1P9JA

Solution structure and dynamics of the egf/tgf-alpha chimera t1e
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
54
structure length
54
Chain Sequence
VVSHFNDCPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of an Epidermal Growth Factor/Transforming Growth Factor-alpha Chimera with Unique ErbB Binding Specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
molecule keywords chimera of Epidermal growth factor(EGF) and Transforming gro
total genus 4
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1p9jA00
2BOUA 1DVAL 5CKMA 3TZIA 3GCXE 4C16A 2H9EL 1IJQA 1G1RA 1Z6CA 1TLEA 4RRXA 2MHPA 1ATEA 1FAKL 5FDQA 3LC3B 4TGFA 4CUEA 1U67A 2WFTA 3GISX 1NFXB 1APQA 3TBDA 5KIRA 4XL1A 2FLBL 5IKQA 1HAFA 4A7IA 2RA0L 2GD4A 4ZXYL 1URKA 1EPHA 1IVOC 2VJ3A 1CEJA 4Z0LA 1LPGA 2VWLL 2Y82B 2D1JB 2G00L 1IGZA 1I0UA 1IP0A 1HJ7A 2F9BL 1P0SL 3P5BL 3F6UL 2VVUL 1COUA 2WG4B 3MQEA 1NZIA 1BF9A 1IOEL 3N8VA 4ZHAB 1NT0A 2XBWL 4X8VL 1M1XB 1EBVA 1IQML 2P95L 3KQDL 2KB9A 3KRKA 3LN1A 1UZKA 1Q4GA 4X8TL 3POYA 1GK5A 4FM5A 3SOVA 2W2ME 2EI7B 3KK6A 3HO4A 5I46L 3SOQA 3FFGL 4PH9A 1KLIL 1PFXL 3IJEB 4Z6AL 2FD6A 2K2TA 1KLOA 1CX2A 3TH3L 1AUTL 5IKVA 3LC5B 1HCGB 1NPEB 4BTUA 1FSBA 2FLRL 1N7DA 4MMYB 2VWNL 3NTBA 1ADXA 1G1QA 4BXWA 1HX2A 2W26B 4E1GA 2M74A 1EPIA 2MGRA 3KQEL 1FAXL 2ADXA 2BOHA 2W86A 2J95B 1EQGA 3CFWA 2J38B 5IKTA 3LAQA 4BXSA 1EAIC 3HS7A 3NT1A 3N8WA 5JBCE 3CA7A 1F7MA 3CS7L 2P26A 2W2PE 3ASIA 4RUTA 3EGFA 2BMGA 1DDXA 2Y5HL 3M37L 3N8WB 4Y7BB 2PHBB 1NFYB 1IQFL 3KL6B 1W8BL 1JV2B 4BTTA 2TGFA 1RFNB 1KIGL 1Z6EL 4JYVL 2J4IB 3BT1A 4YT7L 5CKQA 1A3PA 1U8CB 2KV4A 2WPME 4NG9L 4OTJA 1V3XB 2W3IB 4YT6L 1IQGL 3Q3KB 5JBAE 2BQ7A 2CJIB 1NQLB 5E8DA 1ATAA 1ATDA 2DDUA 4JZDL 3SW2A 2B7DL 4COXA 3TK6B 1XDTR 4D0FA 4JYUL 1W7XL 3M36L 1X7AL 3FBYA 5JB8E 1B9WA 1J9CL 2VH6B 1CVUA 2XBYL 4Y79B 4LMFA 5JB9E 2WPLE 2Y7ZB 4Y6DB 5JW1A 1IQLL 1IQEL 4NA9L 1YUGA 1HRFA 3KQBL 2XBXL 2W2NE 1HAEA 1EGFA 1EPJA 3PGHA 4Z0KB 2WPKE 2I9BA 1IQNL 3HO3A 3H5CB 3TK5B 1APOA 2XC5L 2WYJB 1EPGA 1IOXA 2WPHE 3C9AC 3LN0A 1CCVA 1SZBA 2NPRA 3HPTA 3R05A 4XLWA 1FFMA 4ZH8B 1F7EA 4JZFL 1UZPA 5CISA 3U73A 2VWMK 2XC4L 2XC0L 4Y76B 4JZEL 1WHFA 1YGCL 1TPGA 5F19A 2Y7XB 1LPKA 2KL7A 4XBMA 1FF7A 3BPSE 3QCWA 1UZJA 2P3TA 3HS6A 4RRZA 1UZQA 4D0EA 4RRWA 4M11A 1HT5A 2J34B 3OLTA 1LMJA 3N8YB 2K2SB 4X8UL 3MDLA 5COXA 4LORA 4ISIL 2P3UA 4D90A 5K0HB 1KSNB 3F1SB 3ZYJB 2J2UB 2P94L 1WU1B 2WYGB 5JBBE 3V65B 3QH0A 1PXXA 2JKHL 4ZXXL 2Y38A 1CCFA 3BT2A 3ZYGA 1ATBA 2FLGA 2PUQL 1L3YA 3IITB 2YGOA 1L5GB 1LPZA 2P16L 4MMXB 1F0SB 3V64C 3TGFA 1JBUL 3N8XA 1ZAQA 4O02B 3RR3A 1O5DL 1KLJL 1FE2A 4G1MB 5EGMB 5CKNA 4Y7AB 1IQKL 1TOZA 2BQ6A 3KQCL 3DEMA 4Y71B 1HT8A 3LIWB 1XKAL 3SOBB 1K37A 1YUFA 2Y5FL 2BZ6L 3LTGD 4X8SL 2MGPA 3FCSB 6COXA 5JVYA 1G1TA 1HREA 1DX5I 1MOXC 2WPJE 3QMOA 1LQDA 3Q7DA 1XKBA 2P3FL 1P9JA 3LTFB 1PRHA 1MQ6L 2OYUP 2RNLA 5JVZA 3ENSA 3HS5A 4BDWA 4OTYA 4O1ZA 4YZUB 2FZZL 1XFEA 3NJPC 1G1SA 1IQJL 2J94B 2BOKL 4CUDA 2VVVL 3GCWE 2AYLA 1CQEA 3ELAL 5L2ZL 1EQHA 2Y81B 4BTIA 1JL9A 1CVWL 3KCGL 1F0RB 3N8ZA 1G2LB 2W3KB 3N8YA 2EI6B 1EMOA 2P93L 5L2YL 5KN5C 2UWPB 2VVCK 1G2MB 2WPIE 3NTGA 3U7UG 1QFKL 3K9XA 2OYEP 1EMNA 1FJSL 4AQTA 1PGEA 2UWOB 1DQBA 2RHPA 2Y80B 1IGXA 1NFWB 2P3FN 2VWOL 4MMZB 2WFXB 4ZAEB 2BQWA 1OB1C 1NFUB 2YGPA 1HZ8A 1DIYA 2Q1JB 2EI8B 2BOXA 4RS0A 1MQ5L 3HO5A 2UWLB 2Y5GL 1EZQB 2XBVL 2P28B 4M10A 5F1AA 2W2QE 3ZYIB 4CUFA 1IQHL 2BO2A 2VH0B 2W2OE 1N1IA 1YO8A 4ISHL 4BDXA 2I9AA 5L30L 3OLUA 1C5MF 4RRYA 1WHEA 3CENL 1YUKB 4NGAL 4CSYA 2PR3B 1K36A 1PTHA 2WG3C 5IKRA 1IQIL
chains in the Genus database with same CATH superfamily
2BOUA 1DVAL 5CKMA 3TZIA 3GCXE 4C16A 2H9EL 1IJQA 1G1RA 1Z6CA 1TLEA 4RRXA 2MHPA 1ATEA 1FAKL 5FDQA 3LC3B 4TGFA 4CUEA 1U67A 2WFTA 3GISX 1NFXB 1APQA 3TBDA 5KIRA 2BSFA 4XL1A 2FLBL 5IKQA 1HAFA 4A7IA 2RA0L 2GD4A 4ZXYL 1URKA 1EPHA 1IVOC 2VJ3A 1CEJA 4Z0LA 1LPGA 2VWLL 2KNIA 2Y82B 2D1JB 2G00L 1IGZA 1I0UA 1IP0A 1HJ7A 2F9BL 1P0SL 3P5BL 3F6UL 2VVUL 1COUA 2WG4B 3MQEA 1NZIA 1BF9A 1IOEL 3N8VA 4ZHAB 1NT0A 2XBWL 1QIUA 2WZPP 4X8VL 1M1XB 1EBVA 1IQML 2P95L 3KQDL 2KB9A 3KRKA 3LN1A 1UZKA 1Q4GA 4X8TL 3POYA 1GK5A 4FM5A 3SOVA 2W2ME 2EI7B 3KK6A 3HO4A 5I46L 3SOQA 3FFGL 4PH9A 1LMMA 4GU4A 1KLIL 1PFXL 3IJEB 4Z6AL 2FD6A 2K2TA 1KLOA 1CX2A 3TH3L 1AUTL 5IKVA 3LC5B 1HCGB 1NPEB 4BTUA 1FSBA 2FLRL 1N7DA 1V1HA 4MMYB 2VWNL 3NTBA 1ADXA 1G1QA 4BXWA 1HX2A 2W26B 4E1GA 2M74A 1EPIA 2MGRA 1KKEA 3KQEL 1FAXL 2ADXA 2BOHA 2W86A 2J95B 1EQGA 3CFWA 2J38B 5IKTA 3LAQA 4BXSA 1EAIC 3HS7A 3NT1A 3N8WA 2VRSA 5JBCE 3CA7A 1F7MA 3CS7L 2P26A 2W2PE 3ASIA 4RUTA 3EGFA 2BMGA 1DDXA 2Y5HL 3M37L 3N8WB 4Y7BB 2PHBB 1NFYB 1IQFL 3KL6B 2HORA 1W8BL 1JV2B 4BTTA 2TGFA 1RFNB 1KIGL 1V1IA 1Z6EL 2BT7A 2J4IB 3BT1A 4JYVL 4YT7L 5CKQA 1A3PA 1U8CB 2KV4A 2WPME 4NG9L 4OTJA 1V3XB 2W3IB 4YT6L 1IQGL 3Q3KB 5JBAE 2BQ7A 2CJIB 1NQLB 5E8DA 1ATAA 1ATDA 2DDUA 4JZDL 3SW2A 2B7DL 4COXA 3TK6B 1XDTR 4D0FA 4JYUL 1W7XL 3M36L 1X7AL 3FBYA 5JB8E 1B9WA 1J9CL 2VH6B 1CVUA 2XBYL 4Y79B 4LMFA 5JB9E 2WPLE 2Y7ZB 4Y6DB 2H9EC 5JW1A 1IQLL 1IQEL 4NA9L 1YUGA 1HRFA 3KQBL 2XBXL 2W2NE 1HAEA 1EGFA 1EPJA 3PGHA 4Z0KB 2WPKE 2I9BA 1IQNL 3HO3A 3H5CB 3TK5B 1APOA 2XC5L 2WYJB 1EPGA 1IOXA 2WPHE 3C9AC 3LN0A 1CCVA 1SZBA 2NPRA 3HPTA 3R05A 4XLWA 1FFMA 4ZH8B 1F7EA 4JZFL 1UZPA 5CISA 3U73A 2VWMK 2XC4L 2XC0L 4Y76B 4JZEL 1WHFA 1YGCL 1TPGA 5F19A 2Y7XB 1LPKA 2KL7A 4XBMA 1FF7A 3BPSE 3QCWA 1UZJA 2P3TA 3HS6A 4RRZA 1UZQA 4D0EA 4RRWA 4M11A 1HT5A 2J34B 3OLTA 1LMJA 3N8YB 2K2SB 4X8UL 3MDLA 5COXA 4LORA 4ISIL 2P3UA 4D90A 5K0HB 1KSNB 3F1SB 3ZYJB 2J2UB 2P94L 1WU1B 2WYGB 5JBBE 3V65B 3QH0A 1PXXA 2JKHL 4A94C 4ZXXL 2Y38A 1CCFA 3BT2A 3ZYGA 1ATBA 2FLGA 2PUQL 1L3YA 2BT8A 3IITB 4GU3A 2YGOA 1L5GB 1LPZA 2P16L 4MMXB 1F0SB 3V64C 3TGFA 1JBUL 2JJLA 3N8XA 1ZAQA 4O02B 3RR3A 1O5DL 1KLJL 1FE2A 4G1MB 5EGMB 5CKNA 4Y7AB 1IQKL 1TOZA 2BQ6A 3KQCL 3DEMA 4Y71B 1HT8A 3LIWB 1XKAL 3SOBB 1K37A 1YUFA 2Y5FL 2BZ6L 3LTGD 4X8SL 2MGPA 3FCSB 6COXA 5JVYA 1G1TA 1HREA 1DX5I 1MOXC 2WPJE 3QMOA 1LQDA 3Q7DA 1XKBA 2P3FL 1P9JA 3LTFB 1PRHA 1MQ6L 2OYUP 2RNLA 5JVZA 3ENSA 3HS5A 4BDWA 4OTYA 4O1ZA 4YZUB 2FZZL 1XFEA 3NJPC 1G1SA 1IQJL 2J94B 2BOKL 4CUDA 2VVVL 3GCWE 2AYLA 1CQEA 3ELAL 5L2ZL 1EQHA 2Y81B 4BTIA 1JL9A 1CVWL 3KCGL 1F0RB 3N8ZA 1G2LB 2W3KB 3N8YA 2EI6B 1EMOA 2P93L 5L2YL 5KN5C 2UWPB 2VVCK 1G2MB 2WPIE 3NTGA 3U7UG 1QFKL 3K9XA 2OYEP 1LK9A 1EMNA 1FJSL 4AQTA 1PGEA 2UWOB 1DQBA 2RHPA 2Y80B 1IGXA 1NFWB 2P3FN 2VWOL 4MMZB 2WFXB 4ZAEB 2BQWA 1OB1C 1NFUB 2YGPA 1HZ8A 1DIYA 2Q1JB 2EI8B 2BOXA 4RS0A 1MQ5L 3HO5A 2UWLB 2Y5GL 1EZQB 2XBVL 2P28B 4M10A 5F1AA 2W2QE 3ZYIB 4CUFA 1IQHL 2YGQA 3S6XA 2BO2A 2VH0B 2W2OE 1N1IA 1YO8A 4ISHL 4BDXA 2I9AA 5L30L 3OLUA 1C5MF 4RRYA 1WHEA 3CENL 1YUKB 4NGAL 4CSYA 2PR3B 1K36A 2HOXA 1PTHA 2WG3C 5IKRA 1IQIL
chains in the Genus database with same CATH topology
2BOUA 1DVAL 5CKMA 3TZIA 3GCXE 4C16A 2H9EL 1IJQA 1G1RA 1Z6CA 1TLEA 4RRXA 2MHPA 1ATEA 1FAKL 5FDQA 3LC3B 4TGFA 4CUEA 1U67A 2WFTA 3GISX 1NFXB 1APQA 3TBDA 5KIRA 4XL1A 2FLBL 5IKQA 1HAFA 4A7IA 2RA0L 2GD4A 4ZXYL 1URKA 1EPHA 1IVOC 2VJ3A 1CEJA 4Z0LA 1LPGA 2VWLL 2KNIA 2Y82B 2D1JB 2G00L 1IGZA 1I0UA 1IP0A 1HJ7A 2F9BL 1P0SL 3P5BL 3F6UL 2VVUL 1COUA 2WG4B 3MQEA 1NZIA 1BF9A 1IOEL 3N8VA 4ZHAB 1NT0A 2XBWL 2WZPP 4X8VL 1M1XB 1EBVA 1IQML 2P95L 3KQDL 2KB9A 3KRKA 3LN1A 1UZKA 1Q4GA 4X8TL 3POYA 1GK5A 4FM5A 3SOVA 2W2ME 2EI7B 3KK6A 3HO4A 5I46L 3SOQA 3FFGL 4PH9A 1LMMA 1KLIL 1PFXL 3IJEB 4Z6AL 2FD6A 2K2TA 1KLOA 1CX2A 3TH3L 1AUTL 5IKVA 3LC5B 1HCGB 1NPEB 4BTUA 1FSBA 2FLRL 1N7DA 4MMYB 2VWNL 3NTBA 1ADXA 1G1QA 4BXWA 1HX2A 2W26B 4E1GA 2M74A 1EPIA 2MGRA 3KQEL 1FAXL 2ADXA 2BOHA 2W86A 2J95B 1EQGA 3CFWA 2J38B 5IKTA 3LAQA 4BXSA 1EAIC 3HS7A 3NT1A 3N8WA 5JBCE 3CA7A 1F7MA 3CS7L 2P26A 2W2PE 3ASIA 4RUTA 3EGFA 2BMGA 1DDXA 2Y5HL 3M37L 3N8WB 4Y7BB 2PHBB 1NFYB 1IQFL 3KL6B 1W8BL 1JV2B 4BTTA 2TGFA 1RFNB 1KIGL 1Z6EL 4JYVL 2J4IB 3BT1A 4YT7L 5CKQA 1A3PA 1U8CB 2KV4A 2WPME 4NG9L 4OTJA 1V3XB 2W3IB 4YT6L 1IQGL 3Q3KB 5JBAE 2BQ7A 2CJIB 1NQLB 5E8DA 1ATAA 1ATDA 2DDUA 4JZDL 3SW2A 2B7DL 4COXA 3TK6B 1XDTR 4D0FA 4JYUL 1W7XL 3M36L 1X7AL 3FBYA 5JB8E 1B9WA 1J9CL 2VH6B 1CVUA 2XBYL 4Y79B 4LMFA 5JB9E 2WPLE 2Y7ZB 4Y6DB 2H9EC 5JW1A 1IQLL 1IQEL 4NA9L 1YUGA 1HRFA 3KQBL 2XBXL 2W2NE 1HAEA 1EGFA 1EPJA 3PGHA 4Z0KB 2WPKE 2I9BA 1IQNL 3HO3A 3H5CB 3TK5B 1APOA 2XC5L 2WYJB 1EPGA 1IOXA 2WPHE 3C9AC 3LN0A 1CCVA 1SZBA 2NPRA 3HPTA 3R05A 4XLWA 1FFMA 4ZH8B 1F7EA 4JZFL 1UZPA 5CISA 3U73A 2VWMK 2XC4L 2XC0L 4Y76B 4JZEL 1WHFA 1YGCL 1TPGA 5F19A 2Y7XB 1LPKA 2KL7A 4XBMA 1FF7A 3BPSE 3QCWA 1UZJA 2P3TA 3HS6A 4RRZA 1UZQA 4D0EA 4RRWA 4M11A 1HT5A 2J34B 3OLTA 1LMJA 3N8YB 2K2SB 4X8UL 3MDLA 5COXA 4LORA 4ISIL 2P3UA 4D90A 5K0HB 1KSNB 3F1SB 3ZYJB 2J2UB 2P94L 1WU1B 2WYGB 5JBBE 3V65B 3QH0A 1PXXA 2JKHL 4A94C 4ZXXL 2Y38A 1CCFA 3BT2A 3ZYGA 1ATBA 2FLGA 2PUQL 1L3YA 3IITB 2YGOA 1L5GB 1LPZA 2P16L 4MMXB 1F0SB 3V64C 3TGFA 1JBUL 3N8XA 1ZAQA 4O02B 3RR3A 1O5DL 1KLJL 1FE2A 4G1MB 5EGMB 5CKNA 4Y7AB 1IQKL 1TOZA 2BQ6A 3KQCL 3DEMA 4Y71B 1HT8A 3LIWB 1XKAL 3SOBB 1K37A 1YUFA 2Y5FL 2BZ6L 3LTGD 4X8SL 2MGPA 3FCSB 6COXA 5JVYA 1G1TA 1HREA 1DX5I 1MOXC 2WPJE 3QMOA 1LQDA 3Q7DA 1XKBA 2P3FL 1P9JA 3LTFB 1PRHA 1MQ6L 2OYUP 2RNLA 5JVZA 3ENSA 3HS5A 4BDWA 4OTYA 4O1ZA 4YZUB 2FZZL 1XFEA 3NJPC 1G1SA 1IQJL 2J94B 2BOKL 4CUDA 2VVVL 3GCWE 2AYLA 1CQEA 3ELAL 5L2ZL 1EQHA 2Y81B 4BTIA 1JL9A 1CVWL 3KCGL 1F0RB 3N8ZA 1G2LB 2W3KB 3N8YA 2EI6B 1EMOA 2P93L 5L2YL 5KN5C 2UWPB 2VVCK 1G2MB 2WPIE 3NTGA 3U7UG 1QFKL 3K9XA 2OYEP 1EMNA 1FJSL 4AQTA 1PGEA 2UWOB 1DQBA 2RHPA 2Y80B 1IGXA 1NFWB 2P3FN 2VWOL 4MMZB 2WFXB 4ZAEB 2BQWA 1OB1C 1NFUB 2YGPA 1HZ8A 1DIYA 2Q1JB 2EI8B 2BOXA 4RS0A 1MQ5L 3HO5A 2UWLB 2Y5GL 1EZQB 2XBVL 2P28B 4M10A 5F1AA 2W2QE 3ZYIB 4CUFA 1IQHL 2YGQA 3S6XA 2BO2A 2VH0B 2W2OE 1N1IA 1YO8A 4ISHL 4BDXA 2I9AA 5L30L 3OLUA 1C5MF 4RRYA 1WHEA 3CENL 1YUKB 4NGAL 4CSYA 2PR3B 1K36A 1PTHA 2WG3C 5IKRA 1IQIL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BOU A;  1DVA L;  5CKM A;  3TZI A;  3GCX E;  4C16 A;  2H9E L;  1IJQ A;  1G1R A;  1Z6C A;  1TLE A;  4RRX A;  2MHP A;  1ATE A;  1FAK L;  5FDQ A;  3LC3 B;  4TGF A;  4CUE A;  1U67 A;  2WFT A;  3GIS X;  1NFX B;  1APQ A;  3TBD A;  5KIR A;  4XL1 A;  2FLB L;  5IKQ A;  1HAF A;  4A7I A;  2RA0 L;  2GD4 A;  4ZXY L;  1URK A;  1EPH A;  1IVO C;  2VJ3 A;  1CEJ A;  4Z0L A;  1LPG A;  2VWL L;  2Y82 B;  2D1J B;  2G00 L;  1IGZ A;  1I0U A;  1IP0 A;  1HJ7 A;  2F9B L;  1P0S L;  3P5B L;  3F6U L;  2VVU L;  1COU A;  2WG4 B;  3MQE A;  1NZI A;  1BF9 A;  1IOE L;  3N8V A;  4ZHA B;  1NT0 A;  2XBW L;  4X8V L;  1M1X B;  1EBV A;  1IQM L;  2P95 L;  3KQD L;  2KB9 A;  3KRK A;  3LN1 A;  1UZK A;  1Q4G A;  4X8T L;  3POY A;  1GK5 A;  4FM5 A;  3SOV A;  2W2M E;  2EI7 B;  3KK6 A;  3HO4 A;  5I46 L;  3SOQ A;  3FFG L;  4PH9 A;  1KLI L;  1PFX L;  3IJE B;  4Z6A L;  2FD6 A;  2K2T A;  1KLO A;  1CX2 A;  3TH3 L;  1AUT L;  5IKV A;  3LC5 B;  1HCG B;  1NPE B;  4BTU A;  1FSB A;  2FLR L;  1N7D A;  4MMY B;  2VWN L;  3NTB A;  1ADX A;  1G1Q A;  4BXW A;  1HX2 A;  2W26 B;  4E1G A;  2M74 A;  1EPI A;  2MGR A;  3KQE L;  1FAX L;  2ADX A;  2BOH A;  2W86 A;  2J95 B;  1EQG A;  3CFW A;  2J38 B;  5IKT A;  3LAQ A;  4BXS A;  1EAI C;  3HS7 A;  3NT1 A;  3N8W A;  5JBC E;  3CA7 A;  1F7M A;  3CS7 L;  2P26 A;  2W2P E;  3ASI A;  4RUT A;  3EGF A;  2BMG A;  1DDX A;  2Y5H L;  3M37 L;  3N8W B;  4Y7B B;  2PHB B;  1NFY B;  1IQF L;  3KL6 B;  1W8B L;  1JV2 B;  4BTT A;  2TGF A;  1RFN B;  1KIG L;  1Z6E L;  4JYV L;  2J4I B;  3BT1 A;  4YT7 L;  5CKQ A;  1A3P A;  1U8C B;  2KV4 A;  2WPM E;  4NG9 L;  4OTJ A;  1V3X B;  2W3I B;  4YT6 L;  1IQG L;  3Q3K B;  5JBA E;  2BQ7 A;  2CJI B;  1NQL B;  5E8D A;  1ATA A;  1ATD A;  2DDU A;  4JZD L;  3SW2 A;  2B7D L;  4COX A;  3TK6 B;  1XDT R;  4D0F A;  4JYU L;  1W7X L;  3M36 L;  1X7A L;  3FBY A;  5JB8 E;  1B9W A;  1J9C L;  2VH6 B;  1CVU A;  2XBY L;  4Y79 B;  4LMF A;  5JB9 E;  2WPL E;  2Y7Z B;  4Y6D B;  5JW1 A;  1IQL L;  1IQE L;  4NA9 L;  1YUG A;  1HRF A;  3KQB L;  2XBX L;  2W2N E;  1HAE A;  1EGF A;  1EPJ A;  3PGH A;  4Z0K B;  2WPK E;  2I9B A;  1IQN L;  3HO3 A;  3H5C B;  3TK5 B;  1APO A;  2XC5 L;  2WYJ B;  1EPG A;  1IOX A;  2WPH E;  3C9A C;  3LN0 A;  1CCV A;  1SZB A;  2NPR A;  3HPT A;  3R05 A;  4XLW A;  1FFM A;  4ZH8 B;  1F7E A;  4JZF L;  1UZP A;  5CIS A;  3U73 A;  2VWM K;  2XC4 L;  2XC0 L;  4Y76 B;  4JZE L;  1WHF A;  1YGC L;  1TPG A;  5F19 A;  2Y7X B;  1LPK A;  2KL7 A;  4XBM A;  1FF7 A;  3BPS E;  3QCW A;  1UZJ A;  2P3T A;  3HS6 A;  4RRZ A;  1UZQ A;  4D0E A;  4RRW A;  4M11 A;  1HT5 A;  2J34 B;  3OLT A;  1LMJ A;  3N8Y B;  2K2S B;  4X8U L;  3MDL A;  5COX A;  4LOR A;  4ISI L;  2P3U A;  4D90 A;  5K0H B;  1KSN B;  3F1S B;  3ZYJ B;  2J2U B;  2P94 L;  1WU1 B;  2WYG B;  5JBB E;  3V65 B;  3QH0 A;  1PXX A;  2JKH L;  4ZXX L;  2Y38 A;  1CCF A;  3BT2 A;  3ZYG A;  1ATB A;  2FLG A;  2PUQ L;  1L3Y A;  3IIT B;  2YGO A;  1L5G B;  1LPZ A;  2P16 L;  4MMX B;  1F0S B;  3V64 C;  3TGF A;  1JBU L;  3N8X A;  1ZAQ A;  4O02 B;  3RR3 A;  1O5D L;  1KLJ L;  1FE2 A;  4G1M B;  5EGM B;  5CKN A;  4Y7A B;  1IQK L;  1TOZ A;  2BQ6 A;  3KQC L;  3DEM A;  4Y71 B;  1HT8 A;  3LIW B;  1XKA L;  3SOB B;  1K37 A;  1YUF A;  2Y5F L;  2BZ6 L;  3LTG D;  4X8S L;  2MGP A;  3FCS B;  6COX A;  5JVY A;  1G1T A;  1HRE A;  1DX5 I;  1MOX C;  2WPJ E;  3QMO A;  1LQD A;  3Q7D A;  1XKB A;  2P3F L;  1P9J A;  3LTF B;  1PRH A;  1MQ6 L;  2OYU P;  2RNL A;  5JVZ A;  3ENS A;  3HS5 A;  4BDW A;  4OTY A;  4O1Z A;  4YZU B;  2FZZ L;  1XFE A;  3NJP C;  1G1S A;  1IQJ L;  2J94 B;  2BOK L;  4CUD A;  2VVV L;  3GCW E;  2AYL A;  1CQE A;  3ELA L;  5L2Z L;  1EQH A;  2Y81 B;  4BTI A;  1JL9 A;  1CVW L;  3KCG L;  1F0R B;  3N8Z A;  1G2L B;  2W3K B;  3N8Y A;  2EI6 B;  1EMO A;  2P93 L;  5L2Y L;  5KN5 C;  2UWP B;  2VVC K;  1G2M B;  2WPI E;  3NTG A;  3U7U G;  1QFK L;  3K9X A;  2OYE P;  1EMN A;  1FJS L;  4AQT A;  1PGE A;  2UWO B;  1DQB A;  2RHP A;  2Y80 B;  1IGX A;  1NFW B;  2P3F N;  2VWO L;  4MMZ B;  2WFX B;  4ZAE B;  2BQW A;  1OB1 C;  1NFU B;  2YGP A;  1HZ8 A;  1DIY A;  2Q1J B;  2EI8 B;  2BOX A;  4RS0 A;  1MQ5 L;  3HO5 A;  2UWL B;  2Y5G L;  1EZQ B;  2XBV L;  2P28 B;  4M10 A;  5F1A A;  2W2Q E;  3ZYI B;  4CUF A;  1IQH L;  2BO2 A;  2VH0 B;  2W2O E;  1N1I A;  1YO8 A;  4ISH L;  4BDX A;  2I9A A;  5L30 L;  3OLU A;  1C5M F;  4RRY A;  1WHE A;  3CEN L;  1YUK B;  4NGA L;  4CSY A;  2PR3 B;  1K36 A;  1PTH A;  2WG3 C;  5IKR A;  1IQI L; 
#chains in the Genus database with same CATH topology
 2BOU A;  1DVA L;  5CKM A;  3TZI A;  3GCX E;  4C16 A;  2H9E L;  1IJQ A;  1G1R A;  1Z6C A;  1TLE A;  4RRX A;  2MHP A;  1ATE A;  1FAK L;  5FDQ A;  3LC3 B;  4TGF A;  4CUE A;  1U67 A;  2WFT A;  3GIS X;  1NFX B;  1APQ A;  3TBD A;  5KIR A;  2BSF A;  4XL1 A;  2FLB L;  5IKQ A;  1HAF A;  4A7I A;  2RA0 L;  2GD4 A;  4ZXY L;  1URK A;  1EPH A;  1IVO C;  2VJ3 A;  1CEJ A;  4Z0L A;  1LPG A;  2VWL L;  2KNI A;  2Y82 B;  2D1J B;  2G00 L;  1IGZ A;  1I0U A;  1IP0 A;  1HJ7 A;  2F9B L;  1P0S L;  3P5B L;  3F6U L;  2VVU L;  1COU A;  2WG4 B;  3MQE A;  1NZI A;  1BF9 A;  1IOE L;  3N8V A;  4ZHA B;  1NT0 A;  2XBW L;  1QIU A;  2WZP P;  4X8V L;  1M1X B;  1EBV A;  1IQM L;  2P95 L;  3KQD L;  2KB9 A;  3KRK A;  3LN1 A;  1UZK A;  1Q4G A;  4X8T L;  3POY A;  1GK5 A;  4FM5 A;  3SOV A;  2W2M E;  2EI7 B;  3KK6 A;  3HO4 A;  5I46 L;  3SOQ A;  3FFG L;  4PH9 A;  1LMM A;  4GU4 A;  1KLI L;  1PFX L;  3IJE B;  4Z6A L;  2FD6 A;  2K2T A;  1KLO A;  1CX2 A;  3TH3 L;  1AUT L;  5IKV A;  3LC5 B;  1HCG B;  1NPE B;  4BTU A;  1FSB A;  2FLR L;  1N7D A;  1V1H A;  4MMY B;  2VWN L;  3NTB A;  1ADX A;  1G1Q A;  4BXW A;  1HX2 A;  2W26 B;  4E1G A;  2M74 A;  1EPI A;  2MGR A;  1KKE A;  3KQE L;  1FAX L;  2ADX A;  2BOH A;  2W86 A;  2J95 B;  1EQG A;  3CFW A;  2J38 B;  5IKT A;  3LAQ A;  4BXS A;  1EAI C;  3HS7 A;  3NT1 A;  3N8W A;  2VRS A;  5JBC E;  3CA7 A;  1F7M A;  3CS7 L;  2P26 A;  2W2P E;  3ASI A;  4RUT A;  3EGF A;  2BMG A;  1DDX A;  2Y5H L;  3M37 L;  3N8W B;  4Y7B B;  2PHB B;  1NFY B;  1IQF L;  3KL6 B;  2HOR A;  1W8B L;  1JV2 B;  4BTT A;  2TGF A;  1RFN B;  1KIG L;  1V1I A;  1Z6E L;  2BT7 A;  2J4I B;  3BT1 A;  4JYV L;  4YT7 L;  5CKQ A;  1A3P A;  1U8C B;  2KV4 A;  2WPM E;  4NG9 L;  4OTJ A;  1V3X B;  2W3I B;  4YT6 L;  1IQG L;  3Q3K B;  5JBA E;  2BQ7 A;  2CJI B;  1NQL B;  5E8D A;  1ATA A;  1ATD A;  2DDU A;  4JZD L;  3SW2 A;  2B7D L;  4COX A;  3TK6 B;  1XDT R;  4D0F A;  4JYU L;  1W7X L;  3M36 L;  1X7A L;  3FBY A;  5JB8 E;  1B9W A;  1J9C L;  2VH6 B;  1CVU A;  2XBY L;  4Y79 B;  4LMF A;  5JB9 E;  2WPL E;  2Y7Z B;  4Y6D B;  2H9E C;  5JW1 A;  1IQL L;  1IQE L;  4NA9 L;  1YUG A;  1HRF A;  3KQB L;  2XBX L;  2W2N E;  1HAE A;  1EGF A;  1EPJ A;  3PGH A;  4Z0K B;  2WPK E;  2I9B A;  1IQN L;  3HO3 A;  3H5C B;  3TK5 B;  1APO A;  2XC5 L;  2WYJ B;  1EPG A;  1IOX A;  2WPH E;  3C9A C;  3LN0 A;  1CCV A;  1SZB A;  2NPR A;  3HPT A;  3R05 A;  4XLW A;  1FFM A;  4ZH8 B;  1F7E A;  4JZF L;  1UZP A;  5CIS A;  3U73 A;  2VWM K;  2XC4 L;  2XC0 L;  4Y76 B;  4JZE L;  1WHF A;  1YGC L;  1TPG A;  5F19 A;  2Y7X B;  1LPK A;  2KL7 A;  4XBM A;  1FF7 A;  3BPS E;  3QCW A;  1UZJ A;  2P3T A;  3HS6 A;  4RRZ A;  1UZQ A;  4D0E A;  4RRW A;  4M11 A;  1HT5 A;  2J34 B;  3OLT A;  1LMJ A;  3N8Y B;  2K2S B;  4X8U L;  3MDL A;  5COX A;  4LOR A;  4ISI L;  2P3U A;  4D90 A;  5K0H B;  1KSN B;  3F1S B;  3ZYJ B;  2J2U B;  2P94 L;  1WU1 B;  2WYG B;  5JBB E;  3V65 B;  3QH0 A;  1PXX A;  2JKH L;  4A94 C;  4ZXX L;  2Y38 A;  1CCF A;  3BT2 A;  3ZYG A;  1ATB A;  2FLG A;  2PUQ L;  1L3Y A;  2BT8 A;  3IIT B;  4GU3 A;  2YGO A;  1L5G B;  1LPZ A;  2P16 L;  4MMX B;  1F0S B;  3V64 C;  3TGF A;  1JBU L;  2JJL A;  3N8X A;  1ZAQ A;  4O02 B;  3RR3 A;  1O5D L;  1KLJ L;  1FE2 A;  4G1M B;  5EGM B;  5CKN A;  4Y7A B;  1IQK L;  1TOZ A;  2BQ6 A;  3KQC L;  3DEM A;  4Y71 B;  1HT8 A;  3LIW B;  1XKA L;  3SOB B;  1K37 A;  1YUF A;  2Y5F L;  2BZ6 L;  3LTG D;  4X8S L;  2MGP A;  3FCS B;  6COX A;  5JVY A;  1G1T A;  1HRE A;  1DX5 I;  1MOX C;  2WPJ E;  3QMO A;  1LQD A;  3Q7D A;  1XKB A;  2P3F L;  1P9J A;  3LTF B;  1PRH A;  1MQ6 L;  2OYU P;  2RNL A;  5JVZ A;  3ENS A;  3HS5 A;  4BDW A;  4OTY A;  4O1Z A;  4YZU B;  2FZZ L;  1XFE A;  3NJP C;  1G1S A;  1IQJ L;  2J94 B;  2BOK L;  4CUD A;  2VVV L;  3GCW E;  2AYL A;  1CQE A;  3ELA L;  5L2Z L;  1EQH A;  2Y81 B;  4BTI A;  1JL9 A;  1CVW L;  3KCG L;  1F0R B;  3N8Z A;  1G2L B;  2W3K B;  3N8Y A;  2EI6 B;  1EMO A;  2P93 L;  5L2Y L;  5KN5 C;  2UWP B;  2VVC K;  1G2M B;  2WPI E;  3NTG A;  3U7U G;  1QFK L;  3K9X A;  2OYE P;  1LK9 A;  1EMN A;  1FJS L;  4AQT A;  1PGE A;  2UWO B;  1DQB A;  2RHP A;  2Y80 B;  1IGX A;  1NFW B;  2P3F N;  2VWO L;  4MMZ B;  2WFX B;  4ZAE B;  2BQW A;  1OB1 C;  1NFU B;  2YGP A;  1HZ8 A;  1DIY A;  2Q1J B;  2EI8 B;  2BOX A;  4RS0 A;  1MQ5 L;  3HO5 A;  2UWL B;  2Y5G L;  1EZQ B;  2XBV L;  2P28 B;  4M10 A;  5F1A A;  2W2Q E;  3ZYI B;  4CUF A;  1IQH L;  2YGQ A;  3S6X A;  2BO2 A;  2VH0 B;  2W2O E;  1N1I A;  1YO8 A;  4ISH L;  4BDX A;  2I9A A;  5L30 L;  3OLU A;  1C5M F;  4RRY A;  1WHE A;  3CEN L;  1YUK B;  4NGA L;  4CSY A;  2PR3 B;  1K36 A;  2HOX A;  1PTH A;  2WG3 C;  5IKR A;  1IQI L; 
#chains in the Genus database with same CATH homology
 2BOU A;  1DVA L;  5CKM A;  3TZI A;  3GCX E;  4C16 A;  2H9E L;  1IJQ A;  1G1R A;  1Z6C A;  1TLE A;  4RRX A;  2MHP A;  1ATE A;  1FAK L;  5FDQ A;  3LC3 B;  4TGF A;  4CUE A;  1U67 A;  2WFT A;  3GIS X;  1NFX B;  1APQ A;  3TBD A;  5KIR A;  4XL1 A;  2FLB L;  5IKQ A;  1HAF A;  4A7I A;  2RA0 L;  2GD4 A;  4ZXY L;  1URK A;  1EPH A;  1IVO C;  2VJ3 A;  1CEJ A;  4Z0L A;  1LPG A;  2VWL L;  2KNI A;  2Y82 B;  2D1J B;  2G00 L;  1IGZ A;  1I0U A;  1IP0 A;  1HJ7 A;  2F9B L;  1P0S L;  3P5B L;  3F6U L;  2VVU L;  1COU A;  2WG4 B;  3MQE A;  1NZI A;  1BF9 A;  1IOE L;  3N8V A;  4ZHA B;  1NT0 A;  2XBW L;  2WZP P;  4X8V L;  1M1X B;  1EBV A;  1IQM L;  2P95 L;  3KQD L;  2KB9 A;  3KRK A;  3LN1 A;  1UZK A;  1Q4G A;  4X8T L;  3POY A;  1GK5 A;  4FM5 A;  3SOV A;  2W2M E;  2EI7 B;  3KK6 A;  3HO4 A;  5I46 L;  3SOQ A;  3FFG L;  4PH9 A;  1LMM A;  1KLI L;  1PFX L;  3IJE B;  4Z6A L;  2FD6 A;  2K2T A;  1KLO A;  1CX2 A;  3TH3 L;  1AUT L;  5IKV A;  3LC5 B;  1HCG B;  1NPE B;  4BTU A;  1FSB A;  2FLR L;  1N7D A;  4MMY B;  2VWN L;  3NTB A;  1ADX A;  1G1Q A;  4BXW A;  1HX2 A;  2W26 B;  4E1G A;  2M74 A;  1EPI A;  2MGR A;  3KQE L;  1FAX L;  2ADX A;  2BOH A;  2W86 A;  2J95 B;  1EQG A;  3CFW A;  2J38 B;  5IKT A;  3LAQ A;  4BXS A;  1EAI C;  3HS7 A;  3NT1 A;  3N8W A;  5JBC E;  3CA7 A;  1F7M A;  3CS7 L;  2P26 A;  2W2P E;  3ASI A;  4RUT A;  3EGF A;  2BMG A;  1DDX A;  2Y5H L;  3M37 L;  3N8W B;  4Y7B B;  2PHB B;  1NFY B;  1IQF L;  3KL6 B;  1W8B L;  1JV2 B;  4BTT A;  2TGF A;  1RFN B;  1KIG L;  1Z6E L;  4JYV L;  2J4I B;  3BT1 A;  4YT7 L;  5CKQ A;  1A3P A;  1U8C B;  2KV4 A;  2WPM E;  4NG9 L;  4OTJ A;  1V3X B;  2W3I B;  4YT6 L;  1IQG L;  3Q3K B;  5JBA E;  2BQ7 A;  2CJI B;  1NQL B;  5E8D A;  1ATA A;  1ATD A;  2DDU A;  4JZD L;  3SW2 A;  2B7D L;  4COX A;  3TK6 B;  1XDT R;  4D0F A;  4JYU L;  1W7X L;  3M36 L;  1X7A L;  3FBY A;  5JB8 E;  1B9W A;  1J9C L;  2VH6 B;  1CVU A;  2XBY L;  4Y79 B;  4LMF A;  5JB9 E;  2WPL E;  2Y7Z B;  4Y6D B;  2H9E C;  5JW1 A;  1IQL L;  1IQE L;  4NA9 L;  1YUG A;  1HRF A;  3KQB L;  2XBX L;  2W2N E;  1HAE A;  1EGF A;  1EPJ A;  3PGH A;  4Z0K B;  2WPK E;  2I9B A;  1IQN L;  3HO3 A;  3H5C B;  3TK5 B;  1APO A;  2XC5 L;  2WYJ B;  1EPG A;  1IOX A;  2WPH E;  3C9A C;  3LN0 A;  1CCV A;  1SZB A;  2NPR A;  3HPT A;  3R05 A;  4XLW A;  1FFM A;  4ZH8 B;  1F7E A;  4JZF L;  1UZP A;  5CIS A;  3U73 A;  2VWM K;  2XC4 L;  2XC0 L;  4Y76 B;  4JZE L;  1WHF A;  1YGC L;  1TPG A;  5F19 A;  2Y7X B;  1LPK A;  2KL7 A;  4XBM A;  1FF7 A;  3BPS E;  3QCW A;  1UZJ A;  2P3T A;  3HS6 A;  4RRZ A;  1UZQ A;  4D0E A;  4RRW A;  4M11 A;  1HT5 A;  2J34 B;  3OLT A;  1LMJ A;  3N8Y B;  2K2S B;  4X8U L;  3MDL A;  5COX A;  4LOR A;  4ISI L;  2P3U A;  4D90 A;  5K0H B;  1KSN B;  3F1S B;  3ZYJ B;  2J2U B;  2P94 L;  1WU1 B;  2WYG B;  5JBB E;  3V65 B;  3QH0 A;  1PXX A;  2JKH L;  4A94 C;  4ZXX L;  2Y38 A;  1CCF A;  3BT2 A;  3ZYG A;  1ATB A;  2FLG A;  2PUQ L;  1L3Y A;  3IIT B;  2YGO A;  1L5G B;  1LPZ A;  2P16 L;  4MMX B;  1F0S B;  3V64 C;  3TGF A;  1JBU L;  3N8X A;  1ZAQ A;  4O02 B;  3RR3 A;  1O5D L;  1KLJ L;  1FE2 A;  4G1M B;  5EGM B;  5CKN A;  4Y7A B;  1IQK L;  1TOZ A;  2BQ6 A;  3KQC L;  3DEM A;  4Y71 B;  1HT8 A;  3LIW B;  1XKA L;  3SOB B;  1K37 A;  1YUF A;  2Y5F L;  2BZ6 L;  3LTG D;  4X8S L;  2MGP A;  3FCS B;  6COX A;  5JVY A;  1G1T A;  1HRE A;  1DX5 I;  1MOX C;  2WPJ E;  3QMO A;  1LQD A;  3Q7D A;  1XKB A;  2P3F L;  1P9J A;  3LTF B;  1PRH A;  1MQ6 L;  2OYU P;  2RNL A;  5JVZ A;  3ENS A;  3HS5 A;  4BDW A;  4OTY A;  4O1Z A;  4YZU B;  2FZZ L;  1XFE A;  3NJP C;  1G1S A;  1IQJ L;  2J94 B;  2BOK L;  4CUD A;  2VVV L;  3GCW E;  2AYL A;  1CQE A;  3ELA L;  5L2Z L;  1EQH A;  2Y81 B;  4BTI A;  1JL9 A;  1CVW L;  3KCG L;  1F0R B;  3N8Z A;  1G2L B;  2W3K B;  3N8Y A;  2EI6 B;  1EMO A;  2P93 L;  5L2Y L;  5KN5 C;  2UWP B;  2VVC K;  1G2M B;  2WPI E;  3NTG A;  3U7U G;  1QFK L;  3K9X A;  2OYE P;  1EMN A;  1FJS L;  4AQT A;  1PGE A;  2UWO B;  1DQB A;  2RHP A;  2Y80 B;  1IGX A;  1NFW B;  2P3F N;  2VWO L;  4MMZ B;  2WFX B;  4ZAE B;  2BQW A;  1OB1 C;  1NFU B;  2YGP A;  1HZ8 A;  1DIY A;  2Q1J B;  2EI8 B;  2BOX A;  4RS0 A;  1MQ5 L;  3HO5 A;  2UWL B;  2Y5G L;  1EZQ B;  2XBV L;  2P28 B;  4M10 A;  5F1A A;  2W2Q E;  3ZYI B;  4CUF A;  1IQH L;  2YGQ A;  3S6X A;  2BO2 A;  2VH0 B;  2W2O E;  1N1I A;  1YO8 A;  4ISH L;  4BDX A;  2I9A A;  5L30 L;  3OLU A;  1C5M F;  4RRY A;  1WHE A;  3CEN L;  1YUK B;  4NGA L;  4CSY A;  2PR3 B;  1K36 A;  1PTH A;  2WG3 C;  5IKR A;  1IQI L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...