1P9MB

Crystal structure of the hexameric human il-6/il-6 alpha receptor/gp130 complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
166
structure length
163
Chain Sequence
LTSSERIDKQIRYILDGISALRKETCNKCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hexameric Structure and Assembly of the Interleukin-6/IL-6 alpha-Receptor/gp130 Complex
pubmed doi rcsb
molecule keywords Interleukin-6 receptor beta chain
molecule tags Signaling protein/cytokine
source organism Homo sapiens
total genus 40
structure length 163
sequence length 166
ec nomenclature
pdb deposition date 2003-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1p9mB00
1ALUA 1KF9A 1HGUA 2INTA 4YPGC 2LAGA 1M4BA 2KZ1A 1Y6ML 5D28B 1M48A 2O27A 5FUCA 1HWGA 4NEMA 1EERA 3D48P 4O6KA 1YKBA 3EW3A 1B5LA 3UX9A 3UEZE 1ITLA 1BGCA 3SE3B 4GRWA 2HYMB 1N1FA 3G6DA 1CYLA 2ILKA 1Y6NL 2Q98A 3OQ3A 2LMSA 1GA3A 1P9MB 1EXZA 3N06A 3SE4B 5KNHI 4Z5RD 4NI7A 4I77Z 1RHGA 2CYKA 2L3OA 1PW6A 1HWHA 1SCFA 4YDYI 1LK3A 1ITMA 1PVHB 1RFBA 2Q7NB 1BBNA 3DGCL 5D70A 1PGRA 1BUYA 4NI9A 4FA8E 1CN4C 3DUHC 1CNT1 5D72A 1CSGA 2B8XA 1FYHA 2B8YA 5L6YC 1BGDA 1PY2A 3LB6B 1HUWA 1Y6KL 3BPNA 1ITFA 1JLIA 1HIKA 3L5XA 3PIVA 4CNIC 1IJZA 3NCBA 1LQSL 3S9DA 1NBPA 1GNCA 1EMRA 1I1RB 2O26A 3QT2C 2ERJD 1M49A 2IL6A 4RS1A 3L5WI 5FHXA 3D87A 1AXIA 3UF2A 3UF5A 3INKC 3EJJA 5D71A 1A7MA 2H24A 1VLKA 3QB7A 3MZGA 1LKIA 1ITIA 4NKQC 1BGEA 1M4AA 3G9VB 1RCBA 3HHRA 1BP3A 4ZF7A 4MHLA 2L3YA 4X51A 1Z92A 3PIWA 5E4EA 1M4RA 1HIJA 1A22A 2B5IA 3NPZA 4ZS7A 1HULA 1WU3I 1D9CA 1ILKA 1INRA 1ETEA 2E9WC 1V7NV 3DLQI 3QB1A 5C7XA 2GMFA 3NCCA 1AX8A 1F6FA 1FG9A 1Z7CA 1IARA 5LQBA 2B8UA 4YQXA 1BCNA 4O9HA 1AU1A 4NEJA 5D22A 1IL6A 1QVNA 4PS4A 3BESL 2B91A 1V7MV 3BPLA 3Q1SI 3QWRB 2D9QA 3NCEA 4WRLB 1IRLA 2B8ZA 3HMXB 1EVSA 1RW5A 1HZIA 1IK0A 3B5KA 1CD9A 1J7VL 1D9GA 3BPOA 3VA2A 3N0PA 4J4LC 3LB6A 3QAZA 1M47A 3WCYI 4DOHA 2B90A 4YUEC 1F45B 3D85C 1EKUA 1M4CA 3NCFA 2D48A
chains in the Genus database with same CATH superfamily
4YPGC 2LAGA 2KZ1A 5C44D 2R7ZD 4NEMA 3D48P 4O6KA 1ITLA 3SE3B 2Q98A 3OQ3A 5EQHA 1P9MB 3DI2A 4NI7A 2CYKA 2L3OA 4A3DD 3H0GD 4IKVA 4IKZA 1BBNA 2R92D 2XUTA 1PGRA 5D70A 5GXBA 3OG6A 5L6YC 1HUWA 1Y6KL 1HIKA 3PIVA 3NCBA 5FLMD 2IL6A 4IKXA 5D71A 4XNJA 3MZGA 1ITIA 5IP7D 4MHLA 2L3YA 3PIWA 1INRA 4OAAA 5C7XA 4D2BA 1AU1A 4A3ID 4A3MD 2B91A 1V7MV 2JA8D 3HMXB 4DKDA 1EVSA 4IU9A 3B5KA 3BPOA 4IKWA 3LB6A 3QAZA 4OH3A 3HOUD 4YUEC 3D85C 5C3ED 2D48A 1KF9A 2INTA 1PV7A 5EQGA 3H3VE 5FUCA 4NN7A 4BY7D 2Z3QA 3UEZE 1BGCA 2HYMB 4JA3A 1GA3A 4IKYA 3SE4B 5KNHI 4XNIA 4I77Z 4IU8A 1ITMA 1PVHB 1RFBA 1WCMD 3WDOA 1BUYA 4FA8E 1CN4C 2C35A 1CNT1 3DI3A 1CSGA 1Y1WD 5C4XD 3LB6B 3BPNA 1ITFA 5D59A 4CNIC 1IJZA 4U4TA 1I1RB 3QT2C 4RS1A 3UF2A 1AXIA 2H24A 2B63D 4A3LD 1M4AA 4YBQA 3HHRA 1BP3A 4ZF7A 2CFPA 4X51A 1Z92A 4Q65A 3NPZA 4ZS7A 1Y1VD 1ETEA 1V7NV 3I4MD 5C65A 4BXXD 1AX8A 2VUMD 1IARA 2B8UA 4YQXA 4O9HA 5D22A 4A3JD 3O7PA 3Q1SI 3QWRB 3NCEA 4A3FD 2B8ZA 3HOYD 4QIQA 3HOVD 3HOXD 1CD9A 3N0PA 3OG4A 1M47A 1PV6A 5IYDD 4LRLA 1M4CA 2OQPA 1ALUA 2PSMA 1HGUA 1Y6ML 4NN6A 1M48A 5IP9D 1EERA 1YKBA 1B5LA 3UX9A 3G6DA 4TPJA 1Y6NL 2LMSA 4U4VA 2R93D 1EXZA 4A3CD 4APSA 1RHGA 4U4WA 4ZWCA 1HWHA 3AYHA 1SCFA 2Q7NB 4TPHA 3HOWD 4BBRD 3DUHC 1PW4A 4BBSD 2B8XA 4JREA 1FYHA 2B8YA 1BGDA 1PY2A 4D2CA 3HOZD 3L5XA 1NBPA 2ERJD 3L5WI 3D87A 3UF5A 3INKC 1A7MA 3QB7A 2O6IA 4NKQC 3G9VB 3TGXB 4A3GD 4DKFA 5E4EA 1M4RA 2B5IA 1HULA 1D9CA 1ILKA 4A3KD 4W6VA 3NCCA 2Q14A 1F6FA 5A2NA 5A2OA 1Z7CA 4TPGA 1QVNA 4YB9D 3BESL 4BY1D 2JA5D 2JA6D 2D9QA 4A3BD 1IRLA 1IK0A 4DKCA 4A3ED 1D9GA 3VA2A 4DOHA 4LDSA 3DGCL 4J4LC 4UVMA 1EKUA 3NCFA 1M4BA 5D28B 2O27A 4A93D 1HWGA 3EW3A 3I4ND 4GRWA 1N1FA 1CYLA 2ILKA 4GC0A 3N06A 4Z5RD 4GBYA 1PW6A 4EXPA 4YDYI 1LK3A 5EQIA 3HHCA 3PO3D 4NI9A 3O7QA 4GS7A 5D72A 4PYPA 2Z3RA 4GBZA 1JLIA 4ZYRA 1LQSL 3FKID 3S9DA 2CFQA 1GNCA 1EMRA 2O26A 4ZW9A 1M49A 5FHXA 5IYCD 3EJJA 2Y5YA 4LEPA 1VLKA 4JR9A 1LKIA 1BGEA 4J05A 1RCBA 4ZWBA 3PO2D 1HIJA 1A22A 5TS9A 1WU3I 2E9WC 3DLQI 4DKEA 4D2DA 2GMFA 1FG9A 5LQBA 1BCNA 2V8NA 4NN5A 4NEJA 1IL6A 4PS4A 3BPLA 5IYBD 4WRLB 2JA7D 1Y14A 3IRHA 1RW5A 1HZIA 5D58A 1J7VL 5D6KA 3WCYI 4EXNA 2B90A 2XQBA 1F45B 3QB1A
chains in the Genus database with same CATH topology
2OQPA 1ALUA 2PSMA 1KF9A 1HGUA 2INTA 4YPGC 2LAGA 1M4BA 2KZ1A 1Y6ML 4NN6A 5D28B 1M48A 5C44D 2O27A 5FUCA 3H3VE 1HWGA 4A93D 2R7ZD 4NEMA 5IP9D 1EERA 3D48P 4NN7A 4O6KA 1YKBA 2Z3QA 4BY7D 3EW3A 1B5LA 3UX9A 3UEZE 3I4ND 1ITLA 1BGCA 3SE3B 4GRWA 2HYMB 1N1FA 3G6DA 1CYLA 2ILKA 1Y6NL 2Q98A 3OQ3A 2LMSA 1GA3A 2R93D 1P9MB 1EXZA 3N06A 3SE4B 5KNHI 4A3CD 3DI2A 4Z5RD 4NI7A 4I77Z 1RHGA 2CYKA 2L3OA 4A3DD 1PW6A 3HOYD 3H0GD 1HWHA 3AYHA 1SCFA 4EXPA 4YDYI 1LK3A 1ITMA 1PVHB 1RFBA 1WCMD 2Q7NB 1BBNA 3DGCL 2R92D 5D70A 1PGRA 3HHCA 3PO3D 3HOWD 1BUYA 4NI9A 4FA8E 1CN4C 4BBRD 2C35A 1CNT1 3DI3A 3DUHC 1CSGA 2B8XA 4GS7A 1FYHA 2B8YA 5D72A 1Y1WD 5C4XD 3OG6A 5L6YC 1BGDA 1PY2A 3LB6B 1HUWA 1Y6KL 3BPNA 2Z3RA 1ITFA 3HOZD 1JLIA 1HIKA 3L5XA 3PIVA 4CNIC 1IJZA 3NCBA 1LQSL 3FKID 3S9DA 1NBPA 5FLMD 1GNCA 1EMRA 1I1RB 2O26A 3QT2C 2ERJD 1M49A 2IL6A 4RS1A 3L5WI 5FHXA 3D87A 1AXIA 3UF2A 5IYCD 3UF5A 3INKC 3EJJA 5D71A 1A7MA 2H24A 1VLKA 3QB7A 3MZGA 2B63D 1LKIA 2O6IA 4NKQC 2JA7D 1ITIA 1BGEA 4A3LD 1M4AA 3G9VB 5IP7D 3TGXB 1RCBA 4A3GD 3HHRA 1BP3A 4ZF7A 4MHLA 2L3YA 4X51A 4DKFA 1Z92A 3PIWA 5E4EA 3PO2D 1M4RA 1HIJA 1A22A 2B5IA 5TS9A 3NPZA 4ZS7A 1HULA 1WU3I 1D9CA 3HOUD 1ILKA 1Y1VD 1INRA 1ETEA 2E9WC 1V7NV 4A3KD 3DLQI 3QB1A 4DKEA 3I4MD 5C7XA 4BXXD 2GMFA 3NCCA 2Q14A 1AX8A 1F6FA 1FG9A 1Z7CA 2VUMD 1IARA 5LQBA 2B8UA 4YQXA 1BCNA 4O9HA 4NN5A 1AU1A 4NEJA 5D22A 4A3ID 1IL6A 1QVNA 4PS4A 4A3JD 3BESL 2B91A 4A3MD 1V7MV 3BPLA 3Q1SI 4BY1D 2JA8D 5IYBD 2JA5D 3QWRB 2D9QA 3NCEA 2JA6D 4A3BD 4A3FD 4WRLB 1IRLA 2B8ZA 5C3ED 1Y14A 3HMXB 1EVSA 3IRHA 4DKDA 1RW5A 1HZIA 3HOVD 1IK0A 3B5KA 1CD9A 1J7VL 4DKCA 1D9GA 3BPOA 3VA2A 3N0PA 4J4LC 3HOXD 3LB6A 4A3ED 3OG4A 3QAZA 1M47A 3WCYI 4EXNA 4DOHA 4BBSD 5IYDD 4LRLA 2B90A 2XQBA 4YUEC 1F45B 3D85C 1EKUA 1M4CA 3NCFA 2D48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ALU A;  1KF9 A;  1HGU A;  2INT A;  4YPG C;  2LAG A;  1M4B A;  2KZ1 A;  1Y6M L;  5D28 B;  1M48 A;  2O27 A;  5FUC A;  1HWG A;  4NEM A;  1EER A;  3D48 P;  4O6K A;  1YKB A;  3EW3 A;  1B5L A;  3UX9 A;  3UEZ E;  1ITL A;  1BGC A;  3SE3 B;  4GRW A;  2HYM B;  1N1F A;  3G6D A;  1CYL A;  2ILK A;  1Y6N L;  2Q98 A;  3OQ3 A;  2LMS A;  1GA3 A;  1P9M B;  1EXZ A;  3N06 A;  3SE4 B;  5KNH I;  4Z5R D;  4NI7 A;  4I77 Z;  1RHG A;  2CYK A;  2L3O A;  1PW6 A;  1HWH A;  1SCF A;  4YDY I;  1LK3 A;  1ITM A;  1PVH B;  1RFB A;  2Q7N B;  1BBN A;  3DGC L;  5D70 A;  1PGR A;  1BUY A;  4NI9 A;  4FA8 E;  1CN4 C;  3DUH C;  1CNT 1;  5D72 A;  1CSG A;  2B8X A;  1FYH A;  2B8Y A;  5L6Y C;  1BGD A;  1PY2 A;  3LB6 B;  1HUW A;  1Y6K L;  3BPN A;  1ITF A;  1JLI A;  1HIK A;  3L5X A;  3PIV A;  4CNI C;  1IJZ A;  3NCB A;  1LQS L;  3S9D A;  1NBP A;  1GNC A;  1EMR A;  1I1R B;  2O26 A;  3QT2 C;  2ERJ D;  1M49 A;  2IL6 A;  4RS1 A;  3L5W I;  5FHX A;  3D87 A;  1AXI A;  3UF2 A;  3UF5 A;  3INK C;  3EJJ A;  5D71 A;  1A7M A;  2H24 A;  1VLK A;  3QB7 A;  3MZG A;  1LKI A;  1ITI A;  4NKQ C;  1BGE A;  1M4A A;  3G9V B;  1RCB A;  3HHR A;  1BP3 A;  4ZF7 A;  4MHL A;  2L3Y A;  4X51 A;  1Z92 A;  3PIW A;  5E4E A;  1M4R A;  1HIJ A;  1A22 A;  2B5I A;  3NPZ A;  4ZS7 A;  1HUL A;  1WU3 I;  1D9C A;  1ILK A;  1INR A;  1ETE A;  2E9W C;  1V7N V;  3DLQ I;  3QB1 A;  5C7X A;  2GMF A;  3NCC A;  1AX8 A;  1F6F A;  1FG9 A;  1Z7C A;  1IAR A;  5LQB A;  2B8U A;  4YQX A;  1BCN A;  4O9H A;  1AU1 A;  4NEJ A;  5D22 A;  1IL6 A;  1QVN A;  4PS4 A;  3BES L;  2B91 A;  1V7M V;  3BPL A;  3Q1S I;  3QWR B;  2D9Q A;  3NCE A;  4WRL B;  1IRL A;  2B8Z A;  3HMX B;  1EVS A;  1RW5 A;  1HZI A;  1IK0 A;  3B5K A;  1CD9 A;  1J7V L;  1D9G A;  3BPO A;  3VA2 A;  3N0P A;  4J4L C;  3LB6 A;  3QAZ A;  1M47 A;  3WCY I;  4DOH A;  2B90 A;  4YUE C;  1F45 B;  3D85 C;  1EKU A;  1M4C A;  3NCF A;  2D48 A; 
#chains in the Genus database with same CATH topology
 4YPG C;  2LAG A;  2KZ1 A;  5C44 D;  2R7Z D;  4NEM A;  3D48 P;  4O6K A;  1ITL A;  3SE3 B;  2Q98 A;  3OQ3 A;  5EQH A;  1P9M B;  3DI2 A;  4NI7 A;  2CYK A;  2L3O A;  4A3D D;  3H0G D;  4IKV A;  4IKZ A;  1BBN A;  2R92 D;  2XUT A;  1PGR A;  5D70 A;  5GXB A;  3OG6 A;  5L6Y C;  1HUW A;  1Y6K L;  1HIK A;  3PIV A;  3NCB A;  5FLM D;  2IL6 A;  4IKX A;  5D71 A;  4XNJ A;  3MZG A;  1ITI A;  5IP7 D;  4MHL A;  2L3Y A;  3PIW A;  1INR A;  4OAA A;  5C7X A;  4D2B A;  1AU1 A;  4A3I D;  4A3M D;  2B91 A;  1V7M V;  2JA8 D;  3HMX B;  4DKD A;  1EVS A;  4IU9 A;  3B5K A;  3BPO A;  4IKW A;  3LB6 A;  3QAZ A;  4OH3 A;  3HOU D;  4YUE C;  3D85 C;  5C3E D;  2D48 A;  1KF9 A;  2INT A;  1PV7 A;  5EQG A;  3H3V E;  5FUC A;  4NN7 A;  4BY7 D;  2Z3Q A;  3UEZ E;  1BGC A;  2HYM B;  4JA3 A;  1GA3 A;  4IKY A;  3SE4 B;  5KNH I;  4XNI A;  4I77 Z;  4IU8 A;  1ITM A;  1PVH B;  1RFB A;  1WCM D;  3WDO A;  1BUY A;  4FA8 E;  1CN4 C;  2C35 A;  1CNT 1;  3DI3 A;  1CSG A;  1Y1W D;  5C4X D;  3LB6 B;  3BPN A;  1ITF A;  5D59 A;  4CNI C;  1IJZ A;  4U4T A;  1I1R B;  3QT2 C;  4RS1 A;  3UF2 A;  1AXI A;  2H24 A;  2B63 D;  4A3L D;  1M4A A;  4YBQ A;  3HHR A;  1BP3 A;  4ZF7 A;  2CFP A;  4X51 A;  1Z92 A;  4Q65 A;  3NPZ A;  4ZS7 A;  1Y1V D;  1ETE A;  1V7N V;  3I4M D;  5C65 A;  4BXX D;  1AX8 A;  2VUM D;  1IAR A;  2B8U A;  4YQX A;  4O9H A;  5D22 A;  4A3J D;  3O7P A;  3Q1S I;  3QWR B;  3NCE A;  4A3F D;  2B8Z A;  3HOY D;  4QIQ A;  3HOV D;  3HOX D;  1CD9 A;  3N0P A;  3OG4 A;  1M47 A;  1PV6 A;  5IYD D;  4LRL A;  1M4C A;  2OQP A;  1ALU A;  2PSM A;  1HGU A;  1Y6M L;  4NN6 A;  1M48 A;  5IP9 D;  1EER A;  1YKB A;  1B5L A;  3UX9 A;  3G6D A;  4TPJ A;  1Y6N L;  2LMS A;  4U4V A;  2R93 D;  1EXZ A;  4A3C D;  4APS A;  1RHG A;  4U4W A;  4ZWC A;  1HWH A;  3AYH A;  1SCF A;  2Q7N B;  4TPH A;  3HOW D;  4BBR D;  3DUH C;  1PW4 A;  4BBS D;  2B8X A;  4JRE A;  1FYH A;  2B8Y A;  1BGD A;  1PY2 A;  4D2C A;  3HOZ D;  3L5X A;  1NBP A;  2ERJ D;  3L5W I;  3D87 A;  3UF5 A;  3INK C;  1A7M A;  3QB7 A;  2O6I A;  4NKQ C;  3G9V B;  3TGX B;  4A3G D;  4DKF A;  5E4E A;  1M4R A;  2B5I A;  1HUL A;  1D9C A;  1ILK A;  4A3K D;  4W6V A;  3NCC A;  2Q14 A;  1F6F A;  5A2N A;  5A2O A;  1Z7C A;  4TPG A;  1QVN A;  4YB9 D;  3BES L;  4BY1 D;  2JA5 D;  2JA6 D;  2D9Q A;  4A3B D;  1IRL A;  1IK0 A;  4DKC A;  4A3E D;  1D9G A;  3VA2 A;  4DOH A;  4LDS A;  3DGC L;  4J4L C;  4UVM A;  1EKU A;  3NCF A;  1M4B A;  5D28 B;  2O27 A;  4A93 D;  1HWG A;  3EW3 A;  3I4N D;  4GRW A;  1N1F A;  1CYL A;  2ILK A;  4GC0 A;  3N06 A;  4Z5R D;  4GBY A;  1PW6 A;  4EXP A;  4YDY I;  1LK3 A;  5EQI A;  3HHC A;  3PO3 D;  4NI9 A;  3O7Q A;  4GS7 A;  5D72 A;  4PYP A;  2Z3R A;  4GBZ A;  1JLI A;  4ZYR A;  1LQS L;  3FKI D;  3S9D A;  2CFQ A;  1GNC A;  1EMR A;  2O26 A;  4ZW9 A;  1M49 A;  5FHX A;  5IYC D;  3EJJ A;  2Y5Y A;  4LEP A;  1VLK A;  4JR9 A;  1LKI A;  1BGE A;  4J05 A;  1RCB A;  4ZWB A;  3PO2 D;  1HIJ A;  1A22 A;  5TS9 A;  1WU3 I;  2E9W C;  3DLQ I;  4DKE A;  4D2D A;  2GMF A;  1FG9 A;  5LQB A;  1BCN A;  2V8N A;  4NN5 A;  4NEJ A;  1IL6 A;  4PS4 A;  3BPL A;  5IYB D;  4WRL B;  2JA7 D;  1Y14 A;  3IRH A;  1RW5 A;  1HZI A;  5D58 A;  1J7V L;  5D6K A;  3WCY I;  4EXN A;  2B90 A;  2XQB A;  1F45 B;  3QB1 A; 
#chains in the Genus database with same CATH homology
 2OQP A;  1ALU A;  2PSM A;  1KF9 A;  1HGU A;  2INT A;  4YPG C;  2LAG A;  1M4B A;  2KZ1 A;  1Y6M L;  4NN6 A;  5D28 B;  1M48 A;  5C44 D;  2O27 A;  5FUC A;  3H3V E;  1HWG A;  4A93 D;  2R7Z D;  4NEM A;  5IP9 D;  1EER A;  3D48 P;  4NN7 A;  4O6K A;  1YKB A;  2Z3Q A;  4BY7 D;  3EW3 A;  1B5L A;  3UX9 A;  3UEZ E;  3I4N D;  1ITL A;  1BGC A;  3SE3 B;  4GRW A;  2HYM B;  1N1F A;  3G6D A;  1CYL A;  2ILK A;  1Y6N L;  2Q98 A;  3OQ3 A;  2LMS A;  1GA3 A;  2R93 D;  1P9M B;  1EXZ A;  3N06 A;  3SE4 B;  5KNH I;  4A3C D;  3DI2 A;  4Z5R D;  4NI7 A;  4I77 Z;  1RHG A;  2CYK A;  2L3O A;  4A3D D;  1PW6 A;  3HOY D;  3H0G D;  1HWH A;  3AYH A;  1SCF A;  4EXP A;  4YDY I;  1LK3 A;  1ITM A;  1PVH B;  1RFB A;  1WCM D;  2Q7N B;  1BBN A;  3DGC L;  2R92 D;  5D70 A;  1PGR A;  3HHC A;  3PO3 D;  3HOW D;  1BUY A;  4NI9 A;  4FA8 E;  1CN4 C;  4BBR D;  2C35 A;  1CNT 1;  3DI3 A;  3DUH C;  1CSG A;  2B8X A;  4GS7 A;  1FYH A;  2B8Y A;  5D72 A;  1Y1W D;  5C4X D;  3OG6 A;  5L6Y C;  1BGD A;  1PY2 A;  3LB6 B;  1HUW A;  1Y6K L;  3BPN A;  2Z3R A;  1ITF A;  3HOZ D;  1JLI A;  1HIK A;  3L5X A;  3PIV A;  4CNI C;  1IJZ A;  3NCB A;  1LQS L;  3FKI D;  3S9D A;  1NBP A;  5FLM D;  1GNC A;  1EMR A;  1I1R B;  2O26 A;  3QT2 C;  2ERJ D;  1M49 A;  2IL6 A;  4RS1 A;  3L5W I;  5FHX A;  3D87 A;  1AXI A;  3UF2 A;  5IYC D;  3UF5 A;  3INK C;  3EJJ A;  5D71 A;  1A7M A;  2H24 A;  1VLK A;  3QB7 A;  3MZG A;  2B63 D;  1LKI A;  2O6I A;  4NKQ C;  2JA7 D;  1ITI A;  1BGE A;  4A3L D;  1M4A A;  3G9V B;  5IP7 D;  3TGX B;  1RCB A;  4A3G D;  3HHR A;  1BP3 A;  4ZF7 A;  4MHL A;  2L3Y A;  4X51 A;  4DKF A;  1Z92 A;  3PIW A;  5E4E A;  3PO2 D;  1M4R A;  1HIJ A;  1A22 A;  2B5I A;  5TS9 A;  3NPZ A;  4ZS7 A;  1HUL A;  1WU3 I;  1D9C A;  3HOU D;  1ILK A;  1Y1V D;  1INR A;  1ETE A;  2E9W C;  1V7N V;  4A3K D;  3DLQ I;  3QB1 A;  4DKE A;  3I4M D;  5C7X A;  4BXX D;  2GMF A;  3NCC A;  2Q14 A;  1AX8 A;  1F6F A;  1FG9 A;  1Z7C A;  2VUM D;  1IAR A;  5LQB A;  2B8U A;  4YQX A;  1BCN A;  4O9H A;  4NN5 A;  1AU1 A;  4NEJ A;  5D22 A;  4A3I D;  1IL6 A;  1QVN A;  4PS4 A;  4A3J D;  3BES L;  2B91 A;  4A3M D;  1V7M V;  3BPL A;  3Q1S I;  4BY1 D;  2JA8 D;  5IYB D;  2JA5 D;  3QWR B;  2D9Q A;  3NCE A;  2JA6 D;  4A3B D;  4A3F D;  4WRL B;  1IRL A;  2B8Z A;  5C3E D;  1Y14 A;  3HMX B;  1EVS A;  3IRH A;  4DKD A;  1RW5 A;  1HZI A;  3HOV D;  1IK0 A;  3B5K A;  1CD9 A;  1J7V L;  4DKC A;  1D9G A;  3BPO A;  3VA2 A;  3N0P A;  4J4L C;  3HOX D;  3LB6 A;  4A3E D;  3OG4 A;  3QAZ A;  1M47 A;  3WCY I;  4EXN A;  4DOH A;  4BBS D;  5IYD D;  4LRL A;  2B90 A;  2XQB A;  4YUE C;  1F45 B;  3D85 C;  1EKU A;  1M4C A;  3NCF A;  2D48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...