1P9OA

Crystal structure of phosphopantothenoylcysteine synthetase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
290
structure length
269
Chain Sequence
RWAEVMARFAARLGAQGRRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFPPQTWLSALRPSGPLSGLLSLEAEENALPGFAEALRSYQEAAAAGTFLVVEFTTLADYLHLLQAAAQALNPLGPSAMFYLAAAVSDFYVPPLQITMKMVPKLLSPLVKDWAPKAFIISFKLETDPAIVINRARKALEIYQHQVVVANIFVLIVTKDSETKLLLSEEEIEKGVEIEEKIVDNLQSRHTAFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantothenoylcysteine synthetase
publication title Structure of human phosphopantothenoylcysteine synthetase at 2.3 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 84
structure length 269
sequence length 290
chains with identical sequence B
ec nomenclature ec 6.3.2.5: Phosphopantothenate--cysteine ligase (CTP).
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04127 DFP DNA / pantothenate metabolism flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CoaB-like 1p9oA00
1U7WA 5INTA 4QJIA 1U7UA 1P9OA 1U80A 2GK4A 1U7ZA
chains in the Genus database with same CATH superfamily
1UEJA 3DG9A 3LT5A 3G2IA 3GW8A 1UJ6A 5KKAA 3TOXA 2D0PB 2VBIA 3KR9A 5G53C 3TLZA 2IS2A 2X5JO 2F62A 4X3OA 4F2GA 1T36B 5KAMA 3D43A 4EJ2A 3FGNA 2VOEA 3ASZA 3EF1A 3ZLTA 4CLXA 3UK7A 3FWPA 4OQDA 4AUMA 1NUTA 5JY6A 1SOUA 3O8OA 4LXIA 4M1SA 5L4NA 5AW9A 3DTVD 2EERA 2BFOA 1Y6GA 3LQKA 4RHTA 5BN3B 1RZRD 2LTAA 1KMNA 1G38A 3T7CA 3SN6A 4Z9AA 5T3YA 5DBHX 4DCNA 3L18A 1PGQA 4CEIA 3NX4A 2Q7DA 1T26A 3UMRA 3ITNA 2AFHB 5D5QA 1JEJA 3C1AA 4I0WB 4I4TB 2PR7A 2QBYB 3OQHA 1KE1A 3RVKA 3OECA 3LBIA 3AR9A 3RSCA 2MYNA 1HQCA 1QFZA 3O3NB 3JAWB 4TLAA 5L3SA 5HVNA 1EZZA 3KB2A 5KWSA 3OIDA 5C31A 4XJVA 4QPZA 4N5LA 4XD7A 4C6TA 4CDRA 2V7QD 2FSIA 2OFWA 4M8KA 1KI3A 5LQMA 1NBWB 1XRPA 1PWHA 4TTQA 1GAWA 1TYCA 3DPIA 4WESB 3DVSX 2CSUA 1ICIA 2ID7A 3DFUA 2ODNA 3CTMA 4QDKA 5AHOA 2R6DA 2O3QA 2OECA 2XGGA 4KGXA 4BDSA 2G1JA 2BTQB 4IWYA 1Q7CA 1ZRHA 3EA5A 4G5RA 3PUHA 4IIHA 4X00A 3NTUA 1U11A 1LEHA 1N2EA 3ONDA 1DCFA 4ZVPA 3VR1A 3ZWNA 5MGNA 5LD2C 5EWJB 4XA8A 1QPBA 1QTIA 1EUYA 3U1VA 2ZSBA 2OSBA 1EFTA 1N77A 4XTCS 1H3EA 3MILA 3E9QA 3OZWA 4M76B 4MAAA 4QGHA 4M21A 3TUIC 3UMCA 3CW2A 1RWXA 3JYNA 3HB4X 4RK5A 4MV3A 3BBLA 1ONBA 2IQIA 2YXEA 2DT5A 3C15C 1FDIA 1GQYA 5F21A 2I4OA 2X2OA 4JL8A 5JHGB 1IH8A 5IANA 1J06A 1QVZA 3ZDFA 1G7TA 2ACKA 4I6EA 3SXUB 3DO5A 3DNPA 5JUWA 3MBIA 4ZT5A 1T2DA 2LV8A 2YQ5A 1Q0HA 4KHZA 2ORYA 3NHPA 721PA 3AY0A 2WNHA 4G26A 3UAZA 4FFPA 4K9QA 3B3AA 1X7WA 1J0BA 1MP0A 1D7OA 3Q6MA 5G4LA 2O8FB 1NQ5A 4PLCA 3SHWA 4UQOA 3QY0A 4U39A 1KI6B 5K2MA 3OP4A 4PZAA 3BWCA 2EJBA 3EASA 3WL6A 3EMDA 4QZVA 3H9EO 1Z5WA 2QE7A 3FYUB 4LVNA 4E1VA 4NS1A 1TL7C 2X0RA 4DBLC 5J4HA 3SJBA 2C5GA 1NNSA 2H17A 4Q16A 1J97A 4LJAA 1QMGA 2EZ9A 1T29A 2E21A 1BN6A 1NUSA 2P7IA 3DZBA 4JLOA 1IZYA 5AT1A 2AF3C 3ZD9A 5KTPA 2C2OA 3NDBB 1X9HA 1B8OA 5AH0A 1NVGA 5F3DA 5G0UA 3W6OA 2QJOA 5AW0A 2WICA 1OBCA 4AY5A 2C29D 4IH1A 5I4CA 3QOFA 4LHYA 2HIMA 1KU0A 4W5OA 2OHXA 3VDMA 4P6VF 5IM4A 4ZCIA 3I45A 4YIKA 2K2QB 4G5OA 2ZM6B 3GLUA 3L0SA 3OLQA 3L1HA 5CBKA 4RA9A 4JYBA 1W85B 2F17A 4DM7A 4TYWA 4Y2PA 2OGSA 5KSPA 3L41A 2JLCA 5DTIA 3VAZA 1VLJA 1JTEA 3W1EA 4N8DA 2EAUA 3FDZB 3GFOA 2WYIA 5HBGA 5EQFA 3GEMA 1SHJA 1QLJA 3U2QA 3ZGVA 5ENZA 1K06A 1VXOA 1NV8A 1JJBA 1X86B 3I28A 1YOBA 4C0LA 3K6RA 4UDOA 1Z7WA 3HPRA 4C4RA 4BGUA 4UZEA 2F3SA 2FPIB 4Q3DA 1V41E 5CM9C 3GZ4A 3ZDZB 5K6AA 4MVJG 4ECAA 1IL0A 1LBSA 1S1CA 1R16A 5C1OA 2O2HA 4YQFA 4GI1A 1SHZA 3H19A 4I1SA 5SYMA 4Q47A 1AQIA 1D1QA 1KZ7B 3VTAA 2PUDA 1C5KA 1Z5OA 4X8MA 2N46A 1PFKA 4JNCA 3SKYA 5JCOA 1XN1A 3BYZA 1WXFA 3C6QA 1WU7A 3N05A 4ZAYA 1LGYA 3IQHX 4FX2A 3K9FC 1T2AA 5CBPB 1NJ1A 2CVPA 1R5JA 4YQZA 4WXEA 1Z7GA 1P9OA 1TVKB 1DG3A 4XPIA 3PPWA 4O4JB 5J47A 1OHHA 3BQMB 2ZK7A 1E4YA 3OT1B 1WZUA 1Y5LA 3EA4A 3SZMA 4PAMA 1Y9JA 4JL6A 1ZKDA 4ZMBA 1I6LA 2DUNA 2GT1A 3AF0A 2HJWA 5TGDA 5KVSA 2IP4A 2DHQA 3OETA 4WEOA 3WHLA 5HRAA 1AD2A 3FHOA 3R1IA 1H5UA 4NEGA 5ES3A 3V55A 3ZC3A 3KUXA 4AFNA 4RA6A 2UYCA 4N40A 4EZEA 2GBFA 3LMKA 3BM5A 3ZLJA 2BEVB 1Z6ZA 3DLIA 1EX9A 1KZYC 3E2MA 3IYLW 2OCKA 2ET6A 2HMVA 4Q3LA 4BZPA 1X94A 1URPA 4QDJA 3VR3A 1SCUA 3E5NA 2IGBA 1C7QA 1V1MB 1TM3E 4PAQA 3AY6A 2OCGA 3EPPA 4NATA 1TCBA 5F76A 3A1WA 1RVV1 3V6LA 2J0SA 1US8A 2I71A 1DRJA 2P9FA 4MW1A 3W1VA 3FI0A 1YFJA 1LJ8A 3G68A 5ADUS 3LQ4A 4J0DA 1JXMA 2RHCA 1T9CA 4FONA 5JRJA 3J7TA 4KQWA 1O6ZA 4LOKA 3EEOA 4ZPXA 2WINI 1D9XA 1R0YA 3FYUA 1DC3A 4I66A 1CEYA 4GM1A 4S1OA 1YK0A 3SJUA 4C0XA 1PDVA 3PPIA 1L4EA 3EXFB 2RHLA 1LQ2A 2Q3JA 3C6XA 5E9WA 1NC3A 1VKRA 2Q3DA 3ET4A 3AESA 4KN9S 3UYKA 1J42A 2H4XA 5D01A 1R9MA 3VDQA 3W5UA 5JNRA 1D0VA 1QYWA 3SYRA 5D86A 2HY7A 1L8XA 3QW2A 4XYBA 4J7CA 5KVVA 1GU0A 5AOVA 3WIBA 3NNSA 2O59A 2QE7D 3E61A 1ODFA 3KQYA 1GSOA 1UJCA 3L5OA 5BUSA 4Q00A 1A9OA 1AKMA 3WLKX 4DB4A 4R31A 1T91A 1MJFA 3SEZA 1F2UA 1X7XA 5B6IA 4NCBA 2ZCUA 4MJ7A 3EIXA 4TX1A 2M32A 2YV4A 3MG9A 2QPAA 3I8SA 4YO7A 5E3JA 1PJRA 2QGZA 3EVFA 3VV2A 1J09A 3MJRA 3AZPA 4XFJA 3S2YA 1FMFA 1DBQA 1CUCA 1KU6A 1XCPA 4H7PA 4RNCA 4XCVA 4JJIA 5HRUA 3FOFC 2I8LA 5HILA 3PHJA 3JYPA 3FF4A 4YMIA 1FFYA 1CQJA 4GVLA 3NBUA 4HAYA 5JTUA 4DV4B 1OGIA 3AERA 3WL4A 2V7EA 3TQIA 1J4AA 2J09A 4MRRA 1XL1A 1X1EA 4FEGA 4ZDIA 1BO6A 2ZR8A 8ADHA 4BJ1A 1R18A 2TMGA 1Z26A 1MRNA 3QYPA 4AN4A 2VHWA 3WYEA 3KSZO 3KJFA 1GN9A 3NYRA 5GOZA 1O0BA 4UBJA 2D1YA 4MAMA 2Z2XA 1KGSA 1YIDA 2E49A 2YW9A 3G1UA 2W2OA 4Z9FA 3TEFA 2C0QA 3P20A 4ZP1A 3JSXA 3KJGA 3SEAA 1JFTA 4MI1A 3BMXA 4RD1A 3AB3A 3SBOA 1Y9EA 4FXOA 5ESXA 1DQZA 4EI8A 4TSKA 3A9CA 3MBOA 1PFVA 4J76A 4RD4A 3R7WB 2FPWA 1G8GA 5A1JA 3HUDA 4AMUA 3I32A 4HFJA 4TL7A 2O7SA 3RUIA 4B40A 2RGXA 5T6MA 4R1PA 2PYIA 4FOLA 1CLEA 4HRAA 3NT5A 5ICCA 2O5EA 1S8FA 3G8BA 1BJTA 2HTEA 2IYPA 4GLJA 2AJDA 5E6RB 4J4BA 1QQ7A 3TQFA 1S5PA 4TM7A 1HT1E 1RTKA 4I4IA 1PNVA 2IYFA 1FS6A 1NQXA 1T3GA 2H7VA 4RH3A 1DS6A 2BFBA 1KBQA 1UBRS 1WDWB 4OLBA 2W22A 2HXYA 1JQAA 2PSJA 5FORA 4EUHA 1EGMB 1OHHD 4WHMA 3HCAA 1HYQA 4KPGA 4PRLA 2Z58A 2BFCA 4AXXA 2J31A 1KY2A 2BSQA 5B6PA 1F4PA 4NYMQ 3P0IA 4RKWA 3GMTA 1EG2A 3ACBA 1XHFA 4E51A 2OEPA 2IHKA 4Z54A 4NS4A 1APBA 2WZDA 3OJOA 3P19A 3IQGX 4URWR 3UJ6A 1V7ZA 4DM3A 4AAYA 4EVRA 5J4VA 3T7EA 1C1XB 5BWBA 3MCWA 1LI5A 2Z5FA 4OB8A 1WHTB 2QUJA 2XAUA 4B8WA 4NYIQ 1U1DA 5TF0A 1ZUNA 3E9RA 5JWRA 2FEOA 1X1CA 2DBZA 1O8BA 3OEED 4KQ9A 2ZJYA 5EAIA 3TKYA 1ESMA 4DLKA 3AHGA 4RTOA 1XU9A 4G5SA 2QLFA 2WTXA 5JMTA 4GRIA 2FZKA 4MKIA 4FYPA 3VR3D 1NT4A 2IXGA 4BLRA 1XXLA 1MBZA 4L51A 3PRJA 2J3JA 4BFTA 2VYNA 1E9CA 4YA6A 1S2NA 2QI9C 4KOEC 4H3HB 5I7VA 3PNPA 2ZB3A 3NAZA 1J2TA 1YUBA 3OZCA 2QX8A 3COJA 4JYAB 3JQCA 1AHHA 3WRWA 5KTNA 1FYVA 3NV9A 1KVTA 3IP3A 3D6UA 2WJYA 1M1YE 4CF3A 1Y8CA 2O2DA 4U5QA 2ZUTA 1HQKA 2RAUA 4LJKA 1QWSA 1ND6A 3PKJA 1UBOS 2DPHA 1DKLA 1ENOA 2A5YB 2QENA 3A9UA 1QG0A 3L4EA 2CNKA 4KIFA 2ZIWB 4MMYB 2WIKA 1PJ2A 2N75A 4PFKA 4Q9IA 1HT2E 3BTVA 1YB4A 1NBIA 1SD2A 3M4NA 4KRGA 3UWDA 5I3CA 5IFKA 1FYDA 1W94A 1OGJA 2IZ0A 4MLPA 4DLXA 3IS3A 3GGJA 1U5CA 2FSGA 3IEKA 4PZLA 2QRVA 3E2PA 5FPPA 2NW6A 1GGVA 1PR4A 1Z28A 4S0ZA 3OCZA 1ZA1A 3CVOA 2CD9A 2KX7A 2VZ8A 1ZNZA 1IAVA 4YDSA 3VU0A 5JAOA 3CCBA 2IZ6A 2PT6A 3FUWA 3TSCA 1AMOA 3JVIA 4LYEA 2RBKA 4RAQA 3IE0A 2H18A 2BBOA 1DQSA 2QMZA 1P1KA 3X1DA 2H1SA 3KEFA 3P94A 5CYOA 2W2KA 1JMYA 5HCIA 2YS7A 3HG7A 4FT4A 3WJ1A 4YV0A 1U31A 5FUYA 2FN7A 1ZVQA 2OXTA 1EFDN 2OR3A 1ESEA 3EZFA 5HG0A 1E0AA 5KJ6A 3V2HA 4WCFC 2EF0A 1VJGA 3VZCA 3KSBC 1TO6A 4B3JA 1FJXA 1PJBA 4WJZA 1NDUA 3R7SA 5BNZA 3IHKA 1KKUA 3D7MA 3UWPA 2HZBA 2J9GA 1WMSA 3IQZA 1A7KA 1W8IA 4F1WA 5JC1A 4DA6A 3BE4A 4CUZA 1VSTA 5AVSA 3SZOA 1YZVA 5CDYA 1TO2E 1K5GA 1T5DX 2O0MA 4DV3B 4UULA 3R8FA 4DBLE 4RIHA 3ZBQA 3ZDYB 1NP3A 1B8UA 4WOPA 2WKQA 4OI4A 4ERNA 5BSGA 3VA7A 1YNOA 2BHRA 2FW1A 3OLYA 3OWHA 1EA5A 3OTWA 4GRAA 3K94A 1Z2PX 4TTRA 1PNRA 5D3ZA 2QG9A 5FI5A 2XQKA 1RAGA 1JJVA 4XDHA 2PRYA 4M8LA 3SLRA 4QFDA 3UB4A 1FBNA 1CQIA 1UAGA 3B38A 3N59A 3P4YA 3VU1A 3DCJA 1VI2A 5E38A 3EFOB 4AURA 3N74A 2OTCA 1U3FA 1UK6A 1C1HA 3N8KA 3Q3VA 3KYJB 5SV2A 5A3QA 4CW7A 4CF5A 5LR6A 3GLFB 4UU0A 2EKBA 1ZHFA 1DDOA 2NNWB 4LF5B 5JWHA 3LL7A 3LBYA 2I29A 4UJ3A 2EGGA 4JL5A 1R0RE 3OD1A 3Q5DA 4M9CA 3B53X 3WRYA 2PR2A 4YGYA 2ODEA 5DNWA 1U2RA 2UVQA 4ER3A 3NCTA 1GQFA 2BMAA 2KLBA 4PYKA 3ZS8A 3RFFA 2W5UA 4CRWB 4YRMA 2OWEA 3DXXA 2GHIA 4PYIA 2YXPX 1JDPA 4JJZA 3VNBA 3GUVA 5GZ6A 4KACA 4G89A 2V6GA 3PC8C 1KYWA 3U9TA 4I1PA 2QN7A 3I8XA 2AJLI 1ZY2A 4HRVA 2R87A 2PGIA 4QBFA 5DHPA 1QFMA 3DE4X 5LP6C 1QRUA 1ZHOA 4P3XA 1N7JA 5EJIA 4NE9A 5BOSA 3PQCA 3IUNA 1MV8A 1I2MA 2DKOA 3SD7A 3JQQA 4JT8A 1WKBA 3D64A 1NRXA 4KQCA 3D2BA 4X84A 3NAGA 3T5CA 4Z5XA 4V1CA 2G7MC 2SICE 1WABA 2PY6A 1Y6FA 5E6SA 3H2IA 3WL5A 2UZ3A 4ENVA 1PL0A 3ERCA 2VTVA 5EJ7A 3CNBA 1LPNA 3MWLA 3P0EA 4ER7A 1XB2A 3LY7A 1XEXB 2PKQO 3JZAA 5ALNA 4J0CA 3KVVA 2QROA 3TW8A 1ZOIA 4AY6A 4MEJA 4ZU6X 2AGVA 2WUGA 1V1RB 2OMEA 4FWIB 4LPKA 1ARZA 1U7WA 4UPEA 3TW0A 2JZNA 5HBRA 2PMCA 4B3CA 1P9LA 3QLVC 1KEWA 2QVGA 2VYND 2G5PA 4G2TA 4ZYLA 3GAZA 4EB6B 3PQ3A 4LVUA 1OKKA 4ZREA 5FPYA 5KTTA 1E3DA 2WHPA 1WULS 1E0SA 5DP1A 2VHZA 4RETA 2C5BA 3RU2A 3EJWA 3SXPA 3JQAA 4REOA 2O8DB 3PFCA 1NBME 4LKRA 3I6ZA 3ZIDA 4AJ9A 1C3OB 4GMDA 5JR3A 2AWOA 3Q3CA 4G81A 5GONB 2VIIA 2BGUA 1U3CA 3HJAA 2IKSA 3LRXA 2PSHA 4WW0A 5DCWA 4LHEA 2ZRLA 1YNSA 3B2QA 3HEAA 4CM5A 2I76A 5ELLA 4Z6KA 5CXQA 4H6VA 4N4AA 4QHSA 4Z53A 1TCUA 5AW1A 1J1IA 4PZEA 4W5TA 3KVRA 2Z2ZA 2IPXA 2A0KA 3IIEA 3OPNA 3HXTA 4PYRA 2HLDA 2IY8A 2ZAIA 3VSBA 1EKXA 1Y8QB 3TTUA 3DMRA 2IYXA 3EISA 5G4KB 3O0DA 5KWEA 1DWUA 5KQRA 4X7BA 2MMCA 3S1SA 3CUKA 1D8AA 3GG2A 3MSCA 3RV3A 2UXDB 1WUJS 4YDQA 1UPBA 1Y6ZA 2E82A 4DMMA 1IN7A 4QOJA 5LZ2A 3UHFA 4QJBA 3UWSA 1S3SA 3U7IA 1E64A 4P3PA 2YRXA 3EH2A 2BI4A 2XECA 3QVGB 3AM4A 4FFLA 3JRNA 3PE6A 4LVCA 1SU4A 2DZDA 2X3FA 4FYKA 4MRSA 3THSA 5C2JB 1C1DB 3BSFA 3LK7A 2BGKA 3TNLA 1MR3F 1X9IA 3PHBE 1RQGA 3R2JA 4R68A 4E7OA 2IS4A 2O7NA 2XODA 2F9LA 2OLJA 1NUQA 1RTTA 4C87A 3AUKA 2BI7A 5IX8A 5TT0A 2J9XB 4HMOA 1N6NA 1FRZA 4P7BA 3VU8A 2ECFA 3UA3A 3O91A 2EQBA 3AW9A 4URFA 5TDHA 5IDYA 3NHRA 1F5NA 1NUUA 1DC6A 2IH2A 5ICEA 2YICA 3KT3A 2GARA 2WIJA 3K4QA 3BGSA 3M4JA 1R7RA 4I55F 1T1EA 1ZMTA 3RKSA 3RC8A 3P96A 4TYNA 2FOXA 5AM0A 1FW6A 5PGMA 2HXGA 3ZHVA 4NBNA 2O8NA 1K66A 3VNRA 4OA8A 1EPUA 2LNDA 3K9BA 3PI7A 1E9AA 3WXMA 5CJPA 2Y3IA 2C7OA 1G7SA 2QD5A 4GLLA 4AS2A 4BNIA 4U2EA 3T1QA 1EVQA 4MVJD 4RJKA 4NDAA 4HAXA 8OHMA 4BL5A 5PNTA 1AHIA 3O5AA 5I7AA 1EBBA 1BDJA 1XHLA 2BN4A 3CT6A 3PICA 3Q3HA 4NONA 5TQ0A 3TKAA 3UHOA 5MFZA 3V8NA 4C9BA 3AEUA 3SPXA 1E9BA 4LS3A 4OXQA 1W36C 3ESDA 4MW2A 2Z2YA 1C3XA 5F5XA 4LGYA 2V97A 3N75A 2CFCA 2B7CA 5D1HA 1V7CA 1W4ZA 4WNAB 5CA1B 2WB4A 3MA0A 4HD8A 4IQ4A 1A5TA 2W6PA 3CSUA 3L7CA 4XJSA 1B7GO 3BG5A 3SR3A 4TYYA 4ZZ0A 3NO4A 3TIGA 3G17A 1K8YB 4HDAA 1V39A 1GAQA 5JFOA 5BWNA 2O3TA 4DKJA 2MSLA 3G8YA 1HSOA 4TKMA 3FLMA 4IHQA 5FTNA 4ZVQA 4N0DA 2VXOA 2FZGA 2IH4A 1TXGA 2OQIA 2ZT7A 1ST2A 1QK3A 2WDZA 1EUDA 5DK6A 1JQKA 1Q19A 3CC8A 2IP1A 5JOQA 3BL5A 1T9BA 1CQZA 1XZLA 3PFHA 2P2ZA 3UXHA 3ND7A 2W71A 4XYEA 4X45A 5BQPA 4PBTA 5ISMA 3R7LA 1FDRA 4EY5A 1Z88A 4E11A 3WZMA 2M6KA 3GC6A 4UUBA 2F1RA 2P27A 1QTRA 1X8JA 4KRXA 3WMFA 4PG8A 6ABPA 2Z1NA 2JLYA 1F1BA 2AFRA 4KC0A 4KQIA 3TJMA 4EY3A 2H6EA 3BE5A 4UEQA 4UOZA 3WJ7A 1MN6A 3I3SR 3HA7A 5JH7F 1IE3A 4H7KA 2OG2A 4FBGA 1UOEA 1E2IA 4F72A 1OKKD 1ZUWA 3SOZA 4OATA 3M5WA 1N9KA 4PQRA 4YWJA 3FIUA 3JQAD 2FE4A 1J99A 3JATA 3U3OA 1U2EA 4B7UA 2N9UA 2HRQA 3IAM6 4ZPJA 4I36A 4PLGA 5JI2E 3R9IA 3OEYA 4NHOA 3EGIA 1Y6QA 2P0AA 4QU5A 2VT2A 3F2VA 3H9GA 2Y0CA 1Q17A 4GPEA 3OF2A 3DUFB 4MUIA 1T5LA 4Q03A 1XMOB 1ZL2A 1J90A 3VYRB 1E89A 1U9IC 3G0BA 3DBRB 1FVHA 6REQA 3IFSA 1Y8ZA 5AJYA 4B0PA 2XADA 2HLDD 5HFJA 5A7GA 5L6LB 2AFIA 4HQRA 4QULA 3C1UA 4EGCB 1A9TA 2BFNA 2BDUA 2BPOA 3BXXA 1RQ2A 2Q99A 2B7BA 1W0JD 1YDEA 4GXNA 2FEWB 2ZKIA 2P3LA 3TIFA 1G7CA 1PFUA 5KNDH 1DOZA 1WB6A 4NU0A 4YJ2F 1OWPA 1QHSA 2DTDA 3O9VA 4LECA 5LQSA 3T1VA 4DMCA 1OBVA 4NDZA 4DUYB 4ECEA 4Q7QA 3T3IA 1KQ3A 3TS1A 3OU2A 4GX0A 3TFOA 3TQCA 1T2VA 4MUXA 2JGDB 4XYMA 1P0IA 3D3WA 1YA4A 1QP0A 3VISA 2FW9A 4FS8A 4LZZA 3KZVA 1YI1A 1MJNA 1Z5UA 2A7XA 2DBVO 2F2TA 2Q4DA 2W83A 1A4IA 2WUWE 2XCLA 2ZRDA 1QE3A 3NS7A 1YQ9A 1Q0PA 2OM2A 2UYGA 1E2LA 3PWZA 3R76A 3S44A 4IDPA 4WA7A 4EG8A 4ZOQI 3EN0A 1GG8A 1ZJYA 3IT1A 2I4IA 5IZ4A 4GEKA 1B6SA 3JZDA 1E8MA 3ZHCA 2O4CA 2JGAA 2WG1A 3G9UA 1M6WA 2EF1A 4Z3DA 1KEPA 3RUFA 3UMFA 3LLCA 1ZGAA 2ZWMA 1V25A 3A3YA 3WTCA 4BB6A 5K0ZA 3R0QA 4EIWA 3FNFA 2YZMA 4DIUA 5DHAA 3KM0A 2O20A 3HWRA 5F7ZA 3ZG6A 3HK2A 1NLFA 4HTFB 3A6LA 4HNAB 5ALFA 4EFNA 1WUTA 1V11B 4TUYB 1XTJA 4O3MA 1ZK0A 4JLBA 3TW4A 2XB8A 1SAYA 4HS9A 4IQGA 3LAWA 2GF2A 5EXSA 1Q95A 2QAGB 2BR3A 2PANA 1MEJA 7YASA 1CIVA 1F60A 4X1IB 3AGPA 3L8EA 4WNAA 3RTCA 5JROA 2AUMA 4BVGA 1SK8A 3ZQKA 4DKXA 4P7JA 2HFKA 2ZWAA 3BKWA 2CJWB 3K0AB 2FR0A 2I33A 3CO0S 2VHEA 1XEWY 5ALHA 2WE8A 2B5VA 1G0NA 4E2YA 3SR4A 3ZVMA 1PD1A 2H3EA 5JSFA 4J6EA 2C7GA 2P9QA 4X7RA 3W8EA 1B3RA 2J08A 3MD0A 3ZZ0A 4AMVA 5HK9A 1SVNA 4ZAXA 5KU1A 1D4OA 1I1NA 4CEJA 2VYCA 1KVRA 4QOHA 4BQPA 3A1VA 4JJGA 3TFQA 4CKXA 3GN1A 1MU0A 2QQEA 4ATNA 1NV9A 1C7FA 2WLSA 3EWNA 2L19A 3KHUA 4XLZA 1U3WA 2V3WA 1HK7A 1Q7RA 1V48A 1ORDA 4HSEA 2X3YA 3B9RA 2F4VB 2ISQA 2X40A 3LUPA 4C0SA 2I1VB 3O2NA 4BEVA 1D07A 1K0UA 4PNZA 3HFJA 1KDYA 1MJ5A 5JQGF 4NEQA 3TDKA 1QBKC 4BLTA 3BXEA 1OLOA 4BQSA 1USKA 4L27A 4LQCA 4EHHA 4NC9A 4CHGA 1EE9A 1E1QA 1Y3DE 2BE7A 2Q4EA 2H3HA 2ZIEA 3M1IA 3QWHA 2QU7A 4JC5A 5CT6A 5TPZD 1EK2A 1SQFA 3WKEA 3AQIA 3DBHB 1II8B 1VI6A 4MV1A 2FR8A 3IBCA 4MUNA 4D9HA 4OJNA 1KY5A 1PG2A 1XXHE 3E9YA 3GHHA 1P4SA 4B1FA 1NYLA 3REQA 3WZLA 4QPNA 1KI7A 1MX1A 5K3SA 1YV9A 1CUAA 1DEOA 2P5TB 4X64B 5C5IA 1W1IA 3EVEA 1WD7A 3WYAA 5LUAA 1FUYB 4TGLA 2CHGA 4I55A 1HH4A 3ZWWA 2AA3A 3HYRA 4JC8A 5E7MA 4FGLA 1D2AA 1PHPA 2VHUA 4ICIA 2GN4A 4K81B 3CVJA 4LYAA 4ZI7A 1SZJG 1U5AA 1J8FA 2Y1DA 1Z17A 3GCWA 2J5KA 1E2DA 3ANMA 2DUMA 4F96A 4WXMA 3ABRB 3KQQA 1O9HA 2VWQA 3UENA 1CUXA 3D5EA 4ALJA 1Q20A 3V00A 1XZMA 2PVCA 2XEDA 2Y4NA 4QRDA 2ZPTX 2GFHA 4L5IA 5HFNA 3U48A 4DCUA 3A9VA 1GQSA 2XLBA 3R9WA 4QX6A 2DQ4A 3STUA 1QVRA 3VYVA 1FA9A 3PCRB 2AI1A 2XGMA 3M2TA 1ENPA 3WS7A 4Y6SA 4RH1A 5CDFE 3CWCA 1KAHA 4MRMA 3T1OA 4KP7A 3R3SA 3FGZA 5I7UA 4FE3A 4R3WA 4TTTS 1UWVA 4P4NA 3VTFA 1A98A 1WXWA 2DJIA 4DIMA 4Y6OA 3F5DA 3HJTA 1E6WA 2XKAA 2RG1A 4A2WA 1B76A 4EFLA 1HYGA 2JS7A 2DR0A 2QSYA 3RVDA 5GTDA 1HA3A 3AWIA 1PN3A 1XHEA 2OORA 2V5UA 4RTKA 2D8AA 4M1EA 3RU3A 3DDZX 2F7SA 5FL7A 4DZRA 3UBTA 5KYVA 5GY7A 4YN3A 1K7YA 3LW7A 3UATA 3FOZA 5T5QA 2PMBA 4JI7B 1THTA 3EZNA 4JB0A 4U7HA 1RLOA 2IZ1A 2JRLA 2ZATA 3A58B 3CZAA 4D3XA 1CIPA 1DGQA 1ZKMA 4R16A 4OBXA 4PIVA 2PS1A 5CGZA 4C07A 3ROFA 4FZ5A 3SMVA 4HDRB 4N6OA 5M2QA 2PKEA 2YJ5A 4MWSA 4FD2A 1Z12A 3V1NA 1VKJA 5JH7A 1P0QA 5EERA 1T0JB 3GEGA 4E6PA 2NWQA 5EI5A 3ZY4A 3D6JA 3O75A 1RYMA 2YYSA 3GDOA 4ANFA 1SGWA 4GNKA 4LV5B 4YP1A 4TVSA 4Z4EA 1RC1A 1KDTA 5FL3A 4ND5A 1JSXA 4UAUA 1JECA 3AP3A 4MS1B 3R7AA 4A8TA 3OKCA 1HWYA 1DWPA 1NVWQ 3ETJA 4Q7JB 4JYPA 1ADYA 2ZIVB 3OQBA 1ABBA 3OQIB 1Q14A 2DTXA 4QTYA 4KXVA 1NU6A 3D6AA 4WCVA 5JCPA 2IPAB 3STXA 1R9NA 4XUGB 4DMRA 4TRRA 3GJ6A 1L4YA 3CSSA 3FCXA 4CV2A 4HX9A 3VPFA 1WPQA 3QX3A 1TT5B 2WUFA 1G6KA 4CM3A 3GP8A 1Y42X 1CY4A 4O63O 3OU6A 2RK3A 3D8RA 3L7JA 4FQ7A 1I7PA 2PZAA 4DAOA 3Q4GA 1IM8A 5KIAA 4XJTA 5KOJA 4EKYA 1MPTA 2GPSA 3FMFA 4FHGA 3VH3A 2YIVX 1PEAA 1U0TA 2PX0A 2PKQP 3DYVA 3QKIA 2JFOA 2I1QA 4X0EA 5C8ZA 3UEOA 4YJ2A 2L0XA 3IPYA 5IYZF 3N87A 3LP8A 1Z6XA 1NA5A 2D0DA 2XDQB 2HBYA 3GVHA 3RBXA 1RSZA 3WADA 4LXUA 3RRFA 3O8CA 1W4LA 3UTDA 3QQPA 2NV0A 3HJRA 1DIBA 3KFVA 3V80A 3ZR4B 5BVHB 4MB6A 1K89A 1MG0A 3CEMA 2Z43A 5B2ZA 1S2IA 3UGQA 3ZV5A 4R2WA 4MUGA 2B1QA 3UXMA 5NLLA 1K3TA 1I1QB 2NGRA 1OLSB 3LZDA 3HLKA 2V03A 1KFBB 4J49A 2FJ0A 3DE2X 1FFCA 3MGGA 5ANRB 5AW8A 5ED4A 3A3OA 3A1NA 3ROZA 2J0VA 2MINA 1Y3FE 2HQ1A 2VPQA 3KSRA 4HNGA 2B6HA 4J7UA 4YJGA 1R5BA 5ER6A 2YWCA 1P77A 4YWHA 1TZKA 5DGCA 3MIIA 3CLRD 3D4IA 5EUBA 5EJEA 1K8ZB 3PUXA 3CEJA 1QS0A 1UPTA 2BRUA 2GBIA 1U28C 1DLIA 2CJXA 3E48A 2NZVG 2CNWA 4AC9A 4N7MA 5KYYB 2HHHB 1YQXA 2G9ZA 4CTKA 4QBHA 1FLVA 1RM4A 4RJJA 4K03A 4RH0A 2PFSA 4EZBA 3SHOA 3GJXC 5JS2A 4G84A 2WMNB 1HF3A 2HCRA 3DO8A 2ZPUA 4KJZA 1KQPA 2V1XA 2H5LA 1NLZA 2VP9A 3OJFA 4YJ3F 5P21A 3Q6NA 3TSZA 3DBOB 2QQ5A 3RYIA 5FLXA 1OFIA 4FT2A 4JI0B 3LZ6A 5L9AA 4H4EA 1T9KA 4NENA 1XCOA 1RW4A 1L7OA 4WQMA 4HN2A 5CU7A 4F2DA 3QVSA 4V0QA 1V26A 3MELA 4OI1A 4EECA 1UADA 3F6SA 1Z7BA 1MABB 5KYTA 4ZXFA 4TT8A 1JG1A 3T06B 3G7UA 5B3AA 3M33A 1WY5A 1W2GA 421PA 2Q5JA 3PFKA 4BNXA 4JLKA 1W5SA 2GOYA 1ORWA 4QXAA 5HPYB 5L7YA 5JDIC 3A14A 4ND4A 4KRYA 4RCYA 5D3KA 1I7LA 1A2KC 3TD6A 1WCWA 1QDEA 1XAHA 2B82A 1K7FB 2G82A 3OZIA 4Y18A 3TZLA 1MAWA 5JQGA 2QRHA 3EZXA 1C0PA 1V9CA 2Q5OA 3O8QB 1K7CA 2BGRA 1G5IA 1A5SB 5I9LA 1G4HA 1X1QA 2EJCA 4PO8A 4IO1A 2BONA 5FL7D 3DVLA 4IG9A 4LX8A 5I01A 4OI0A 1P5FA 3IIKA 4KXQA 3G8CA 3CEHA 3N2EA 4XQ0A 1TMOA 5F9MA 3ED5A 3CONA 5FRDA 3PX3A 1K5HA 5H0IA 2Q3HA 3L8DA 4IM7A 3HXLA 4P4LA 5FJIA 3BFVA 4X1YB 3R20A 1IWOA 4RS4A 1G3QA 4L2IB 1B42A 2HXSA 3JQ7A 4L76A 4YLEA 4AN1A 4D99A 1ZM9A 1WQ3A 3N2GB 1UJMA 3NFRA 2W8ZA 3V6MA 2PUCA 1RI3A 1SUCA 3FHJA 4P86A 2CE2X 2RGBA 4YMSA 2AYZA 2JLQA 3H17A 4Y2HA 3SFTA 4Y2XA 4NZMA 3B60A 1VL0A 4L72A 3B1FA 2J41A 4LXXA 3MTBA 4YECA 2WSSD 4WLFA 3Q1LA 2JGLA 3KRTA 4LJRA 5I7FA 1N2CB 3I01A 3NDIA 3WYBA 1CXZA 1YVRA 2ZXUA 2ZVDA 2WPNA 1P2VA 3AKCA 5KVAA 4LXQA 4JVOA 4JELA 5HMMA 3GJZA 2QX4A 2YH2A 5I48A 4JOQA 2RK4A 3B6EA 1UFVA 1WCIA 2PEZA 1KP3A 1T8RA 1GL6A 2VK4A 1PEKE 1XZAA 2P5UA 4P5DA 1ZINA 1O94A 2QXUA 3PNYA 4QJ4A 2RHOA 2ZE6A 4ZHQF 3O4GA 5I5GA 2VPPA 2G67A 1JDNA 2QGNA 1USUA 3PQ7A 2R00C 1XNGA 1U2SA 5BUCA 3HDVA 3AQ4A 2ST1A 2OXCA 1U0SY 5CRIA 3RVLA 5BVHA 5KJCA 1JFSA 5EN4A 2VRWA 2ZUSA 2CYCA 3G59A 4KWTA 1NDQA 2Q1WA 2AOWA 1NMSA 1ENYA 5GZ3A 2YJTD 3L4KA 3VJRA 3HJGA 3OFNA 3G5TA 4GEGA 1DTWA 1YB7A 2RSLA 4P3KA 1NQAO 1T0BA 2BDTA 1HQYE 3OM9A 1GQRA 2PUHA 4WK4B 5JAUA 1L5VA 3KT8A 1DXOA 4FB4A 1RHQA 5B2EA 4DJJA 2UU9B 3RS0A 3DVAA 4O08A 4C0WA 1ZOPA 3RC9A 3HKBB 1O9GA 1Z5NA 2JNWA 2ZYAA 3SKVA 1G1MA 5EKSA 1H93A 2PYZA 5HF5A 3WYGA 3ZE9A 2B0JA 5JEDA 4HUQA 3QEOA 1SG6A 1T15A 4UPVA 3HL4A 2WZCA 1QE5A 2VHTA 2XPCA 4Q37A 5IDWA 2TRSB 4BO3A 3TLGB 1C41A 1K68A 2ANCA 4LJ7A 1IUOA 2BHLA 1XF1A 2GLTA 3K9GA 2P9HA 3MIZA 2WK1A 1JQBA 5IMBA 3TOCA 4OGKA 1EP3B 4FHCA 3S1AA 1QU3A 2XMSA 1DKNA 1Y34E 2QW0X 5DGDA 3I34X 3IJ5A 2CNWD 4EKNB 1WETA 4DT1A 4IS3A 1T2FA 4MZXA 1ILEA 3I4LA 2HBQA 3FPBA 2DP4E 1KAMA 1N5RA 3HVJA 3M4ZA 1IB0A 1OC4A 1UM9A 4TRJA 5CA0F 5KYUB 3FNRA 4YAGA 3FUTA 3K9WA 3PC7A 4PWYA 1TTPB 1W5BA 4K88A 4R41A 4UBLA 5C18A 3OIUA 5KOIA 3L4SO 2KB0A 2DLNA 1NP6A 2L69A 4K8RB 2B4QA 2Q5LA 4ZU3A 4G0UA 5DDIP 1N1EA 2WZQA 1IEVA 1YL5A 4NZZA 4WOKA 4QGSA 1EGQA 3P2YA 2NUAB 4DEYA 3CXUA 5DP2A 2X4DA 4S1VA 2XTZA 3N0XA 1L8QA 4L9SA 3A2NA 4B44A 2DPMA 4E22A 1YVUA 3PL5A 2ABWA 4YT2A 1ZK4A 1X7GA 3HR4A 2E6UX 2XSZA 3PD7A 2KYRA 2WYOA 1JB1A 1VJ5A 2GKGA 3F1KA 4X7PA 1FVXA 2CXXA 1P73A 1U80A 3SDZA 4M8NE 1MEOA 1VBNA 4QHYA 5DXAA 3UB2A 4D3ZA 5HXAA 5IT4A 3AI2A 4AKSA 1K27A 5D3MB 4KQFA 1PJ3A 4X1YA 5IYZA 2GKSA 4IFTA 4KLRA 1OH6A 3L8HA 1YS2X 3MOSA 2DQKA 4M1KA 5EHGA 3KOMA 3R5HA 3ADCA 2IHZA 3LPCA 4BVFA 3WOHA 1MDFA 4NNJA 3R40A 5ALOA 1HDZA 1OFGA 3MOGA 4EGAA 2ZS9A 3BMQA 4NMXB 2RJNA 5H9WA 5JBNA 1QX4A 4YO8A 3T4PA 1T4BA 2X9QA 2AL7A 2ERCA 2DCMA 2GRAA 4JEMA 4W7SA 2WD7A 3CPHA 4N5NA 3TW6A 3FLBA 3K2IA 3OTGA 1XTRA 1UBHS 1NXTA 1N34B 3L9XA 3VNQA 2YZ7A 2H0QA 2C4MA 4UDNA 1X3SA 4TKVA 4MQLA 3L4JA 1MOPA 1WOMA 3L1JA 3AV0B 3L5KA 4L28A 5M04A 3GWGA 1H2BA 3Q6IA 4MV9A 2R8OA 4AD8A 2XT6A 4DHEA 4OKIA 2XA2A 4UMDA 3QX8A 3NOVA 1X1TA 4P5PA 1VDZA 2PRKA 2WWXA 3FFTA 1OI7A 3KE9A 3LVRE 3U4IA 2E4ZA 1NXOA 2BP7B 2VNAA 3EVBA 2CDBA 2D7CA 2P4SA 3GFFA 3O31A 3AHJA 3QOXA 2VK1A 2C42A 3ZV6A 4LY3A 1GQQA 1G3MA 2PT5A 1L4HA 3G2NA 4MA4A 1H42A 1SHUX 4JS0A 4LNHA 5EKDA 1I6WA 3QY9A 2HIHA 4HS4A 4YJ3A 5F7JA 2VA9A 5REQA 4PHTA 5LDHA 4BO0A 3THYA 5AM1A 2WHXA 4YCJA 2VL7A 3A10A 2D5IA 3MMXA 4MWGA 1O94D 3OZAA 1FNMA 1Q0RA 1DO2A 2VHXA 4FEAA 1K6EA 2CLSA 4CCAA 1QGUA 1T8YA 2YXBA 4TV8F 2O3UA 3EQZA 3CF6R 1G60A 1SC1A 3E8MA 1E6EA 5FPQA 5FOUA 2GEJA 4RDXA 1VBMA 1CYDA 2X4IA 4DPLA 3UPTA 3OT4A 1P6UA 1R4NB 3OFND 1VMIA 4W4TA 3UMVA 2HREA 1VHWA 3H8JA 4RZIA 1SBCA 4OHVA 3UG7A 3ZK9A 5COAA 2VQFB 2O8EB 2M1ZA 1UBTS 1IRIA 2YDXA 3T52A 2Z2KA 4BYGA 1TOAA 1N6OA 1ZN8A 5F4ZA 1DC4A 4QASA 1VRVA 2GLUA 2I4RA 1OA0A 4R9VA 2NU8B 3AFOA 3SG0A 1J7JA 2KE5A 4MI3A 2H4FA 3KLNA 2C99A 3EQ2A 4DA0A 2O6HA 3LFUA 4QQNA 4D0SA 1NI4B 5C4MA 3G0DA 1OFUX 2D8MA 4JAVC 4XUEA 4CLOB 4E07A 4N3AA 5CXSA 1CUFA 1P4AA 3ESYA 2VZ0A 4YQYA 4CTNA 4EY6A 1N36B 5EWMB 2JIPA 2EFGA 3UGTA 4BMXA 1L7RA 2P3QA 4RDIA 4GT1A 1W7AA 2FU5C 1KS2A 1GCIA 1S8AA 1T5SA 1YS7A 2GUWA 2BSXA 2VDKB 3OQ6A 4JGIA 5DULA 5AVJA 3PPYA 4DGQA 4A6DA 1F7UA 2ICAA 3A1CA 2G1AA 3K70B 2OQ2A 5IKXA 2B4AA 1MC4A 1KFEB 1KAQA 2H06A 5D00A 2PMEA 5K0FA 4OOEA 2R6GA 5AVOA 4EYOA 2CHUA 2DH5A 2X6QA 1IB6A 2ZTVA 3L7IA 5CLGA 4FFDA 5E1BA 3SMQA 3UB3A 4PHFA 5DCUA 3SZUA 3WDSA 2DKFA 2DFDA 3WLMA 1UK8A 2M6SA 3ROTA 1UMBA 3M6WA 2G7ZA 4B81A 2ZREA 1A76A 3UAYA 3H65A 4PN7A 4GSLA 3H5NA 3QJGA 3IX7A 2FK8A 3WX0A 5B7QA 2HA7A 4R1QA 3GCDA 1VSVA 5EXTA 2AS0A 1XKLA 2LCIA 2ZTSA 1XU4A 5TQJA 4MUAA 1QJCA 4BE4A 1KO5A 4EJSB 4HWTA 4RLFA 4LPSA 1COZA 1SCNE 1JU4A 1L4NA 2Q9UA 3NM5A 4IXDA 4ZQGA 3M3DA 2DH6A 4ZHQA 3T1YB 3CU5A 2Q5EA 1Q1BA 2X13A 2YR0A 4IXWA 4YRQA 3RWOA 3T94A 5C80A 1Q16A 2QDKA 3C4JA 4XWKA 2XSZD 3JD2A 2J85A 2PL1A 1IMJA 5BV2P 2QRLA 5BN5B 2XXBA 3RANA 3ZGLA 4PFQA 5BVGA 5A1TA 4CVNA 2AJ8A 3AF1A 5DNUA 3ODPA 3QFSA 3DZKA 1NONA 4KL8S 1N5KA 3CFYA 5AJXA 4CMCA 2FRDA 1NW6A 1WMFA 2AR7A 1M1ZA 3B8HA 5K3AA 3VHXB 5K99A 1ADGA 1NN1A 2ZBQA 1AQUA 1M2EA 3CRVA 3JRWA 3M1AA 1QX3A 2CJFA 1RKXA 2FNAA 2ZDQA 4LOAA 4J0JA 4XUDA 4WLOA 3OUTA 4B35A 1ZSYA 1W6UA 4XQCA 4ABYA 1KKLA 5A3SA 4QWWA 3D8SA 2JI8A 4WZAA 2O2JA 1ZITA 3R0JA 3FSJX 1D2MA 2EEZA 2F3UA 2VDPB 1B3BA 4PG7A 4YDHB 1XRRA 2Q2OA 2C57A 2ZIFA 4JXXA 4ETIA 3QA9A 3QHQA 3ZWMA 4FHEA 3IP9A 4MVCA 4BGVA 3DMDA 4DLLA 2C8VA 3KZNA 4PCAA 4AQYB 3W2FA 1RHKA 1QOQB 2PGJA 3A1TA 3O92A 4IGIA 4WFIA 3RS4A 4PLZA 2VJLA 3DQQA 4WKBA 5IASA 5BW6B 1SBYA 2GB4A 1W2WB 3DHNA 1T5BA 3P2EA 4LBWA 2Q4OA 2X9LA 5GQSA 4DYDA 5JJCA 3NR2A 2VHVA 4P08A 1O2DA 1DNPA 1XT6A 2QN2A 3P2IA 3QU5A 1NFFA 2GJ8A 4GGOA 3CPEA 3U7QB 3ZH9B 3MWEA 2GXAA 5EJGA 3CURA 2C2XA 4IOJA 1T9HA 2PWBA 1Y9DA 1YK1A 4AMGA 3D0OA 1BQ4A 4M6WA 3HUTA 1E4EA 4XQEA 5FP0A 3U7GA 4UTOA 2GM3A 5CA0A 3KOOA 1NVDA 4XGQA 3I9NA 3AL2A 1RXEA 4XVRA 1JVBA 5LMNB 1KETA 1NNI1 1WB9A 4Y0NA 3NC0C 4NNOA 4B5KA 4XGKA 3JTMA 4GECA 4BNMA 5I8PA 4PSAA 3R3UA 5COQA 5LQAA 2POQX 1CYEA 5KSWB 4LHSA 3I4CA 3I37X 2W37A 5F1YA 1DP4A 5KYNA 3OA2A 4Y1RB 2EZ4A 4MQFA 1ODTC 3HDGA 3M1LA 3LQ2A 2BOVA 5HOEA 1RMYA 1XNHA 1UDWA 3HJUA 4DS3A 4D9CA 4XWTA 4CLOA 1ZQ1A 4ZTZB 1GLVA 4P8RA 1A5BB 3VAYA 2PH3A 3DMNA 1U9YA 1KK3A 1YTUA 1R27A 4UASA 3I52A 3JWIA 1E5LA 1ZN9A 2R1VB 3GZNA 2XJ9A 4TLEA 5MF6A 3O4VA 1FF9A 2J3DA 1Y4ZA 1J25A 2OYRA 1YB2A 2PFGA 5HUQA 4ID9A 4BQRA 3AHEA 3EGWA 4Q9DA 4MGEA 1HRKA 1Y5RA 2FWNA 3TBFA 1U2DA 1U3UA 4BVAA 3CPJB 5GVSA 2JAQA 4Y9TA 3WGQA 1J9ZA 3ME5A 3M9LA 1SUIA 3WB2A 4DIEA 5EYPB 2NUBA 3FRHA 4K9RA 2AOVA 3PWKA 4LDRA 3FYUC 4A26A 4GYYA 4QXOA 1UBEA 2X5NA 3CW9A 3L0ZA 3OTQA 4IRMA 4QXPA 5BT9A 3EAFA 3IL2A 3WKDA 1JEDA 3EK2A 4YJHB 2G71A 5JXGA 3U3ZA 2HRCA 2P9YA 3C41J 4CLDA 1MTZA 1BDBA 3TLJA 2Z3VA 4FOTA 3PA8A 5BT8A 1YCDA 1XCLA 4EY7A 3E9CA 1A7AA 2NV2B 2R8PA 3D2CA 4KAAA 1IIBA 3NG1A 1K75A 1PFGA 1UMKA 2D2EA 4YRFA 5FKJA 4ETNA 2FDCA 1CT9A 2CK3A 5IAOA 1G21E 4PC6A 2D1FA 3DS8A 1VCHA 3I58A 1KF0A 4GR4A 4X1KB 1XTTA 1KEUA 3TE7A 4JLSA 4ZMRA 4Q4CA 2YOGA 4XOIA 4B3TB 3VNUA 3ADKA 4W9NA 1K6IA 4DNFA 1XD9A 5JU6A 3UFXB 5BN5A 3JQDA 5AJHA 1JIUA 2CWWA 4JMLA 4P34A 1NXWA 5EUQB 1UBLS 5EA2A 4GMKA 3ZV3A 5AKHA 1M34B 2JFHA 3TGWA 2CUKA 5BWCA 5DYYA 4JWKA 4UUMA 4TV8A 4I19A 1YR7A 3NWJA 2F48A 4G0OA 3HN2A 3KQMA 5U1PA 4BDTA 4YCLA 5JISA 4PHHA 121PA 1V4NA 3E7WA 4M88A 1E1CA 4Q3AA 4RJIA 4UHKA 3HY6A 5CK4A 2HRZA 5L3QA 5EMKA 3CB4A 5LOVF 1XLVA 5EXPA 1RI1A 2X0NA 3AYZB 4LC1A 4ZCPA 3WFIA 1M74A 2WJZB 1Z0JA 3WK7A 1BRMA 3PUZA 5KYWB 1KYIA 2P7HA 1HO3A 4BNWA 1C8LA 4ZN6A 4LK3A 4CBVA 3TAXA 3MD9A 3WQHA 4E13A 3E9EA 1OD6A 4MR7A 5JRDS 2K7ZA 2OXEA 2AMVA 4IZOA 5ALDA 2IRWA 1R88A 2H7CA 3UJ8A 2XMPA 3BCSA 2WUVA 4KX5A 4CL0A 3B52X 2YWRA 4V0MA 1LX6A 1XCMA 4YP6A 1DXHA 3JD1A 2F3PA 1E7SA 2GZHA 3SJZA 1B16A 1RJDA 1ILWA 2PD4A 1ZFNA 2AN3A 1PQ4A 1SVUA 1H23A 1Z37A 1Z74A 2H1VA 3KHSA 4FLEA 4HEQA 1W4CA 4EEXA 3ANXA 1IQRA 2FDXA 4BV9A 2V6FA 3H1PA 4C0HA 4UAVA 1ELOA 4JXZA 3LA6A 3A4TA 1RP1A 4MTLA 4TT3A 4BJ6A 3BUSA 1TK9A 2AK3A 4D8YA 1F20A 1C1YA 1A9XA 1WR8A 1N5IA 3F78A 3QFFA 3FUCA 2RI0A 1ATIA 4R1NA 4NFSA 3FR8A 5TARA 3WWZA 5A5VA 1MENA 4R51A 1YDWA 2Y68A 4M46A 4DJ5X 3LWDA 4GOMD 4X5OA 3WGOA 1YQGA 5HKBA 3OZ7A 1FFSA 3BICA 3JASA 5E6UA 3TPCA 3TIXB 3V8BA 3AX6A 2F1OA 3HUUA 2H1WA 4BN0A 2BFMA 3F8SA 1ZIYA 2IDKA 3ZEIA 1ZXXA 4GWLA 1R4MA 2BYTA 1IUPA 2AOTA 4QTXA 4F7DA 5JSHA 3LLMA 1NBEA 1GZ6A 2PQMA 4E4RA 4IIDA 2MOKA 1TU3A 1MZPA 3DKRA 2QQFA 4JLDA 2DPYA 5SY4A 4MPDA 4EO7A 2FPPA 1EAYA 2PX3A 3FSRA 4FGZA 4OOFA 4Z0TA 1RC0A 1B14A 1X7ZA 3PDUA 4D6XA 3THXA 2HU7A 3HZZA 1KEEB 1XWIA 2FZCA 2R4UA 2V0CA 5EYPA 3FHCB 1I5RA 1OVMA 3LX5A 3PXCX 2XBMA 3HV0A 3LA8A 3PX2A 3F6BX 1LSJA 3QE0A 1EJ6A 2VXBA 1IBLB 3AVXA 1G9XA 1C4OA 1EG7A 1YZTA 3FH0A 3P0RA 5CLQA 4DMGA 5K8TA 3CLVA 4QAJA 4HV4A 4L6AA 4B45A 1XRQA 16PKA 1AUPA 2Q28A 3C7DB 1ENZA 1F8XA 1YBMA 2R5NA 3ETCA 2BFPA 1WV0A 3GQVA 4E33A 1JKJB 1VG9B 4RULA 2PVSA 1XMVA 4N47A 3WLSA 3KKOA 1LC0A 3HM2A 3EXG2 4BEBA 1XVIA 4MPJA 1QCCA 3B1JA 4DV5B 1H4VB 1AJEA 5TQ2A 1LPAB 5J5CA 1E8DA 1Z6TA 4G85A 2J7PA 3PZRA 3SC2B 2ZYSA 5FLEX 4GHWA 4L1KA 1CUBA 3LT0A 2GZ1A 1SU6A 4J4TA 3SSOA 3V8MA 2Y4OA 4MIOA 3H9UA 3VR0A 3B1KA 3N70A 3ER9A 2OPHA 4Z4IA 1Z9BA 1HKHA 2ODAA 4OK3A 4MIEA 4CCYB 2CK3D 2YJGA 1Z2DA 2FUG6 2FWRA 1XQ9A 3AETA 3MXTA 4N0PA 5DRTA 4DCCA 1I1HA 4PYLA 3GJ3A 4RGYA 3ANYB 1YH3A 4G3XA 4Y2RA 1GDTA 1WNTA 3E4CA 4E5YA 4F1JA 2R6AA 4AZWA 2GEKA 2RH8A 1SQGA 4B3IA 2ZUCA 5HK8A 1UWKA 4OMDA 4AMYA 2ZJ7A 3QU7A 3AEZA 4KQGA 4A15A 4HADA 2IBSA 2BGGA 3A32A 1CR0A 3M6XA 3KX2A 2PS3A 4GNRA 3RHZA 1GT91 2Q3BA 3RFVA 4J0HA 1KYZA 2QNRA 4JUCA 5J4KA 2VWGA 3URKA 4U6SA 3OCJA 2HHCA 3HRHA 4JB8A 4MW7A 2I87A 1JHMA 4PQYA 3AKEA 5HDBB 5C3MA 1CJSA 1Z2AA 2L2QA 4HF7A 5JCXA 3MTQA 1B15A 4YLGA 1P7YA 2OPBA 4L4SA 1R6UA 3BX1A 2BBWA 1SXJA 4ER6A 4WADA 5F98A 3KSDO 4ZOEA 2B4YA 3BAZA 3SHFA 1E62A 1SKBA 1HQDA 3F6CA 4I5EA 1LUAA 4K87A 1EK5A 1XMPA 4QUBA 1V7QA 2I7VA 3FX2A 1S3GA 1K9SA 3SQOA 4FNMA 4MDFA 3HJFA 5BYJA 2FX3A 3FWNA 4HG2A 1JEYA 2Y77A 4EH1A 1Y1TA 4ESHA 1UBNA 2Q0SA 4AL4A 2XXJA 1JN0A 3AJEA 3SOPA 1BTOA 2P2GA 4MUHA 3E2IA 5M29A 3R7BA 3LV8A 1R4ZA 4Z7JA 2IYVA 2E48A 1LDMA 3LW8A 1I2ZA 4BO5A 5LWHA 1OLXB 3R6TA 4KXLA 5IDXA 2WHRA 4J75A 4WTOA 4IMJB 3T1NA 3AI7A 1DJOA 3M6LA 3TCKA 4DADA 4EYQA 2XCSB 2DR3A 3A2KA 1ISSA 1XQ6A 1FYXA 2GYUA 4MLCA 3W9YA 1FU8A 2GWRA 3MWDB 4PRKA 5BSUA 3QVLA 3LG2A 1PS9A 4DXDA 1IZ0A 4EPRA 1BEZA 4B4KA 3W9BA 3O7MA 4DRXB 5B12A 4C7OB 2FF5A 2IC5A 2ZQ5A 3WRYC 2VS1A 1KOFA 3RIXA 4ALIA 3F71A 4W8OA 3T9BA 4NJMB 4X95A 4P0QB 1BHQ1 2TECE 4HYEA 2VUTA 1XVLA 3N2LA 3RWBA 5JLJA 5FAKA 2I3GA 1RXVA 1QRAA 3K5WA 1WEHA 1KJQA 1NXQA 1YZYA 4UMVA 3IPLA 1E3TA 4DC1A 1RCTE 2IDJA 1W19A 5AMXA 1XL0A 3BH6A 1PVDA 3KQSA 5H1YA 1FDWA 4IZHA 3G5AA 4YCBA 1CY8A 1YR2A 2XMQA 1CQWA 1D2HA 2A92A 2WA1A 1VZ2A 3FPHA 1EGVB 4LCBA 1EXNA 3P9QA 3ESZA 4QELA 2FOLA 4BNVA 5KYXB 1GN8A 1MAHA 1NVBA 1USIA 1FLAA 1DEHA 4CU2A 3WWPA 4EITA 4DUZB 2P30A 2JHFA 2JLAA 4Q21A 4M2LA 4U2GA 4M9SA 2O5CA 4RSMA 2BHNA 2E87A 3KT0A 2QJWA 2QW8A 3RKRA 1P4HA 1D2GA 3JQFA 2RJ3A 1N7IA 4YAWA 2PQ0A 5B1YA 5E7JA 5CAEA 4FJ2A 2O3JA 3VO2A 4I1YA 4I46A 4JGBA 3TEMA 3GEHA 3TSYA 3W7AA 5LOVA 2AMYA 3FR7A 5C32A 4BB5A 1BE6A 9LDBA 4UHHA 3N5KA 4E12A 4GYJA 3KB8A 2Y0EA 2R8YA 3BL6A 4YR9A 4YHHB 3P2JA 2GF0A 5CLLA 2NPIA 2WU4A 1RZ3A 2W58A 3E3MA 4Y2JA 1HM5A 5IG2A 2FYTA 4NICA 2QQ0A 1I5OA 4O2AF 4ZVMA 1YCGA 4OLAA 3I1JA 4P4SA 5D5HA 4W5HA 5FR2A 5FUVA 1U6JA 1SOMA 4HDNA 5CDUA 1H22A 1HE2A 2KSQA 5HW0A 4ZMSA 2XF8A 1YA6A 1EDZA 1YT5A 2IF2A 3RJMA 4B48A 1KDPA 3AFIA 1XTQA 2VP4A 1JP7A 2HMYB 4M9XA 3PQ6A 1GG2A 4H0CA 2C2ZA 1GL9B 1PBTA 1D1TA 3MQFA 5E4TA 4O2BB 1NW3A 3T38A 1AKYA 1N1DA 3FYSA 4M86A 2WRZA 4U7WA 3RE1A 5JRZA 1UZLA 1V8PA 2AEEA 2Q3FA 3E15A 3K4PA 4P22A 5FUWA 5IT5A 3BD6A 3KJZA 4BECA 4P54A 1DAIA 2JRCA 4FBMA 1GUBA 5AJVB 4BFWA 1HG1A 1BD3A 2PZ8A 2V59A 3X0DA 4CQMB 2QRNA 2I4TA 1P0FA 1Y1LA 1Y4SA 3FGOA 4X91A 3GLIB 4JBXA 1J8DA 1DBWA 3H8WA 1MB2A 2Q3LA 2A94A 2X1LA 4ZAFA 3U3XA 3ZK7A 6PFKA 1S0UA 3E03A 3L05A 4UTRA 5L40A 3M6VA 4ZQCB 4LNUA 1FMLA 2HSGA 3GELA 2QZZA 1UBFA 2ES4A 2B0CA 2BE9A 3E5RA 3G5UA 3OZEA 1V5WA 1CUUA 1SXJD 3KEOA 1K8XB 1GTRA 2WTBA 4F04A 3REGA 2PZFA 3LHSA 1NE7A 3M5DA 2QLBA 3A36A 2W6MA 4JXJA 5K20A 1E1YA 3FBTA 4QIHA 4QQFA 5ADHA 3OCUA 4HEA1 4HI0E 4MW5A 2P1RA 1HETA 1NBOA 1NI5A 5HZHA 1PLLA 2XVZA 4OMUA 4BAZA 4AJJA 5DI3A 1FRNA 3HN7A 3ZEAA 1W88A 2IXDA 2FWMX 3C8UA 3U7JA 2PX8A 2PIAA 1GNRA 3DB2A 1CE8B 5AM3A 2R7NA 4GKAA 4WXYB 4C7OA 3NEJA 3CNOA 4X92A 3LBFA 1SIOA 1QKJA 3DEZA 4FCCA 5AIAA 5F2NA 1XG5A 1KRHA 3V8VA 2PDAA 2I4LA 4GZMA 3ZZMA 3IPXA 2Z3WA 3OX4A 4RY9A 1R50A 1M6VB 1XDBA 3D6HA 2VDNB 3GH3A 4D6YA 3PFNA 1Q6YA 4WZ6A 4KK3A 4K26A 4PLPA 4O5OA 4RV9A 3B3FA 1BXKA 2E5WA 1N4AA 3VSAA 4BRUA 3F2IA 3EIOA 2Y2UA 1CY2A 3MGCA 1R6DA 4M0KA 1DOHA 1ZA2A 1PQYA 2J4CA 1PL6A 1SK9A 3BRWA 1R12A 1XPJA 3H8SA 1GDHA 2XDYA 4OLHA 4R01A 1J2EA 3GNSA 4DA9A 4R84A 2JI4A 4B3MB 3EXAA 1CJKC 3RU9A 3HU3A 3WIUA 1JIQA 2P9JA 4JQYA 4KKXB 5JJLA 3O90A 1DUVG 3R75A 1XRLA 3ZWCA 4LWQA 2E1PA 4RZXA 4LDNA 1YJBA 2XNKA 4BP3A 3ZKAA 4E5UA 2YBEA 1THGA 1GSIA 1U3VA 2CGEA 3KYCB 5HQTA 1JLLB 4A0QA 2I3BA 3TZHA 4FR0A 1PLKA 4YJFA 1ECLA 1MX9A 3E7DA 3RC1A 1FPMA 3G0CA 1IG0A 3SC6A 2ASVA 1XDZA 3NCHA 4J7AA 4CL8A 3AG6A 1BDHA 2WTMA 4B2YA 1NMZA 3D6MA 2P5YA 4JVNA 3GD5A 3OU7A 2FRXA 2ILTA 1TJNA 4WK6A 4ALMA 3SF0A 1M8GA 1DJPA 2EFYA 4OHCA 3U49A 2XT9A 5FTJA 5C53B 1T1IA 2PN1A 4J4HA 1LWNA 4ZCLA 3LKBA 4M89A 1GEGA 2FMHA 1ZH6A 4QKQA 2I2WA 2HK6A 1JI0A 1DPGA 2PGNA 3BULA 1A96A 3G7SA 3QVVA 4FFRA 4J0KA 2NU6B 4AT1A 1UXGA 3CW8X 4KUGA 3WWEA 1BXGB 5LDDC 3CUWA 4CV0A 3UH0A 1GU7A 5A3VA 1BOFA 1PX0A 1I4TD 2DFLA 2ZSFA 2H48A 3QOWA 4B76A 5BV7A 1H0SA 2CLFB 4URHA 1O77A 1ZD1A 2Y66A 4ALNA 1TD1A 1WMBA 2GZ3A 3GT3A 4TYMA 3RSLA 4YMUA 3I6IA 1TU4A 4Y6PA 1V3UA 2XYRA 2OFXA 2SECE 1TJ3A 1YFKA 5CT4A 4CKBB 1QGOA 4E14A 1G9TA 3BIJA 3IV7A 3FF1A 2OD7A 2ZQYA 4RMNA 4L0QA 3W5HA 4ASUA 1M5RA 5KTOA 3H18A 1PE0A 3AUAA 4K2AA 4PLYA 1DC7A 1YZLA 1ZWKA 2FPRA 5CVEA 2VXYA 3A9SA 1JPJA 4UHJA 3B51X 5GINE 1UMCB 2DGDA 1RE1A 3L1IA 4GDMA 4JR0A 2G83A 2PD6A 2W70A 4DJEC 4BXOB 4BMSA 1MC1A 3G13A 4L4UA 1CUZA 1M6YA 3OTOB 1QHHA 3EQ9A 3KPUA 3ZCPA 2B1GA 2ID9A 1K0FA 4O59O 5L3RA 4R98A 4BKMA 2QYOA 1AXRA 4PNPA 5B37A 4C6HA 3GPLA 1YBAA 3K2BA 3F6PA 3R6DA 1VP9A 2EQAA 3K30A 1M1UA 4ZI3A 1KYTA 5JFGA 2IYRA 5HF6A 1Y6RA 3TZBA 3LXXA 1FTYA 3L9WA 4YV7A 1SIUA 1UC4B 2JFQA 2UAGA 3BD9A 3DL0A 3KT6A 4B9EA 2R85A 1YQUA 3C3YA 3JZFA 5K0SA 1G8MA 2X6TA 1IWBB 1L4KA 2YZNA 1O96A 1IUNA 2P0YA 3QVXA 2BGMA 4JUIA 5HUJA 5BYBA 3L0BA 3FYCA 4TZKA 1XYGA 3SE0A 4NE7A 3V4VB 3ZCSA 2JAOA 4X7MA 1FMCA 3OFSA 1VHJA 4RIGA 2QSZA 3X1JA 3R5JA 1L7EA 3MERA 1XQ1A 1EBFA 1PR9A 2ATEA 3GQBA 4L0MA 3DKVA 3MAJA 4A82A 3L7BA 5CDGA 5A5DA 4JKOA 3DV0B 1KSFX 2G4LA 1Y8AA 2IGTA 1HL3A 2X86A 3MAAC 2RHHA 4KXFB 2PWYA 3PB3A 1E7RA 4ND7A 1MW8X 3IP1A 3AONB 2HWYA 2CLOB 1TAGA 1GNQA 3KP1A 5KAPA 4ZZ1A 3IAHA 3L0OA 2BSAA 3GJYA 4KPYA 1KL7A 1P72A 1CRZA 1IU9A 1Z0SA 1K2VN 3LT4A 5ARDA 4P53A 3ZS9A 4FC7A 2NVUB 1N0HA 4AJPA 3BRCA 4BWVA 4URXR 3OQMA 2YBDA 3UJAA 4EG7A 1L4BA 2BMWA 2P79A 2AX3A 3HCFA 4O2AA 4PGFA 5FOWA 4QUEA 4TVKA 2XX3A 3H0CA 3NOOA 5SYAA 3ZCRA 1V71A 2OOKA 4CV1A 1Z39A 1JIJA 4COKA 4CIAA 3PXDA 2QLTA 3BPSA 4QC2A 1NR5A 3RS3A 6NULA 3W0LB 2R44A 3JWHA 4GGPA 2CVQA 4D1YA 2ZKLA 3BRWD 1FSZA 3E7PA 1P1IA 1EGHA 2PSFA 3OAAA 4XKJA 4ZYTA 5AW6A 4F3NA 5LMUB 4E4YA 5K3BA 3ZK8A 2H65A 3B9BA 4IIJF 3PJRA 4HXFB 4XRRA 1N5MA 1NXXA 1T5IA 3D0QA 3OIFA 1F8FA 1KJWA 2IVFA 3LGSA 3P2OA 1SXQA 4X20B 5D51S 4EHNA 3DZ8A 4TZ0A 1I2CA 2FEMA 3PRHA 3TL3A 1YJCA 1G42A 1BW9A 5A9TA 1GZ7A 3HZHA 3B6KA 1L1QA 5CUQA 1KIMA 6YASA 5JZSA 1TVEA 4RQBA 2OCDA 1JTFA 3QP9A 1H05A 1NSFA 5CVDA 2AR0A 5J4LA 3ENQA 2AUTA 2EVWX 5TMDA 2VSFA 4LK2A 5J58A 5DEOA 3R74A 2FR8C 4OSEA 3ZV7A 1DBRA 5A0FA 2IUTA 2IK8A 2Q21A 2XBUA 1X9GA 3M6MD 3UN1A 4AWAA 3I30X 4UBOA 2EXXA 1MAUA 4YXWA 5KQPA 1CERA 1E77A 1JZTA 1V0JA 1IMOA 3CLRC 3GH1A 4LOLA 3TL2A 4TVOA 2HJSA 1SHLA 4IDBA 1LBIA 2PMFA 2A0WA 4OAQA 2DUUA 1L1FA 3QV2A 4A5OA 1LS6A 4N0EA 3ZJUA 5JAZA 3NVDA 2QL7A 2CXSA 4R8VA 2B4KA 4IL5A 1YVEI 4OTZA 4AX8A 5LN1A 2W00A 3L6RA 2N1MA 1H5QA 1WCXA 4C30A 1DXYA 4IAOA 1TD9A 1WO8A 5JYCA 4BNFA 4BXOA 4TN5A 3WIDA 4OHRA 1NVEA 2H59A 5JSQA 2CLKB 1T3SA 2XOEA 4ZOCA 3CF4G 3NXKA 2Z09A 2O3SA 3GPDG 3QKSB 1I36A 4L57A 2X0EA 3T3HA 4W63A 4ASUD 4F3YA 1DMSA 2Q6OA 4HXEB 3VFDA 5C9ZA 3ZDAA 4QWMA 1YE8A 3HCCA 2AEMA 2J9YB 2RHGB 3F3SA 2VA8A 1ZX1A 3DDUA 3MJCA 1ISIA 5FNZA 5I3ZA 4MP3A 3V9PA 1GRNA 3NTXA 3G0HA 3CX8A 3L7DA 2H2HA 4WAUA 1DU4A 3A28A 3ZU5A 5BVGB 2ZJ5A 3NANA 4AJNA 5JMWA 1NTOA 4XYLA 4AG6A 4QU8A 2QXYA 3GI1A 3PQDA 3ZI4A 4X54A 5HEKA 5BSEA 3FPEA 1Y37A 2VDOB 1A72A 3UXEA 3D2LA 1OE0A 4Y7DA 1XZQA 1NJSA 3I2YX 3IMKA 4MO2A 3W77A 1MQSA 1CUWA 2QG6A 4DZTA 4MHTA 1PZXA 2OORC 4J3FA 5FTMA 4PN3A 4RKYA 4GUDA 4YJDA 3AVOA 3ICQB 2VPZA 2XQFA 1U0EA 1VHQA 3CUYA 3H3XA 4WKCA 4KAXA 3U6BA 5T57A 1H8HD 2C7QA 3QBTA 1BVHA 4RXMA 3IBFA 3LO5A 1PZMA 5J2TF 2B1IA 3DCYA 3QA3E 4DJTA 1RZUA 4HFNA 3LBAA 1ULHA 4ZRDA 1SXGA 4XVUA 3E82A 4RTNA 4GYWA 4KYIB 3CUUA 3LPAA 5CIQA 4TTPA 3EHEA 1PKEA 3HU1A 4NARA 3TDNA 3QRWA 1I14A 3H0KA 4DA8A 1E9EA 2K2WA 3HKEB 1JUDA 1Z63A 1A8PA 2R6HA 4BFZA 4ZZ3A 4LWZA 2BL4A 2CHFA 3LBNA 4MLZA 3I72A 2I80A 3LOQA 3BREA 4ARZA 5A4DA 4RMJA 3ENNA 4K46A 1CF2O 1FFDA 1FUUA 2I62A 4OB7A 2VKTA 1JMVA 3OKAA 1SPXA 1GTL1 3D4PA 2EL7A 3CZQA 4KXUA 3KWFA 5B55A 1NYRA 2HO5A 3ROKA 2A1UB 3EBLA 3NC1C 1P6XA 3ONNA 2ZYWX 4J07A 1EX1A 1EFLA 3WQQA 4DAEA 5ICSA 2J45A 3MEQA 1ZUIA 3FOEC 5THXA 2BDEA 2ON6A 4YMGA 1PT7A 2FW7A 3ELWA 4FYJA 4BHTA 3OAAD 2C59A 3PHHA 1XF9A 3P2MA 1Y89A 2BEUB 3FNGA 3PSAA 4RACA 4CQLB 5AI5A 2ZIXB 2CVFA 1QIJA 5H3HA 3OUUA 3R9KA 5FHRA 4R2XA 3UYLA 1H4TA 4Z9YA 3H2YA 5E9JA 2Q49A 2YHUA 2O9JA 4A5SA 4DJAA 1QAMA 1XWWA 3T9AA 3BXGA 3PRYA 4Q18A 3KYIB 3D3QA 4RQAA 1NKVA 3QMWA 2J9FB 3KR0A 1BGXT 1GPAA 1OZHA 3H99A 3H04A 4GOJA 3M6AA 1NC1A 3EDMA 4P80A 3GJ4A 1J8VA 2VFAA 4G1CA 4ZHSA 4BLOA 1JEOA 2AVNA 2J6HA 3PKIA 3P0HA 1F0PA 3ZCQA 4HEHA 2FEXA 3I1FA 4HVTA 5F2KA 4KQEA 4DE5A 4BC0A 3WA7A 3RAFC 4MQEA 1MOZA 3KJHA 4WL0A 4Y3UA 4C4ZA 4F84A 4WJLA 5D87A 3AI1A 5ITVA 4JKIA 4IH9A 3IMFA 2BKEA 3CQ9A 2YY6A 4YXWD 2ID4A 2C88A 5BMVB 3DLAA 4K6OA 1U8UA 1R0KA 2BRUC 4GP9A 2JLVA 2R79A 4XX0B 4YBRA 5DN9A 4RCZA 1WBDA 2GTHA 5FDFA 3PT9A 3BGIA 3ND6A 4FPXA 3MS7A 3MQ2A 5DW3A 3FMOB 1ZIPA 1NMQA 3G23A 1CZOA 1P61B 1TLLA 3DZCA 1AKTA 3H3FA 3HCNA 4RJLA 4OIFA 4RTRA 3QUSA 3HXKA 2G08A 3QKTA 4DWVA 2W42A 3RYFB 2B8WA 4MKFA 3RRXA 2VQ6A 5FPHA 4YJKA 3TTSA 4IDHA 5CDHA 3WDLA 3RJZA 3T1HB 2E6KA 1T9ZA 3QLUA 1P29A 2EFDB 3RTGA 2H7XA 1BU5A 1N4DA 1YKFA 3RUCA 1XPRA 3BCUA 1FPQA 3CKLA 1ZMBA 5EQJB 4ZANA 1C9KA 1RBMA 2J3LA 1G59A 3CNEA 4KBGA 5L53A 5K8IA 2QTLA 3HKDA 2C31A 5ILOA 2W7TA 4U2FA 2ZUVA 3F7NA 3VI4B 2G0TA 2QG4A 4BCDA 3AHFA 1Y4AE 1QFSA 4TWIA 2O8BA 1IY9A 2EW8A 5EGNA 2J3EA 2WZBA 1QPGA 2PZBA 4HDMB 4IIJA 3ND8A 3HS3A 4MRVA 3O6VA 3GVCA 1Q1GA 1N2JA 3MT0A 1M2OA 3LYUA 2VHJA 2P11A 4KEAA 3DR5A 1DEKA 1AXEA 3IEUA 2ZE8A 3HSSA 3IBYA 1GZ4A 4ZD6A 1RFGE 1DV2A 2BGLA 2P69A 5CYPA 5FBRB 1DCKA 1QH0A 3E5HA 2C5SA 4G09A 3EXG1 1TQDA 3IXQA 4F2HA 3RARA 2XNCA 3B6ZA 2C95A 5DYTA 4RD0A 1TJPB 3CKKA 5EIFA 2RGCA 5AW5A 4Y2YA 5HYVA 1L7XA 2HLHA 5LLTA 1G1AA 2RGYA 4MS4B 2AFIE 3VZSA 2FPLA 3UJHA 3QKRA 1G6HA 1KYQA 1THZA 1VIMA 3D0KA 3FCSB 4RY2A 4XM1A 5J59A 2EATA 3PVSA 4J1QA 3KQOA 2BR4A 3FVQA 3H4IA 1AVTA 2DFNA 4C21A 2HYIC 3HUEA 1ACJA 4Q4DA 2RHMA 1T8TA 1TFRA 1C30B 1ZM3A 2DAPA 2EG9A 1KK1A 1AS0A 2GHQA 1I3CA 3IOYA 1XRJA 3G2OA 2Q8QA 1TQ8A 3KYBA 4ZVTA 1RRPA 3TAUA 4BTEA 2Z6QA 3RT7A 2XOXA 3FNIA 3SGLA 3TDMA 3QUQA 2XZTA 1QVVA 2HADA 1YCFA 5CFLA 1YHNA 3AR2A 4ND3A 3BH0A 2VDLB 1MNAA 3PNKA 2FI1A 5ENDA 1RZVA 4JQSA 4UOQA 4XVQA 4GZ3A 1ANKA 1ZLXA 2XWBF 3I9JA 4FMCB 4IUYA 3WGMA 5DGTA 3T7IA 3TXAA 3F74A 3JVUA 4OQQA 4Q4AA 3Q41A 3GJ5A 1O94C 1YQDA 1CR6A 3QEKA 5CB4F 1CK4A 2GK3A 3T99A 1TF2A 3HWSA 3VQTA 1DELA 4BGEA 5BN4A 5A4FS 4OHFA 1G41A 2PZEA 2QX6A 4DDTA 1QKKA 2HSEA 4G0QA 1GAJA 2B61A 4K0RA 5IAGA 4ZYWA 1F1JA 2EC5A 1LK5A 4ZVLA 5DX0A 1NURA 2RIPA 2XB6A 4YFVA 5KREA 1ZP6A 2ZRNA 2A1TR 1K63A 2IOQA 2Q6KA 3OFVA 1K5PA 3OZBA 3S8EA 3MWFA 2KBEA 2VTKA 3A4YA 4EQ6B 4S3MA 2K5UA 3OSZA 3BGWA 3NBZC 1KVSA 3MFYA 2FLVA 4A2QA 3A31A 5HZGA 4I9NA 3UICA 4I8IA 4V1CI 2B21A 2V5VA 2Z98A 2I6QA 4HJRA 4UEOA 4EYGA 1VLZA 3LX4A 4D3YA 2WG0A 4YRNA 3JARB 4OSPA 4MAFA 3IP6A 3P9KA 4Z4QA 1E3WB 3IQXA 4DV2B 1SVWA 2GHTA 3K1JA 5EMLA 2WLTA 1Q44A 2FSUA 2V7VA 3PQEA 3EVDA 4HGOA 3UK1A 5KOHB 3IV9A 3DMHA 1ODKA 4JUAA 2YS6A 3CCFA 4I1RA 4MRPA 6CHYA 4PGGA 3NHFA 1P1CA 5J2TA 3HFSA 4G1FA 4F9GA 5A7HA 1OLUA 1R6VA 1XA3A 4L02A 4UU7A 5K9ZA 4NCAA 2Q0QA 3U4CA 4FKMA 3AOEA 3IIJA 2VJDA 1QTQA 3MM4A 1ZOSA 3CGGA 4Q12A 2E4WA 1C0IA 1H6CA 4ZEVA 3NORA 1PT8A 1SIWA 2Q5FA 5E7IA 3DPSA 1OH5A 2W93A 1J0XO 4HNRA 2F43A 5LNK6 3WGGA 4JLJA 2PUWA 3FPGA 2IELA 4RK0A 2C9DA 3HBNA 2WF6A 3N7AA 4DLPA 4FFWA 4P5EA 4F6RB 2NZ2A 1UDXA 5HJ2A 5I47A 4JOBA 5JS8A 3TBKA 5LXTF 1VLLA 2BGTA 1XTBA 2XMCA 3LKZA 5JCJA 2AW5A 4ZO9A 1JH8A 4BMZA 1OAAA 2IEGA 3C3EA 3R4VA 1AY0A 4GM0A 4UCWA 1CUVA 4S24A 4OD0A 4CJXA 4V0SA 1P4JA 4IMRA 1A4UA 1BA2A 2WHEA 3WZ2A 1DCMA 2FFJA 1CR2A 2NTJA 1JA0A 2P2SA 2XCQA 4PX3A 3MRSA 1EWVA 4XJXA 1A8QA 3HI6A 1TKAA 2XY4A 3R8XA 1E7QA 5JNVA 3T15A 1GXSA 5FO0A 5IBPA 2IV7A 3S2SA 1F06A 4CF4A 5B2FA 4AJOA 2O14A 4WLUA 5DYIA 2IU0A 3MT8A 5AUPB 3IUQA 5DWDA 1AKUA 5GADl 4LA4A 5HIIA 2Z2IA 4CR7A 1Y9ZA 2QHXA 5IHPA 4BRSA 4BKPA 2G9QA 4C2TA 5ERYA 3WK4A 5AKKA 3VU9B 2X1MA 3L7LA 4WN3A 1QZUA 1C30A 2GM5A 2H63A 4K6CA 4HZGA 5JALA 3IO5A 4RAOA 4RLSA 4OFZA 5A6SA 2TMYA 4RD2A 4CIBA 4W99A 2GCIA 1LPBB 2ZRHA 4F4JA 1XRMA 2H4HA 1NUAA 1WD5A 1U0FA 3HN6A 2QTGA 4F7WA 2IYSA 2GR9A 4KWEA 3BBPA 1ISGA 2IE0A 1QXSA 2QD2A 2VQSA 2PV0A 3CZMA 4PLTA 4RSRA 1L5HA 3AEQB 4BBJA 4EVIA 3GAAA 1ZLYA 2Z6AA 3U39A 1HMPA 4ZCSA 4TL9A 5F73A 5JXJA 2RAFA 4K7JA 4L9WA 4K3VA 3ORYA 5T41A 3TI9A 3AB8A 9ATCA 2CHQA 4WNYA 5B3JA 4FWBA 1LQUA 2BFFB 4L73A 1AV6A 2IPLA 2PRJA 3QLEA 5AHWA 3JQRA 3SNKA 1U7ZA 1YHZA 2QZSA 4Q1BA 1HY3A 4KLAA 5FT9A 1L5YA 4BVLA 1CLUA 1BVRA 4YAJA 5ICFA 1I0ZA 2GEDA 2YFKA 2OXFA 3TG8A 3QXHA 3K5IA 4RKRA 1P7PA 4I50F 3G2KA 4ABTA 1Z35A 4K9KA 1DBVO 3I04M 1GGMA 4D6PA 4H1VA 4E7PA 2FUKA 3K8YA 1ZVMA 5D7BA 4GDFA 2QX9A 1I3NA 1X74A 4CKEB 4KPEC 4ZZIA 3ASVA 2DBYA 5J40A 1IN4A 2CCJA 3EZ6A 4KXMA 3UJ7A 4C4XA 4C6SA 1SD1A 3O4HA 2CDAA 1SVMA 3UJCA 5EMNA 4UM9D 4INJA 2WIAA 3EY9A 1BSVA 1U7OA 2B69A 2IBTA 3QG1A 2OCYC 4EOGA 3NETA 2X4LA 4CFZA 5BQOA 2EW2A 2G04A 2G4VA 3ORQA 2NSLA 1L5SA 2PO5A 3UCEA 3BMNA 1RWBA 2LKDA 1XV5A 3V4ZA 1XN4A 2E5FA 2DFTA 4FHZA 2V55B 4OHYA 3H7IA 4KO2S 4QFMA 2IU4A 1Q3TA 2UUPA 4RORA 5HA5A 4M1MA 3GK3A 4GX5A 3STVA 3WIOA 2CLIB 2JBAB 2RHJA 5TRTA 5KJEA 4XPZA 3WFJA 1SC9A 2X76A 3C3WA 4J43A 5B3LA 2OXIA 1RJWA 1YWGO 3KZKA 4WLVA 4FYXA 1B1AA 1KBZA 3B78A 1A7JA 1R2QA 1UBSB 3JAKA 4NTZA 4AUKA 3H9BA 3FVTA 1EUCB 1C8VB 4Z0HO 3MTAA 4D5EA 4DG5A 3KWLA 4D4JA 1HE5A 4AQ7A 3ZWPA 3AEKA 1EQUA 1FUIA 3FA2A 3GROA 1W30A 1IXRC 2KS6A 2YFHA 4RF4A 1NVUQ 3P9RA 1M5UA 3ZKWA 2D0OB 4JJ4A 1FB5A 1N25A 3D2AA 2QYHA 2GBPA 3MJEA 1LS1A 2JFGA 2PLAA 3HDHA 3NEAA 3PVZA 2OBMA 3T0GA 1UDCA 5A62A 1PUIA 5KC9A 2BFEB 2JBWA 4KUHA 3BJEA 4WKGA 4DR4B 1JDTA 1AB6A 4GRDA 1GA1A 4W1PA 4R3UC 3ZNNA 2UYYA 3PUVA 4RZHA 3LBHA 4W5JA 2Z8XA 2CFTA 4RWEA 1RD4A 1AHPA 5F9HA 2CZQA 4QU9A 1NSTA 1ZK1A 1A2OA 3JQ9A 2OHHA 3P9CA 5JCJD 5KQGA 3AY7A 1N2IA 4F06A 1MUUA 3S7TA 2FW0A 3RTDA 4KU4A 3T7DA 5CB4A 4DLTA 4FEYA 1GRQA 1XZPA 1OH8A 3BWBA 4QOEA 3VI3B 2X5OA 3WO0A 3FZGA 2R48A 4J91A 4MQUA 4QOSA 1GTG1 1LK0A 2H08A 4IHJF 2UVPA 1TA0A 3RROA 3CS3A 4I7EA 4M7WA 1H6DA 3PWSA 2XQIA 1FCJA 1W581 4MMXB 2FRDC 4ED9A 3M89A 4I50B 3TBHA 1Z0IA 3GXBA 5F51A 4FB5A 2O7QA 3H2KA 1QO7A 4RHYA 3T5TA 3LY9A 4GKJB 3UMJA 5CB6A 1EGAA 1TM4E 4OGGA 1OB5A 2J0QA 1L8OA 2OD9A 5AVXA 1WZCA 4AWXA 1E2QA 3O2SB 2ZU0C 3OLCX 5EESA 1G5FA 3I53A 3UOWA 2GXQA 4KBYA 3V33A 3PUWA 3D4NA 1OZ0A 4LSMA 1G5PA 1P60A 2QT0A 4BCCA 3HDYA 1HOTA 3HCWA 3LRTA 1SZCA 3NWOA 3DOJA 2HWUA 2HCFA 3KDSE 3PU6A 4XCXA 1ES9A 2FPUA 3E4DA 4MYUA 4B17A 4BNTA 1F3LA 3IAUA 4O1MA 1RXWA 4DXHA 4B4DA 4O33A 4YRGA 2ODQA 4YV1A 4W6ZA 2I3DA 1EFVB 3BTSA 1EM8B 1IFXA 1SCJA 5DHFA 3UIEA 2NT3A 4AZSA 2AW3A 3P9NA 1JG4A 1RXYA 3L93A 1GAXA 4G4GA 2VDWB 4QPDA 2UZAA 1QIIA 2RAVA 4RY8A 4H77A 2WVHA 1VMKA 3O2QB 3SAJA 3N39C 1B00A 4ZEWA 2P67A 5DTQA 4FDVA 4CKEA 4EF5A 1Z82A 2XV1A 3HRIA 1IM2A 1XALA 1XR3A 4LY6A 5E8JA 4C3UA 3GLGB 3RIEA 3D7RA 1E1LA 2R66A 4NCXA 3TRDA 5TJ9A 4B7ZA 5LXTA 4FDUA 5HKAA 4BP1A 3C5HA 3EQ7A 4WT7A 1JHVA 1R0CA 1FQJA 4B6GA 5EPOA 4EF4A 4Z4HA 1JKFA 3PNQA 2GDJA 1BMTA 1EE2A 1QP4A 4KOAA 1J0CA 4LAFA 2YRWA 4MI6A 5FLKA 1EXDA 3UW3A 4F9TA 2JPDA 1KI2A 2JKYA 3C6KA 3ZE8A 1PGJA 2QSJA 3KVYA 4M1YA 3A7EA 3IPRA 4LOJA 1M6EX 1Z6QA 5CTJA 4UUNA 4BFLA 4EK9A 1WX1A 2Q8PA 4NU5A 5TPWA 5IKMA 2YMQA 1GR0A 3L7AA 3QLVA 2C94A 5FTLA 4RKEA 1IHPA 1VL2A 2CVOA 1JWLA 1JQ5A 1AKEA 2B1RA 2GA8A 1WHSB 1EZ1A 3TSOA 2HJ9A 3F5FA 2JIQA 3I5AA 3ITKA 3FOAA 1ORTA 3NRBA 4HBGA 4JLPA