1P9OA

Crystal structure of phosphopantothenoylcysteine synthetase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
290
structure length
269
Chain Sequence
RWAEVMARFAARLGAQGRRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFPPQTWLSALRPSGPLSGLLSLEAEENALPGFAEALRSYQEAAAAGTFLVVEFTTLADYLHLLQAAAQALNPLGPSAMFYLAAAVSDFYVPPLQITMKMVPKLLSPLVKDWAPKAFIISFKLETDPAIVINRARKALEIYQHQVVVANIFVLIVTKDSETKLLLSEEEIEKGVEIEEKIVDNLQSRHTAFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantothenoylcysteine synthetase
publication title Structure of human phosphopantothenoylcysteine synthetase at 2.3 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 84
structure length 269
sequence length 290
chains with identical sequence B
ec nomenclature ec 6.3.2.5: Phosphopantothenate--cysteine ligase (CTP).
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04127 DFP DNA / pantothenate metabolism flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CoaB-like 1p9oA00
1P9OA 1U7UA 5INTA 4QJIA 1U7WA 2GK4A 1U7ZA 1U80A
chains in the Genus database with same CATH superfamily
3FJOA 2E4YA 5E4FA 1OB2A 1CR4A 1P3DA 4DV6B 2C3YA 1J1UA 4ZZ1A 1LNQA 1WQ4A 4W6ZA 3THWA 3LPMA 4EUHA 3IVAA 1DRUA 4PTZA 1NGSA 1ZKMA 4G5SA 1IB6A 3KKOA 1GFIA 4ZCRA 1NI4B 3C5VA 3I3OA 4Y9UA 3DVAA 4F9GA 2FSUA 2B8JA 2HRQA 4UFOA 1E9EA 2PUWA 3NOXA 1B2RA 4CFZA 2EKQA 2PL3A 1DFIA 1Y7IA 1HNZB 1TU0A 3IP5A 4M9XA 5BMVA 4C20A 3RDPA 4CT0A 5BV1A 2AOTA 1BQEA 2O9JA 4FN5A 2OGSA 5K3FA 3V8PA 4GP9A 2OCXA 3NUZA 4PZZA 1QDUA 1R5OA 3URMA 4ZQBA 2H2FA 4ZV4A 3R74A 3GRVA 3IHWA 3I6IA 1PFGA 4R6WA 1U0RA 1XDBA 3DBRA 1PHPA 1QE5A 2H1OA 1WUTA 4BB6A 3JD4A 2F3SA 3VNBA 1JLMA 1RS0A 3DWGA 5KWJA 3L0CA 1NJSA 5ALRA 4AMBA 1G8HA 2BGJA 1XC7A 1R6AA 1OX5A 3N7AA 5LMCA 1URPA 1TPZA 1XMXA 2XYQA 5KNBA 5ELMA 3QITA 1Y1QA 1EQAA 4UHEA 1IVNA 4AG5A 4TXHA 3IB3A 1KA9H 3O82A 3F6PA 2PRSA 1DIGA 4JL8A 1JI3A 2PUGA 4PZ0A 5E6UA 4W6QA 3WGYA 3HWSA 4CGZA 4MWTA 1KI3A 1WXGA 2BONA 2WVHA 3U5TA 3OD5A 4JQCA 4R05A 5LOVA 5K20A 4HQ6A 4X24A 2YHBA 4QTYA 1O89A 4IY1A 3HH8A 2I71A 2FX2A 2VK1A 4EOGA 1VIDA 2BMAA 4JXJA 1FX0A 3T06B 1ZLYA 4QRIA 4PZAA 2FN4A 4RZHA 4K5QA 1SY7A 3PIRA 2SECE 3WLLA 1RRGA 3HO8A 5BUZA 1M2KA 1VBFA 1DAEA 4UEWA 2LCFA 4IYRA 2A0WA 4IEEA 2YJ5A 3HB0A 2RG1A 3NM6B 1I2AA 1E3WA 3BF8A 2OA0A 4CMIA 1XO1A 2BFEA 3CRMA 3E8MA 2I4LA 1MHPA 2WB4A 3BB4A 3NFRA 3H2GA 3OU7A 4CVNA 3FOAA 2A4MA 3ZDRA 4HAYA 1RXYA 3JQ8B 1GVNB 2BPOA 2X7HA 3LUBA 4HNAA 4RV9A 1NXPA 2GQ0A 3G5UA 4ZQHA 5GV8A 3EPHA 1NRJB 4XSVA 4BJHB 3ADBA 5EPOA 1P6QA 2BTEA 1IHPA 3WY9A 3H11A 5FBWB 2X3UA 2JZCA 4XLLA 4G1UC 2Z2IA 1TCUA 1PKXA 5TRTA 4UBKA 4BNDB 3CLRC 4IQFA 3WADA 2WVJA 1RJWA 1X1SA 3MM4A 4KWCA 5C80A 3GLKA 3IE1A 1IBKB 5BR1A 3I76A 3WZMA 1M34B 2N46A 3LCMA 4HFJA 1NE2A 4M1WA 1MF7A 3JSAA 1U2PA 3A4IA 4TMWA 1UKVY 3UFBA 5L3VA 1LDEA 1OX4A 3JWIA 4NULA 4QQKA 5TS2A 1LX7A 3T7RA 3GN2A 4LHVA 3WIVA 4ZHQA 3K70D 3KT0A 1RWWA 5EGNA 3DL4A 2NUAB 5KX5B 1GFSA 5PGMA 5HIKA 4GKJB 3C8MA 1SGWA 2I6UA 4JKIA 1LDGA 1WKCA 1Z82A 1Y1LA 1UZAA 1I2MA 1FE8A 1O3YA 2GN6A 3EIWA 3M82A 3IMKA 3DNMA 2V1XA 2QK4A 3IT1A 4LVNA 3WFIA 1AT1A 5LQRA 5IYZF 2AK3A 4C6TB 6NULA 5MDHA 2BGUA 2HLDA 5SY6A 4JAVC 1NR7A 3R5FA 5E6RB 1N2IA 5T41A 4KO1S 3OTOB 4KQ1A 2W0MA 3UFXA 4QBFA 3LRPA 3T1VA 3PWSA 2QVYX 1GNLA 4NCXA 1OFGA 3LBAA 1EUZA 2H52A 2P5UA 2ZR8A 4FOPA 3W7VA 1RU3A 4TPKA 4CUZA 2PD4A 1AS3A 1FBTA 2EFDB 3P9RA 4XVUA 4MX8A 4HP8A 5IW8A 5HMMA 2NVUA 2GA9A 1K6XA 4TV8A 4EZBA 4ZN6A 2WHPA 5LQDA 4RFVA 3FHLA 3TOCA 1QK3A 1R88A 3KLMX 4BGIA 4DCCA 4IUDS 3G8YA 2WYWA 1N5LA 3TNJA 2CVHA 1JR3D 1H5NA 1QHXA 4D4KA 3DV2A 4Q1AA 2QOEA 3WRVA 1L8AA 3C6MA 1K88A 4KK3A 1B15A 4DB4A 4XD7A 3GA5A 4UAUA 4IXMA 3IS3A 5GVRA 1XTVA 2EJBA 1OTXA 3JAWB 1DINA 3H87A 2IZOA 3VUEA 4Q05A 4HVCA 5DNAA 1MC1A 4ML3A 3EWSA 1HK7A 4AP6A 3G5LA 1Q0TA 1KZ7B 1S4QA 3E7DA 4XR9A 1FU8A 4BU1A 3MLAA 4HH3C 4L07A 4DCOA 3L8ZA 221PA 3ORSA 4P2GA 2CXXA 3KWFA 4GYKA 4KLNA 2XV1A 3CZAA 3K2EA 3AVPA 2RFLA 1EHYA 1DADA 4WH0A 3VPBA 4FSDA 4A6DA 3MILA 4FNMA 4M46A 4AJJA 3IDQA 3I6MA 3RRBA 4EVQA 5T3UA 1DDIA 4MMYB 3P2JA 4CKXA 3K20A 1SHUX 1FP7A 3RHTA 4JJEA 1M1YA 1Q50A 3I5UA 1WZCA 4II7A 2RGUA 1XTZA 4LEIA 5L6LB 1RP1A 1ZXBA 4LWZA 3RYIB 3KCNA 5CPFA 2VTVA 2C61A 2JNWA 1TLTA 3ICEA 3LVQE 2MSDB 1CRLA 4QLOA 3KUXA 1XP5A 2E9SA 3UGKA 3OH8A 5KQLA 1QIJA 3V4VB 1PFUA 1CQPA 2Q8NA 1K4YA 2R9VA 2IUTA 3N74A 4GMGA 1OIXA 1X7WB 1G8MA 2BFOA 2FWBA 2J59A 2YRFA 5IS2A 1CDDA 3AEUA 2PL5A 2H9AA 4U2KA 4D8TA 4K1XA 2O1WA 4I1OA 1YRHA 4C7OB 1W2WB 1GCGA 3BB1A 2O5RA 1JEAA 3DB1A 3KVYA 2B69A 5ETJA 1XGKA 4R5MA 1NBME 4GH5A 2Y4NA 1TO1E 3FFTA 1UC5B 1K7EB 3GQVA 4YQZA 1XAGA 4EH1A 4EMTA 1VRCA 5K4HA 2UVPA 1T2DA 1QB7A 5A5DA 3D1JA 1OVGA 1CUBA 2Y05A 2YYAA 3MSCA 2OZLB 4ITVA 1C7FA 3H0EA 3F4LA 5IAJA 4DY6A 2IOQA 1WPXA 2FPRA 5D87A 5EP1A 5HFNA 4QHYA 2P9TA 4EJSB 1W44A 1KDYA 3D3JA 4ZANA 2EHDA 4P5EA 3V80A 3WYEA 4RPIA 1WPRA 5HWSA 2P9QA 5FT9A 2YHSA 3MN1A 4R9NA 4B3CA 2AOVA 2W7TA 3C24A 2VHVA 1RXWA 3IUBA 3MJFA 2ZE5A 1XI2A 1WQ1R 1NW8A 4YXWA 3KXIA 5DWQA 2ANBA 3B3FA 3VUFA 4PAQA 2HMVA 3WL5A 1QU2A 2NTYC 3CF4G 3OKPA 3O8BA 3MOGA 2QP4A 4FFBB 1Z25A 2VNAA 3REOA 2FZ4A 4D3FA 3DBIA 2VLIA 1X1CA 1DQYA 2R8EA 4DCVA 3T9FA 3RYFB 2PKCA 1IXZA 1UXJA 2X42A 3H1GA 5E2AA 2P62A 4C89A 1HO3A 2BM0A 1NVUQ 2KWIA 1E79A 2BEUA 3I34X 3PT9A 2H4JA 2X0FA 1X77A 5BQ3A 2G7ZA 3DMFA 2ASEA 2HPHA 2AEEA 3WISA 3WV4A 2C31A 3NYRA 2ONJA 4HMPA 3BWXA 3I4FA 1KKLA 4FMCB 4RXMA 4EMUA 2V5VA 2W9XA 4JC0A 5T4EA 4MWEA 2WJHA 1DKRA 2V8OA 3H1PA 3FPFA 4MQ6A 4I1UA 5DVZA 4KJZA 1L5SA 4BAUA 1DVRA 5L4SA 4PRZA 2JFVA 2VJYA 3IQFA 4EYEA 1DI0A 4ESEA 3T7DA 2REOA 5DBFA 4KI0A 2RGNA 4JLOA 3PLRA 5AWFC 2HZBA 1NIPA 1KZ6A 2P65A 3L7LA 5JXHA 5AW6A 1XKQA 4DRZA 5DYYA 1DWUA 1N2EA 1GEGA 4B73A 2GN0A 1JQ5A 2IIVA 2YJZA 2IW1A 4MWSA 4LJYA 2E49A 1WU7A 2FWPA 2W98A 4J0CA 3F8TA 3LFHA 3DOIA 4DILA 1JH9A 2JFNA 3L5OA 2BZ1A 1OGYA 1EBUA 1T5HX 1M0TA 2C29D 1T8WA 1CT9A 1TE2A 1U8EA 3EIQA 2P4EA 3QVUA 4CDRA 121PA 1JR4A 8GPBA 4RVHA 4UQLA 5LCXA 2EQ5A 3IO3A 2IUYA 1E4EA 4ZVVA 4E08A 5U1PA 2ZWAA 2Y9MB 4CYMA 1KVUA 2BN4A 3RTBA 1P44A 2XKAA 5FCDA 2YZ2A 5I9BA 2J9YB 5SZHB 3K5HA 3TPFA 3ZU3A 3F5DA 3GLQA 3UWOA 5I4CA 1VMEA 3K32A 3UN1A 2EJTA 4I4CA 3JQ9A 4HRVA 3I2YX 1L1FA 1ZGAA 2WDZA 3ZEIA 3U7IA 3LDFA 2GAIA 3ROKA 5EJ5A 4G0VA 4ND7A 3VDMA 4WCFB 1TM5E 2I3ZA 4URYR 3CHYA 4AY4A 3U60B 4DC9A 3QFRA 3X2FA 3DLIA 1S8AA 2VTEA 3RTDA 1EEXB 2GN9A 3Q1KA 3R2JA 4L27A 3S2FA 1T4DA 3EGEA 3TZ6A 3WWZA 5CYGA 4XWAA 1E2JA 3EUAA 3VKVA 1NYQA 3OQ1A 2RGEA 2P91A 1DUIA 3IL2A 1QG0A 2GKOA 2H9YA 3D6AA 1T6BY 4HDKA 4KHZA 4Y7DA 1I0IA 4NAVA 4NOLA 2Y0DA 5EMKA 4NHEA 1WCYA 1YKGA 2BKEA 3PEWA 1ONOA 3GJXC 5DMXA 2O07A 3KZXA 3P7MA 3UTCA 2A9PA 3BT7A 4LJLA 1E2LA 5JWOA 1PG5A 1GNPA 3CKMA 1LTQA 4N5LA 3BL8A 5JRZA 3K9LA 3F6BX 5I6DA 4DMFA 3JPWA 1D2CA 1W2HA 1TJNA 2FSSA 4AY2A 2ZJ7A 1XVTA 2H1RA 2EFHB 2QE7A 2XMSA 2BRUA 2IC5A 5FJIA 1X7XA 4F38A 4J07A 1YH3A 1XAHA 4GGMX 4RPGA 3WO1A 4J1NA 4FONA 2JL1A 1XN1A 4QDXA 3BZWA 1NP3A 1L5QA 2QRQA 2XIQA 3ZCQA 5AJZA 5H59A 4F3YA 1X1QA 1W36D 4M8NE 2ZETA 1JDZA 1NBAA 3S29A 3QKIA 4HNSA 2QRNA 5PNTA 3TR0A 1BEZA 3MEQA 3KZMA 4HMOA 1DIBA 1QQTA 1Z74A 2PKQO 3FFXA 3MS2A 4LBYA 5EWLB 5C3UA 1YRWA 5A7HA 3STWA 1CUSA 3K70B 3JD3A 1VKOA 3R5KA 3NETA 1KJYA 4UAGA 3V8MA 3ON5A 4MVJD 5HGJA 3GCZA 1GPYA 1SEPA 3QFCA 1V43A 2PEZA 4FD3A 1QOPB 1MB3A 4A2QA 1CERA 4OHCA 3NNDA 4F11A 2JLAA 1ESEA 3Q8XB 5FLEX 3ZWVA 3FMFA 1XTUA 2XNDA 2DHCA 2F4NA 2YUIA 2Z30A 3MJEA 4FW9A 2YL2A 2IZ7A 1BMFA 3THRA 4AF7A 1KR2A 2FQYA 4ARSA 3FYHA 5HKKD 3BF7A 5F73A 3VOBA 3TQQA 1Q2UA 2XMBA 5GV7A 2WDPA 5HZGA 4ZT3A 2HMWA 1SUBA 1M2HA 1U0SY 1XXHE 2GARA 2PQ6A 1FP6A 3COYA 3EFOA 1SVUA 1XCGB 3DBOB 5LZ8A 1Q7EA 3DHYA 4YCCA 1XQ1A 2ZREA 4HYYA 4J4TA 2QZ9A 3BMCB 4FFVA 4CW7A 4PZDA 1G3QA 3E81A 3CVUA 1T9DA 1E5DA 4QEKA 1XRJA 2E5FA 4MITA 1TJ4A 2I4OA 1E6EA 4GZ5A 2QGFA 2Z0MA 2ZDHA 4R9VA 1XTQA 1YJQA 2PYIA 4RORA 4KDFA 5H1YA 2HJRA 2Q45A 421PA 1ZD2P 2XF8A 4BNUA 4CM4B 3W1EA 5B57C 1JMKC 3CE6A 1PTJA 1E8DA 1GGEA 2KLBA 2O7NA 3T3GA 1HDRA 5DX1A 2X2PA 1Z2OX 3ZQ4A 4F1KA 2QPAA 4KQ2A 4DMGA 3EVDA 1KORA 4MVJH 3LRXA 1NC3A 3NOOA 1DRKA 2O2SA 3UF0A 4B8ZA 3B3AA 1XJWA 4OGLA 2QVBA 4TTSA 2H3EA 1VGRA 4ZAVA 2C7GA 2CXRA 1EU1A 1HY3A 2J7PA 5JQGA 3L9XA 1F48A 1SG9A 5JH7F 3EG9A 1N78A 1NN3A 1J8QA 5JWHA 2GLTA 4Y9SA 4PPNA 3F7NA 1QPZA 4HATA 4IJ6A 4EPYA 3O3MB 5C5DA 2ZU0C 3CZQA 1ODJA 4NFHA 3TOZA 3TQIA 1MH1A 4RTMA 4K9DA 2JDID 1G4HA 5KBYA 3VR6A 2FZ5A 4KPUA 1HNNA 3N75A 2G9NA 3IUEA 4PY2A 1T4CA 2BVNA 3FG9A 3PYLA 4P8RA 1E6LA 1N9GB 2UXCB 5CA1A 5TARA 3RAPR 4XQEA 2QHXA 1XPOA 4ODIA 3KL4A 4A36A 3AHJA 3EXG2 1V1MB 4KNVA 2GJ9A 2V6IA 3SZUA 2FW0A 4IMJB 4EYKA 2PJZA 1PZMA 1KK3A 4CLDA 3AHHA 4YRJA 1WHSB 3SY8A 2JAHA 4RD1A 4MUIA 2C4UA 5THXA 1OT5A 4Y0NA 2W6ID 2WF5A 3QBJA 2CJXA 2I78A 1LVHA 1US8B 1NXTA 4ENVA 2DLCX 3TR6A 4L0MA 1V2GA 3T4EA 2HWUA 3ORQA 5T4FA 4HTFA 3OZRA 3K9WA 4OOFA 1M1NA 3F0TA 3PFFA 4OLBA 1ELOA 3EXAA 4LV5B 3DPSA 2CDRA 3N0VA 5K01A 1JF8A 1L8QA 1CUZA 4WBNA 2V4UA 3KT6A 2WB2A 1UWVA 1HE5A 2W6JA 2AV6A 1B6TA 1FMLA 1PVOA 2DWPA 4MVJG 4DC1A 2R7AA 4QXAA 1YKSA 2JLZA 2GJKA 5C8YB 3O90A 5JAIA 3CQ9A 1KE2A 4GEKA 1E62A 2H1WA 2HQBA 3GGSA 1VL5A 4HEQA 3SR3A 4E03A 3EVTA 2FZGA 4ZEXA 5F2OA 2AFIB 3LYHA 4MV8A 4INJA 4WFKA 4EARA 4JI4B 2FN3A 3ZWYA 4TXMA 4RY2A 3COVA 2J6BA 4G36A 1MCZA 2VF5X 3FRJA 3S2IA 4D79A 4HGNA 3TUIC 1AGXA 3DDUA 2BUAA 2V7PA 3JARB 5IH3A 1PEYA 5HA5A 5JPCA 2AG5A 2PTGA 3KSUA 3RU3A 3VR3D 4FDVA 4LWPA 5BOVA 3GFPA 2WRZA 3RAGA 1Q1QA 2E85A 5CGZA 3IQGX 1S1CA 1POWA 1YZGA 3SFVA 3TX6A 4ADSG 3R8FA 4Y6OA 1GTZA 2QTZA 3AJEA 4PEVA 4F7WA 3ILHA 5KNLA 2D1QA 3KEFA 4RLFA 1OBHA 4XOIA 1HURA 5CCDA 3ZVLA 2YJTD 7ABPA 1J0CA 4LRUA 2I1VB 4HQ0A 4WK0B 3OLVA 4Z2AA 1J2YA 1SD2A 4IKEA 2W8BA 1PZEA 1NKTA 1Y1TA 4QOJA 1ND6A 3RJ5A 5AVRA 3N0TA 4MLCA 3DMHA 4U2BA 1Q7RA 3B6MA 1TTQB 1DRVA 1TZBA 2A2ZA 4MB2A 4XPIA 3K9FC 2ENWA 1F0NA 1U7OA 3TF5A 3HADA 1EFUA 3LO5A 2V3VA 1Z6QA 1MAVA 4G0ZA 5ULLA 4LRXA 1XNHA 4PAWA 3OJWA 5AKIA 5BN5A 4CV1A 3DA8A 1JHRA 4QL3A 1T6ZA 4BUZA 3BX1A 1X7DA 1I13A 2ISQA 2RGBA 3A9CA 3T1YB 2HHAA 3AZOA 5AK6A 1PWZA 3D3QA 3QGMA 1NFQA 2EARA 4IHJA 4UDXX 1ZN2A 2BGNA 4FFNA 4AP9A 4KNYA 1PGJA 4JX9A 4O0LA 1O97D 2PIAA 3ROGA 2AKEA 3V4SA 1F2DA 1Y6JA 2P7HA 5CK4A 4RLQA 1L5NA 3ONVA 3ZI4A 3CIOA 4HGRA 1XEAA 5KJ1A 4LN1A 4YALA 5ICFA 5COBA 1DUSA 1YI8A 1ORRA 1ZC4A 3OC0A 4FB4A 4NI5A 4RZUA 5ESXA 1IAVA 1P0PA 1AHHA 4FHZA 4TMVA 5B6JA 1Q74A 1BFDA 1ZFNA 3CT6A 1DFGA 3BFVA 3NH6A 4HX2A 1PAUA 1VKJA 2AIRA 4WNCA 5DGIA 3VPAA 2JG3A 1M6WA 1XNRB 4F21A 5DM0A 2WIGA 4IFBA 5JDCC 4CKYA 3ZHOA 4J76A 2D74A 3HBNA 3OTGA 4DKXA 3K92A 4NE7A 1PR4A 3DBLA 4IZHA 4Q18A 3NEJA 2JLQA 3EA5A 1CP2A 1F5NA 2ZAOA 4OX9B 2ZSHA 2IEYA 3QFTA 1ZGHA 2O50A 1MPXA 3HFJA 4CMGA 2CE7A 5JZ9A 1Q6YA 2ADFA 2UXBB 1VPDA 5KWVA 3T3PB 1B6RA 2EBFX 4I46A 2VP5A 1HDIA 5B2EA 1CQXA 2I6GA 3FSJX 1L3IA 2VHEA 2AHRA 3WWEA 1Q20A 4P9NA 4WNYA 1Z0AA 4EEKA 1JR6A 1QO9A 3G5MA 3PE6A 2GZ1A 3PF8A 2OC9A 1QTIA 1I3OA 3RGWS 4PO3X 2IDKA 2RSLA 1R16A 1VKHA 4AF8A 2FXIA 5IC4A 4OBXA 3CVXA 4B4OA 3E58A 1FTSA 1ID1A 1J21A 3FJ1A 4QXQA 5KYWA 3PXBA 4MS4B 1GAJA 2Y9PB 2AWNA 4HZUA 1UMBB 1RYBA 5CB4B 1ISFA 2ACEA 1T34A 1U6IA 4G5XA 4IGEA 1N6LA 4FIZA 4MI6A 1JZSA 1Z0DA 3DO8A 4URUR 4WERA 1RVV1 1L7NA 3LSYA 3OSZA 1KEPA 3T15A 3IODA 2W70A 4G26A 5BT8A 4PR0A 1ITZA 1W36B 4BLTA 3FA2A 3HJTA 1WUKS 1FPQA 4F2HA 3QVGA 1R64A 5T57A 2P9CA 5JD3A 4IMPA 1BRMA 5M5BA 4K6FA 3PD7A 5KC9A 3EZNA 4E3ZA 4PX9A 4LJRA 4W1PA 1JDSA 5LQUA 1G3MA 1ULHA 1PGNA 4RAQA 4EPTA 1YS6A 1UXKA 2XUJA 4QYTA 1ENZA 4ERXA 3NS7A 3ZBUA 5D01A 1GPLA 3A4NA 3ISJA 3K8ZA 1V47A 3O9ZA 5F76A 3ROZA 4R98A 1BTOA 5HCIA 4UM7A 1BXGA 1Z08A 4NJEA 3ESQA 1KZ9A 3K5PA 5DH9A 3H1AA 3R9IA 4ALIA 5HZMA 1P91A 2YZMA 2WTBA 1P1JA 1WB4A 2XZOA 1WPGA 4UPVA 2NO1A 3K0CC 3VNSA 1SKYE 4EA6A 1IY8A 1IQUA 5K0EA 2C83A 1BKYA 3EFEA 2MT9A 4LHWA 5C34B 1C8VB 3HO6A 1ZSYA 2XH8A 4QNRA 2V0NA 3VAYA 3WHKA 4JYAB 3P9QA 1KDZA 4N48A 3WLQA 3D1LA 5DBHX 1EXNA 2J41A 1E18A 1YVEI 1DJLA 2ODQA 1MR3F 4YMSA 2GFHA 3I6BA 4ZVQA 3UT0A 3ZHYA 1XTJA 3AB3A 3LLMA 3WMWA 4G2TA 4CT5A 4EJMA 4KWIA 1BJKA 3AOGA 4EG1A 3H5RA 1B4DA 3AFIA 4MUJA 1Z2AA 1E7YA 3K96A 5I7RA 2A84A 3PRKE 4D99A 3D6NB 1R8SA 2GTHA 1V45E 1BQ3A 1QS0A 1MO4A 3OKAA 3VHXA 5WRFA 3T95A 1WMBA 4EKYA 2AE1A 3NWJA 4EECA 4HFMA 2X86A 2VP0A 2ZBDA 3ILYA 4X71A 1XE3A 1FUYB 2Q1YA 5G4KA 2IOHA 3LPLA 2CB0A 4KN5A 3LTNC 1K5DA 1FP4A 3DZBA 5EE0A 3EJ6A 1CBUA 2XVYA 1A8QA 1MNAA 1MB4A 4KMSA 4UVDA 1U2TA 3QKRB 3UMCA 1U2EA 5KHLB 3AFNA 1CY2A 2IU4A 3B13B 2WMOB 4W5OA 2AI2A 5BVGA 2Q7OE 1K92A 3ROTA 1TMGE 2ID4A 3L7MA 3SQMA 4D5EA 3V1UA 4YO8A 2R00C 4YV0A 1Y0BA 3P2MA 4IRMA 4MR7A 4IH9A 2ODWA 3WLFA 2QMHA 2B1QA 3RSQA 4LSZA 4R1QA 4AN1A 1RKBA 1W35A 5A9TA 2E6KA 1GZSA 3YASA 4WD3A 3ZV4A 2JLUA 4I9HA 2JZOA 2HSJA 3GR6A 2WAOA 1ZIDA 3HSYA 3HZOA 2JHAA 3L7KA 3SQNA 1XVIA 1VL8A 4KFSA 4NENB 4QSMA 4QASA 1LZLA 1PD0A 1YR7A 3VMMA 2NU7B 4C4XA 1JWLA 1EG2A 2X2FA 5J4VA 1R0XA 1BFKA 4BFUA 5IX8A 2B6NA 2ZRBA 4RDHA 2R48A 2UVQA 5LA6A 4OI2A 4RHUA 3SGLA 5HPYB 1FVXA 2OBLA 4Q3CA 5BR8B 1CR1A 2XCLA 5KOJB 1VP9A 3IOEA 4AUMA 3NWOA 1PJLA 3W7AA 3P4UA 4YUWA 4MARA 4S35A 1WZEA 1QBKC 1R8XA 1JBQA 1XTBA 3SJBA 2L0XA 1NJ6A 2H31A 4HNRA 4XEUA 3HXLA 4P3PA 5A71A 3GN1A 4I1YA 1N36B 4BCDA 1X13A 3ZK9A 3QELB 1M5RA 3O4RA 3HP7A 4RGVA 3BDVA 4OHVA 3FNRA 1C3VA 2I4IA 2RKOA 1NNUA 1BX1A 3WB1A 5AW7A 3LOQA 1G9TA 2CL5A 2Q3MA 3NEPX 4BV2A 1N9ZA 5IEBA 2WIAA 1UBLS 3NX4A 4MV5A 3USES 2E18A 2ZWMA 4U02A 5JAOA 4IVPA 5KYYA 2ID8A 2WE7A 3BHNA 3FRHA 5BMVF 1J70A 4YP0A 3MTIA 1SHKA 4QO8A 1E59A 1XBTA 2X77A 4M9CA 1SBHA 1Z4MA 2FG6C 4J9VA 5EIXA 1O54A 4RVOA 1KP2A 1UPXA 1EUCA 4EIWA 3OZXA 3EDCA 3ANMA 4PZLA 4DYDA 2JGFA 1GCUA 1IMOA 1PUIA 2ZJYA 1DXYA 2K7ZA 3KOWA 3L0ZA 4WNIA 4KPYA 5I9TA 2IIPA 2ZIGA 1YS1X 5JLAA 5BWOA 1AQIA 3DP7A 3WDMA 4IR7A 5CT5A 4TZKA 1JP7A 4LQ4A 1VXRA 4N12A 2ACVA 4XPZA 1AA6A 1DC4A 1VHTA 5IVKA 1KZYC 2OORC 1OLUA 5TVGA 2Z2YA 3W04A 4QT0A 5F1OA 1VSUA 4BKOA 4BXOB 3JQAD 3P1JA 3E0XA 4KXVA 2GZ3A 2NV0A 1T91A 2QUBA 1RI3A 3PB3A 3K09A 3ENVA 4I1RA 4WOJA 1OTHA 2PU5A 4XA8A 3VR1A 4FR2A 2GN8A 3PITA 4X85A 1BVUA 1EBFA 1ZI6A 3CX8A 1N3YA 1W5AA 5FBVB 1J8DA 1WMSA 1EGQA 3UG6A 4B4WA 2NVWA 2OFWA 1UBSB 4N7MA 3CKYA 4YVFA 2BR4A 4YPVA 3UMJA 4ZJYA 2O8DA 4Q6WA 3MFQA 3B38A 1WP9A 2BM8A 3HPRA 4UNSA 4CMCA 5LOVF 5IKXA 1QZXA 5KIAA 4WIAA 5JSFA 3DE7X 2CSXA 4CIWA 5CDGA 3OJOA 1NNEA 4UMFA 4YPFA 2Q6TA 3FOWA 3UJHA 3MTBA 4EHLA 1TEVA 3TRIA 4J6EA 5I7HA 1FRNA 3JVUA 2HHHB 2CUNA 1Y1SA 2FETA 2WIKA 1CDZA 4FE7A 4LWOA 3N7UA 1UDAA 1SVWA 3NKFA 5HTOA 4XDHA 1JS1X 4AMVA 1RLUA 1CKEA 1GARA 4RMJA 3OP4A 4DAEA 1I3NA 1BCSB 1HT0A 3ER6A 2XDQB 4M1MA 4B87A 3IAFA 4JK3A 4PAMA 5B4VA 2J9ZB 1IULA 1WF3A 1VL1A 2ZYVX 4CIVA 3G7SA 2ZM5A 1RJGA 2Z8ZA 3TUJC 2VPTA 4MV7A 4LMRA 3BWCA 1BXRA 3B12A 2JLVA 1T2NA 2ZYDA 3QWFA 3B1KA 4MPTA 4CDMA 4QZVA 5J4LA 3KUKA 2RH4A 1ODTC 4ZEVA 4F85A 4HG2A 2ZJ5A 2WF8A 3UUWA 4G4SO 2ZUVA 3TM4A 4D0LB 3QPUA 3E5NA 2QA5A 3R6LA 3IC5A 5FTWA 1N6IA 3IE2A 4J90A 1THGA 4OXRA 1CVRA 5CVVA 2WA1A 4KOEC 1NQAO 1L5LA 2WTMA 2VC2B 1NVTA 3IFSA 4UVGA 4DIUA 4YQEA 3GEBA 4ZV7A 1UBUS 1LH0A 1N8KA 1JL3A 2WIFA 3E05A 1YR6A 1QWSA 3M1YA 4IG4A 2V9ZA 5IJWA 1SQGA 4JFAA 2VCYA 5K0GA 3OKFA 1Z0ZA 2F43B 1PLKA 3FPBA 4TM7A 3WWOA 1VC2A 5IFLA 4FT2A 1HEYA 4TMZA 1DJQA 4N3AA 1SO8A 3CZ4A 2AGVA 4PLGA 4BO3A 5HUQA 5JAZA 4P0QB 1HM5A 1JFRA 1GIAA 2SICE 2X7XA 3CNHA 1A9XB 4N1AA 3RIHA 4L74A 4REQA 5DTRA 5FTNA 2M6KA 2RJ3A 2SKDA 4K88A 3S2GA 5E4YA 3WLKX 5TX7A 1P4HA 4OM8A 4DR4B 3IR6A 3NNSA 4N3BA 4WLNA 1RADA 5JS7A 2QXUA 3HDQA 5TSDA 3I32A 4QM7A 4JXXA 3JWPA 4TV8F 2NNWB 3ZD9A 1J2EA 3NTQA 4EO4A 2NG1A 2PGNA 2OM2A 4OJMX 1WXHA 2EDAA 4MIKA 1A4UA 2NU8A 2Q62A 1O6GA 3K6SA 3RC9A 3QIVA 3BWBA 3BE5A 1EFVB 2W6PA 4RKEA 1LBTA 2HBZA 2HK8A 5EMJA 5CB8A 4DV5B 4EUNA 1JA0A 4LTDA 3V9AA 5I7VA 2XY4A 1TVKA 4PBRA 3HJHA 5HOEA 4RDXA 2ONCA 1COWA 1F6BA 2WTAA 4JBWA 3D8NA 1Q0UA 4GRIA 3NIGB 4AF6A 4D74A 5DN6A 1Z8NA 4OMCA 4QHTA 2AYYA 4BLWA 2O2GA 3Q6IA 4AMUA 1ZBQA 5D2CA 4B33A 5B7GA 3G0HA 1JUDA 2V7EA 3M3PA 1SU7A 1I6MA 1HI9A 3OLWA 4JDUA 4TQ9A 5JDIA 1H1LB 3ZV7A 1CSEE 5DOZA 4EQ6A 5JD4A 4TZ6A 3DTVA 2XXAB 4CKWB 3WVNA 2QNRA 2B4KA 1CHNA 1RZRA 3JQPA 1Z28A 4M0LA 1E61A 3EGCA 4UNIA 4WACA 4BTVA 2D5AA 4ZK6A 2A1UB 4K8RB 1PR0A 4KRGA 3MXOA 5AVKA 3KTOA 4AKSA 2J9GA 5D86A 3GLHB 4LBVA 1D3AA 3BZUA 2EG5A 3AL3A 1JU4A 4BJ5A 3FLAA 1XZDA 2HCJB 4TM8A 3CSUA 3FGNA 1JHOA 1IN7A 5FBLB 1DSSG 1D0IA 1P8JA 1J23A 5KTOA 1RPZA 3WL6A 4URXR 3KKPA 2XMRA 2PCLA 3TIXB 3F6EX 4GKAA 4H3KB 5EQTA 2HW8A 4AP5A 4HO1X 3D0OA 4TLDA 5L53A 3QE9Y 2HMYB 2A0FA 1OVMA 2JC3A 1ONBA 2CJYA 1GGHA 2WMNB 3CRW1 3D4LA 3EXEA 4FLFA 5CTJA 3V4LA 2E37A 1YUNA 3OE4A 3WL4A 2E7ZA 1OGJA 1YZVA 3JRXA 3QENA 1N6PA 4JB8A 3SQXA 1A71A 1A98A 1DAHA 1W4LA 1Y8QB 1E60A 3ZCSA 3ADCA 1V11B 4MZDA 1C81A 1ZK2A 5CYPA 3PXGA 3DE1X 3T54A 2GZHA 2V45A 1WSBA 2Q9UA 1YI1A 2CL0X 4G37A 4AUKA 3R8CA 2FDXA 4OCZA 3WGUA 2HYIC 3H9GA 3PNBA 4BVFA 1PSZA 3RIMA 4RLHA 3PEEA 4WZAA 1AQYA 2J0QA 2JJ1A 2FSIA 2PRZA 5I9NA 5CCEA 4UKDA 4H7KA 4WZBA 3R7DA 4DVGA 3IULA 1MX1A 2FOLA 1QVVA 2K4MA 2GZMA 2B7LA 2QQ5A 4URFA 3RT9A 3WA7A 1Z45A 1U3GA 4A6EA 1R12A 1VCOA 1W34A 1ORIA 1KAHA 3A31A 3D3NA 4HK4A 2CLMB 9LDTA 4NCAA 1R4MB 1W4CA 2G71A 2C9BA 4KIWA 4Y0AA 3ST7A 1DXOA 1U8YA 4I66A 4F96A 4MVYA 3PQ4A 4IO1A 4OP1A 1NPYA 3TI9A 1GU0A 1S2DA 4QGFA 2CJPA 5IYZB 1P29A 3FCSB 4JB3A 3LUDA 5BOSA 4CUKA 1ISGA 1L1RA 4W5TA 1M66A 2YIJA 1L7XA 5FLYA 4KW7A 2W71A 3RS9A 1NVAA 4DT1A 3EN0A 3L8FA 3L4SO 5CX4A 1JSLA 4LK3A 2PLRA 2ZLBA 1GPWB 4P80A 4TLAA 4XKJA 2HGSA 3PFCA 2J46A 1XJQA 5HEKA 4BNVA 1TC2A 4IJVA 1QF7A 2IVZA 4QBHA 4JASB 1GNSA 2BFMA 2H0AA 5DYGA 3Q12A 4JLMA 3SX4A 1SCKA 3EQ8A 4DZRA 1YVDA 3AR6A 3MT7A 2OZEA 3OVMA 4N65A 2ZIZA 3NNNA 3U2QA 1C7IA 2B8EA 4JBYA 1H8HA 1TW3A 2EU8A 3DEFA 2XWQA 1CE8B 1WCIB 1FQWA 4BJ6A 3JX9A 4A92A 1EFAA 3GEMA 3V33A 1GZ5A 3LGAA 4TQGA 5JJIA 4OQDA 1B93A 4PLTA 3L1HA 1MC8A 3S68A 4L57A 3RPEA 2HR1A 1F2TB 4PWYA 3Q85A 3AEYA 3JTEA 2BKLA 4ZQEA 3V1TC 5HKBA 3U16A 1IU9A 1EA7A 1XA3A 1I9CA 1RZ3A 2FWMX 2I66A 2QKYA 3M4JA 2ASVA 2I8AA 1KYQA 3FTNA 4COKA 1LS6A 2H63A 3F97A 3LBYA 4UBLA 1ZYUA 1R4ZA 3K0FB 3MTDA 4DJFC 5C1OA 5I5GA 3H5IA 3FHCB 3PA8A 1K1EA 2XJ4A 1C50A 3NU1A 4FFSA 5ER9A 1XCOA 3EZ2A 1NMEA 3CF2A 1UANA 3MCZA 1NULA 4WZ6A 2Z56A 1EVKA 5LBTA 3ZEAA 1RAGA 2OCIA 2VYVD 3JQAB 3ABRB 1PDVA 2BTOA 1E1QD 4G63A 4Y2UA 4C7JA 1H66A 3PWTA 3WL8A 5JIBA 1RKXA 1R27A 4V02A 1R50A 2IRWA 3R0XA 5EHNA 3VJKA 1XZEA 3HCWA 1M2VA 3MUOA 4UHKA 4BQQA 2I9KA 2PMWB 2YJNA 1LBEA 1DARA 3TL3A 4PICA 1QQ6A 3BH6A 7MHTA 3FOCA 3DZCA 2R00A 3QHAA 4N8DA 3ILXA 4TLLB 3CH4B 1ORTA 4P7FA 1HV8A 3FZEA 3LYUA 5DT9A 3OAAA 3G82C 4I3FA 4IRXA 1X7HA 3ETDA 4OA5A 4MV0A 5THQA 4Z7OB 1V48A 3LC7O 4PVCA 4CN8A 5AM4A 4ARVA 5DNCA 2HQRA 4ND8A 1Z0IA 3HV0A 1ULUA 4QBTA 3KKKA 2FX5A 3CN9A 5AMXA 4LJ8A 4ZWNA 5DB4A 1J20A 3BMNB 4JIMA 4OJQA 3ESDA 1S1MA 1BWPA 3CZCA 1CJUC 2PGOA 1Z4PX 2FSGA 5JD6A 1Y9EA 3N2IA 2IBMA 4A1OA 1LF0A 3K1AA 3TGWA 2FRVA 3L1UA 3Q7SA 1V4BA 3QQPA 4KK4A 1NBWB 1P72A 1XMIA 1UKYA 3Q11A 1NMXA 4MEJA 4F46A 2ATEA 3IMFA 3LCRA 2V58A 1L5HA 2XODA 1HFKA 3KE9A 3QY0A 3R5HA 3QKUA 3RRZA 3TRHA 3TNDA 3ZHTA 2DUUA 3AF1A 4EG0A 3HVUA 1TJPB 1JVSA 1J24A 2BMWA 3RVNA 1VKRA 4Z3OA 5LIRA 1WVGA 3ZU2A 1FJGB 1D6MA 5FX2A 1TA0A 1FF9A 1PR2A 3A36A 3DVSX 4F8YA 3EBOA 3LT0A 3LUFA 3L4KA 3PXUA 4YJDA 5KU1A 2PGIA 3TE7A 4DUYB 3ANLA 1JFFB 2C9DA 3WYCA 1RQGA 3GJ3A 3CU5A 5F1YA 2XWJI 2YCLA 3AUAA 3DEHA 4OHMA 1FVHA 1RWOA 1NQ5A 2BDTA 4O8CA 4Q3KA 1W19A 2OHIA 2VQ6A 4ETMA 1SJ9A 1D03A 2QY6A 5EUMA 4EQZA 2I2BA 2FH5B 3WAKA 1GN8A 1Q14A 3H2KA 5C18A 2PX2A 3MSXA 4PFQA 5C4GB 3HR4A 3WE7A 1XZJA 2QBYA 2IVFA 3WIUA 1NJ5A 5BNWA 2W6CX 1E7SA 3MQ2A 2C97A 3DGFC 1FVFA 2XD9A 4TT3D 1IEVA 2H1IA 3DE3X 3QPDA 4CEHA 3EMKA 2BFWA 1OC4A 4E5YA 5KSZA 3D8HA 4M0EA 4N0QA 4D46A 7MDHA 5A4IS 4R2XA 2PZBA 4V0NA 1T9CA 3N5CA 2VQ3A 1E1CA 3OA0A 4F72A 1DT5A 4UBMA 2DLNA 5JS2A 2BUBA 2JATA 2EKPA 1R0RE 2WQZA 1YL6A 5E38A 5TF0A 1HG0A 2O3TA 1EFDN 1PDWA 5K8LA 4O4LA 1FDRA 4IQ8A 5HQJA 4EGQA 3ZD8A 2HNAA 3CLHA 4DR3B 1PQUA 2CMHA 2WFAA 2Z2XA 2XYVA 4XWGA 4ZREA 3E9ZA 2J3QA 4RA6A 1BW9A 3STHA 3LBFA 1S3SA 1RKQA 1KY5A 1K7CA 2XNHA 3IE0A 1V6CA 3P52A 1Q21A 1LNZA 1ZHOA 2NQTA 1P9RA 3VSEA 1ZZEA 1X87A 4JSYA 2CDBA 1UJBA 3CFYA 1DC8A 2VSNA 2WLSA 1LUAA 3FVTA 5A4JA 3BCRA 1H4VB 3CG4A 1A5AB 4Q02A 1M6NA 2IXTA 1WULS 1ZOOA 3KYCB 4M55A 4RHTA 1YB6A 4NMXB 4H7HA 3BDIA 5EHQA 5FIUA 5H3LA 5FWYA 5JQGF 5U4QA 1CY0A 3TLEA 4XQGA 4X6UA 3RVPA 1OOEA 3WXMA 3ZLTA 4YV2A 4HD8A 2BELA 1BE8A 4JENA 4QYMA 1J33A 4YI3A 2WTXA 1KEWA 1N5DA 1JBKA 3FI9A 3ROPA 4N6GA 2QL6A 2QQFA 4HRAA 3VVBA 2BKXA 3UT5B 3EA0A 4Z4CA 3H9BA 1KJ8A 2QSYA 2CK3A 4MS1A 2NUTB 4MOWA 4C0SA 4BQPA 3OBIA 4J2OA 1DEKA 3NIDB 5CA1F 5DIZA 1OH5A 5FUWA 4QFDA 1OI2A 4UASA 2OHJA 4FQ5A 1QJ4A 1LI4A 2FXVA 4Z6KA 4P4TA 1PR9A 3OHPA 1PQWA 3CUYA 1JIIA 2HQ1A 1ZMBA 4LVOA 1YZHA 5JBQA 3T94A 3D8UA 1PT8A 2XSZD 4IPTA 1LRKA 3WC4A 1R0BA 4WLUA 2WWWA 4MULA 4C9BA 3T9AA 4ARAA 3M1IA 3FBWA 1P5JA 2ONYA 4BO4A 2QDXA 4EZIA 1KQNA 2FN7A 3MT8A 3D64A 5DKFA 1NW6A 4RZ2A 2Y1CA 5KREA 2RKWA 3OFVA 4MW6A 1JB9A 2VN8A 3Q6MA 3DM9B 3G23A 5DCWA 4WBNF 4NY1A 2OBXA 3ZU6A 3HNPA 2VDQB 5TQ0A 2YFKA 3ENKA 2X8BA 1DBQA 3USZA 2WZQA 4QQFA 2GETA 2FQ1A 2REQB 1JU3A 2AXEA 2CZGA 2QTHA 2Y6VA 3EA4A 3QE4A 2NZXA 1FSZA 5D51S 1DIOB 3WBBA 3I64A 4L85A 3TLMA 4ZQCB 2CLDX 1G5FA 1X92A 2HEGA 2O3RA 3EVEA 1W85A 1CEXA 2VEOA 1BCRA 2FG5A 3KJGA 4FQ8A 2I7DA 4WZZA 3TEJA 1SWWA 1KXJA 3OE1A 4EWLA 3PX3A 1R8YA 2OCPA 1MO5A 1ZIXA 3AF5A 4AROA 2UU9B 4IHKA 2O7QA 3OJFA 3B20A 3BMXA 1Z4IA 5EYPB 4X45A 2VT7A 3RK4A 4HPJB 3A3KA 1CK4A 1HFJA 1WAMA 3TQFA 4Z4IA 3X43A 1P5ZB 1SXIA 1N33B 1WEHA 2KLHA 4AKHA 4K9RA 3ZW7A 1FJHA 1ZK4A 1MORA 1ISRA 1SU8A 4WOBA 1KFEB 1PX0A 2MWMA 5I7UA 2YNMD 1DE0A 1ECPA 1PYDA 1TK3A 4LJAA 4E4YA 2BCGY 2C5BA 1B76A 2V7GA 5CH5A 2RI0A 3CRVA 3PPYA 4MVWA 3FMVA 4MW1A 2I4MA 3KO8A 4LYFA 4X63A 1UKZA 3G3EA 2HXSA 4Q9JA 3GGJA 4N18A 4JQYA 4D80A 1C0EA 2WZCA 1LDNA 3FDZA 3WK6A 3S2UA 5DK4A 1H6AA 2D7JA 3UAGA 1U2GC 2G1JA 3EVBA 2V7BA 5EMLA 2FPIA 2CLLB 4M76B 1UQRA 4UBOA 5A02A 4DCNA 1YC2A 5TQ2B 4IDFA 3RYHB 1B74A 3LHFA 5JZSA 5EJ9A 2PX3A 4TMFA 1R10A 3PL1A 3TJMA 3OZVA 1Q1ZA 5C7IO 1Z6YA 2OHVA 2OKGA 2X41A 3DL0A 1V5WA 2H8GA 4OQMA 3ZWBA 2J7KA 5EWJA 5B37A 2MYTA 3LUKA 1H9CA 4HDRB 3F98A 1MW8X 2Y67A 2F1RA 1KDVA 4OQPA 1N2CE 1T2UA 2G83A 3DEIA 3IIIA 3OP1A 4R1SA 4RU1A 5ALGA 3ZKWA 5JROA 4LXXA 1J9ZA 1CUCA 3E9MA 1XP8A 5JH7B 5KNDA 3C7DB 3ZYCA 3ZVNA 4DR7B 3UH1A 4S2EA 3L0OA 3AILA 3HB5X 4IHJF 4YJ2A 4J3JA 4HVLA 3RVMA 2KJQA 2OR3A 4FEEA 3WGMA 2XE8A 4JOSA 3CRRA 3D2BA 2WWVD 4YRKA 1IZ8A 1L6RA 3H9EO 2K7FA 3KV1A 1X2EA 4IZ6A 3PFIA 1O58A 2E82A 4BQRA 2CNOA 3OX2A 1SXPA 1CW2B 2JIBA 2W6MA 1S2MA 2XQJA 2ZFUA 3L4EA 2AHOA 1E3JA 1UXIA 4Q3NA 1TGYA 1L6IA 2PRYA 2ZATA 4LBZA 4EPRA 2OV3A 3DHEA 1ZUD1 2GCOB 4FNOA 3EIUA 4DCUA 1GYPA 3LGSA 2CUKA 4TKZA 2GPWA 4Q4DA 2C94A 4ZYVA 3W8NA 3LDGA 3HXKA 3FDFA 2QNBA 4YAUA 2EBWA 1VM6A 4DUPA 3E3NA 5EWMB 4LQCA 4L8FA 3GELA 1IH8A 3VFDA 2GD2A 4XWYA 5GZ3A 4AO7A 4EF5A 2XYHA 1JMYA 4YJKA 2E87A 3EZFA 3J7TA 4CUJA 3EPLA 3PC8A 5CLGA 4JLUA 4B1FA 1X1AA 2OKCA 1TQ8A 1XA0A 4OGFA 3X1KA 3L3BA 2UYHA 2YWBA 1P5RA 4MV9A 3PC4A 4B4VA 1EZ1A 4ZCIA 1EAYA 3KDSE 3GFBA 3R9KA 1E5TA 4NR0A 1Z4KA 1U0FA 2QLLA 5HW0A 5JMOA 3DFZA 2Z43A 1HORA 5IZCA 1EDEA 2Q4TA 3DP9A 1XHEA 1S0UA 3RYCA 1EWRA 1QORA 3E22B 4P4SB 2XI4A 5DTIA 4DE5A 3QUCA 4Y9RA 2HA0A 3DBHA 3REFA 3N87A 3VU8A 1MV5A 2RK3A 1K8XB 3MWLA 1G9XA 3VGPA 5DGDA 5DBEX 1Y3BE 1SUSA 2JCGA 4IOLA 3TEMA 1YZFA 4R83A 2JGRA 3GY0A 1XT6A 2GPBA 2OBMA 1G18A 1Y89A 1DIRA 2PX5A 3CJQA 3GUCA 3OMWA 4I9FA 4LKRA 3RVBA 3PLNA 3IDAA 2FPPB 2PKYX 1RIFA 2W90A 3AIIA 2GYUA 3EPPA 1SK8A 3UMVA 4HQNA 1TIBA 3PZRA 4WCDA 4X20A 2EAUA 4F3CA 1CY6A 4GOMD 3OLZA 2C77A 4RLSA 4TWJA 1W5SA 2RHOA 2XQGA 3GZJA 1DS6A 1XCMA 4G67A 3BJZA 1U4NA 4MJXA 3NMUF 1HDEA 3MWEA 1ML4A 3I01M 1KJJA 1NW5A 4HT3B 4DIMA 5BV8A 2O8VA 3SM3A 4DR5B 1KEZA 3RFUA 1VG9B 2QGZA 4D92A 3U40A 4AS2A 4Q24A 2P90A 4XJTA 3HWX1 3E9YA 4P81A 4TMYA 4IIGA 2H1CA 4EJSC 1NG1A 4NX2A 4D56A 3IELA 1BXKA 5JY1A 5KNBD 1JFVA 1P1CA 2DH6A 3U7HB 4YJ3A 5CG1A 5KSOA 2CL6X 3PEFA 4Y6PA 3R3ZA 3V34A 3AKZA 2DQYA 5AUQA 4I8DA 4K6MA 3BQMB 3AKDA 4WNAB 4F5ZA 2R7NA 2G77B 1TJ3A 1NUQA 3C0KA 1DAIA 4QGBA 4QJ4A 3OOJA 5EJGA 4CI0B 4PS0A 2L2QA 3AV0B 4RENA 3BK1A 3OTQA 3THOA 1V26A 3E9RA 4G1BA 3TSCA 3W3ZB 2H1HA 1SCBA 3VV3A 5JASA 1T5TA 2HA6A 5H16A 3VTZA 1AF4A 4RH3A 1ZH4A 3NDJA 3P0EA 1I1OA 1LDBA 2FDRA 3JQBC 1TT5B 4OSEA 3S1AB 1UT8A 2VZ0A 3TLZA 4ZJZA 4F2PA 4L75A 5HM8A 3ZIUA 2QQEA 4G0PA 4NBTA 1R6VA 3KPVA 1WDTA 5LZ7A 2VXYA 4E15A 1HC7A 1TJ5A 3N2ZB 3LPNA 2FF7A 4US2R 1IRXA 1G1MA 2BAGA 3HVRA 3NHZA 1SXQA 1YA8A 4K6KA 3O47A 3QQ5A 3AVYA 2ARKA 3EVCA 3KTAB 1H42A 4YH1A 4WN9A 2XF2A 4FZ3A 3PHBE 4ZCSA 3QFSA 3VGJA 4LZJA 2BC9A 5C0OE 4LXTA 2VDMB 3W6UA 3U4QB 2O8CA 4EPVA 3N2KB 3I5YA 3T9EA 4MW9A 3I2GA 3HNRA 1N7IA 4G09A 4C0WA 2GYWA 4ALMA 1WA5A 3AHGA 3TLKA 3SEFA 4BFVA 1FFXB 1WUHS 3A70A 1C9KA 2XUDA 1VJ0A 2PLFA 4Z86A 1RPTA 2B61A 4QYXA 1UK9A 1QRUA 1UJ5A 3P9SA 3JS5A 5EY5B 4RE5A 3VPSA 3NASA 5FWDA 2I3AA 5GP1A 3ZDFA 3HUEA 1KAGA 3RWMB 2O7SA 1GR0A 3K1TA 4PSCA 4PFKA 1Z35A 4FMDF 4B44A 5FUQA 1PNQA 3Q3IA 4ZT5A 1SXGA 3IH5A 3WA6A 4JHXA 4HLQB 1UKBA 4H6XA 3SX0A 2C3MA 4L1KA 5CD1A 3Q40A 3KZ1E 4Y9TA 3FDIA 2PWAA 1M75A 2X40A 4XGRA 4EB3A 1GCIA 2AN3A 1GQ2A 4B85A 2ZYUX 1E4OA 3PFHA 2HLDD 2HFJA 4DTCA 3LA8A 1NJGA 5LA6F 2C4NA 2R1UA 1TW2A 3Q1LA 4O59O 4CCAA 3S2ZA 4Q66C 3LLCA 1P1IA 2B92A 2XRFA 2WYVA 2O1XA 2QIPA 4O02B 1I4LD 3L0YA 1IOLA 4D02A 1JAHA 3PX7A 1XF1A 1P7PA 2GPAA 2JI4A 4HQOA 1ND5A 3CLKA 1SXJC 3RFVA 1LW6E 5IT5A 4DA7A 4EHIA 1ISPA 4OMUA 4P7KA 4GZ3A 4AJPA 3WJ1A 1ZONA 2WSLA 2VR1A 3K72B 3LQ4A 3F6SA 4DQKA 2OESA 1I36A 1QJCA 3NIFB 1E77A 2F3QA 5AI8A 4AAYA 1F06A 1DIAA 4WINA 1QRTA 4XD7D 2HBQA 1G8KA 1RACA 1SU4A 1USIA 4X61A 5FBQB 3RBVA 4RTJA 4HN9A 3R1IA 3NANA 3R0ZA 1IUNA 2XUPA 1GPUA 4WEOA 4HDMA 1RMQA 4DMKA 1M8PA 3ASYA 1VJRA 4GHWA 5CFPA 5HZKA 4B3DA 4YRNA 5CRIA 3ZY5A 1CPYA 3PJRA 2CVQA 4XIFA 1RYNA 4FC7A 2P3LA 4NPAA 1OH8A 4LJ5A 2BSXA 1KK1A 3EEOA 4NARA 2G28A 3DO5A 4KXQA 1O96B 2GAAA 1JJBA 4UUQA 3TKAA 3VU9B 3W77A 1GL6A 1CLEA 4D4GA 1NSFA 2BEWB 3FUWA 5KTMA 2QZZA 1M8FA 3QPBA 2DKNA 1NBHA 1T9BA 2C9CA 1Q3HA 3T35A 9LDBA 3W9BA 3ODPA 1GRRA 3D6TB 4R31A 3AJDA 1C7ZA 3T3DA 4OHYA 1YZNA 4YI5A 3FJYA 4F3NA 3K70C 1ZKDA 1UFRA 3SJUA 5H4HA 2VTBB 3HCFA 1C9YA 1E7QA 2BKUA 1P0IA 3SNHA 2UZAA 4J91A 3E9DA 1O4VA 3L1IA 4Q1EA 4OUDA 4ARZA 5K0BA 2YTZA 5KPJA 1TK9A 3KP1A 3MCWA 3W1VA 3U7GA 3FYUB 1J2RA 1QMPA 3RRJA 2XVZA 3VXKA 1XMQB 3QPWA 2F1HA 5CLHA 2G06A 3OWOA 1XEFA 1LD3A 2XTNA 3DFMA 1NN5A 3PR2B 4J0IA 2HJGA 1ZIPA 1XDDA 2I65A 4OMFG 1N1EA 1JWAB 2HB6A 2SCUB 4TMKA 4PLWA 1GGNA 3U80A 3X0DA 4OQQA 5BYAA 2ZEJA 2ODBA 3QMPA 4WXHA 5HXAA 2D0IA 1KOLA 1S7GA 1DKLA 3AMVA 1EFTA 1GILA 3KUCA 1VIVA 4HUQA 3WYBA 4EJ2A 2GMWA 4JR1A 1SQ6A 3I37X 4PXSA 1U02A 2HIGA 2PMKA 4PCUA 4D9JA 5KJCA 2FKNA 3FMOB 2F59A 3QU7A 3QXGA 4QSHA 2YYSA 1WXDA 3KYDB 4PV7A 2UYCA 3HNOA 2QTWB 3OFKA 1Y8AA 5J5AA 2Z98A 1OXSC 5JT1A 1HEUA 3ETJA 3GGOA 3OZBA 2IUUA 3P26A 4LXHA 2V03A 3QWIA 3PTZA 1JQAA 1EK0A 4TL6A 5CM9C 2VTKA 4G5YA 4BNXA 2RHLA 4RTLA 4PNZA 1SU6A 2XB2A 3KM0A 1T5IA 2GS9A 4UTZA 1GGFA 3P2EA 2IE0A 5HM6A 2VG8A 1A7JA 1UBJS 1TOAA 4C0KA 1M83A 3OG9A 3O7WA 3BEDA 5A4KA 1Z0JA 3WYGA 1TAQA 2X15A 4YXWD 2RHGB 1I33A 3ROXA 1VQ1A 2ZBPA 3T5TA 3E7WA 3GLHE 1RRVA 1XZBA 4UTOA 1MIOB 1U3WA 4GP7A 4HQFA 4ZVSA 1AZWA 3F1LA 5IBRA 3RGGA 3RIXA 4I14A 3TQCA 2C92A 4EJ6A 1K68A 2G82A 4J49A 4KG7A 3TJZA 4Y6RA 1DPGA 3M1AA 2DR2A 3JR3A 4XVHA 2Y1XA 1VSTA 1E79D 2J5KA 3TNYA 1FW6A 3O8CA 3O21A 4FBMA 1GRQA 1YRQA 2BZGA 1QKKA 1DELA 1QIGA 2FWAA 2A9VA 2YWEA 4DNQA 3PT5A 4D26A 2WWXA 4DJ5X 1H2ZA 3VYUB 2HIAA 1BE1A 1E3IA 4GXTA 5LYJA 4L22A 4KP7A 2GK7A 4S1TA 2O2IA 3KOUA 3O95A 4LZZA 4FGWA 1DKUA 4CIYA 2Q5QA 4JQSA 1QHHA 5HF6A 5BMVB 3N07A 2B7BA 3FB1A 1TMOA 2H00A 3CSSA 2W8ZA 1P3Y1 3MTEA 5BSGA 1KVRA 4A2CA 2WUWE 3DQQA 4O4JA 4XGNA 5BURA 1FQOA 3LQQA 4KRYA 2OXTA 2RHWA 5BXYA 2RD2A 3OF5A 4HRYA 3KOZA 1FNDA 2LR0A 2P5SA 3K2QA 3DR5A 3M4YA 3RKRA 4E30A 1A0OA 4DCMA 4EB8A 3ONNA 2DMRA 2HAEA 4LXYA 2JRLA 2CF5A 4MRRA 3HKEA 3DBRB 1PZFA 4K7JA 3I62A 2SHKA 5L8VA 2OBNA 2C3PA 1QP7A 3FOZA 1JKJB 3SVTA 2PUBA 3G0OA 1R2QA 4RTSA 1UJ2A 3IKLA 4DMHA 1CULC 1WQ3A 1IOVA 1Y3DE 3KTDA 5KVCA 4L4ZA 4OYRA 5JI3E 5K8TA 1TEZA 3OZGA 2Z4RA 3IP7A 3U4IA 1DCMA 4G0NA 2VH2A 2NXEA 3TSZA 3ZQ6A 3I0ZA 3R6TA 1G7CA 3EAFA 1TRHA 2IYEA 2YYYA 3U7RA 4WCVA 5E6UB 4EGSA 2IYUA 3CRZA 2H92A 4P54A 4YJGB 2JKZA 3Q7QA 2ZRKA 3SXPA 1RMYA 2F2TA 3WFJA 1U98A 5LOVB 3EAQA 2QX7A 1WMEA 2Z3WA 2NXJA 3NBFA 2GD1O 2J3JA 3P0JA 3QA3E 3R5XA 4L8YA 5TR9A 1LPSA 4M83A 2V74B 4ENTA 4BMVA 5HRCA 4XWWA 4KI7A 4IDGA 2F17A 5LSAA 1YSCA 3LCCA 3RK1A 3X1WA 1E1DA 1FX0B 1B0UA 2CLEB 1INLA 2X8AA 4C87A 2XCOA 3N9IA 1H2BA 1T9GS 5CTAA 9ATCA 1NI3A 3L46A 3T7CA 1X1DA 5I7AA 3MZ0A 4CMIB 2Q4EA 3VZPA 1E3WB 1NF3A 4KFTA 2XRMA 2IHVA 4CQMA 5K2OA 1WETA 4RKQA 3H83A 5A9RA 4W5NA 1W0KA 2CFIA 4MPPA 3DF9A 3M2TA 4HNAB 2FPSA 4M1TA 2W2PA 1KVQA 3EC1A 3H9CA 1AA9A 3QJYA 4R1LA 3UY4A 1D9ZA 2QE7D 1II8A 3H11B 4R1PA 1E3EA 1PLLA 2RHDA 2ZRAA 2A5YB 4JMPA 5DP2A 4C4SA 1DAGA 3AY0A 1F7UA 3LC1O 2ZJAA 1HL3A 1SB9A 2NQ8A 2FUG6 4FK8A 2AXQA 3U1TA 3NIWA 4B17A 4BQSA 4QPZA 4RVCA 5INTA 1V8ZA 1F38A 2XBLA 2GM9A 1VLLA 3ID6C 2HOQA 3TB4A 4R6XA 1OX4B 4OSOA 4EHKA 1IXSB 4R51A 4YMWA 2PA3A 3E4DA 4FX5A 1VSVA 5AKEA 3PKZA 1GWNA 1YZTA 3LDUA 4G24A 4L28A 3IUYA 4EATA 2F6RA 2OXRA 2QWXA 2I4RA 4M9SA 3UH0A 2P30A 1YR1A 3KG2A 1BGWA 1EFPA 5FOTA 3L1JA 1P7VA 3VPCA 1I2CA 3NTLA 4J3FA 3QNWA 1BS2A 3WWDA 5CIQA 4FN4A 2X8LA 2G40A 1MBZA 1QGOA 5F7JA 2XNDD 1XPUA 2SKEA 3RWOA 4HFNA 1OAAA 1BMFD 3B9RA 3GT7A 1NI5A 1PEAA 1CR2A 2C07A 2HWWA 2GZAA 3SHTA 5I45A 2QRGA 3UFXB 2Z1DA 3ZH2A 2YVQA 1NFFA 4K9QA 1NHWA 1PR5A 2PLNA 2WWIA 5L6MB 1VBMA 4FEYA 1JPNA 3I9V1 4K8OA 4X44A 2HV9A 4ZFNA 2BUCA 3LKVA 3SMVA 1VPEA 4NAUA 3MTAA 4QQRA 2VFAA 5JADA 3T52A 1VE1A 4FYJA 2XZDA 2QB5A 4QKQA 2NVUB 4TV8B 2WHPB 2ZUSA 1PS0A 3FKQA 1DBWA 3NHYA 4M8IA 3FCUB 1RI5A 2H2GA 1NVWQ 3KUUA 1NSYA 2ZUBA 3ICWA 3MQFA 3Q10A 4OI4A 4ZZ0A 1B2LA 3ILSA 3DV0A 4ZPJA 1P7ZA 2B1IA 5UKDA 4DS3A 5DJ5A 5IWAB 2XA1A 1RBQA 3FAZA 3K4HA 4ZC8A 4WKOA 1N0HA 4UUMA 4LDZA 1DIHA 1LCIA 4UUOA 5I7WA 2NU6A 1OH6A 4DG5A 4Q47A 3V42A 4PC2A 1IIBA 3H75A 3OO0A 4DIOA 1RM3A 3NV9A 4I81A 3RM3A 5KC8A 1IAQA 2IXEA 4PLYA 3SC6A 2J7PD 2O14A 2O52A 3FUTA 5A62A 3RB8A 4BLOA 4BNTA 1MQSA 3CWCA 1K3TA 3QG5A 4AZWA 3T3HA 1LK0A 2XWPA 2XDWA 1VCNA 4FHFA 2FAXA 4ICIA 1EH5A 4TWBA 5TEWA 3RQSA 3ZDBA 1AUQA 1W36C 1NLYA 2VSFA 5DTMA 4JNKA 1QLJA 3VR6D 1H3NA 1Z4JA 3P9KA 1K5GA 5IC6A 2IZ0A 3G2IA 3GJ5A 3G6WA 2QR2A 3KVNA 4RY9A 1A4IA 4CLHA 2JGDB 2XDYA 4KUGA 3MGGA 1M72A 5SICE 4LDJA 1NIJA 3CLRD 3N2GA 4KVAA 5MGNA 1HYBA 2QORA 3DM5A 3L6DA 4EJFA 1WSWA 5FBZA 1Y8RA 1VTKA 3O83A 3BH0A 4JUBA 1EYZA 4C0QC 3GFVA 1XTIA 3UK6A 4ZICA 2OD9A 3GDGA 2RGYA 5KS2A 3OLCX 4H4DA 4RKWA 2YWGA 2Y76A 4FYHA 1XTRA 3WK7A 1G5RA 3AEUB 4GC9A 3H05A 2IHUA 1T35A 2B82A 4L0DA 5AJUA 1U8ZA 3BWDD 3HM2A 1OBOA 3N8DA 3OECA 2AG0A 4YLEA 1DJNA 2C2MA 4B2LA 5JSHA 1YR2A 3FNQA 2QAJA 2VDNB 4CR7A 4R1TA 1FFGA 5IN5A 1T0IA 3CR7A 3EF3A 2W6JD 1RIIA 2UVPB 4I55A 2MYNA 1P4RA 1VMDA 4CF4A 5J2TA 3IUQA 1BDHA 1BHSA 1FRQA 4JN6B 1MT3A 1VCHA 1YJBA 2ETXA 3CH6A 4BVHA 5IDWA 1EVQA 3G0BA 3LP5A 4YCMA 1Z83A 3HR7A 3PDIA 3EEYA 3AY3A 3ZI7A 2P2ZA 3MGAA 4N47A 4XI9A 5L3QA 3O03A 2GLXA 3H9QA 4WADA 1I9GA 3ZBPA 5A5EA 1V9CA 3PQ7A 2GXQA 2I8LA 2YRXA 5IHXA 2H1VA 1SXJA 2FFAA 2XIJA 4IS3A 2AFHA 2EIHA 3FLMA 4UM8B 1QB8A 4Q03A 3DT9A 3C7TA 2ZRPA 3I8OA 3LW7A 3M6WA 3SC2B 3HC7A 1XJ0A 2LCIA 2QDKA 4IGIA 4MKGA 4OYYA 3ZGZA 1N2JA 2H08A 3IEUA 3NGMA 4QUKA 4L5AA 4DQVA 4EFDA 4JU9A 1DBSA 1KJZA 4J6FA 4EZEA 1V41E 3P9CA 1GM5A 1JYEA 1LLFA 2ZAMA 3I2KA 3WNQA 4B79A 2V9PA 4KE9A 4ARCA 1O0SA 2FOXA 1MD9A 1AHIA 2WHQA 3VR0A 4ER5A 2CDCA 1PYOA 2KI5A 1EE2A 4KIFA 3UJBA 3ZIAA 3JPYA 5HNKA 2PT5A 2V3WA 4MWDA 1TIKA 4LA4A 4R3WA 3DF7A 2VCEA 3GRAA 4R8MA 1CJTC 1OQAA 1VI5A 4XGQA 3N8IA 4D3SA 5JJBA 4V0MA 4NDZA 1EWTA 2X6TA 3B7GA 2IYZA 1WSAA 3M5CA 5FB3A 3OZAA 4RFSA 3FF4A 3IOYA 3RV4A 3O4JA 4OXXA 1WZIA 3I8SA 5ITSA 2BH2A 1YMUA 5ES3A 1AHNA 4DXHA 4ZU3A 4O4LF 4FCVA 2G3YA 1ZM3A 3OQHA 1T8RA 1X0VA 3C3XA 5BYKA 3CC8A 3SDBA 3W2FA 4LTNA 4EFKA 2PA0A 2AR0A 3O26A 2CN1A 3KAQA 3TCXB 1XDUA 1CCWA 4TYNA 3DAOA 5K0SA 1OPXA 2ATXA 1PWEA 4UU8A 2POCA 3T12A 3EISA 1K06A 1JKXA 5C53B 2BGIA 2X0KA 3CRNA 5A1JA 4PC3A 2JASA 2ZRCA 1Q44A 2K6GA 3AM4A 3C4JA 3KHKA 5EHGA 5FD8A 5K0ZA 2P41A 5DHUA 2BFBA 1O5IA 1C8LA 2O1SA 4ERNA 2ZI4A 3HFSA 1NZFA 2ID9A 2F1IA 5B3AA 1F8FA 1EFCA 2OSBA 4QGSA 2JI6A 3PQFA 3MPUA 3HR8A 1E4EB 3O4HA 2RJNA 1QH1A 5CFRA 2UUBB 3VR5H 3CF4A 4FCCA 1DC7A 5TMPA 1UM9A 4I4NA 1FXWA 2MSNA 3KZVA 5FNZA 4D8YA 1NV8A 3L0PA 2PKWA 5KVQA 1T3ZA 2WFLA 2ZUCA 2V65A 3I23A 2NV6A 3BK7A 1U6JA 5IK2A 3T3NA 3JALA 2BEJA 2BEVB 3VTFA 2IYTA 1VXOA 4A91A 4DANA 4N6OA 4H6WA 1P62B 1VHDA 1GZ3A 3CG0A 4AXBA 1RE0A 4YRZA 2C2GA 2B35A 5JC1A 3U3OA 2AW3A 1UBKS 5B53A 1DV1A 3TZEA 1UDCA 1YT5A 1ZOPA 3E6AA 2EW1A 3ESYA 3KKZA 3LVBA 3OIGA 4HB3A 2BMEA 2RGCA 4HXFB 3LP6A 5D7NA 4BVAA 4BNLA 5LMNB 3H1FA 2OC4A 1P60A 2A4KA 2XOKA 3CH7A 4G5GA 4BRZA 3PEVA 4TS4A 2G4VA 1P0QA 1KEEA 5CFNA 1W47A 3E3MA 4K1LA 5FI5A 3EW9A 3OCVA 4HYEA 3AEXA 3RSGA 4FXOA 2R7KA 2DHRA 3O94A 3RS4A 3WWYA 1VPLA 1I3KA 1X7XB 3KHTA 3X2EA 3V32A 4CNBA 2CNDA 2RGGA 3LD9A 3MT0A 3SE7A 2ZT6A 3LWNA 4J0DA 4DADA 3L8EA 4DLYA 1NT2A 2J6IA 2WAAA 4G0XA 5EVJA 5DW3A 1BU8A 1JEQA 3A6HA 1G6HA 3UV3A 4R71A 4UAJA 4IX9A 3U9LA 1UAAA 1DQNA 3RS3A 1IJBA 2JFHA 4HNVA 5F78A 2RHJA 1O97C 1VE3A 2ZJ3A 1O6ZA 1V8BA 1ZHHA 2H2DA 3A4VA 3HYTA 2FP4A 3NXSA 4J16C 3RLIA 4JLNA 2VJMA 3U62A 2C5GA 2G67A 3H86A 5KAMA 5IXSA 1JECA 1REQA 5IULC 2G1AA 2J09A 4KX5A 1HDZA 3DYIA 1K8ZB 2KPOA 2HF8A 1TQ2A 1FSSA 4ECAA 2QL9A 1MPTA 4FI3F 3EXFA 1OBVA 3M8KA 5FTJA 2IJGX 2PX4A 1QIFA 1WU8A 3LQKA 3ORYA 4I6GA 3TYXA 1RRFA 4NPCA 4QODA 2QLFA 3S70A 5CFZA 3QYFA 3EB9A 5C35A 1E4YA 2PAFA 1ZRSA 5EJ7A 2VPQA 5IG2A 1M5UA 2G5TA 2QR3A 4E2ZA 1YO6A 3W34A 1PVDA 5H7XA 3AERB 4BP8A 1Z38A 2IDJA 3BFPA 3VMFA 1U7XA 4AVYA 4ZYUA 1GYRA 1IY2A 3NGLA 3HVIA 5LQNA 3ZY6A 4QD3A 3JQFC 4C3OB 2EATA 4ZTUB 2YVLA 2VVTA 4G4IA 1KZGB 3HN2A 4I1PA 1E9BA 1V8OA 2R3SA 3AEQA 4MYHA 2DY1A 3ABOB 4K0RA 2QVGA 5ALNA 3CN7A 2DERA 3HI6A 3BFKA 3ZS9A 3CKLA 3DZHA 3ZGOA 1AQLA 5EMMA 1W88B 3GL9A 1AN9A 3A7DA 2Z4TA 2QD5A 1M2FA 3UPUA 4AY5A 4V0KA 3ZNOA 1WTCA 1XZMA 2KBFA 2EGGA 1RBMA 2O8EA 2IYSA 2BI8A 1F1BA 3QW4B 5JQGB 2ZYGA 3TTXA 1IM2A 1XRMA 1F20A 3AP1A 3I6YA 3KXPA 2R6AA 2Q46A 5CHYA 5F7XA 3UENA 3MG9A 4O1HA 1P19A 2FW8A 1DQPA 2D3TA 3L7IA 4YJ2F 4QM6A 4NBRA 5H80A 1NNLA 1BROA 1WNTA 4K6CA 3TK1A 4ER7A 1O94A 1NDUA 5C2JB 2QVXX 4KPUB 1ZJ4A 2OBBA 4HAWA 1PJAA 2QN7A 5C8DA 1SUWA 3QEMA 2NT3A 2VZ8A 4B45A 3QYJA 4XYEA 4YAEA 1N2XA 5CA1B 5H81A 3LO8A 1DBVO 1W9MA 3GLFA 1DCKA 4JEHA 5JALA 1GRNA 3TWOA 2WK1A 5IHPA 3FTCA 2C0PA 1F14A 1XEXA 4WFIA 5F4ZA 3PDUA 5TQJA 3ZTYA 5CD9A 3RTCA 1NM5A 1KH2A 2JB9A 2ZBUA 4YMVA 1GCAA 1BS9A 4JJIA 4UOEA 5GJVC 2G1PA 4BP3A 1QSGA 2GTIA 1CHDA 4HTFB 3BSSA 1M1NB 2FVYA 3GEDA 4BE9A 4RSGA 3PDWA 3R7FA 1EQUA 2VNHA 1IBRA 3L7YA 4M0FA 3SKVA 3B2NA 1I8TA 1G20A 1X70A 3O7MA 2H7XA 2ZZMA 1ZXLA 2FJ0A 2PT6A 5DBOA 1CB0A 1NTOA 1YDGA 3UKDA 6ADHA 4YMUA 3PUYA 2HRZA 3F9RA 1AKUA 1M7HA 3ESRA 3O1LA 4KO8A 5IARA 1PV4A 2HDHA 2FZCA 4H2DA 3IP6A 1ESZA 3KKEA 3N58A 4LV8B 2PUDA 1PJBA 1J42A 3LM8A 1IZ7A 1EZZA 2A35A 3B78A 3EQ6A 1P9NA 5J2UA 4UAVA 3ZXSA 3MD9A 1ISSA 3GBVA 4PYQA 1ML3A 3FAKA 1T9HA 1P2DA 2V96A 1G291 2J0EA 4FOSA 1EIZA 2MMGA 1K66A 1V3TA 1X9IA 1C9NA 4CTNA 2V0GA 3ZJTA 4FYYA 2WLTA 3ZLVA 1QDLB 3KT3A 3A7EA 3LY9A 5TIIA 3L8DA 3A06A 2CFCA 1JQJC 5SYMA 3JVIA 1JT9A 1V7PC 3AHIA 2EF1A 3R40A 4PZCA 3K0KA 2VDWA 4OH1A 4MW2A 3X1JA 2J8ZA 3Q9SA 4Y2SA 4CF6A 5L3SA 1JEEA 3O84A 4AY3A 1EHIA 5FFFA 3HJUA 1T3GA 2XUKA 4N9WA 1OLSA 2ZRGA 4OXNA 5IXJA 1ZM4A 2ACWA 2W8BB 2ZJ8A 3LX6A 3ED5A 2I33A 4NZNA 4XPIB 5FA5A 1PGOA 3QTLA 1VZ3A 3W8EA 3SM9A 4YJ3F 2ZSAA 5DEIA 2JCVA 1USWA 1IWPB 2A9OA 1UR5A 2GLUA 2HN9A 4FBGA 4DLPA 1HFWA 3ESBA 4FR0A 2QLMA 1E7WA 3BD9A 4LVCA 4ZEOA 2JFZA 4MGEA 1VL0A 2OBYA 1QNLA 2Z9BA 1MXHA 1XX6A 3HY3A 3PYMA 4J8PA 4EHBA 4UD2A 4FR5A 5BN5B 2WTNA 1JYSA 3SQWA 3AR8A 3H18A 3CWQA 1U2DC 1O6FA 2WW8A 4UD6A 3OY7A 4ZI2A 5F1PA 4LOLA 2GEVA 1F8GA 1QH8A 4XZ3A 4JYMA 2OFFA 1QRAA 3C15C 4L0QA 2XB6A 3MJTA 3JW8A 4OGGA 1C5KA 1WLSA 3V8NA 4HX9A 1L4HA 4GLBA 3VAZA 1A50B 1LFDB 4R2LA 3WRXC 4IHJB 4RFLA 5FADA 4DIDA 1UMDB 3CEAA 5JZMA 3TSAA 2QTRA 4Z54A 1GPDG 1XWIA 3IMEA 2W37A 3I39X 1CJMA 4ER6A 4KFUA 2I54A 2OENG 4NOKA 1TQ4A 2QIOA 4B3IA 3FTEA 4WK6A 1U2ZA 1OAOA 4KQFA 4YT4A 3NO4A 4GVLA 4PTLA 3ZVKA 5AJTA 4EELA 4F6RB 5BUSA 3BWYA 3NBUA 1YWGO 1CUXA 2ZUDA 1JSRA 3UUFA 1I4OA 2R1ZA 3VH2A 3C6BA 3KLNA 3H3FA 1O03A 3AU9A 4AC9A 3FSGA 2GBIA 1YA6A 2JI7A 2PSHA 4YJHA 2BP7B 5F12A 4TYMA 2Q2WA 4OXKA 4L7VA 4ZV9A 1EB8A 4WGGA 2X58A 3L8MA 3F7TA 2X14A 1AZLA 3G89A 4TX1A 3U1BA 3G2KA 1T10A 1XYYA 3UEOA 4RV5A 3QE2A 1XL0A 3T3OA 4UCFA 2RGXA 3BS4A 2ZPUA 4NFLA 4MYSA 1A8PA 1XRSB 1QR6A 2EKZA 2OCBA 3DOCA 1XZGA 4II2A 1AKWA 1DG9A 5TEVA 1LF5A 5CW2A 3JASA 3OLQA 3PNPA 4S1WA 3MHTA 2G80A 3KELA 2FHPA 3L79A 2JGJA 4LOJA 3CA8A 4QUDA 3VU0A 2HLNA 3IPLA 3IEPA 4D82A 5C8VA 3KOMA 5FI0B 1N25A 4AWAA 5KYWB 1NMYA 1G16A 4RDIA 5FPPA 4HZUB 4UJ3A 4XYBA 5KMGA 4M37A 2QT1A 3C6XA 4N0MA 1ACLA 3X1MA 4JNCA 2Z8YA 5IWCA 3MJRA 2VP4A 5DMHA 3ZV6A 4AURA 1ISIA 1QZZA 3PNMA 3RFXA 2YOFA 3QVGB 3HYNA 1L5MA 2JZNA 3VDXA 1TMYA 2Q5OA 4RD4A 5LN1A 2ZJ6A 1EGHA 2A86A 5MFPA 2IHNA 5K8VA 2HKIA 3LUAA 3N2YA 2ODEA 5G0WA 4E07A 4OU5A 3SF8A 5ITZB 4HNQA 3REQA 5JXWA 1YUBA 1VJ1A 4RF3A 4HV4A 4DDKA 2FPKA 2GK4A 3ICPA 4TTTS 5ALUA 1U28A 3A1UA 1COWD 4M6WA 4NJEB 1DOAA 1DCFA 1EVIA 1RR6A 1YU9A 3P4XA 5TMDA 1C7EA 2B2XA 5A6SB 5DN6D 3BA6A 3IVXA 2KQUA 3MB5A 3BVPA 1I24A 2J9RA 2HQOA 2QW8A 2XUIA 3H8WA 3LHDA 4RWZA 5DWVA 4YAFA 4BB9A 4FB5A 4XVCA 1XRNA 4L15A 1WBDA 1GUDA 4JLDA 3DTVD 1W7AA 3SEQA 3ZE0B 3A14A 4PANA 2OCDA 2PYZA 1RZRD 1IWOA 3EGDA 2FCRA 4F5EA 7REQA 3KHUA 3PC2A 1Q1AA 1K8QA 1GP2A 2HV8A 3PGKA 4H17A 2IEIA 2ZAIA 5F9HA 4W9MC 2OV6A 1DKNA 5HF5A 1AKRA 2HC9A 3FCOA 3N5KA 4OXQA 4MUGA 3GZ4A 4ID9A 3HN6A 4RGYA 1KAQA 3D0KA 2FN8A 5FUYA 3VHXB 1NNSA 4F4IA 5AQEA 1Z7WA 3BIFA 3LT1A 4D9IA 2I62A 5CNMA 3Q8WA 3ITDA 5G4KB 1T2CA 3U37A 1XPJA 1FLNA 1HDGO 1EINA 2AXPA 3D4PA 3KDAA 4Q3EA 2QI9F 4M4SA 5GVSA 2N1BA 1KAOA 2WNHA 3GJZA 3IBYA 4ARBA 1S2NA 5JU6A 3H4TA 5JTUA 4X9XA 3SOPA 2FEXA 3GV0A 2JFQA 3BL5A 3ELBA 3J81A 2Q9BA 1V8DA 2H59A 3M2PA 3LV8A 1CY8A 3L8GA 4IP0A 1H93A 1RHJA 1NBMA 5FQNA 5J58A 5K5EA 3GLIE 1RI2A 3PG5A 3UHOA 4DEXA 3T1QA 2VWHA 4RPHA 2WJVA 5BVGB 1XHLA 4ENWA 2O06A 3OE5A 4FLMA 2H57A 2LV8A 4LSGA 3TPCA 3KQYA 4XFDA 2JJ1D 2MR5A 5EOVA 4G0WA 1ZMXA 3QF4B 1I14A 2CE2X 2E55A 5ARDA 3A1EA 4KSBA 5AKYA 3W7BA 2FP3A 3T5MA 1E1NA 1Y5LA 5E7JA 1HLPA 1U04A 3SS8A 4DBZA 5BV2P 4OHKA 3RVRA 3K0HA 2XB9A 5KQRA 2DFNA 1IJFA 3FH0A 1IK6A 1UP4A 4YCDA 5D3MB 2VHQA 3QVSA 4ZQIA 1BDBA 5AOBA 3QE3A 2BDEA 1NUSA 4Y1GA 3MC1A 2QGNA 4AMGA 4C4YA 3THSA 4IGAA 3PE4A 4F4DA 4IOKA 2YXLA 3DZKA 2X5NA 2VSXA 2XHEA 5AYVA 4EDHA 3R3JA 2H9IA 3KAPA 2DFLA 1N7HA 1DU4A 4IOJA 4LJ7A 5LA6B 1OXMA 1DXQA 2V7QA 4J43A 1OWMA 4MA5A 2W43A 4NZMA 3RJTA 1NTRA 2GPYA 3ZW8A 1NQXA 3A25A 3ITKA 5A4AA 2IDMA 3B1XA 3U3DA 4ESHA 1AK9A 1GR1A 1VJ5A 2JCBA 3PPXA 4NLLA 5KYXB 1FXUA 1YJ5A 2W2OA 1G8AA 1Z5OA 3ZHCA 5LIPA 1Z8HA 1UBRS 1JRLA 3QLTA 4DLKA 2B8WA 2Z9DA 4B3XA 1T0UA 4LECA 5ALDA 1H4TA 2XYGA 1VSQA 1YK1A 2FMIA 3O91A 5KPDA 3TIVA 1EUDB 2JGMA 1H8HD 2ALJA 4NYMR 1RJFA 3BHIA 4LQLA 1R9GA 4LGCA 1YS9A 5J4YA 3HKDB 5I9SA 2FB9A 1VL2A 4KO4S 1PG2A 1ZITA 4IEFB 5LYJF 1D2NA 1S8OA 3KT8A 4I9UA 1OMOA 2ZYTX 3BH7A 2Q5IA 4V3CA 1SOMA 1VI2A 1H22A 2KB0A 1OXKB 2HSWA 4XQCA 2FMKA 3FZGA 3GJ4A 3TTWA 3ZBTA 3UZUA 3R09A 3NHPA 2VKTA 4NJOA 4L5YA 4POAA 5D5PA 4O4JF 4UHFA 4XWTA 1QIKA 4HXYA 2BJVA 2BM1A 2DFKB 3M6LA 1OWLA 1WD7A 3HEBA 4LYGA 4RY0A 3GLGE 4RHXA 5A1TA 2GK6A 4XASA 1MO6A 3BDAA 1NMSA 5D00A 4OD0A 2NP7A 2O8BA 1GITA 1T5BA 4WFQA 1DDGA 1PJZA 2Q1TA 3I2JA 4JI5B 4C88A 1NR5A 3K2BA 4GQAA 2VJKA 2Q28A 3JD1A 1ENYA 1H0KA 2AC7A 3QEJA 4O6VA 4C7MA 5F2KA 1YACA 4KAXA 2GEBA 3SBXA 1VDMA 3BRSA 2FR0A 4YRAA 2XQIA 5A3QA 5HP4A 3H65A 4RZQA 3F9IA 2CZQA 2H4HA 3CONA 3E1SA 2J3LA 4BPBA 3C3DA 1L4MA 5HJ7A 3JATA 1PT6A 2EEZA 2Q4OA 4BX2A 5E0OA 3OAAD 1NQTA 2FR8C 4LC9A 1JIKA 4ACBA 1NATA 3HO1A 2FRDA 2O8DB 2J6CA 3C3JA 2BSAA 5CDSA 2CNBA 5JCZA 3EGXA 4G25A 4U8HA 2GERA 2HLPA 4TTIA 3B1ZA 4RM2A 4LGYA 4D9MA 2VK2A 1G59A 1PFKA 1M3SA 1GAWA 4NEGA 3KKQA 1E9SA 5AI0A 4BFYA 3GHYA 4C2UA 1RMTA 4RVFA 2OFOA 3ZH9B 1CF2O 1ZU5A 4DWWA 1M6VB 5EQFA 3CCFA 1O8CA 3V6MA 2ABWA 4PG5A 1YDHA 4QU8A 3S2SA 2XNKA 3NJRA 2E4UA 4X1OA 4ZI5A 2PYDA 4IF4A 4N3CA 3DE0X 2CVOA 3RIGA 3SHVA 3U1VA 5BNZA 4MVJI 4DLTA 3K9BA 5DW0A 4TLBA 2J3EA 3WGIA 2Y1LA 3GVHA 5ALKA 3RVQA 1ULTA 1BMTA 2ZJ2A 3M89A 1ZK0A 3DDCA 4ZVOA 2Z09A 3DDNA 5IM5A 2VT6A 3PGMA 1RQPA 3PU6A 4G9BA 2IPLA 5AM0A 1DAPA 1PO7A 2H7VA 1N2SA 2E89A 2OQIA 3NRCA 1M0WA 3DKIA 2Q1XA 4BBPA 3W4IA 5KUTA 4YUAA 3NV7A 3GG2A 4LDQA 4LDAA 5THKA 2QW1A 2X22A 4YCSA 1Q1EA 1UZMA 1YMVA 4CKEA 3P5SA 3DAHA 4ZZ2A 2NTNA 1JXOA 4L02A 5F1KA 1H2FA 1H2RS 2XMZA 2NO6A 4HADA 4EA9A 4EBBA 4F8JA 4DA8A 3RIYA 4RULA 1G64A 5F4BA 5TGTA 1ZCJA 3W6NA 3ZTWA 3N86A 3NC1C 2XEXA 1G17A 2NV2B 3WRYA 2DG2A 3RROA 3WHPA 4EVRA 1WY5A 4U7HA 1FRZA 4C0JA 3IV9A 3CVYA 1TZ2A 2F9FA 3FFWA 4NCJA 3I9V6 1ZUIA 3USCS 4MR9A 3BGVA 2Y0BA 5G0SA 2XUZA 4M0KA 2V4ZA 4HX5A 1FFSA 3FKJA 4MP6A 2ZUEA 3TLCA 4BO0A 1QHEA 1OI4A 3A6ZA 3QXXA 1XLTA 3SBDA 4WKCA 1Q12A 1X7YA 4IUBS 4REQB 2IQ5A 3ICOA 4EY4A 4YT2A 1D2RA 1XXHA 2PD3A 2PU7A 5EJEA 1JIVA 5BYJA 4JLPA 2MSEB 2J3IA 3GAZA 5HBGA 5KZMB 1ZPDA 1HXHA 1YE5A 3O5AA 4PGHA 5BYBA 4EG8A 3DH0A 5CW1A 2UZ0A 1F2VA