;  3L6G A;  2XD2 A;  1XVY A;  2I49 A;  2MKZ A;  3OEK A;  4I1D A;  1LLS A;  3DLN A;  5KZT A;  2V25 A;  1LAG E;  4N13 A;  4H8I A;  4OWD A;  2Y7I A;  1DBZ A;  3DP6 A;  2I4C A;  1JEU A;  4ELO A;  4EQ7 A;  4OTE A;  1S7Y A;  2O1M A;  2CMO A;  1AL3 A;  3O9P A;  2DVZ A;  1SW2 A;  2QS2 A;  3S4U A;  3PV0 E;  1VSO A;  1A8F A;  3PUW E;  1I6A A;  2V3T A;  4EUO A;  1EZO A;  1INP A;  1MXY A;  3CG3 A;  5IZ3 A;  3RPL B;  1FCK A;  5ET8 A;  1SPI A;  3VXB A;  5KDT B;  4KYD A;  4DCX A;  4HCY A;  4TQU Q;  1AIV A;  5AA2 B;  2Y84 A;  3N6U A;  2HZK A;  4R6H A;  2DOJ A;  1LCF A;  1MDP 1;  1H43 A;  4O3A A;  2RF1 A;  5I59 B;  4G4P A;  4BDN A;  4WEP A;  4H67 A;  4OVS A;  4JXI A;  4F3S A;  1YAE A;  4H5G A;  3V89 B;  1P1O A;  1LBX A;  3EPE A;  3G3K A;  1DK4 A;  2PT1 A;  3MP1 A;  4U21 A;  4NN3 A;  4MH5 A;  1CNQ A;  1VE4 A;  1MXV A;  5JK4 A;  2GHB A;  2PT2 A;  1NV3 A;  2ZYO A;  3U8Q A;  3K0V A;  4I3Y A;  4DXB A;  5CRY A;  4PAK A;  1FQD A;  2CEX A;  2RC9 A;  5ITP A;  2F5X A;  3C34 A;  1N76 A;  1KA1 A;  5AA3 A;  4U4X A;  4X48 A;  2BJI A;  2NWJ A;  3RLF E;  2AL4 A;  2NVU B;  2DWI A;  4ZZA A;  1NH7 A;  1B3E A;  4RYA A;  4DI3 D;  2F7A A;  2I0B A;  3C9H A;  5B7D A;  1NUW A;  2XWO A;  1HSL A;  3IOU A;  4LA9 A;  4BDQ A;  4DE8 A;  3JZJ A;  1FSA A;  1SYI A;  1POY 1;  4GLI A;  2OBG A;  1FBD A;  2R71 A;  3U93 A;  4MLV A;  3RUM A;  4Q30 B;  3QXM A;  1I6B A;  1O7T A;  2UVI A;  3VLU A;  3C31 A;  2I58 A;  3QMF A;  4F1Y A;  3CFX A;  2F6G A;  3M3F A;  1M5E A;  1MY3 A;  1Q35 A;  4ZEB A;  4QFP A;  3HHG A;  3GXA A;  2GHA A;  3VV5 A;  2DQV A;  2UYF A;  5TPA A;  3H6T A;  3B8B A;  3LUY A;  4JSD A;  3A3U A;  4PFY A;  1LFI A;  1MM6 A;  3LC8 A;  1B32 A;  4AS4 A;  2A5S A;  1D3K A;  5L8D A;  5JTY B;  3PTY A;  3MZ9 A;  4HE1 A;  2QMW A;  2R9J A;  1DOT A;  4E0W A;  2Z8F A;  4MBP A;  1F9B A;  3PPR A;  4M1V A;  4X8R A;  3IOV A;  3BFU A;  1FPE A;  3T22 A;  3IO6 A;  4N17 A;  3VE1 B;  1FBC A;  3N94 A;  1ZBM A;  4I8C A;  4G8N A;  2ZXT A;  4ZEC A;  3G3G A;  5IM2 A;  3MVW A;  5I7I A;  4ZE9 A;  4YB7 A;  4KD5 A;  2E1S A;  2Z23 A;  1LGB C;  4GVO A;  4N81 A;  4O8M A;  4Q5T A;  1QUL A;  4N07 A;  4NE4 A;  4ELQ A;  3IX1 A;  2FA7 A;  4QFK A;  4FEB A;  1Y20 A;  2O7U A;  2I48 A;  3H6W A;  4IO6 A;  4ESX A;  3SEV A;  3RN8 A;  1OVB A;  2ZZV A;  3GLB A;  1FTK A;  4N15 A;  3GZG A;  3HO7 A;  2YPN A;  1LBB A;  2XXX A;  4PE5 B;  3U92 A;  4IR8 A;  1MH3 A;  4NG7 A;  2DYX A;  1RDY A;  1USY E;  2F3D A;  4GOT A;  3V5A A;  2I6E A;  1B4H A;  2ONK E;  3K1P A;  4PP0 A;  4IO4 A;  1NV7 A;  3TTK A;  4YKP A;  3U1O A;  2AL5 A;  1EH3 A;  5I59 A;  4PAF A;  2AYS A;  1N3W A;  3QUF A;  2VD2 A;  4XEQ A;  4RY1 A;  1LST A;  2B3F A;  5A5L A;  1N3X A;  3OD7 A;  2XWK A;  1NNP A;  3KOT A;  5CMB A;  2PCR A;  5EQA A;  1B52 A;  1FBF A;  1B5I A;  2ZMB A;  1XT8 A;  4GBW A;  2Q2C A;  1Y1M A;  4XKQ A;  2DDK A;  3O6H A;  4JVI A;  4OVP A;  5IAI A;  4GFR A;  1NFT A;  3EHT A;  3IFC A;  1POT A;  5FBP A;  4DDD A;  1NUX A;  2DVC A;  2V3U A;  2G93 A;  4IO2 A;  1O64 A;  4P3L A;  4HE2 A;  2ONR A;  4PFW A;  4LON B;  3OOA A;  1N0T A;  2HXR A;  1P1U A;  3SER A;  3PPO A;  3B50 A;  2ONS A;  4ESW A;  3I6V A;  2NUV A;  4YIC A;  1B9J A;  3ODB A;  1MQD A;  3G3J A;  3IAZ A;  3S2V A;  3MQ9 A;  2CEY A;  2F78 A;  4G68 C;  2V93 A;  4GIZ A;  5ITO A;  2PX1 A;  5BUU A;  3MPK A;  4LQ2 A;  1NH8 A;  1H76 A;  3PPQ A;  2REJ A;  2W7Y A;  3JV9 A;  3DP8 A;  1LBY A;  4KFQ A;  2RC7 A;  4PF6 A;  4ZS9 A;  4H46 A;  4NF4 A;  4OZ9 A;  5I84 A;  2P3V A;  4P0I A;  5TPA B;  1QW0 A;  3OO7 A;  3SES A;  4JDF A;  4PAI A;  4LN5 A;  4QFO A;  3HST A;  1LBC A;  5DTB A;  1SW4 A;  3Q27 A;  4GL0 A;  4R74 A;  1LBZ A;  2O51 A;  3FXQ A;  1RDZ A;  5AA1 A;  2R8T A;  3MP6 A;  3FAT A;  3K02 A;  2O7I A;  3KZG A;  4UA8 A;  4E0X A;  3KC0 A;  4GWY A;  2FYI A;  3B6Q A;  3MVX A;  3G3I A;  4GBV A;  2H25 A;  4OQO A;  4PF8 A;  4UAC A;  5EQ8 A;  2WEF A;  2I3W A;  1PC3 A;  4HXV A;  1ANF A;  2VOZ A;  2HQ0 A;  5I5P A;  4GWX A;  2D21 A;  3C32 A;  1BTJ A;  3A3C A;  4H6D A;  2HCA A;  2QFL A;  3FGS A;  4H65 A;  4KYE A;  1DPE A;  4I62 A;  5EYH A;  1TFA A;  2PFY A;  2B65 A;  3E79 A;  1IQ7 A;  2KQZ A;  3M8U A;  4JSO A;  2CZH A;  1FBG A;  3FD3 A;  1EZP A;  4QSD A;  1DPP A;  2JJK A;  3OMB A;  3T9V A;  3FIR A;  2OK2 A;  4MLQ A;  4PET A;  4OEV A;  2DXY A;  5I57 B;  4F2O A;  3VXC A;  4ELP A;  1QKA A;  1I69 A;  3MVY A;  3HN0 A;  2WBB A;  3CFL A;  3TQL A;  5ET6 A;  4H5F A;  4MFI A;  1PBP A;  5BWJ A;  3KN7 A;  2FIE A;  3MST A;  4ZZE A;  2F36 A;  3RYD A;  3AXF A;  5CMC A;  4PFT A;  5H8Q A;  1NNK A;  2D5W A;  4L17 A;  4KCD A;  2DWA A;  2XXY A;  4FOR A;  4P47 A;  5FHN A;  2GH9 A;  3M3L A;  3PMX A;  5I3S A;  1H45 A;  1B3G A;  4JVC A;  1ATG A;  4BDO A;  3QAX A;  1YXI A;  1LAH E;  3R26 A;  4I3E A;  1N7W A;  1FTJ A;  3H6V A;  1QKB A;  1IXH A;  1IZ1 A;  1NV6 A;  1B5J A;  1VR5 A;  2F7C A;  2Q89 A;  3LV0 A;  1LFG A;  3TTM A;  3SZP A;  2HPG A;  3FZV A;  2QS4 A;  2ZNU A;  4OFL A;  3K1N A;  1B51 A;  4N8G A;  1NL5 A;  4ONY A;  4MAG A;  1EYK A;  5IZ1 A;  5DEX B;  3HFU A;  4NAP A;  1B7H A;  3O97 A;  4XKN A;  1MQI A;  1P1Q A;  3MUQ A;  1NNT A;  4KHZ E;  3IO4 A;  3ECR A;  4ISU A;  5FTI A;  1B5H A;  4F3P A;  1Y4C A;  5DYH A;  3MC2 A;  3UP9 A;  2WX9 A;  4XIG Q;  3G3H A;  3VLV A;  2OCU A;  2VD3 A;  4N6D A;  5EQ7 A;  1S9T A;  2QJE A;  5H8S A;  3E78 A;  2PVU A;  1URS A;  1EYI A;  4R73 A;  3KN8 A;  4BDL A;  4OA4 A;  4OEU A;  1JVY A;  4NQ8 A;  1IIW A;  2ZYN A;  1FPJ A;  1MXX A;  2B4M A;  3PUV E;  2QRY A;  4U4S A;  5TP9 B;  1VFE A;  3LUZ A;  1XVX A;  3RTW B;  3O2A A;  4FAJ A;  4NWC A;  1BK4 A;  3CSB A;  5FHM A;  1UTB A;  2P0S A;  2GRV A;  4H0W A;  4GWW A;  3ROJ A;  2I3V A;  3K4U A;  3IB0 A;  1PDA A;  2G29 A;  3O66 A;  3B7D A;  4YMB A;  3OEL A;  1MPC A;  3Q26 A;  4FJP A;  2DXR A;  1OIB A;  4TOZ A;  3HCQ A;  3VVD A;  2X7Q A;  3KBZ A;  3C35 A;  4QFL A;  4EF1 A;  4IY5 A;  2Q74 A;  3TOD A;  5CI5 A;  3FJ7 A;  3L6H A;  2Z22 A;  3P7I A;  5LDZ A;  5EYF A;  1WOD A;  1K9Z A;  3HHF A;  4BDM A;  2VHA A;  1OVT A;  1TT1 A;  3H6U A;  1SBP A;  3TCH A;  3D1R A;  2OWT A;  3A09 A;  1BLF A;  3MZB A;  4EXL A;  1B0H A;  1M5C A;  1MY2 A;  3MBP A;  1B7Z A;  4JVD A;  5DVF A;  1Y3Q A;  4Z0I A;  1FBH A;  4LZ7 A;  1TFD A;  1UTH B;  3T93 B;  2V4C A;  4F2Q A;  4OEN A;  5FHO A;  2YLN A;  2FHY A;  3WAF A;  3T66 A;  2RIN A;  3G3F A;  3N5L A;  4FAT A;  5TP9 A;  1B6H A;  4MCO A;  4P9K A;  2QS3 A;  4GWZ A;  1WDN A;  1UTB B;  3K6V A;  2XWV A;  3PPP A;  5J16 A;  4RK2 A;  2CZL A;  4DCY A;  4R72 A;  2FVZ A;  3D4G A;  1XI6 A;  3TYH A;  4M4G A;  3GBA A;  4QSE A;  4LP2 B;  1PB9 A;  3S9L C;  3OXN A;  1OLA A;  4KQP A;  2XXP A;  1B2H A;  2DWH A;  4POX A;  2O84 X;  3FBP A;  4OVJ A;  1M5D A;  4GWO A;  1FBE A;  1LBV A;  5A5X A;  1MY1 A;  4KCC A;  1QGX A;  2RCB A;  4NGU A;  2ZYM A;  2XXI A;  5IGA A;  3O28 A;  4HS7 A;  5DEX A;  4JWY A;  3ZSF A;  3OEM A;  2PMS A;  1NI9 A;  4MHF A;  2Q9T A;  1FTL A;  1FPI A;  1OMP A;  5CBR A;  2XXK A;  1FJ6 A;  4NF5 A;  3JYR A;  4EQB A;  4PFU A;  1P1N A;  4R6Y A;  2H9B A;  4GF8 A;  4RXL A;  3KBR A;  3IFA A;  4MIJ A;  3DEL B;  4NF4 B;  3CRB A;  1FPK A;  3UN6 A;  4LQ5 A;  5AE4 A;  1AH5 A;  3PPN A;  1FQF A;  2XXQ A;  2CZI A;  4IO7 A;  2P3N A;  1DTG A;  4R9F A;  4IGR A;  4AB5 A;  1EZ9 A;  3OO6 A;  4XTC Q;  4F3G A;  3K6X A;  2RC8 A;  2XD3 A;  3EF7 A;  3KSJ A;  4ZEK A;  4DI4 B;  3O29 A;  1BKA A;  3FV1 A;  1ZMG A;  1PB8 A;  1XS5 A;  3KJ7 A;  3LSL A;  1A99 A;  1T0K A;  2REG A;  4FED A;  1L5T A;  3BKI B;  5CBS A;  3QK6 A;  1FPD A;  4KR5 A;  1B58 A;  4QBA A;  3QYT A;  2UVG A;  2HAU A;  1IXC A;  1YZ0 A;  4MX6 A;  5ICT A;  2WKY A;  3PUZ E;  1YYZ A;  1LCT A;  3KEI A;  1IXI A;  3SEW A;  4R9G A;  5ESY A;  5ET7 A;  3MP8 A;  1MXU A;  4YKI A;  4XFE A;  4O7I A;  3TTL A;  4OES A;  3ZKK A;  5B70 A;  2QVU A;  2Q8M A;  2GFE A;  2XXU A;  4NF5 B;  4MMP A;  4GWU A;  3UOR A;  3ZS6 A;  5CMM A;  3HV1 A;  4R6K A;  4GWS A;  1AWB A;  3C36 A;  4P1E A;  2XXR A;  2F35 A;  2X26 A;  4MF3 A;  4K3F A;  4N4U A;  5EHS A;  4N6K A;  3V8X B;  2P2A A;  3LSX A;  1ZU0 A;  3F11 A;  5JTY A;  4GL8 A;  3CR9 A;  2PFZ A;  4F29 A;  4YKJ A;  2CZK A;  1NV4 A;  1JEV A;  4PTK A;  4X1B A;  1KA0 A;  4NHB A;  5I56 A;  1OQG A;  4F3B A;  1RYO A;  5K2Y A;  1G0I A;  3ISP A;  1I6Q A;  4KI0 E;  4OAN A;  2F8D A;  1R9Q A;  1FBP A;  4OVT A;  2Y5L A;  3RPW A;  4NF0 A;  3CG1 A;  4P0G A;  4PDH A;  3FAS A;  1MY0 A;  1MM7 A;  4YB5 A;  1SDX A;  3KFM A;  4G8H A;  1Z7M E;  2VPN A;  4PE3 A;  2UVJ A;  1JP4 A;  3A29 A;  3GBB A;  3KN3 A;  1OQH A;  3MAM A;  2D3I A;  4YAH X;  2ZNT A;  3TMG A;  1GV8 A;  1FPF A;  1R9L A;  5A5X B;  3S9M C;  2HHM A;  2H4I A;  1QUI A;  5L9O A;  4PFI A;  1M5F A;  4GX3 A;  3IB1 A;  1UIU A;  5DW8 A;  3CHG A;  2ZNS A;  4XKP A;  5ELV A;  3BBR A;  4NTL A;  1NV2 A;  3RPL A;  2PYY A;  4XF5 A;  3UA8 A;  5H8F A;  1UQW A;  3KOS A;  3UK4 A;  4P11 A;  3VVF A;  1XHY A;  4R75 A;  1YCJ A;  1Z7N E;  4EF2 A;  1ZKB A;  4JBZ A;  4YZZ A;  1DMB A;  4QRZ A;  4P8B A;  4LZ8 A;  3OO8 A;  4WXJ A;  3LBS A;  4F31 B;  1EU8 A;  3K6W A;  4RNS A;  1JQF A;  4C0R A;  5H8N B;  4ECF A;  4POW A;  2H99 A;  5ET5 A;  1LAF E;  4EQ9 A;  2DSF A;  3K6U A;  1P99 A;  2O69 A;  3FXR A;  4AQ4 A;  2OWZ A;  1D9V A;  1JW4 A;  3E3K A;  3BIG A;  3M3K A;  3OSQ A;  2XX8 A;  3KG2 A;  4ZEF A;  3VLW A;  1IMF A;  3T96 B;  1N04 A;  1Y1Z A;  4H1X A;  3FVN A;  2O6A A;  4IO5 A;  3FVK A;  2UYE A;  3CI8 A;  4BLA A;  4YU0 A;  1LB8 A;  2AIX A;  1Q1K A;  1NV5 A;  1FJ9 A;  3SEY A;  1MG1 A;  1FTO A;  3C4M A;  3H3G A;  2V3Q A;  3QSL A;  2WYK A;  4QHQ A;  4XKR A;  1PB7 A;  1QUJ A;  3RTF B;  5ISU A;  3K2D A;  1H44 A;  1B05 A;  2O68 A;  4OYV A;  3PGF A;  2XXH A;  2OJT A;  1YTV A;  1FQE A;  1QVS A;  4I40 A;  1NUY A;  1EYJ A;  4QFN A;  1QJM A;  3MZ1 A;  4G68 A;  4RPO A;  2ANJ A;  2L5V A;  2QS1 A;  5HM4 B;  4AB6 A;  3OEN A;  2Y5K A;  5F24 A;  1IMB A;  5K2X A;  5F7V A;  1ZIU A;  4NF8 B;  4NMY A;  1J1N A;  3BIH A;  4RJZ A;  1DCU A;  4GQO A;  2B4L A;  4OER A;  4OMB A;  4HW8 A;  4N6P A;  2GQ1 A;  1FPB A;  3TDJ A;  2UVH A;  1MH4 A;  2ALU A;  5IKB A;  5I56 B;  4KXP A;  4ZED A;  4WED A;  3PMV A;  5LOM A;  1RKM A;  3PD9 A;  1USY H;  2ESN A;  3U94 A;  2M8C A;  2XXW A;  4RA1 A;  2XHD A;  3TCF A;  1IIT A;  3MPL A;  1B0L A;  4R2F A;  3C33 A;  3LSW A;  2B3B A;  1IXG A;  5KCJ B;  3D4C A;  5CM6 A;  3PU5 A;  4G77 A;  4BDR A;  3U72 A;  2OX3 A;  3ONM A;  3TTN A;  3ILT B;  2HAV A;  3H06 B;  4YKK A;  2YJP A;  3IJX B;  2ZYK A;  1MPB A;  3USD A;  1PEB A;  3EQ1 A;  1IUD A;  2XX7 A;  3TEP A;  2WBD A;  1GTK A;  3UIF A;  4H45 A;  3O6G A;  3TZA A;  2QPQ A;  1N7X A;  4YMA A;  4N8Y A;  3UGW A;  3KJT A;  5IZZ A;  3TTR A;  3RT8 A;  4N91 A;  3MVZ A;  5H8H B;  3IL1 B;  2RCA A;  4G8M A;  3OSR A;  4WKM A;  3B6W A;  4PQJ A;  4PFB A;  5H8F B;  4OHN A;  3K1M A;  5AA4 B;  3G7W A;  1FTM A;  3OO9 A;  4KPT A;  1IME A;  4NF6 A;  1NUZ A;  4JWO A;  4FIM A;  3DM0 A;  2E0S A;  2KLF A;  4ELR A;  1H3D A;  1URD A;  3E9X A;  4KYS A;  3R7X A;  3GYY A;  1A8E A;  4EXK A;  4GD5 A;  1LBW A;  4FBP A;  4MNP A;  2Q8J A;  1SW5 A;  3K01 A;  2R6G E;  4U23 A;  5T3J A;  2A5T A;  2F7B A;  5F1Q A;  1B40 A;  2FNC A;  2V84 A;  3NOH A;  1FQB A;  1WVJ A;  3FVG A;  2F6P A;  1IMD A;  4DLD A;  1MPD A;  4H8J A;  4QF9 A;  1CE2 A;  1JET A;  5EYG A;  3SDF A;  4PDD A;  5HBC A;  4U1O A;  3TFL A;  3R6U A;  1A7L A;  1IEJ A;  1LB9 A;  4F1U A;  4DZ1 A;  1GR2 A;  1RYX A;  4FE8 A;  4ZE8 A;  1A54 A;  3H03 A;  3RGY A;  2IA4 A;  4G61 A;  3HPI A;  1AMF A;  5AA2 D;  4OVR A;  4Q8R A;  4PFR A;  3SEX A;  1FW0 A;  3E13 X;  3MYU A;  4Z7E A;  5TU0 A;  4U1Z A;  4P1L A;  3T1B A;  3KC1 A;  2XA5 A;  2XX9 A;  1VDW A;  3O6I A;  1B1H A;  4O94 A;  1DTZ A;  1CB6 A;  5CC2 A;  4P56 A;  1R6Z A;  1MQH A;  4ZDM A;  2ZZW A;  3KGC A;  5IZ3 B;  1NNF A;  1OLC A;  1LAX A;  1GVC A;  1FPL A;  1B46 A;  1RDX A;  3TKD A;  4NWD A;  2HZL A;  1SYH A;  3N26 A;  1A55 A;  3TCG A;  4NX1 A;  3S9E A;  3W9W A;  4X1D A;  4QXD A;  3TQW A;  3IB2 A;  4AS5 A;  2Z8D A;  3QUJ A;  5I58 A;  4TLL B;  3PD8 A;  4IGT A;  3H4Z A;  3QIM A;  3RNN A;  2P1S A;  3S9N C;  4LUB A;  1SI1 A;  4OFO A;  2VP1 A;  1A40 A;  5HPQ A;  3Q28 A;  5DVI A;  2BJJ X;  5ICQ A;  4NED A;  1ZJL A;  1NMU A;  1JW5 A;  4GX4 A;  4GXA A;  2DWJ A;  3FXU A;  1ZLQ A;  4F1V A;  1ZTY A;  4PCD A;  1MRP A;  1P1W A;  2VPO A;  2FIX A;  5I2K B;  4G2Z A;  3MW0 A;  5KCJ A;  4O7M A;  4TLM B;  1Y3N A;  4DXC A;  1GGG A;  1QUK A;  2HXW A;  3LR1 A;  2THI A;  1VFD A;  2NXO A;  4PBH A;  2PBW A;  3VFJ A;  1HSE A;  4ZEI A;  2ZZX A;  3Q25 A;  4IB2 A;  1MS7 A;  2H98 A;  1US4 A;  1LFH A;  1IMC A;  1TWY A;  1G0H A;  2XXT A;  5JEI A;  3RQT A;  2ABH A;  5DVJ A;  4LZ5 A;  4EDP A;  1IMA A;  4PC9 A;  4X9T A;  3RT6 B;  1M5B A;  2OWS A;  4C1U A;  2Z8E A;  3FJG A;  5I57 A;  4DXU A;  1SQY A;  2XXV A;  1K9Y A;  2FBP A;  5AA4 A;  1UTH A;  3CSG A;  5I58 B;  4XXU A;  3EHU A;  3FJM A;  3W15 C;  2RKM A;  1N84 A;  2OLB A;  1Y4T A;  3MJN A;  5M2V A;  1MXW A;  3U65 A;  3FXB A;  2UXA A;  5H8N A;  3BFT A;  4PBQ A;  5H8Q B;  3TEL A;  2Y7P A;  2A5T B;  5EHM A;  3CVG A;  4F18 A;  1D9Q A;  1S50 A;  1SD3 A;  1MQG A;  2Y7R A;  1B3F A;  2DE4 A;  2WYP A;  3Q29 A;  5EQ9 A;  5L9S A;  1B3H A;  1NV0 A;  1B3L A;  5I2K A;  2Q2A A;  3DP4 A;  1NV1 A;  4R2B A;  1BIY A;  3EHS A;  4MNC A;  5I2N B;  3PMW A;  1SW1 A;  1HSJ A;  1FQA A;  1SI0 A; 
#chains in the Genus database with same CATH homology
 1LGB C;  5LOM A;  4HCW A;  4GVO A;  2X7Q A;  1UIV A;  2O1L A;  3C35 A;  4Q5T A;  1QUL A;  4N07 A;  4NE4 A;  3CIJ A;  3SEY A;  4ELQ A;  3IX1 A;  2OZZ A;  4ZEI A;  2FA7 A;  4QFK A;  4F39 A;  4FEB A;  4QFL A;  4JB7 A;  1MG1 A;  2DE2 A;  1Y20 A;  2O7U A;  4EF1 A;  1FTO A;  2I48 A;  3H6W A;  4IO6 A;  1FQC A;  3C4M A;  5DT6 A;  4C1T A;  4IY5 A;  4ESX A;  3H3G A;  2V3Q A;  3SEV A;  3QSL A;  3TOD A;  4QHQ A;  4XKR A;  5CI5 A;  1PB7 A;  3LSF B;  3FJ7 A;  3RN8 A;  1QUJ A;  3L6H A;  2IEE A;  2Z22 A;  3P7I A;  1OVB A;  2HEU A;  3K2D A;  3MWB A;  3RTF B;  1H44 A;  1B05 A;  5ISU A;  3GLB A;  1FTK A;  5J1D A;  1Y3P A;  2O68 A;  3GZG A;  4OYV A;  3HO7 A;  2DP8 A;  5EYF A;  3B6T A;  2YPN A;  3PGF A;  1WOD A;  3HHF A;  2XXH A;  4BDM A;  1GVC A;  1LBB A;  2VHA A;  2XXX A;  4PE5 B;  4IO3 A;  3TKD A;  1XC1 A;  5AA2 A;  3U92 A;  2OJT A;  1OVT A;  1TT1 A;  1MH3 A;  1YTV A;  3H6U A;  3TCF A;  2DYX A;  1FQE A;  3SET A;  1SBP A;  3TCH A;  1QVS A;  5FTH A;  1USY E;  2OWT A;  3A09 A;  4GOT A;  1BLF A;  3MZB A;  4EXL A;  1B0H A;  3V5A A;  4Q0C A;  4G68 B;  1M5C A;  1B4H A;  1MY2 A;  2I6E A;  2ONK E;  3MBP A;  3K1P A;  4PP0 A;  3SEU A;  4IO4 A;  4QFN A;  1QJM A;  3THI A;  1B7Z A;  3MZ1 A;  4G68 A;  4RPO A;  4YKP A;  3TTK A;  3H7M A;  2ANJ A;  1MQJ A;  5DVF A;  3U1O A;  1B4Z A;  1Y3Q A;  2AL5 A;  4Z0I A;  1EH3 A;  1URG A;  2QS1 A;  5HM4 B;  4AB6 A;  4LZ7 A;  1TFD A;  5I59 A;  3OEN A;  1UTH B;  2AYS A;  4NF8 A;  5K2X A;  3T93 B;  1O63 A;  1TXF A;  4QSC A;  1N3W A;  3QUF A;  4F1U A;  4F2Q A;  5F7V A;  5CMK A;  1ZIU A;  4OEN A;  4NF8 B;  5FHO A;  1II5 A;  2VD2 A;  2YLN A;  4NMY A;  3WAF A;  1J1N A;  4RY1 A;  3TPA A;  1LST A;  2B3F A;  3T66 A;  4LAT A;  2RIN A;  3G3F A;  3N5L A;  4LVQ A;  4FAT A;  2NOO A;  4RJZ A;  5TP9 A;  1B6H A;  2DE3 A;  4OFJ A;  2LAO A;  1N3X A;  3OD7 A;  2QS3 A;  3IR1 A;  4GQO A;  1NNP A;  3KOT A;  3K00 A;  1MY4 A;  1WDN A;  1UTB B;  4OER A;  3K6V A;  4RK9 A;  3PPP A;  4THI A;  4OMB A;  3FV2 A;  4HW8 A;  4N6P A;  5CMB A;  4RK2 A;  2CZL A;  2UVH A;  1MH4 A;  2ALU A;  3TDJ A;  4DCY A;  5IKB A;  3IJO B;  4R72 A;  5I56 B;  1B52 A;  3D4G A;  4ZED A;  4WED A;  4RPN A;  3T9U A;  3PMV A;  3VDF A;  1RKM A;  1KWH A;  1D4N A;  3CFZ A;  1USY H;  2ESN A;  3PD9 A;  1B5I A;  3TYH A;  2ZMB A;  4M4G A;  1XT8 A;  4U2R A;  1AOV A;  3U94 A;  2M8C A;  3FVO A;  2XXW A;  4RA1 A;  2XHD A;  3GBA A;  1IIT A;  4LP2 B;  2Q2C A;  1PB9 A;  3EN3 A;  3MPL A;  1Y1M A;  4QSE A;  1B1X A;  4XKQ A;  4YB6 A;  1SVX B;  3O6H A;  1B0L A;  2AIX A;  2VGQ A;  5IAI A;  4HTG A;  4GFR A;  4R2F A;  1NFT A;  3W9V A;  5L9M A;  3C33 A;  3EHT A;  3LSW A;  2B3B A;  1POT A;  2DS9 A;  3ZKL A;  1IXG A;  5I2N A;  5KCJ B;  1JVX A;  3S9L C;  3D4C A;  4DDD A;  5CM6 A;  2DVC A;  3OXN A;  1JNF A;  1OLA A;  2V3U A;  3PU5 A;  4G77 A;  4FAJ A;  1ELJ A;  2G93 A;  3I3V A;  3IOR A;  2XXP A;  1B2H A;  2DWH A;  1O64 A;  2HFB A;  3FUZ A;  3IOW A;  1Y9U A;  4IO2 A;  2H5Y A;  4POX A;  3U72 A;  3ONM A;  2ONR A;  2O84 X;  3PUY E;  4PFW A;  3TTN A;  3ILT B;  4LON B;  3OOA A;  2HAV A;  3H06 B;  4OVJ A;  2YJP A;  3IJX B;  4YKK A;  1N0T A;  2QL3 A;  2ZYK A;  1M5D A;  1P1U A;  4O3B A;  3SER A;  4FEC A;  4GWO A;  3PPO A;  1MPB A;  3USD A;  5A5X A;  1PEB A;  3EQ1 A;  1DSN A;  1BP5 A;  1IUD A;  1MY1 A;  4KCC A;  3PUX E;  2XX7 A;  3TAJ A;  4F19 A;  2RCB A;  4GRK A;  3TEP A;  2ONS A;  3T9H B;  1GTK A;  3UIF A;  1MDQ A;  2ZYM A;  4ESW A;  2XXI A;  1XOC A;  3O28 A;  4HS7 A;  3O6G A;  4O3C A;  5DEX A;  2QPQ A;  3I6V A;  4JWY A;  1N7X A;  4ND9 A;  3TZA A;  4YMA A;  2NUV A;  3TUS A;  1D9Y A;  1B9J A;  1YPN A;  4YIC A;  3ZSF A;  3ODB A;  3SKP A;  3OEM A;  5H8H A;  3UGW A;  2Y7K A;  3KJT A;  1MQD A;  2PMS A;  3RT8 A;  1PBQ A;  3G3J A;  3TTR A;  3MVZ A;  4F22 A;  1MXZ A;  5H8H B;  3IAZ A;  3IL1 B;  2Q9T A;  1FTL A;  2RCA A;  3S2V A;  4G8M A;  3MQ9 A;  2F78 A;  1US5 A;  3OSR A;  1OMP A;  2I0C A;  4JWX A;  2QSX A;  4IY6 A;  5CBR A;  4G68 C;  1NKX A;  3B6W A;  4WKM A;  4NF5 A;  4PQJ A;  5KDT A;  3N6T A;  2V93 A;  4GIZ A;  5ITO A;  2F97 A;  2PX1 A;  5H8F B;  5BUU A;  4OHN A;  3MPK A;  4U22 A;  3JYR A;  4LQ2 A;  1JW1 A;  1NH8 A;  3K1M A;  4EQB A;  4PFU A;  5AA4 B;  3G7W A;  1B7U A;  1FTM A;  4OET A;  4OXV A;  3V83 A;  1P1N A;  3I5O A;  4NF6 B;  1H76 A;  2H9B A;  3OO9 A;  4GF8 A;  3KBR A;  4R6Y A;  4KPT A;  4GXS B;  3PPQ A;  4RXL A;  2REJ A;  2W7Y A;  3IK6 B;  3T9X B;  3DEL B;  3JV9 A;  3DP8 A;  4NF6 A;  4NF4 B;  4KFQ A;  4JWO A;  4FIM A;  3DM0 A;  2RC7 A;  2E0S A;  2KLF A;  2QMX A;  4ZS9 A;  3RY3 A;  1H3D A;  1URD A;  3E9X A;  4KYS A;  4NF4 A;  3CRB A;  4OZ9 A;  4I9D A;  3R7X A;  4LQ5 A;  4P0I A;  3UN6 A;  5I84 A;  1A8E A;  1QW0 A;  3OO7 A;  5TPA B;  3SES A;  4EXK A;  5AE4 A;  1AH5 A;  4GD5 A;  4JDF A;  3PPN A;  2X7P A;  4QFO A;  1FQF A;  2XXQ A;  3HST A;  2Q8J A;  1SW5 A;  1LBC A;  3IOT A;  2I4B A;  3K01 A;  2Q88 A;  2R6G E;  5DTB A;  1SW4 A;  3Q27 A;  4GL0 A;  2A5T A;  3E4R A;  3ILU B;  4IO7 A;  4R74 A;  2F7B A;  4U23 A;  5F1Q A;  1B40 A;  1DTG A;  4R9F A;  4DIG A;  2FNC A;  4IGR A;  2F34 A;  2O51 A;  2V84 A;  2Y7W A;  3FXQ A;  4AB5 A;  1EZ9 A;  1FQB A;  1WVJ A;  3KSX A;  3OO6 A;  4XTC Q;  3FVG A;  5AA1 A;  2F6P A;  4F3G A;  3VVD A;  4DLD A;  3WAE A;  5KZT A;  1MPD A;  4H8J A;  4QF9 A;  1CE2 A;  1JET A;  1R1N A;  3L6G A;  3MP6 A;  3VVE A;  2XD2 A;  1XVY A;  4ELR A;  5I58 A;  3SDF A;  2I49 A;  3FAT A;  2O7I A;  3K02 A;  3K6X A;  5HBC A;  3OEK A;  3KZG A;  4I1D A;  4U1O A;  2RC8 A;  2XD3 A;  4UA8 A;  4E0X A;  3TFL A;  3EF7 A;  3KSJ A;  1A7L A;  1IEJ A;  3R6U A;  1LB9 A;  1LLS A;  2FYI A;  3DLN A;  4ZEK A;  3O29 A;  3B6Q A;  3MVX A;  4DZ1 A;  1BKA A;  1GR2 A;  3FV1 A;  3G3I A;  1RYX A;  2V25 A;  1ZMG A;  1LAG E;  1PB8 A;  1XS5 A;  4FE8 A;  4ZE8 A;  4N13 A;  4H8I A;  2H25 A;  4OQO A;  1A54 A;  3H03 A;  3KJ7 A;  2IA4 A;  4UAC A;  3RGY A;  4OWD A;  3HPI A;  1AMF A;  3LSL A;  2Y7I A;  5AA2 D;  1A99 A;  2I3W A;  1PC3 A;  4Q8R A;  3DP6 A;  2I4C A;  1T0K A;  1JEU A;  4ELO A;  2REG A;  1ANF A;  1FW0 A;  2VOZ A;  2HQ0 A;  3E13 X;  3BKI B;  4FED A;  1L5T A;  3SEX A;  2D21 A;  3QK6 A;  3C32 A;  1BTJ A;  4KR5 A;  4OTE A;  1B58 A;  4EQ7 A;  3A3C A;  3QYT A;  1S7Y A;  2UVG A;  2HAU A;  4Z7E A;  4H6D A;  5TU0 A;  2HCA A;  1IXC A;  2O1M A;  3FGS A;  4H65 A;  2CMO A;  4U1Z A;  1AL3 A;  3O9P A;  1DPE A;  4KYE A;  4KD5 A;  2DVZ A;  4I62 A;  1SW2 A;  1TFA A;  2XX9 A;  2QS2 A;  3S4U A;  5ICT A;  2WKY A;  5KDT B;  3PUZ E;  3PV0 E;  1LCT A;  1VSO A;  2B65 A;  3KEI A;  1IXI A;  1A8F A;  3O6I A;  1B1H A;  3PUW E;  3SEW A;  4R9G A;  1I6A A;  1IQ7 A;  2V3T A;  3M8U A;  4JSO A;  4EUO A;  1DTZ A;  3MP8 A;  1MXU A;  1EZO A;  1CB6 A;  4YKI A;  1MXY A;  3CG3 A;  5CC2 A;  3TTL A;  4OES A;  3FD3 A;  1R6Z A;  1EZP A;  1MQH A;  4QSD A;  4ZDM A;  3ZKK A;  1DPP A;  1FCK A;  5B70 A;  3OMB A;  3KGC A;  3T9V A;  2GFE A;  2XXU A;  3FIR A;  4NF5 B;  1NNF A;  1OLC A;  3UOR A;  1LAX A;  2OK2 A;  1B46 A;  4MLQ A;  4PET A;  4KYD A;  5CMM A;  3HV1 A;  4NWD A;  4R6K A;  2HZL A;  2DXY A;  4HCY A;  4OEV A;  4DCX A;  4TQU Q;  5I57 B;  1AIV A;  5AA2 B;  2Y84 A;  3C36 A;  3N6U A;  2HZK A;  1SYH A;  2XXR A;  2F35 A;  4R6H A;  2X26 A;  4F2O A;  3N26 A;  1A55 A;  2DOJ A;  3VXC A;  1LCF A;  1QKA A;  1I69 A;  1MDP 1;  4ELP A;  1H43 A;  4MF3 A;  4K3F A;  3TCG A;  3S9E A;  4O3A A;  3MVY A;  2RF1 A;  4X1D A;  5EHS A;  3W9W A;  5I59 B;  4G4P A;  3TQW A;  3HN0 A;  4BDN A;  4WEP A;  3CFL A;  4H67 A;  3IB2 A;  3TQL A;  4JXI A;  4F3S A;  3V8X B;  2Z8D A;  3QUJ A;  2P2A A;  1YAE A;  4H5F A;  1PBP A;  4MFI A;  4H5G A;  3V89 B;  4TLL B;  3LSX A;  1P1O A;  3KN7 A;  5BWJ A;  3PD8 A;  4IGT A;  3EPE A;  3G3K A;  3H4Z A;  2PT1 A;  3MP1 A;  4ZZE A;  3QIM A;  4U21 A;  3RNN A;  2F36 A;  1ZU0 A;  2P1S A;  3F11 A;  3AXF A;  4MH5 A;  5CMC A;  4GL8 A;  5JTY A;  3CR9 A;  4PFT A;  2Z23 A;  4F29 A;  3S9N C;  1VE4 A;  4LUB A;  4YKJ A;  1MXV A;  5H8Q A;  5JK4 A;  1SI1 A;  2GHB A;  2PT2 A;  4OFO A;  1NNK A;  1A40 A;  2D5W A;  1JEV A;  2VP1 A;  4L17 A;  3Q28 A;  5HPQ A;  4KCD A;  2DWA A;  2XXY A;  4FOR A;  5DVI A;  5FHN A;  4X1B A;  2GH9 A;  2ZYO A;  3M3L A;  3U8Q A;  5I56 A;  1OQG A;  3PMX A;  4F3B A;  3K0V A;  1H45 A;  1B3G A;  5CRY A;  4DXB A;  1RYO A;  1ATG A;  2BJJ X;  5ICQ A;  4NED A;  1FQD A;  4BDO A;  4F3P A;  3QAX A;  2RC9 A;  1ZJL A;  1NMU A;  1LAH E;  5ITP A;  5K2Y A;  3R26 A;  2F5X A;  1JW5 A;  4GXA A;  1I6Q A;  1N76 A;  1N7W A;  2DWJ A;  2F8D A;  3C34 A;  4KI0 E;  1R9Q A;  3FXU A;  1ZLQ A;  5AA3 A;  1FTJ A;  4F1V A;  3H6V A;  1QKB A;  1IXH A;  1IZ1 A;  1ZTY A;  1MRP A;  4KQP A;  4U4X A;  1P1W A;  1B5J A;  4X48 A;  2NWJ A;  3RLF E;  2AL4 A;  1VR5 A;  2NVU B;  2DWI A;  2F7C A;  2Q89 A;  3MW0 A;  3CG1 A;  4G2Z A;  5I2K B;  4ZZA A;  3RPW A;  1NH7 A;  1LFG A;  5KCJ A;  1B3E A;  4P0G A;  4TLM B;  3TTM A;  3FAS A;  4RYA A;  1MY0 A;  1MM7 A;  1Y3N A;  2F7A A;  2I0B A;  3FZV A;  1SDX A;  4YB5 A;  1GGG A;  2QS4 A;  3C9H A;  2ZNU A;  4OFL A;  3K1N A;  4DXC A;  5B7D A;  1QUK A;  1B51 A;  3KFM A;  4G8H A;  1Z7M E;  2UVJ A;  2HXW A;  3GBB A;  1NL5 A;  3KN3 A;  1HSL A;  3LR1 A;  1OQH A;  4ONY A;  2THI A;  1VFD A;  3IOU A;  2NXO A;  4LA9 A;  3MAM A;  2D3I A;  4YAH X;  4BDQ A;  2ZNT A;  3TMG A;  1GV8 A;  1R9L A;  4DE8 A;  2PBW A;  3JZJ A;  5DEX B;  3VFJ A;  1HSE A;  5A5X B;  1SYI A;  3S9M C;  2H4I A;  1B7H A;  3O97 A;  1MQI A;  1POY 1;  1QUI A;  1P1Q A;  4GLI A;  3Q25 A;  3MUQ A;  4IB2 A;  4XKN A;  1M5F A;  5L9O A;  1MS7 A;  1NNT A;  2H98 A;  2OBG A;  4KHZ E;  2R71 A;  3IO4 A;  1US4 A;  1LFH A;  3ECR A;  1TWY A;  3U93 A;  4ISU A;  5FTI A;  1B5H A;  2XXT A;  3IB1 A;  1UIU A;  4MLV A;  3RQT A;  1Y4C A;  4Q30 B;  3RUM A;  3QXM A;  5JEI A;  2ABH A;  1I6B A;  1O7T A;  2UVI A;  2ZNS A;  4XKP A;  5ELV A;  5DVJ A;  4LZ5 A;  3VLU A;  3C31 A;  3BBR A;  4NTL A;  4EDP A;  2I58 A;  3MC2 A;  5DYH A;  4F1Y A;  2PYY A;  3UP9 A;  3CFX A;  2F6G A;  3UA8 A;  5H8F A;  4X9T A;  3RT6 B;  1M5B A;  2OWS A;  4C1U A;  3M3F A;  1M5E A;  1UQW A;  1MY3 A;  1Q35 A;  4ZEB A;  4XIG Q;  2Z8E A;  4QFP A;  3FJG A;  3HHG A;  3KOS A;  3G3H A;  3UK4 A;  3VLV A;  2OCU A;  4P11 A;  3VVF A;  5I57 A;  2VD3 A;  4DXU A;  1SQY A;  1XHY A;  2XXV A;  1S9T A;  2QJE A;  4R75 A;  1YCJ A;  3GXA A;  5AA4 A;  1Z7N E;  1UTH A;  3CSG A;  4EF2 A;  5I58 B;  2GHA A;  1ZKB A;  4JBZ A;  5H8S A;  4XXU A;  3VV5 A;  2PVU A;  2DQV A;  2UYF A;  1DMB A;  3EHU A;  4YZZ A;  4QRZ A;  5TPA A;  3H6T A;  3FJM A;  4LZ8 A;  3W15 C;  1URS A;  3OO8 A;  4R73 A;  2RKM A;  3KN8 A;  4BDL A;  4BDR A;  1N84 A;  2OLB A;  3LUY A;  3LBS A;  4JSD A;  4WXJ A;  3A3U A;  1JVY A;  4OEU A;  1Y4T A;  3MJN A;  4PFY A;  1IIW A;  4F31 B;  1LFI A;  1EU8 A;  1MM6 A;  1MXW A;  5M2V A;  2ZYN A;  3LC8 A;  1B32 A;  3K6W A;  1MXX A;  2A5S A;  2UXA A;  5H8N A;  4RNS A;  1D3K A;  3PUV E;  2QRY A;  5L8D A;  3BFT A;  1JQF A;  5JTY B;  5CBS A;  3MZ9 A;  4U4S A;  2QMW A;  5TP9 B;  4C0R A;  5H8N B;  4ECF A;  4POW A;  2R9J A;  1DOT A;  4E0W A;  2Z8F A;  1VFE A;  2H99 A;  1XVX A;  4MBP A;  5H8Q B;  3O2A A;  1LAF E;  3RTW B;  4NWC A;  3TEL A;  2Y7P A;  1F9B A;  4EQ9 A;  2A5T B;  3PPR A;  3CSB A;  5EHM A;  2DSF A;  3K6U A;  3CVG A;  4M1V A;  1P99 A;  1UTB A;  5FHM A;  2O69 A;  3IOV A;  3BFU A;  3FXR A;  2P0S A;  2GRV A;  4F18 A;  4AQ4 A;  4H0W A;  1D9V A;  1JW4 A;  2I3V A;  3T22 A;  3E3K A;  3IO6 A;  3K4U A;  3M3K A;  3IB0 A;  3OSQ A;  3VE1 B;  1S50 A;  2XX8 A;  3N94 A;  1SD3 A;  1MQG A;  3KG2 A;  1PDA A;  2Y7R A;  2G29 A;  3O66 A;  3B7D A;  4YMB A;  1ZBM A;  1B3F A;  2DE4 A;  3Q29 A;  4I8C A;  4ZEF A;  3VLW A;  3VXB A;  3T96 B;  3OEL A;  4G8N A;  1B3H A;  1N04 A;  2ZXT A;  5L9S A;  1B3L A;  4ZEC A;  1MPC A;  1Y1Z A;  4H1X A;  5I2K A;  3FVN A;  2O6A A;  2Q2A A;  3DP4 A;  3Q26 A;  3G3G A;  4IO5 A;  3FVK A;  3MVW A;  4FJP A;  4R2B A;  1BIY A;  2DXR A;  2UYE A;  3CI8 A;  3EHS A;  3PMW A;  5I2N B;  1OIB A;  4BLA A;  4ZE9 A;  3ZS6 A;  4TOZ A;  4YU0 A;  4YB7 A;  1SW1 A;  1LB8 A;  1HSJ A;  3HCQ A;  1FQA A;  2E1S A;  1Q1K A;  1SI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...