1P9HA

Crystal structure of the collagen-binding domain of yersinia adhesin yada
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
189
structure length
179
Chain Sequence
PNLTAVQISPNADPALGLEYGLNASAKGIHSIAIGATAEAAKGAAVAVGAGSIATGVNSVAIGPLSKALGDSAVTYGAASTAQKDGVAIGARASTSDTGVAVGFNSKADAKNSVAIGHSSHVAANHGYSIAIGDRSKTDRENSVSIGHESLNRQLTHLAAGTKDTDAVNVAQLKKEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Invasin
publication title The Yersinia adhesin YadA collagen-binding domain structure is a novel left-handed parallel beta-roll.
pubmed doi rcsb
source organism Yersinia enterocolitica
molecule tags Cell adhesion
total genus 55
structure length 179
sequence length 189
ec nomenclature
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05658 YadA_head Head domain of trimeric autotransporter adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 1p9hA00
1OM8A 1AF0A 1OM7A 1OMJA 3NTNA 2YO1A 2ZJ6A 3ULTA 1SMPA 2Z8XA 2ZVDA 3LA9A 2XQHA 1AKLA 1K7QA 1OM6A 1P9HA 2QUAA 5D7WA 4I35A 1JIWP 3LAAA 1GO7P 3U1RA 3WP8A 1O0TA 1O0QA 3A70A 2AGMA 3VI1A 1G9KA 1SRPA 3HBUP 5CXLA 1H71P 2ZJ7A 3A6ZA 1K7GA 1K7IA 2QUBA 3HDAP 1KAPP 3HB2P 3HBVP 2YO0A 2Z8ZA 1GO8P 2ML2A 3S6LA 5CVWA 1SATA
chains in the Genus database with same CATH superfamily
1OM8A 1AF0A 1OM7A 1OMJA 4DT5A 3NTNA 2YO1A 2ZJ6A 3ULTA 1SMPA 2Z8XA 2ZVDA 3LA9A 2XQHA 1AKLA 1K7QA 1OM6A 1P9HA 2QUAA 5D7WA 4I35A 1JIWP 3LAAA 1GO7P 3U1RA 3WP8A 1O0TA 1O0QA 3A70A 2AGMA 3VI1A 1G9KA 1SRPA 3HBUP 5CXLA 1H71P 2ZJ7A 3A6ZA 1K7GA 1K7IA 2QUBA 3HDAP 1KAPP 3HB2P 3HBVP 2YO0A 2Z8ZA 1GO8P 2ML2A 3S6LA 5CVWA 1SATA
chains in the Genus database with same CATH topology
1OM8A 1AF0A 1OM7A 1OMJA 3NTNA 2YO1A 2ZJ6A 3ULTA 1SMPA 2Z8XA 2ZVDA 3LA9A 2XQHA 1AKLA 1K7QA 1OM6A 1P9HA 2QUAA 5D7WA 4I35A 1JIWP 3LAAA 1GO7P 3U1RA 3WP8A 1O0TA 1O0QA 3A70A 2AGMA 3VI1A 1G9KA 1SRPA 3HBUP 5CXLA 1H71P 2ZJ7A 3A6ZA 1K7GA 1K7IA 2QUBA 3HDAP 1KAPP 3HB2P 3HBVP 2YO0A 2Z8ZA 1GO8P 2ML2A 3S6LA 5CVWA 1SATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OM8 A;  1AF0 A;  1OM7 A;  1OMJ A;  3NTN A;  2YO1 A;  2ZJ6 A;  3ULT A;  1SMP A;  2Z8X A;  2ZVD A;  3LA9 A;  2XQH A;  1AKL A;  1K7Q A;  1OM6 A;  1P9H A;  2QUA A;  5D7W A;  4I35 A;  1JIW P;  3LAA A;  1GO7 P;  3U1R A;  3WP8 A;  1O0T A;  1O0Q A;  3A70 A;  2AGM A;  3VI1 A;  1G9K A;  1SRP A;  3HBU P;  5CXL A;  1H71 P;  2ZJ7 A;  3A6Z A;  1K7G A;  1K7I A;  2QUB A;  3HDA P;  1KAP P;  3HB2 P;  3HBV P;  2YO0 A;  2Z8Z A;  1GO8 P;  2ML2 A;  3S6L A;  5CVW A;  1SAT A; 
#chains in the Genus database with same CATH topology
 1OM8 A;  1AF0 A;  1OM7 A;  1OMJ A;  4DT5 A;  3NTN A;  2YO1 A;  2ZJ6 A;  3ULT A;  1SMP A;  2Z8X A;  2ZVD A;  3LA9 A;  2XQH A;  1AKL A;  1K7Q A;  1OM6 A;  1P9H A;  2QUA A;  5D7W A;  4I35 A;  1JIW P;  3LAA A;  1GO7 P;  3U1R A;  3WP8 A;  1O0T A;  1O0Q A;  3A70 A;  2AGM A;  3VI1 A;  1G9K A;  1SRP A;  3HBU P;  5CXL A;  1H71 P;  2ZJ7 A;  3A6Z A;  1K7G A;  1K7I A;  2QUB A;  3HDA P;  1KAP P;  3HB2 P;  3HBV P;  2YO0 A;  2Z8Z A;  1GO8 P;  2ML2 A;  3S6L A;  5CVW A;  1SAT A; 
#chains in the Genus database with same CATH homology
 1OM8 A;  1AF0 A;  1OM7 A;  1OMJ A;  3NTN A;  2YO1 A;  2ZJ6 A;  3ULT A;  1SMP A;  2Z8X A;  2ZVD A;  3LA9 A;  2XQH A;  1AKL A;  1K7Q A;  1OM6 A;  1P9H A;  2QUA A;  5D7W A;  4I35 A;  1JIW P;  3LAA A;  1GO7 P;  3U1R A;  3WP8 A;  1O0T A;  1O0Q A;  3A70 A;  2AGM A;  3VI1 A;  1G9K A;  1SRP A;  3HBU P;  5CXL A;  1H71 P;  2ZJ7 A;  3A6Z A;  1K7G A;  1K7I A;  2QUB A;  3HDA P;  1KAP P;  3HB2 P;  3HBV P;  2YO0 A;  2Z8Z A;  1GO8 P;  2ML2 A;  3S6L A;  5CVW A;  1SAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...