1P9AG

Crystal structure of n-terminal domain of human platelet receptor glycoprotein ib-alpha at 1.7 angstrom resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
266
structure length
266
Chain Sequence
b'HPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRAELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Platelet glycoprotein Ib alpha chain precursor
publication title Modulation of alpha-thrombin function by distinct interactions with platelet glycoprotein Ibalpha
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 76
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2003-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF01462 LRRNT Leucine rich repeat N-terminal domain
G PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1p9aG00
3M18A 2V70A 1O6VA 4WYKA 4YEBB 4CNCA 4R6AA 4LSCA 3WN4A 2XWTC 1P8TA 3RW7A 4R07A 5D3IA 4R6JA 4RWTC 1ZIWA 2XOTA 4NKHA 5GMFA 3JB9j 2P1NB 2OMYA 4K17A 4M7EC 5FTTB 3OJAA 1FS2A 4FDWA 3G06A 4R09A 3W3MA 4RCWA 3G39A 4AY9X 5LFNA 4QC0A 4R6FA 4M7EA 4C2BB 4CC4C 1P9AG 4PQ8A 1XEUA 3ZYNA 4B8CD 4LI2A 2OMVA 4U08A 4U06A 2A0ZA 1OTOA 1A9NA 2ASTB 4C2AB 1DCEA 2JE0A 1OTNA 1SQ0B 5IJCA 3RIZA 4J4LA 5HDHA 4Q3GA 2P1PB 3OGMB 4Y61B 1K5DC 2P1MB 4ARNA 4PERA 2CA6A 4R5CA 2OMXA 2Z63A 3PMHG 1H6TA 1A4YA 5GMGA 4FD0A 2V9SA 3UL7A 3E3ZA 3C6NB 4LXRA 2RA8A 2Z64A 3GOZA 3WPHA 4L3FA 4PKIG 4ECNA 4R58A 3O6NA 1FT8A 2JE1A 5GMHA 4CP6A 2UZYA 3ZYIA 4MQWX 4P8SA 4NKGA 1D0BA 3CVRA 4WP6A 4IM6A 4EZGA 3G04C 2Q4GW 1FQVA 2OMWA 4Q62A 1P8VA 1OGQA 3KJ4A 1KOHA 4KT1A 3ULAA 4KXFB 4BSRA 4XSQA 5GS0A 2WFHA 3WPGA 1LTXA 5GS2B 1K5GC 4R5DA 5B0NA 3RFJA 1OOKG 3WPBA 1IO0A 5AWCA 3OJAB 5AZ5A 4GT6A 5AWBA 1M9SA 5GQRK 2Z7XA 3DZEA 4OQTA 4Z61C 3SB4A 3M19A 4PSJA 3ULVA 4MN8B 4J0MA 4AW4A 1XKUA 4BV4R 3E4GA 3RFEA 5HZLB 4U09A 1XECA 2Y5QA 1O6SA 2P1QB 3W3LA 3RW6A 1FO1A 1QYYA 4U7LA 2OMZA 3ZYOA 2UZXA 5B4PA 3A79B 2R9UA 2Z66A 2O6QA 2Z65A 3UL9A 4R0AA 4Z64C 2WQVA 4R6GA 1G9UA 2WQWA 3FXIA 4V2CA 3VQ1A 3W3GA 3TSRE 3RFSA 1M0ZA 4V2DA 4ECOA 2RR6A 4BSUA 3WPDA 3CIGA 4FCGA 2BEXA 3C6PB 5A5CA 3W3KA 1WWLA 4H09A 4LSXA 3UL8A 1M9LA 4ARRA 3E2JA 3UN9A 4I6JB 4Z8GA 3RGXA 3E6JA 1W8AA 1M10B 4V2EA 3P72A 2O6RA 1DS9A 3O53A 4XGOA 1KOOA 1OTMA 2BNHA 2V9TB 5IJBA 4LXSA 3BZ5A 1XWDC 4GLPA 5CMNA 4UFRA 4Z79A 1O6TA 2FT3A 1YRGA 3RJ0A 1DFJI 3WPIA 4CNMA 1JL5A 3WPEA 4BSSA 3VQ2A 4CILA 3RGZA 4LI1A 3G3AA 4HQ1A 3ZYJA 1XCDA 4XOSA 2WQXA 4FS7A 2Z7XB 4Z94G 2Z81A 4QBZA 5B0TA 1OZNA 2Z82A 2OMUA 2JQDA 3WPCA 3G3BA 5AWDA 3W3NA 1H6UA 4RCAB 4L3AA 1U0ND 2ASSB 2WQUA 3WPFA 4CC4A 1Z7XW 3OGLB 3OGKB 4R08A 3REZA 3C6OB 4Q3IA 5IYXC 2OMTA 4LSXC 5IJDA 4PEQB 1PGVA 2ID5A 1GWBA 2IFGA 5AWAA 3CIYA 4QXEA 4FHOA 4G8AA 4KNGA 2P1OB 2Z62A 2O6SA 4TZHA 2ELLA 4P91A 4LSAA 3ULUA 3W3JA 5CMPA 4FMZA
chains in the Genus database with same CATH superfamily
3M18A 2V70A 1O6VA 4WYKA 4YEBB 4CNCA 4R6AA 4LSCA 3WN4A 2XWTC 1P8TA 3RW7A 4R07A 5D3IA 4R6JA 4RWTC 1ZIWA 2XOTA 4NKHA 5GMFA 3JB9j 2P1NB 2OMYA 4K17A 4M7EC 5FTTB 3OJAA 1FS2A 4FDWA 3G06A 4R09A 3W3MA 4RCWA 3G39A 4AY9X 5LFNA 4QC0A 4R6FA 4M7EA 4C2BB 4CC4C 1P9AG 4PQ8A 1XEUA 3ZYNA 4B8CD 4LI2A 2OMVA 4U08A 4U06A 2A0ZA 1OTOA 1A9NA 2ASTB 4C2AB 1DCEA 2JE0A 1OTNA 1SQ0B 5IJCA 3RIZA 4J4LA 5HDHA 4Q3GA 2P1PB 3OGMB 4Y61B 1K5DC 2P1MB 4ARNA 4PERA 2CA6A 4R5CA 2OMXA 2Z63A 3PMHG 1H6TA 1A4YA 5GMGA 4FD0A 2V9SA 3UL7A 3E3ZA 3C6NB 4LXRA 2RA8A 2Z64A 3GOZA 3WPHA 4L3FA 4PKIG 4ECNA 4R58A 3O6NA 1FT8A 2JE1A 5GMHA 4CP6A 2UZYA 3ZYIA 4MQWX 4P8SA 4NKGA 1D0BA 3CVRA 4WP6A 4IM6A 4EZGA 3G04C 4NZTM 2Q4GW 1FQVA 2OMWA 4Q62A 1P8VA 1OGQA 3KJ4A 1KOHA 4KT1A 3ULAA 4KXFB 4BSRA 4XSQA 5GS0A 2WFHA 3WPGA 1LTXA 5GS2B 1K5GC 4R5DA 5B0NA 3RFJA 1OOKG 3WPBA 1IO0A 5AWCA 3OJAB 5AZ5A 4GT6A 5AWBA 1M9SA 5GQRK 2Z7XA 3DZEA 4OQTA 4Z61C 3SB4A 3M19A 4PSJA 3ULVA 4MN8B 4J0MA 4AW4A 1XKUA 4BV4R 3E4GA 3RFEA 5HZLB 4U09A 1XECA 2Y5QA 1O6SA 2P1QB 3W3LA 3RW6A 1FO1A 1QYYA 4U7LA 2OMZA 3ZYOA 2UZXA 5B4PA 3A79B 2R9UA 2Z66A 2O6QA 2Z65A 3UL9A 4R0AA 4Z64C 2WQVA 4R6GA 1G9UA 2WQWA 3FXIA 4V2CA 3VQ1A 3W3GA 3TSRE 3RFSA 1M0ZA 4V2DA 4ECOA 2RR6A 4BSUA 3WPDA 3CIGA 4FCGA 2BEXA 3C6PB 5A5CA 3W3KA 1WWLA 4H09A 4LSXA 3UL8A 1M9LA 4ARRA 3E2JA 3UN9A 4I6JB 4Z8GA 3RGXA 3E6JA 1W8AA 1M10B 4V2EA 3P72A 2O6RA 1DS9A 3O53A 4XGOA 1KOOA 1OTMA 2BNHA 2V9TB 5IJBA 4LXSA 3BZ5A 1XWDC 4GLPA 5CMNA 4UFRA 4Z79A 1O6TA 2FT3A 1YRGA 3RJ0A 1DFJI 3WPIA 4CNMA 1JL5A 3WPEA 4BSSA 3VQ2A 4CILA 3RGZA 4LI1A 3G3AA 4HQ1A 3ZYJA 4NZRM 1XCDA 4XOSA 2WQXA 4FS7A 2Z7XB 4Z94G 2Z81A 4QBZA 5B0TA 1OZNA 2Z82A 2OMUA 2JQDA 3WPCA 3G3BA 5AWDA 3W3NA 1H6UA 4RCAB 4L3AA 1U0ND 2ASSB 2WQUA 3WPFA 4CC4A 1Z7XW 3OGLB 3OGKB 4R08A 3REZA 3C6OB 4Q3IA 5IYXC 2OMTA 4LSXC 5IJDA 4PEQB 1PGVA 2ID5A 1GWBA 2IFGA 5AWAA 3CIYA 4QXEA 4FHOA 4G8AA 4KNGA 2P1OB 2Z62A 2O6SA 4TZHA 2ELLA 4P91A 4LSAA 3ULUA 3W3JA 5CMPA 4FMZA
chains in the Genus database with same CATH topology
3M18A 2V70A 1O6VA 4WYKA 4YEBB 4CNCA 4R6AA 4LSCA 3WN4A 2XWTC 1P8TA 3RW7A 4R07A 5D3IA 4R6JA 4RWTC 1ZIWA 2XOTA 4NKHA 5GMFA 3JB9j 2P1NB 2OMYA 4K17A 4M7EC 5FTTB 3OJAA 1FS2A 4FDWA 3G06A 4R09A 3W3MA 4RCWA 3G39A 4AY9X 5LFNA 4QC0A 4R6FA 4M7EA 4C2BB 4CC4C 1P9AG 4PQ8A 1XEUA 3ZYNA 4B8CD 4LI2A 2OMVA 4U08A 4U06A 2A0ZA 1OTOA 1A9NA 2ASTB 4C2AB 1DCEA 2JE0A 1OTNA 1SQ0B 5IJCA 3RIZA 4J4LA 5HDHA 4Q3GA 2P1PB 3OGMB 4Y61B 1K5DC 2P1MB 4ARNA 4PERA 2CA6A 4R5CA 2OMXA 2Z63A 3PMHG 1H6TA 1A4YA 5GMGA 4FD0A 2V9SA 3UL7A 3E3ZA 3C6NB 4LXRA 2RA8A 2Z64A 3GOZA 3WPHA 4L3FA 4PKIG 4ECNA 4R58A 3O6NA 1FT8A 2JE1A 5GMHA 4CP6A 2UZYA 3ZYIA 4MQWX 4P8SA 4NKGA 1D0BA 3CVRA 4WP6A 4IM6A 4EZGA 3G04C 2Q4GW 1FQVA 2OMWA 4Q62A 1P8VA 1OGQA 3KJ4A 1KOHA 4KT1A 3ULAA 4KXFB 4BSRA 4XSQA 5GS0A 2WFHA 3WPGA 1LTXA 5GS2B 1K5GC 4R5DA 5B0NA 3RFJA 1OOKG 3WPBA 1IO0A 5AWCA 3OJAB 5AZ5A 4GT6A 5AWBA 1M9SA 5GQRK 2Z7XA 3DZEA 4OQTA 4Z61C 3SB4A 3M19A 4PSJA 3ULVA 4MN8B 4J0MA 4AW4A 1XKUA 4BV4R 3E4GA 3RFEA 5HZLB 4U09A 1XECA 2Y5QA 1O6SA 2P1QB 3W3LA 3RW6A 1FO1A 1QYYA 4U7LA 2OMZA 3ZYOA 2UZXA 5B4PA 3A79B 2R9UA 2Z66A 2O6QA 2Z65A 3UL9A 4R0AA 4Z64C 2WQVA 4R6GA 1G9UA 2WQWA 3FXIA 4V2CA 3VQ1A 3W3GA 3TSRE 3RFSA 1M0ZA 4V2DA 4ECOA 2RR6A 4BSUA 3WPDA 3CIGA 4FCGA 2BEXA 3C6PB 5A5CA 3W3KA 1WWLA 4H09A 4LSXA 3UL8A 1M9LA 4ARRA 3E2JA 3UN9A 4I6JB 4Z8GA 3RGXA 3E6JA 1W8AA 1M10B 4V2EA 3P72A 2O6RA 1DS9A 3O53A 4XGOA 1KOOA 1OTMA 2BNHA 2V9TB 5IJBA 4LXSA 3BZ5A 1XWDC 4GLPA 5CMNA 4UFRA 4Z79A 1O6TA 2FT3A 1YRGA 3RJ0A 1DFJI 3WPIA 4CNMA 1JL5A 3WPEA 4BSSA 3VQ2A 4CILA 3RGZA 4LI1A 3G3AA 4HQ1A 3ZYJA 1XCDA 4XOSA 2WQXA 4FS7A 2Z7XB 4Z94G 2Z81A 4QBZA 5B0TA 1OZNA 2Z82A 2OMUA 2JQDA 3WPCA 3G3BA 5AWDA 3W3NA 1H6UA 4RCAB 4L3AA 1U0ND 2ASSB 2WQUA 3WPFA 4CC4A 1Z7XW 3OGLB 3OGKB 4R08A 3REZA 3C6OB 4Q3IA 5IYXC 2OMTA 4LSXC 5IJDA 4PEQB 1PGVA 2ID5A 1GWBA 2IFGA 5AWAA 3CIYA 4QXEA 4FHOA 4G8AA 4KNGA 2P1OB 2Z62A 2O6SA 4TZHA 2ELLA 4P91A 4LSAA 3ULUA 3W3JA 5CMPA 4FMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M18 A;  2V70 A;  1O6V A;  4WYK A;  4YEB B;  4CNC A;  4R6A A;  4LSC A;  3WN4 A;  2XWT C;  1P8T A;  3RW7 A;  4R07 A;  5D3I A;  4R6J A;  4RWT C;  1ZIW A;  2XOT A;  4NKH A;  5GMF A;  3JB9 j;  2P1N B;  2OMY A;  4K17 A;  4M7E C;  5FTT B;  3OJA A;  1FS2 A;  4FDW A;  3G06 A;  4R09 A;  3W3M A;  4RCW A;  3G39 A;  4AY9 X;  5LFN A;  4QC0 A;  4R6F A;  4M7E A;  4C2B B;  4CC4 C;  1P9A G;  4PQ8 A;  1XEU A;  3ZYN A;  4B8C D;  4LI2 A;  2OMV A;  4U08 A;  4U06 A;  2A0Z A;  1OTO A;  1A9N A;  2AST B;  4C2A B;  1DCE A;  2JE0 A;  1OTN A;  1SQ0 B;  5IJC A;  3RIZ A;  4J4L A;  5HDH A;  4Q3G A;  2P1P B;  3OGM B;  4Y61 B;  1K5D C;  2P1M B;  4ARN A;  4PER A;  2CA6 A;  4R5C A;  2OMX A;  2Z63 A;  3PMH G;  1H6T A;  1A4Y A;  5GMG A;  4FD0 A;  2V9S A;  3UL7 A;  3E3Z A;  3C6N B;  4LXR A;  2RA8 A;  2Z64 A;  3GOZ A;  3WPH A;  4L3F A;  4PKI G;  4ECN A;  4R58 A;  3O6N A;  1FT8 A;  2JE1 A;  5GMH A;  4CP6 A;  2UZY A;  3ZYI A;  4MQW X;  4P8S A;  4NKG A;  1D0B A;  3CVR A;  4WP6 A;  4IM6 A;  4EZG A;  3G04 C;  2Q4G W;  1FQV A;  2OMW A;  4Q62 A;  1P8V A;  1OGQ A;  3KJ4 A;  1KOH A;  4KT1 A;  3ULA A;  4KXF B;  4BSR A;  4XSQ A;  5GS0 A;  2WFH A;  3WPG A;  1LTX A;  5GS2 B;  1K5G C;  4R5D A;  5B0N A;  3RFJ A;  1OOK G;  3WPB A;  1IO0 A;  5AWC A;  3OJA B;  5AZ5 A;  4GT6 A;  5AWB A;  1M9S A;  5GQR K;  2Z7X A;  3DZE A;  4OQT A;  4Z61 C;  3SB4 A;  3M19 A;  4PSJ A;  3ULV A;  4MN8 B;  4J0M A;  4AW4 A;  1XKU A;  4BV4 R;  3E4G A;  3RFE A;  5HZL B;  4U09 A;  1XEC A;  2Y5Q A;  1O6S A;  2P1Q B;  3W3L A;  3RW6 A;  1FO1 A;  1QYY A;  4U7L A;  2OMZ A;  3ZYO A;  2UZX A;  5B4P A;  3A79 B;  2R9U A;  2Z66 A;  2O6Q A;  2Z65 A;  3UL9 A;  4R0A A;  4Z64 C;  2WQV A;  4R6G A;  1G9U A;  2WQW A;  3FXI A;  4V2C A;  3VQ1 A;  3W3G A;  3TSR E;  3RFS A;  1M0Z A;  4V2D A;  4ECO A;  2RR6 A;  4BSU A;  3WPD A;  3CIG A;  4FCG A;  2BEX A;  3C6P B;  5A5C A;  3W3K A;  1WWL A;  4H09 A;  4LSX A;  3UL8 A;  1M9L A;  4ARR A;  3E2J A;  3UN9 A;  4I6J B;  4Z8G A;  3RGX A;  3E6J A;  1W8A A;  1M10 B;  4V2E A;  3P72 A;  2O6R A;  1DS9 A;  3O53 A;  4XGO A;  1KOO A;  1OTM A;  2BNH A;  2V9T B;  5IJB A;  4LXS A;  3BZ5 A;  1XWD C;  4GLP A;  5CMN A;  4UFR A;  4Z79 A;  1O6T A;  2FT3 A;  1YRG A;  3RJ0 A;  1DFJ I;  3WPI A;  4CNM A;  1JL5 A;  3WPE A;  4BSS A;  3VQ2 A;  4CIL A;  3RGZ A;  4LI1 A;  3G3A A;  4HQ1 A;  3ZYJ A;  1XCD A;  4XOS A;  2WQX A;  4FS7 A;  2Z7X B;  4Z94 G;  2Z81 A;  4QBZ A;  5B0T A;  1OZN A;  2Z82 A;  2OMU A;  2JQD A;  3WPC A;  3G3B A;  5AWD A;  3W3N A;  1H6U A;  4RCA B;  4L3A A;  1U0N D;  2ASS B;  2WQU A;  3WPF A;  4CC4 A;  1Z7X W;  3OGL B;  3OGK B;  4R08 A;  3REZ A;  3C6O B;  4Q3I A;  5IYX C;  2OMT A;  4LSX C;  5IJD A;  4PEQ B;  1PGV A;  2ID5 A;  1GWB A;  2IFG A;  5AWA A;  3CIY A;  4QXE A;  4FHO A;  4G8A A;  4KNG A;  2P1O B;  2Z62 A;  2O6S A;  4TZH A;  2ELL A;  4P91 A;  4LSA A;  3ULU A;  3W3J A;  5CMP A;  4FMZ A; 
#chains in the Genus database with same CATH topology
 3M18 A;  2V70 A;  1O6V A;  4WYK A;  4YEB B;  4CNC A;  4R6A A;  4LSC A;  3WN4 A;  2XWT C;  1P8T A;  3RW7 A;  4R07 A;  5D3I A;  4R6J A;  4RWT C;  1ZIW A;  2XOT A;  4NKH A;  5GMF A;  3JB9 j;  2P1N B;  2OMY A;  4K17 A;  4M7E C;  5FTT B;  3OJA A;  1FS2 A;  4FDW A;  3G06 A;  4R09 A;  3W3M A;  4RCW A;  3G39 A;  4AY9 X;  5LFN A;  4QC0 A;  4R6F A;  4M7E A;  4C2B B;  4CC4 C;  1P9A G;  4PQ8 A;  1XEU A;  3ZYN A;  4B8C D;  4LI2 A;  2OMV A;  4U08 A;  4U06 A;  2A0Z A;  1OTO A;  1A9N A;  2AST B;  4C2A B;  1DCE A;  2JE0 A;  1OTN A;  1SQ0 B;  5IJC A;  3RIZ A;  4J4L A;  5HDH A;  4Q3G A;  2P1P B;  3OGM B;  4Y61 B;  1K5D C;  2P1M B;  4ARN A;  4PER A;  2CA6 A;  4R5C A;  2OMX A;  2Z63 A;  3PMH G;  1H6T A;  1A4Y A;  5GMG A;  4FD0 A;  2V9S A;  3UL7 A;  3E3Z A;  3C6N B;  4LXR A;  2RA8 A;  2Z64 A;  3GOZ A;  3WPH A;  4L3F A;  4PKI G;  4ECN A;  4R58 A;  3O6N A;  1FT8 A;  2JE1 A;  5GMH A;  4CP6 A;  2UZY A;  3ZYI A;  4MQW X;  4P8S A;  4NKG A;  1D0B A;  3CVR A;  4WP6 A;  4IM6 A;  4EZG A;  3G04 C;  4NZT M;  2Q4G W;  1FQV A;  2OMW A;  4Q62 A;  1P8V A;  1OGQ A;  3KJ4 A;  1KOH A;  4KT1 A;  3ULA A;  4KXF B;  4BSR A;  4XSQ A;  5GS0 A;  2WFH A;  3WPG A;  1LTX A;  5GS2 B;  1K5G C;  4R5D A;  5B0N A;  3RFJ A;  1OOK G;  3WPB A;  1IO0 A;  5AWC A;  3OJA B;  5AZ5 A;  4GT6 A;  5AWB A;  1M9S A;  5GQR K;  2Z7X A;  3DZE A;  4OQT A;  4Z61 C;  3SB4 A;  3M19 A;  4PSJ A;  3ULV A;  4MN8 B;  4J0M A;  4AW4 A;  1XKU A;  4BV4 R;  3E4G A;  3RFE A;  5HZL B;  4U09 A;  1XEC A;  2Y5Q A;  1O6S A;  2P1Q B;  3W3L A;  3RW6 A;  1FO1 A;  1QYY A;  4U7L A;  2OMZ A;  3ZYO A;  2UZX A;  5B4P A;  3A79 B;  2R9U A;  2Z66 A;  2O6Q A;  2Z65 A;  3UL9 A;  4R0A A;  4Z64 C;  2WQV A;  4R6G A;  1G9U A;  2WQW A;  3FXI A;  4V2C A;  3VQ1 A;  3W3G A;  3TSR E;  3RFS A;  1M0Z A;  4V2D A;  4ECO A;  2RR6 A;  4BSU A;  3WPD A;  3CIG A;  4FCG A;  2BEX A;  3C6P B;  5A5C A;  3W3K A;  1WWL A;  4H09 A;  4LSX A;  3UL8 A;  1M9L A;  4ARR A;  3E2J A;  3UN9 A;  4I6J B;  4Z8G A;  3RGX A;  3E6J A;  1W8A A;  1M10 B;  4V2E A;  3P72 A;  2O6R A;  1DS9 A;  3O53 A;  4XGO A;  1KOO A;  1OTM A;  2BNH A;  2V9T B;  5IJB A;  4LXS A;  3BZ5 A;  1XWD C;  4GLP A;  5CMN A;  4UFR A;  4Z79 A;  1O6T A;  2FT3 A;  1YRG A;  3RJ0 A;  1DFJ I;  3WPI A;  4CNM A;  1JL5 A;  3WPE A;  4BSS A;  3VQ2 A;  4CIL A;  3RGZ A;  4LI1 A;  3G3A A;  4HQ1 A;  3ZYJ A;  4NZR M;  1XCD A;  4XOS A;  2WQX A;  4FS7 A;  2Z7X B;  4Z94 G;  2Z81 A;  4QBZ A;  5B0T A;  1OZN A;  2Z82 A;  2OMU A;  2JQD A;  3WPC A;  3G3B A;  5AWD A;  3W3N A;  1H6U A;  4RCA B;  4L3A A;  1U0N D;  2ASS B;  2WQU A;  3WPF A;  4CC4 A;  1Z7X W;  3OGL B;  3OGK B;  4R08 A;  3REZ A;  3C6O B;  4Q3I A;  5IYX C;  2OMT A;  4LSX C;  5IJD A;  4PEQ B;  1PGV A;  2ID5 A;  1GWB A;  2IFG A;  5AWA A;  3CIY A;  4QXE A;  4FHO A;  4G8A A;  4KNG A;  2P1O B;  2Z62 A;  2O6S A;  4TZH A;  2ELL A;  4P91 A;  4LSA A;  3ULU A;  3W3J A;  5CMP A;  4FMZ A; 
#chains in the Genus database with same CATH homology
 3M18 A;  2V70 A;  1O6V A;  4WYK A;  4YEB B;  4CNC A;  4R6A A;  4LSC A;  3WN4 A;  2XWT C;  1P8T A;  3RW7 A;  4R07 A;  5D3I A;  4R6J A;  4RWT C;  1ZIW A;  2XOT A;  4NKH A;  5GMF A;  3JB9 j;  2P1N B;  2OMY A;  4K17 A;  4M7E C;  5FTT B;  3OJA A;  1FS2 A;  4FDW A;  3G06 A;  4R09 A;  3W3M A;  4RCW A;  3G39 A;  4AY9 X;  5LFN A;  4QC0 A;  4R6F A;  4M7E A;  4C2B B;  4CC4 C;  1P9A G;  4PQ8 A;  1XEU A;  3ZYN A;  4B8C D;  4LI2 A;  2OMV A;  4U08 A;  4U06 A;  2A0Z A;  1OTO A;  1A9N A;  2AST B;  4C2A B;  1DCE A;  2JE0 A;  1OTN A;  1SQ0 B;  5IJC A;  3RIZ A;  4J4L A;  5HDH A;  4Q3G A;  2P1P B;  3OGM B;  4Y61 B;  1K5D C;  2P1M B;  4ARN A;  4PER A;  2CA6 A;  4R5C A;  2OMX A;  2Z63 A;  3PMH G;  1H6T A;  1A4Y A;  5GMG A;  4FD0 A;  2V9S A;  3UL7 A;  3E3Z A;  3C6N B;  4LXR A;  2RA8 A;  2Z64 A;  3GOZ A;  3WPH A;  4L3F A;  4PKI G;  4ECN A;  4R58 A;  3O6N A;  1FT8 A;  2JE1 A;  5GMH A;  4CP6 A;  2UZY A;  3ZYI A;  4MQW X;  4P8S A;  4NKG A;  1D0B A;  3CVR A;  4WP6 A;  4IM6 A;  4EZG A;  3G04 C;  2Q4G W;  1FQV A;  2OMW A;  4Q62 A;  1P8V A;  1OGQ A;  3KJ4 A;  1KOH A;  4KT1 A;  3ULA A;  4KXF B;  4BSR A;  4XSQ A;  5GS0 A;  2WFH A;  3WPG A;  1LTX A;  5GS2 B;  1K5G C;  4R5D A;  5B0N A;  3RFJ A;  1OOK G;  3WPB A;  1IO0 A;  5AWC A;  3OJA B;  5AZ5 A;  4GT6 A;  5AWB A;  1M9S A;  5GQR K;  2Z7X A;  3DZE A;  4OQT A;  4Z61 C;  3SB4 A;  3M19 A;  4PSJ A;  3ULV A;  4MN8 B;  4J0M A;  4AW4 A;  1XKU A;  4BV4 R;  3E4G A;  3RFE A;  5HZL B;  4U09 A;  1XEC A;  2Y5Q A;  1O6S A;  2P1Q B;  3W3L A;  3RW6 A;  1FO1 A;  1QYY A;  4U7L A;  2OMZ A;  3ZYO A;  2UZX A;  5B4P A;  3A79 B;  2R9U A;  2Z66 A;  2O6Q A;  2Z65 A;  3UL9 A;  4R0A A;  4Z64 C;  2WQV A;  4R6G A;  1G9U A;  2WQW A;  3FXI A;  4V2C A;  3VQ1 A;  3W3G A;  3TSR E;  3RFS A;  1M0Z A;  4V2D A;  4ECO A;  2RR6 A;  4BSU A;  3WPD A;  3CIG A;  4FCG A;  2BEX A;  3C6P B;  5A5C A;  3W3K A;  1WWL A;  4H09 A;  4LSX A;  3UL8 A;  1M9L A;  4ARR A;  3E2J A;  3UN9 A;  4I6J B;  4Z8G A;  3RGX A;  3E6J A;  1W8A A;  1M10 B;  4V2E A;  3P72 A;  2O6R A;  1DS9 A;  3O53 A;  4XGO A;  1KOO A;  1OTM A;  2BNH A;  2V9T B;  5IJB A;  4LXS A;  3BZ5 A;  1XWD C;  4GLP A;  5CMN A;  4UFR A;  4Z79 A;  1O6T A;  2FT3 A;  1YRG A;  3RJ0 A;  1DFJ I;  3WPI A;  4CNM A;  1JL5 A;  3WPE A;  4BSS A;  3VQ2 A;  4CIL A;  3RGZ A;  4LI1 A;  3G3A A;  4HQ1 A;  3ZYJ A;  1XCD A;  4XOS A;  2WQX A;  4FS7 A;  2Z7X B;  4Z94 G;  2Z81 A;  4QBZ A;  5B0T A;  1OZN A;  2Z82 A;  2OMU A;  2JQD A;  3WPC A;  3G3B A;  5AWD A;  3W3N A;  1H6U A;  4RCA B;  4L3A A;  1U0N D;  2ASS B;  2WQU A;  3WPF A;  4CC4 A;  1Z7X W;  3OGL B;  3OGK B;  4R08 A;  3REZ A;  3C6O B;  4Q3I A;  5IYX C;  2OMT A;  4LSX C;  5IJD A;  4PEQ B;  1PGV A;  2ID5 A;  1GWB A;  2IFG A;  5AWA A;  3CIY A;  4QXE A;  4FHO A;  4G8A A;  4KNG A;  2P1O B;  2Z62 A;  2O6S A;  4TZH A;  2ELL A;  4P91 A;  4LSA A;  3ULU A;  3W3J A;  5CMP A;  4FMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...