1P9OA

Crystal structure of phosphopantothenoylcysteine synthetase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
290
structure length
269
Chain Sequence
b'RWAEVMARFAARLGAQGRRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFPPQTWLSALRPSGPLSGLLSLEAEENALPGFAEALRSYQEAAAAGTFLVVEFTTLADYLHLLQAAAQALNPLGPSAMFYLAAAVSDFYVPPLQITMKMVPKLLSPLVKDWAPKAFIISFKLETDPAIVINRARKALEIYQHQVVVANIFVLIVTKDSETKLLLSEEEIEKGVEIEEKIVDNLQSRHTAFI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantothenoylcysteine synthetase
publication title Structure of human phosphopantothenoylcysteine synthetase at 2.3 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 84
structure length 269
sequence length 290
chains with identical sequence B
ec nomenclature ec 6.3.2.5: Phosphopantothenate--cysteine ligase (CTP).
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04127 DFP DNA / pantothenate metabolism flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CoaB-like 1p9oA00
5INTA 1P9OA 1U7WA 1U7UA 1U80A 1U7ZA 4QJIA 2GK4A
chains in the Genus database with same CATH superfamily
2Q2OA 1E3WB 1JR4A 3ZPXA 3HM9A 1EFDN 1FUUA 1V37A 3TZQA 3TTWA 1FX1A 4AMGA 4CG2A 2ZJ4A 1LQTA 3ANXA 4QU0A 4IH4A 4UAJA 2QPOA 4CHTA 2Q49A 4E1VA 4A2PA 3IR7A 3W79A 4D57A 4DABA 1II8B 1SWVA 1YOVA 4C6SA 2JLUA 3TZHA 4FFLA 4EKGA 2BMAA 4CKCA 4BWGA 4B3TB 2F4VB 3UOAB 4NJMA 1I5EA 3A1UA 3UC9A 2WHPA 2RHMA 4B2YA 5HF5A 2WJPA 3AC0A 1U4NA 2PUCA 2B0JA 2DHCA 3T7TA 1H1TA 3H8VA 4BO4A 5LQKA 1UJ5A 3HV2A 3LDGA 4R6WA 3DTVD 2EWVA 3LNTA 3HHPA 2ADMA 2POQX 3IT2A 1RLUA 3M4NA 3OE4A 3RTAA 3EX7C 1Z7YA 2F3RA 1EQUA 1MCZA 2G9ZA 3PIDA 4PE5B 5GMOA 4PZEA 3TL3A 1SK8A 2GT1A 4Q00A 3ZEIA 3VNUA 4JLJA 3BB4A 1OX4A 4FFBA 3PFBA 5H0IA 4DLBA 4MI1A 2GVDC 3GI1A 4EKNB 1Q0RA 3AOEA 1Z4KA 3L0SA 1L5NA 5HK9A 2W42A 1UMCA 4LHXA 4Y9TA 4IKEA 5JALA 2PS0A 3WDSA 4JQZA 5JVDF 4DDUA 3RIYA 1JDSA 1GZVA 4TUYA 5KTYA 4V3BA 3PEWA 4MRAA 4GQBA 1E9FA 2OV4A 3NVDA 5CLIA 1FFYA 2J9ZB 4Q19A 3RADC 1RRMA 1BCRA 2FEWB 2TS1A 2YVKA 3ZLTA 3ZXIA 3K5IA 4IDQA 4PBSA 2C4WA 2F64A 5GONF 3RVLA 1J22A 1T9GR 4U7DA 4KGDA 3KJGA 2REBA 4IKOA 4M37A 2SECE 3VGPA 4Q3OA 2O0HA 1JAYA 3H7IA 3ETCA 4NYIR 1E69A 3GYGA 4AWAA 4C4OA 4OHCA 5JYCA 3UHJA 3FTEA 5LMCA 3GJZA 1N9KA 2H4FA 3I9V6 1XJCA 3QNWA 3T5TA 3GQBB 3LL4A 4CV2A 2JGAA 4RKEA 2BYTA 3LS2A 2NU6A 3RR2A 3LHFA 3NCTA 1L3BA 2WKWA 3G6KA 4PLPA 1GD1O 1THGA 3AR2A 3JPYA 1G2OA 2ROQA 1KORA 3LQQA 3WV4A 2ZRGA 2DFDA 3AP2A 1WNTA 5GOTA 5T7BA 4URWR 2ACEA 1GARA 3DBIA 3ITEA 1RYBA 4CF3A 5AW3A 1SCUA 3C4VA 3ZHBA 4FX2A 4S24A 3FBGA 1KXZA 4YV2A 5CFLA 4MB2A 1EP3B 1AK9A 4XJSA 4C4XA 3JTMA 4WKOA 3IC5A 1M6VB 5JZSA 3MCZA 4R1NA 2Y6UA 1OXMA 3KALA 4HSGA 3KSMA 1M2VA 2AW3A 3PCRB 2OXIA 16PKA 2NO9A 1DHRA 3VKFA 5DI9A 2VHWA 2P2ZA 2O19A 1S1MA 2ATCA 4CG3A 1Z6AA 5EHXA 4JGGA 2WHEA 2FPLA 3DBRB 1RMYA 3RWMB 1OV4A 3SAJA 3ZZMA 4DQUA 3MCVA 5EXSA 4ITRC 2V5AA 4CQMA 2C5FA 5JAHA 3W5BA 4J16A 1XE3A 4O4JB 4P36A 2QMEA 2R1VA 4Y2UA 3UMFA 3ROTA 5DI3A 2HMSA 3GB9A 1TKBA 3RV3A 2ZBUA 2PL1A 2Z9CA 1X0XA 1QC5A 4OY3A 5EJGA 4RXTA 3VR4A 2ZRDA 3KBOA 4KZKA 1SCKA 3NGMA 1DGQA 2XITA 3JV7A 4Q6WA 2RGBA 1UPTA 1IRIA 3QFSA 3UMCA 3PNPA 3PR2B 5KAMA 1L5RA 4AY3A 3FGZA 3FSGD 2FSUA 2PA3A 3NWOA 2W90A 3KZ1E 1ND5A 4BECA 4G0WA 3ZOZA 4ENTA 4K6FA 3JR7A 4KBYA 1U8UA 3DF9A 1MC4A 2E48A 1JTVA 1JR3D 5E1MA 1DCTA 4A16A 1EFTA 2GERA 1USIA 3STVA 1IXYA 4JIMA 3KYBA 4G1VA 4N6OA 4RJIA 1VSUA 1JG3A 3Q5DA 4PRZA 2ZBPA 1KYTA 4QLOA 3DTTA 1M2OB 4PC7A 3T7SA 2Q5IA 1EFLA 2WTMA 4U3JA 4JLDA 3RC1A 4D99A 1THTA 2QIPA 2Y1XA 4L9AA 3PICA 5CNIA 3ONVA 2H0QA 2J3DA 1IN7A 3FUUA 4M22A 5B3AA 4IZ6A 3AUYA 2OWEA 1E2PA 5GAJA 1LTHR 5A62A 4U2DA 2MSWA 1IQ0A 1KVRA 2C88A 4X0EA 5F9MA 1QH1A 2OLEA 1P9WA 2VDNB 3TG8A 2CE7A 5D85A 5JAIA 3NHLA 5LA6B 3IKLA 2GYUA 3VMFA 4QQ8A 1K4YA 2B1QA 2IEYA 3KS9A 2AOXA 3Q85A 5ICGA 1T9DA 3RBAA 1U2SA 3PC6A 1JXAA 1VBMA 3PXGA 4YRBA 2G0AA 4DLPA 3KZCA 3PEVA 3BTVA 3G5LA 2G5GX 3MWKA 3ABOB 4YH1A 3HBMA 2DC1A 5DOZA 3PENA 1JJFA 2XD9A 4L51A 5IWAB 2JAUA 4GO1A 5HIIA 2QE7A 1IN6A 3LUDA 5EYPA 1QR6A 2D3WA 1JBQA 5LP6A 1TU0A 3N5KA 4ZOEA 1NDHA 2IW3A 1FMCA 2FMUA 2JFNA 3KEQA 1QVVA 4LXYA 4ETMA 1DIAA 3I5UA 3WIOA 5AM2A 1M8FA 4LOLA 2CL5A 4BZXA 5I9MA 4ROTA 5AHKA 4QEDA 5E4TA 2O8EB 2RAFA 1A4IA 3L0DA 3ND9A 3OJLA 2APJA 3D5QA 1AKQA 3BH7A 2HKIA 3SK0A 3IPLA 4B3DA 3P9IA 3STYA 4JLBA 4LNUB 1Z6XA 1XWFA 2OFWA 4BNZA 3R5KA 1IHXA 1RRFA 4N9QA 3OZCA 5JO9A 4PS1A 4NMXB 4GOND 1H05A 1UK8A 4UASA 5AJYA 3WSVA 3QVWA 3TW8A 4XWOA 1VMKA 2Y1OA 4JENA 3H19A 1FVXA 3IVXA 4WMLA 3RYIB 3EPKA 4JI2B 2GX6A 3N3BC 5DHAA 1TU3A 1MJHA 3P2IA 3AU8A 5CA0A 5T6BA 2DY1A 2NYVA 5CVUA 3VH4A 3D5EA 1U65A 4G9EA 1QIHA 2QLFA 1T91A 3WB1A 4EKYA 1ZD2P 4ZO6A 2CHFA 3IUJA 4MR7B 4V0OA 4CDNA 3WY9A 2IYLD 3ZDQA 3WO0A 4ZMBA 4BP8A 4IXMA 3PKZA 4IYJA 3ERCA 1X94A 2LD4A 2Q2WA 1UBEA 3O4VA 2C42A 4DJJA 1PZMA 2FQWA 5KYXB 3SYLA 1QYXA 2WSYB 3CHYA 5KTTA 1X80B 4BZWA 2PX3A 5HUHA 3EGXB 3X1ZA 4MWGA 2PGIA 4A2WA 4BQSA 1ILWA 1FNSA 2D8AA 5CURA 2ZI6A 1BX3A 4UKDA 4Q34A 2CUNA 3O3MB 2I7VA 4GOOD 5M3BA 1MOQA 2WNIA 3N0XA 3RIGA 1ZGBA 3O93A 5DHPA 4R9UC 3PK0A 3H6GA 2V7VA 1KJQA 2JIQA 1SU4A 3DHVA 4M6WB 4KXYA 1RD4A 3UMGA 1NBIA 1P2FA 4M9SA 2JIZD 4ABTA 2J0UA 4OHMA 5IUNC 1B00A 1QIGA 1XPUA 4M7PA 3ITNA 5HVNA 4D3ZA 1DEHA 3P0JA 2HWXA 1DOHA 4IIEA 4HRVA 1PR9A 2GTHA 1C9KA 3JATA 1NVBA 3FGOA 3LLCA 3MTIA 3DUWA 3PHGA 3C48A 4LECA 4HQLA 3V34A 1VP9A 4AICA 5LM3A 4UZEA 4XYMA 5KQPA 3TZCA 4N0EA 4YA6A 1N5KA 5LBIA 1NM5A 2HEGA 1MC1A 3UM9A 2IWHA 3VO2A 4JCCA 1A96A 2VAWA 3ZI4A 4B5KA 5DYTA 1DPFA 1WKBA 2QU8A 2HT1A 3H16A 1ONNA 2XCIA 1VKJA 4YC7A 2BI4A 3KE8A 1HLDA 1T3TA 1A9XB 3OZIA 4HGNA 2H4HA 4J0EA 5KBYA 1DRJA 1PV1A 3GLSA 1E3WA 4B6OA 4WLUA 3X44A 3JVVA 3O0TA 2IH5A 5FRDA 4H3KB 1J90A 3KHSA 2IF0A 3ILSA 1B4DA 4MYTA 3ZZUA 4F5WA 4TXHA 4R83A 5F1YA 5B7NA 2QY6A 2XQFA 1II8A 4HDCA 4BWYA 4Y1RB 1QNFA 2C61A 2OXCA 4FGKA 5C81A 1WEHA 2VRCD 3WZMA 2HBRA 5K0NA 5JCPA 5LSAA 5C5DA 2EZ4A 3DEIA 3WI7A 2A8YA 2EV9A 1VMAA 3MWDB 2J7PA 3P0EA 5HIAA 2PRYA 2ZRFA 1NGSA 3GJ4A 1IUNA 2JLYA 4TVKA 4W82A 2CVPA 1AQYA 1QRAA 2ZCJA 4XAQA 1T9BA 1B41A 3WL8A 1H9BA 3HYRA 3H9UA 3PBKA 3BMCB 2JLSA 3GGPA 2XUZA 3I9FA 3ZR4B 3OFKA 4MO2A 1U9ZA 1DRKA 5EKXA 5L3QB 2QD4A 5IARA 2P6RA 1PL0A 4E5KA 2DFNA 4FCTA 1CNEA 4FFVA 3UK2A 3EODA 2IOQA 4D3YA 3GGOA 1GCOA 1GSAA 2QI9F 1HXHA 4H18A 1W76A 3SQOA 4AXXA 1G21A 4RF5A 4R5MA 1OWLA 4LSZA 2I2AA 3B6MA 2FUG1 1T5OA 4WSOA 3GH1A 2FQ1A 4QRIA 3MELA 4J6FA 5EMKA 3O2JA 3TOSA 3HYSA 3FUTA 2QRGA 1E60A 1W6UA 2XX3A 3F6SA 5KJCA 4NV0A 2C2WA 2CL7X 1DLJA 4RTOA 5EMJA 3QLJA 3G02A 3TCNA 1Z0DA 1KDOA 2FUNB 3NC4A 4NBTA 2VP0A 1XYYA 4TV9B 5JNRA 4CEIB 3DEAA 4OUDB 5DEOA 4EX6A 1GQ2A 2BBSA 4PC1A 5AT1A 4GHWA 4GVXA 3MT8A 2JJ1A 1BD3A 3R6WA 4IM7A 5I8WA 1RNLA 1MW8X 3A31A 3F6CA 5IMSA 1GT91 4MEJA 3T4UA 3OEHD 3V1MA 2WPNA 1PFKA 3VR5A 4GOKA 4XUDA 4U7PB 3GJ8A 2VNHA 3CA8A 1KK3A 4EP1A 5CXXA 2WKPA 1W2WB 2D5BA 2QNRA 4N8SA 4OFZA 1AG9A 1MDFA 1WZEA 4UEOA 2NU7B 4RABA 1U5BB 2R7LA 3DOIA 3EOAI 3KNZA 4MINA 3NM4A 5TR9A 3TQHA 4D7AA 1YH3A 2XODA 6NULA 5K99A 4AO7A 3UAYA 5K4GA 4JU8A 3SC6A 2XLBA 3WYDA 1M6VA 3BGOS 4P98A 1V5IA 2XBMA 3UGKA 1SC1A 4LHWA 3JYOA 1KJWA 3TQIA 4YV0A 5IANA 1IRXA 4CM5A 2AL7A 4D92A 3ZGOA 2OZEA 4NOLA 2AX4A 3VNAA 1LVUA 2BGRA 3A4LA 4HS4A 1R6XA 3OAAD 2XVAA 4QOEA 2JFQA 3UWMA 4AJ1A 4DM7A 1KI2A 3DBRA 3NATA 4UOQA 1TGYA 1NRXA 1LEHA 4GUDA 5A4MS 5L3RA 2ZJAA 3I9V1 2Q5EA 1NRIA 3WBJA 5LBUA 5BR7A 4O4JA 1BHO1 2INGX 4U9UA 4AROA 4ENVA 3O5AA 3QW2A 5LB2A 4E94A 5EFOA 2EP7A 3WWDA 1BYIA 1TQ6A 1OCEA 2A35A 2BRUC 1C7IA 1CETA 2CNWA 2COEA 2FUEA 3L2OB 1L8XA 3R0ZA 4HPWA 4TSKA 4BPBA 1W0JA 4C7OB 4B76A 3Q8WA 3HN2A 3A6PC 1NJSA 2ZQ5A 5HKBA 3T9BA 1OZGA 8ABPA 4IP0A 3GLGB 3G8BA 4JGBA 4C0BA 4W5WA 2HHHB 3QFCA 4QOJA 2X4DA 3NAMA 4QNRA 4TTJA 3VC7A 3ZLVA 4EG7A 3F3YA 9ATCA 3DAGA 1LQ2A 2HBZA 2Y1GA 4DV5B 4PU0A 3BH0A 3T7KA 3CONA 1ZH0A 3GJ6A 2YVUA 3VVLA 4B3HA 2XB4A 1YS7A 2ID7A 4L4ZA 3GGSA 2G71A 3TNDA 4GI3A 3D64A 5UKDA 2CJPA 4C4PA 3GFQA 2WWGA 3L0YA 5AKXA 3L1KA 4RANA 1GA1A 821PA 2G4VA 2RG7A 3C4JA 3MJVA 4KMRA 2QX8A 1F0KA 2Y71A 1M2OA 3GFOA 2FQQA 5KTNA 4HLCA 5JEDA 1B2LA 2WIJA 3OH8A 3B7PA 3IHLA 4NAHA 2PWPA 1NJ6A 4PPNA 3RJZA 2VZLA 5C37A 2QP9X 2Q5JA 2W6CX 3QY9A 3LX5A 1BVRA 4E2ZA 3PLAE 5BV0A 4WXEA 3C3EA 3HBAA 4KNVA 5FTKA 3QMVA 1CRPA 2CNDA 3P2YA 3PHBE 3RG8A 1Z63A 4LZWA 1LWNA 1DOZA 3VSCA 4NOJA 4HYEA 4JJ4A 1MBZA 5CX1A 4PY2A 3L7YA 1JECA 3WRYA 2ZJZA 4TLAA 1OH5A 4XIYA 2WY2D 4IWYA 4XCXA 1UZNA 3DYVA 4RH0A 5G4KB 1TYAE 5GJVC 3C3PA 4QWMA 1IN8A 3BSFA 3JQQA 4I7EA 3WL3A 4JI3B 1E64A 4HWRA 4J2OA 1QHSA 4XWTA 1CXZA 2PSHA 4BRUA 4CCWA 4YCBA 1VRCA 2ETVA 2HSJA 2I1VB 4N0MA 3C7CB 5A4KA 1C7EA 1T2UA 4Y2GA 3GVIA 4GDMA 3PTLA 2CWDA 4GPTA 2G9RA 2WRZA 1TTQB 3DNFA 2X1MA 3WOVA 5DN9A 1FRVA 1OFGA 1GYRA 1PKXA 1Y5MA 3IT1A 4NP6A 3I6IA 1CIVA 3NR2A 4Q66C 4YS6A 4B0OA 4CV0A 2XA1A 3I61A 2OFPA 4DPMA 1OB2A 2HLDD 4EHNA 4NYMR 1DC8A 1RMTA 1L4YA 2I3GA 2O8EA 3NKFA 2QN1A 3GEGA 3L6BA 3VOAA 2ZB4A 3JQPA 3KQPA 4GL2A 2WWHA 4LFBB 4O3FA 1QONA 5ER9A 4DG5A 2JGIA 4LNUA 3BXPA 4EHBA 4PAOA 2ASVA 1M1YA 3DM9B 3SQXA 4WUTA 4XPIB 4UHKA 4EGAA 4XRGA 5EINA 1E7QA 3RYIA 4GEGA 3UHPA 5K09A 5IYZB 2BBWA 5BXQC 1UOEA 1Z5WA 4GWLA 1R8SA 1SIUA 2OCKA 3AFNA 4LY0A 5CDTA 1RXIA 4DZZA 1W5BA 2BT4A 3R5XA 1E1LA 1LH0A 4WA8A 3TX6A 4D45A 2VJAA 3K96A 1GKUB 2YUIA 1M6WA 3V55A 5C53B 5ALTA 1GRVA 5DHSA 1J8FA 4CKYA 4HAYA 2ZU6A 5KNBA 2B2XA 1L4NA 2V59A 5ALXA 1QO0D 3HJTA 4R9VA 1IHOA 4B85A 4MDFA 1QVZA 2IYAA 5KNLA 4UBMA 5KYXA 2YRWA 1VRVA 1X80A 1ZVJA 3D8HA 3LVBA 3EGXA 4BTVA 1C4XA 1GRNA 1PUXA 4ER5A 3TQFA 1C1DB 3B6EA 1L7RA 2PZ8A 4LY6A 3BRCA 3L9WA 1XRNA 1XRJA 2K5UA 5BVGB 3QFTA 2HU5A 1FY2A 2I6SA 2WPDD 3PUWA 4XB1A 4DNXA 2R68A 1CDOA 4CNQA 2BEVA 1U3UA 2RHDA 2VP2A 4J3FA 2PLNA 1NX9A 1Z38A 2E4AA 2PL9A 3A06A 3R0IA 4M6WA 3T5AA 3EVCA 2X6QA 3IQEA 4REOA 4YO7A 2O23A 1FTSA 2OORA 2XB2A 1ZX1A 1CP2A 4XUGB 1X1SA 1IQUA 2OBMA 4ALMA 1JZSA 3ETNA 4QA9A 1T9GS 3BCRA 4PG8A 2D2IA 1ZN9A 2HI0A 4LJKA 3DO6A 5LZ8A 2JLXA 4HC4A 2YIVX 2XADA 4INJA 4XGIA 2GN1A 4JJFA 2F1JA 2H29A 3L4BA 4OHXA 3GA0A 2JDID 3NNDA 5C4GB 3Q9LA 3F74A 5TEWA 5CH8A 4CI0B 1E2EA 3VAYA 2ZB8A 3N76A 5A05A 3Q8XB 1C81A 2IYUA 3ZGXA 4K28A 2CCGA 2WG0A 4D80A 2PGOA 3WLNA 1HI9A 2IKSA 2WTAA 2ZP1A 2QR2A 2ZVQX 3MCWA 3OZ7A 2M1XA 3EY9A 3JQ7B 1CC1S 4UEKA 4O5AA 5AK6A 5IAOA 1TEZA 4AYXA 1FNNA 2Z2KA 1PL8A 3L8FA 4E2WA 1HNZB 2FHPA 2ODTX 5DV9A 3TEMA 2Q3CA 3B8EA 3BB3A 4UDNA 4M8SA 4RX1A 1U8EA 4YCMA 1TUBB 2IYEA 3UTDA 2H1SA 3A4YA 4FCVA 1HQKA 2RK4A 5E6SB 4EEKA 5ELLA 2ILTA 1DVRA 2FPSA 3PDUA 3H11A 3MTBA 3PX3A 1GUFA 1E0SA 2AXPA 5JTUA 4RD2A 5JSKA 1UBRS 3A9TA 3G7SA 2BFBB 1S89A 2WMYA 3GG9A 4MW5A 4OSOA 4BB9A 2C29D 3MWDA 4HX5A 4OM7A 2IITA 3TE6A 3WDKA 1F17A 1M7GA 2PKQO 4ZJPA 3N6XA 1T3SA 5B37A 1VPDA 1AQNA 4IS2A 5EKTA 3HVHA 4EYEA 2QXUA 2JL1A 5I4KA 4U1RA 2XNKA 4ZALA 4N47A 1TTTA 4L02A 3ZE8A 4OU4A 2VYVA 1GRCA 1NC1A 1QPGA 1RBMA 1TJYA 1Z47A 4M9ZA 3VO1A 5A0TA 2V7GA 1IM8A 4CE6A 1OAKA 2QPLA 1QXSA 3D8RA 4XD7D 3TRIA 5L3QA 4DA6A 3DLHA 5F12A 3DNMA 3FYSA 1OBCA 4JBHA 1OGYA 2WSSA 2BZGA 4ZEWA 3M1AA 1E2MA 1Q12A 5IASA 4UAUA 1VC2A 2NTEA 1DRUA 1ZL0A 4QOSA 3WGKA 2H4WA 5KTPA 5FO1A 1GN8A 4DE5A 1E79D 4Q3EA 2VP9A 4AJHA 1XDZA 4HH0A 4LDJA 3AKCA 3GLRA 4PXSA 4AG6A 4PZDA 4RJJA 4XH9B 4HMQA 4D42A 5CNMA 4PHGA 5KREA 1A98A 3BTSA 5ITZB 2UYCA 3OEED 5H4HA 4CEIA 1TLFA 1TIBA 1P7PA 4TV9A 4OUDA 4AF6A 1SUWA 2X0NA 2JVKA 4TLDA 4V0SA 4OXNA 4FJ2A 4QUBA 3AM5A 1D6SA 1ADJA 2QZSA 4CQLA 1X2BA 4D5EA 1BGWA 1NTRA 5KC8A 4BMOB 4DLVA 3I92A 2OAP1 4UVEA 3U2QA 3VSAA 3WRXA 3DVAB 3HYTA 5FNVF 5EQDA 4AECA 5DHRA 3NVAA 1BQEA 1GPLA 3ZJUA 2PMFA 4EY6A 1ILEA 4IEEA 2ONCA 5FKJA 1OYOA 3K0EA 4HTAA 1FOEB 3O31A 4II7A 4OQQA 5AKHA 3LUKA 3VPCA 1XA3A 2QTGA 3QKIA 1DJLA 1AXRA 1DIHA 4IICA 5CNKA 3T4EA 1ZMOA 2NU7A 1G5HA 4UBNA 1ZN2A 2A9JA 3VPSA 1KRHA 4G4SP 3A2NA 2UZ1B 4CDGA 3AEKB 3HSYA 1C9NA 4RNDB 4LQ4A 5AVUA 1L7VC 4R41A 1L7XA 3PB3A 3OUZA 3R5JA 1LY1A 2I6GA 1XD9A 4EUFA 3B60A 1FVFA 5EEHA 2WJJA 1SO8A 5FUQA 5KKAA 3RJ9A 3DPIA 4CFZA 1MPTA 2CDAA 2E9SA 2HLPA 4KXMA 2O9JA 3DTVB 4MV0A 5E3HA 5F3WB 4N3CA 3KXDA 4UNPA 4QXRA 3H2BA 3KZKA 3PQ4A 4BBAA 3NQ41 1PK9A 2H5IA 4QELA 4CEHA 1HYEA 4HN4B 3U3MA 2C0QA 1XLTA 3F4KA 3KR0A 4P93A 1VIDA 4GPIB 4IO0A 3EVAA 3PJRA 1PI3A 1UBSB 1UKCA 2RGGA 2UZ0A 3UW3A 1W93A 2Q28A 2Z83A 4E30A 1UWCA 3GU3A 4NQZA 3OF5A 3UGQA 4WJLA 4YACA 3BM5A 1PFWA 4ZWNA 6Q21A 5MF6A 3QE9Y 2C5HA 3KQHA 5HS4A 1E1YA 2D7DA 4E14A 3M6UA 3AOGA 4LOJA 2FY8A 1TW3A 3FNFA 5F78A 4A5SA 4DIKA 3BCSA 3TQSA 4RV5A 3T3MB 5AWFC 3H1AA 2C2BA 5IVKA 3ZV4A 1NSFA 1R50A 4HGQA 1DDGA 3S2EA 5DTJA 2UZ4A 1MIOB 2G09A 2VPTA 4OX9Y 1ZHOA 3CZ5A 4MGKR 3O8QA 2HA7A 1Z0KA 1G8YA 2CNLA 4B40A 5CG1A 1YMVA 4XE5A 3LY9A 4AMYA 3GHHA 4RHFA 3RUCA 2OQRA 4PZ0A 1HY3A 4C3ZA 3F96A 5C1OA 1Q2UA 5HHTA 3CLRC 2FMFA 4IXNA 2PRIA 1J42A 1GNQA 1CB7A 4FGZA 3SQNA 1A5AB 3EMDA 1V47A 4H7IA 4EHHA 4PCUA 1RFGE 2J5KA 2ZIFA 4FOSA 1LDEA 2VPYA 4NBLA 5G4KA 2G9QA 2ZETA 3EZ6A 4AB1A 3ZDZB 1JEDA 2FRDA 4Z0TA 3SZOA 4M0KA 1B3RA 4FGSA 1QYWA 3UPUA 1BS2A 4A23A 3GELA 2I3DA 3EAQA 1E6KA 1UC5B 3AVTA 4CCYB 5KTKA 1ZHFA 1EBBA 3I5AA 2FR0A 3IUPA 3MK31 2R7KA 1VL6A 1KGSA 2AFVA 3BWVA 4NCJA 2WAAA 3DE4X 1DQNA 1F8XA 3CVOA 1IQRA 1IEWA 4XOIA 4E12A 4RZQA 3HV0A 1D4ZA 2R6ZA 2DWQA 2O3RA 4HNRA 5K6TA 2TMGA 2GK6A 2Q1WA 1EVLA 3MXTA 5ALYA 4NXNB 1ZUNB 3ISVA 1DPGA 1MEEA 4KH1A 3IURA 2BKVA 2RHJA 4HXFB 3MWGA 1XTQA 1TA9A 4Q82A 4Z9AA 3TN7A 4HWGA 4B3BA 2KYRA 5BSFA 5AI4A 3KJHA 2E18A 1YDFA 3KOWA 3V7WA 4EY3A 3QVJA 4UTRA 1KO7A 4CMKA 4FUQA 3AX6A 4FQ8A 2R6HA 1KVSA 3D0RA 3P96A 2PX5A 3N6RA 2CGEA 1N9ZA 5H1YA 4S12A 1GJRA 1TGVA 3W9UA 2ZIGA 2MIIA 1XTUA 3KPJA 1KVUA 3O4GA 4OHFA 2Z8YA 1C1XB 3JQBA 4H9GA 4XPIA 2J59A 4F3TA 1RTKA 1LW7A 2R6JA 3SSNA 1GZ5A 1NMEA 2IH2A 1DFHA 4OX9B 2DJ5A 4RELA 3CWZA 3N2EA 1D6JA 1T2AA 2LCQA 3R74A 4FFWA 2DR3A 3S81A 5C5CA 2XQJA 5IYZA 2CNKA 3U5TA 1CIJA 2QUBA 3AFGA 1I3MA 1NUUA 3SSAA 2NQTA 3ZQ4A 1FU4A 1D9ZA 3OPNA 1U02A 3L7DA 1CY8A 2G5TA 4J2HA 2JIRA 4E70A 3P2JA 3ICPA 2FSFA 4K3VA 4EHKA 4YHHB 1BXGB 1FYXA 1WPQA 3AR4A 4A27A 4BX9A 1IY8A 3TKYA 3SQWA 1EQAA 3R5HA 3F7NA 3ER9A 5I7SA 3BZBA 4WBSA 3T3OA 3MRSA 1NVEA 3AUKA 4IH1A 4JX9A 4ZOLF 3ICVA 4JHXA 2P40A 2DM6A 3KWJA 1MEJA 2DUNA 3T95A 4UHDA 1PR1A 3RS2A 2W6OA 3NFRA 3L1IA 5BW4A 5I4IA 3KU4A 4RLSA 4NCKA 5C8YB 1PZHA 4P4GA 1DBVO 1C1DA 1FP2A 1GNRA 1NUSA 1U8AA 1JQAA 3KFVA 1LPOA 3PUXA 4P6VF 4QJ5A 4WKNA 4JI1B 4R71A 1QOZA 5A0VA 2FPWA 4J0FA 1P17A 2ERXA 1G7SA 1DX9A 4YT2A 3L0IB 1KNXA 3BFPA 4KVGA 3T61A 1FMFA 2A33A 1X1EA 2ISQA 5I45A 3KAJA 1E2DA 5J4HA 3KELA 4PNEA 4ZYZA 4U7HA 5LVAA 3EB9A 1P0QA 2WDPA 2XUIA 3E8MA 2CJFA 1Y98A 1LK7A 2Q6KA 2ILVA 2ZYGA 4UU8A 1X92A 4FOOA 5TGZA 3MN1A 5HM8A 3C1TA 3OECA 4OJNA 4Y2HA 1LUAA 1SFRA 1HE1C 1Z2PX 1RI5A 2RJNA 1J1IA 1U0GA 4MWCA 1MQAA 4RKFA 3ANYB 2OD7A 3E9QA 1JSRA 4Q21A 1FXWA 5BMOA 2OZPA 4D26A 1N6NA 4PQRA 1YDEA 4FNAA 1GZ4A 3EUAA 1TOAA 1XNGA 3O1LA 2B4RO 4HK4A 5KJEA 3TL6A 6ABPA 2DLCX 4XIGS 4B6GA 2G9NA 3EGDB 4E5VA 3A9UA 4PO3X 2Q07A 4IWNA 2C7RA 4WI1A 3NBXX 2NTYC 2QX6A 4LN1A 4QVKA 2P1DA 1J8VA 1IOVA 3CUTA 4P0PB 1J99A 1ESNA 1TUBA 1EFAA 5E6SA 1XMQB 1KQPA 2BKEA 2WV7A 1SKMA 1E4OA 4X1IA 2DWOA 4J43A 2DQ4A 3EPLA 1VPVA 4QUKA 3WWZA 5JARA 3LUHA 3U1TA 2YVLA 2YWGA 3EK2A 3HB0A 3VVMA 3F3SA 1JKFA 2PAFA 2XOKD 1GR0A 5DYNA 1IAQA 2C97A 2YZNA 4GP7A 4URZR 1T2FA 2BFBA 2PBFA 5KVQA 3NUQA 3ILYA 1UL1X 3AKEA 1ZIXA 2YCLA 4BFXA 4OPMA 1KMIY 2VDOB 4FWBA 2I8AA 1GTL1 3V33A 3SP1A 4AY2A 4KQEA 2C2HA 2AI1A 3BF8A 1U9CA 3O2QB 2P2SA 3ETJA 5LPNA 2KMLA 1CVRA 1EFKA 5CK5A 5GZ1A 2VDQB 2GCGA 2F9FA 1VL5A 4G4JA 5EP2A 3NT2A 1TAQA 1A7KA 1NQTA 1TMOA 4DG8A 1RZVA 2F9LA 4Y2TA 2AOWA 4HF7A 4Z7QB 4RK0A 4LHZA 4P82A 4Q15A 3ZC3A 1XAIA 1W0KD 2ZCVA 4KN9S 2IBMA 4Z4GA 3FLBA 5E7QA 4LEIA 3K0SA 4U00A 1VZ3A 1PEAA 1EA5A 3ZVRA 3HEBA 4ZDKA 2CXTA 1E2KA 3VX3A 2O2IA 4IIGA 4YI5A 1AQJA 1PYOA 1T4CB 4DCUA 2P6OA 2C5EA 1J07A 2IXFA 2JFPA 3TCXB 1LSUA 2R4TA 5G0VA 1H8EA 4F3YA 5ITZA 3ZY5A 1C7QA 2DWUA 4I5IA 3MAGA 4RF4A 3PQ6A 1ZNXA 1JIKA 4NTZA 2AA3A 4QOFA 1IUKA 4GZLA 3EVEA 1DJNA 2FJPA 4AL4A 4CVNA 4X8LA 1F1BA 3WLMA 1CWUA 1NBAA 1NRJB 1RJFA 2R6R1 2YY6A 3F5FA 4YQYA 1R9NA 2ORIA 4P58A 3RS0A 4ZPJA 3FIUA 2XNCA 3DVAA 3PC2A 4TMVA 4X7PA 4KQJA 1WRBA 3TB4A 3GLHB 4OAPA 3WK6A 3ONNA 2X0KA 5IFLA 3QUAA 4HRAA 1EUCA 4RL6A 5ARBA 3C85A 2COUA 4ZP1A 3W5IA 2R7MA 1XTSA 3BIWA 3TEJA 4ONEA 3I30X 1NULA 5AVVA 3PG5A 3BA1A 1LZLA 3EXIB 1GTVA 4NR0A 4Y8VA 3U4HA 2JD0A 2UZ1A 4GYYA 4COKA 3QE3A 3AEKA 4V0NA 1U2DA 1EU1A 4NFHA 1R0SA 2BKUA 4AQDA 1Y1LA 1RS0A 5LJIA 2GCOB 3WGZA 4EH1A 3NTOA 5DXAA 1E1MA 3BHNA 1KHHA 3EWNA 1LDYA 2DPGA 4BLPA 4B84A 4DHWA 3VU3A 1ZOPA 1C29B 3K2EA 2Y1LA 3BWBA 1DO8A 1YZUA 4UBKA 4BO9A 4DMRA 4MP6A 1AO0A 2R751 3VV2A 3ORFA 1H85A 3DTVA 4LVNA 4US2R 1A5TA 2GILA 2HSGA 4I3GA 1N1EA 2HMAA 1WQ3A 3BF7A 5SYAA 4EQZA 5LQRA 2XCRB 4IRUB 1M1ZA 1I7DA 5KNCD 4C4TA 2CC2A 3PJDA 4MWTA 3WDMA 2J3JA 4RH3A 1IH8A 4N03A 5L53A 3Q6MA 4RY9A 1QGZA 1SN7A 2PZJA 5HE9A 2GZRA 4A91A 1LF5A 4HKTA 1F2UB 5TRTA 3WKEA 3HB9A 4DCTA 5B2FA 3G2QA 4JVLA 4OLBA 2LWIA 4KVAA 2HJVA 4EO7A 3AHDA 3BUSA 4FT4A 3W4JA 4F5EA 5BSHA 4NEGA 3ZU2A 5E38A 1T35A 3OU7A 3QXXA 3R5TA 2B7BA 1UXKA 4N40A 1GGFA 1S8NA 3RRBA 4YMVA 1KR5A 3FRHA 4HWTA 1I80A 2LP4Y 2YWRA 4A8JC 1KKMA 1ADFA 3TZ6A 5JRDS 1RPAA 1ZINA 3KFLA 3IULA 3IB3A 3OQJA 5T4BA 5IN5A 4F97A 4M9CA 4ZVNA 1FYVA 1O77A 2IP4A 1YZGA 1N5RA 2P9YA 4OQ4A 2OFOA 4TWBA 5BSUA 4DRXA 5LP1A 1MIOA 2VUHB 4WFKA 2GK7A 4HLDA 2QX7A 1QP4A 3ZVKA 1V6AA 3A1EA 1EK0A 2KS6A 2LBPA 3CGWA 4JKYA 1FP4B 3EPHA 4WNIA 5G3YA 2PH3A 1KDVA 3UMMA 1N34B 2GNPA 3ZZ0A 3PC8C 3OT1B 1LBEA 1EFCA 4Y2PA 2CDNA 1EGVB 1LDNA 1S1CA 2OCPA 5DN6D 3WSWA 5LQNA 1GYPA 4JBXA 2CVHA 1RPTA 1V4VA 1DUIA 3IAS6 3CW9A 2C57A 2FFAA 4ESOA 5BY2A 4IDNA 4V24A 5LDGA 1GYQA 2P4HX 3GLUA 4HAWA 1E18A 3IEVA 1E9EA 5FX2A 1TAGA 5KC9A 1NUAA 4XM1A 1IUPA 3LO8A 1N77A 4KE8A 2B6NA 4J0JA 3GMIA 5DB4A 2ZZMA 2WF6A 4HR7A 4CCYA 4CIDA 4EHLA 2DULA 3V4RA 5B6JA 1WXXA 4UVIA 2YOFA 2PU7A 3KEGA 2D0DA 1UJ4A 2GZSA 3HY4A 4HBZA 1C5KA 1KY4A 4TM8A 4JC0A 3S2IA 4JLOA 2IV3A 1I3KA 2XMBA 3LTEA 3PQ7A 3IQZA 1ZUNA 4GXTA 5JZBA 5JDCC 3MD0A 1PQYA 2EYUA 3A9RA 4M8NE 4RVUA 1CUYA 4BNDB 4OMUA 1NNEA 2DXIA 2FVYA 3M5PA 4AS2A 4PZZA 3LRPA 5CA1F 3MM4A 2OB1A 3ESXA 5ED4A 3E5HA 4ZPXA 1QK3A 2EERA 1AKWA 3C3YA 2GN8A 3FFTA 5K3SA 3ZG6A 4ARBA 2VNKA 5ILOA 1BXKA 3O8RA 1ZCZA 1P7ZA 4BLTA 5FBVB 2HNAA 1C0IA 1WCV1 3FSGA 4W8OA 1U9IC 1T1EA 4D6PA 1S2IA 3K70C 3PEYA 2XDWA 1C1XA 2I3ZA 3FSJX 4RUKA 5DISB 5DP2A 5FYDA 3W6OA 5JQWA 1Z18A 3P5BA 1Y6ZA 2CN1A 2R87A 1IBMB 2HB6A 4MVJP 2PKWA 1SBQA 1NYQA 1U5AA 3HO6A 4PNHA 2XYGA 3EVFA 2A9PA 3NGXA 5TGDA 1EFVA 3WMEA 1CQXA 5HF9A 5BORA 4L6CA 4L1KA 2VQ3A 3MT9A 1AKEA 1B26A 2B8TA 2W6JD 3CFYA 2CUZA 3GPDG 2PSFA 3RD5A 2OV8A 3C87A 3S70A 1G18A 3LBFA 3LHKA 4PTZA 1Y48E 2OTCA 1A9ZA 1OY1A 3AF3A 4RY2A 5E0OA 4AZWA 3T5DA 1WCIB 3VOSA 2D74A 4QUHA 4DM3A 4LXIA 1LPSA 1WU8A 1CRLA 2L19A 3ENZA 3GHYA 3KYIB 3M9WA 4D9KA 1ODCA 5FWXB 3H17A 4BO3A 3WBFA 4WD3A 1JH9A 5AUQA 2QTVB 3O1IC 5C8YA 4LAFA 5E2AA 3BDIA 3FGNA 4X91A 1U63A 1EWVA 3OFJA 1A8IA 3MUFA 5GGXA 1M8KA 3SVTA 3V00A 1NQUA 2XGJA 1M0SA 3RUFA 2DWPA 3WQHA 4HAUA 3QUSA 1V6SA 4XM0A 2D1SA 1CT9A 2X5KO 4IO1A 4RDHA 4P5PA 1EHCA 1WHTB 1WW3A 1OFIA 1QQBA 4H3VA 3CJTA 3AFIA 3VISA 4O4IB 2MTBA 3QUTA 3SZRA 4B79A 5IVPA 1PS0A 1NQVA 2C82A 3QLEA 4LDZA 4UU7A 5E3JA 4HJXA 1W30A 3FI0A 2HK8A 5SV2A 1ZN7A 2D1RA 1JG6A 2IXDA 2AZXA 1E7SA 4XLTA 2GOYA 3J81k 4OP3A 4RFSB 3DCIA 4BXOB 3IQIX 1SBNE 2R8OA 5HMMA 4N7JA 4MA4A 3KB8A 1N7JA 1P4AA 4BB6A 3ENKA 1EWYA 1S7CA 2DTXA 4I4TF 3EGDA 1X7YB 1OBVA 1Q0PA 3M6LA 1X1DA 5KTMA 3ADBA 5LWQA 4HAXA 3GLKA 4FKMA 4MRVA 3HVIA 4JOSA 4EY4A 1W73A 2DF8A 3LT5A 1NNLA 4OKIA 1A77A 1G5RA 4OUKX 3LXMA 1H2EA 1TF2A 5A06A 5LZ2A 3F2IA 2J87A 1U7ZA 5EXDA 3RSQA 4D43A 4CLOA 1SAYA 1Z25A 3NOXA 5CK4A 1N6LA 3FWPA 4Y6RA 3H3JA 1C8BA 1TK3A 1GITA 1L5MA 1HPLA 2B5VA 4R31A 1TYDE 1D07A 1N0VC 5DF1A 5BN3B 2PD4A 2VH5R 4BYMA 1HNWB 4K40A 1E3TA 3K09C 2P3SA 4MGHA 4F5YA 1HRKA 1PR4A 4ER6A 4B7ZA 2CXXA 3UHAA 3PQ3A 1MA0A 1RQLA 2EVWX 1L7QA 2P5SA 4KZPA 4TWJA 5DWQA 4ER7A 4YX9A 1B8NA 4URUR 3URKA 3H1EA 2RD2A 5D6NA 1GY8A 1KYQA 4M1ZA 2Y2UA 3FWNA 2QQFA 3I12A 4I14A 2PL3A 4I9GA 1FUYB 1LDMA 4NE9A 3BX1A 2JKYA 4J0IA 1QG4A 3DXYA 1PR5A 4IUYA 5FPQA 3ZQ6A 1RVV1 4EZEA 3LUPA 1WPXA 5EZSA 4QVGA 1SVMA 3TGWA 3GJYA 1DHTA 5JRJA 3TH5A 2J9YB 1QU2A 2V1XA 4LRTB 1YCDA 3O6VA 4MKGA 1US8B 4RY8A 4Q5IA 2B4YA 2R1TA 3EHEA 3HKBA 3R7SA 1CG6A 2QOEA 4PAGA 2QU7A 2X19A 3O74A 1U98A 4A2CA 2YIJA 3PZRA 2EW2A 4X92A 5DULA 4OJYA 2XOXA 1T4CA 3IXMA 1RBYA 4C21A 3S2FA 1QCYA 2WM3A 3CH5A 4LE1A 4ZCPA 1AKYA 4HLUA 1NWHA 2WAXA 1WO8A 3JQCA 4LZNA 4RPLA 4J7AA 4U2KA 1GDDA 1LJLA 3AFOA 4FCCA 3WWOA 5ADHA 2AHRA 4GH5A 2FRXA 1TCCA 1SBHA 2IF2A 3FCAA 1SG0A 5ALJA 4B33A 1UQTA 1QGOA 2QTAA 1L4LA 1NSTA 1DLIA 3NORA 1ZEJA 3CNQS 2FOLA 2HF9A 1V1JA 5EWMB 3MTDA 4B6FA 1Y1KE 5JATA 2KW5A 4OXKA 2H1FA 4ZANA 2ZBGA 3IAAA 3IQFA 2VF7A 3HBJA 3GYBA 4QASA 4XGNA 4KGVA 3RT1A 3DAOA 5NLLA 1TPZA 4ZQHA 4ALNA 4ATNA 2QJFA 4AF8A 1H65A 3OM0A 4MUMA 5H81A 3SZ3A 1TPYA 2YQ5A 3TF5A 4KHZA 1RT9A 1YQDA 1Q22A 1O58A 3AIKA 2ZM5A 1P62B 3O92A 4URYR 5HJEA 3UMVA 4H7FA 4MNTA 2REXB 3EXIA 4WHMA 2VF4X 2I9PA 1O6FA 3WL6A 5CLLA 2DU8A 1Y42X 2OESA 4BBJA 1XD2A 2NVOA 4DKXA 2X0DA 3VR3A 2A9RA 5LZ7A 1RM3A 3FUCA 4D4IA 2VRCA 3S7TA 4LF9B 2P91A 4EVQA 5ALWA 3E9YA 3C7KA 3DOFA 3JQGB 4ITUA 3JVUA 5EIOA 4GXQA 2Q9BA 2YBDA 2ZXFA 2LCIA 4K9QA 4WZZA 1NV8A 1QZZA 4UPDA 5DP1A 2O57A 1ABBA 3VHLB 1CJUC 4DV4B 5CDSA 2H8GA 5BWLA 4P3YA 2G3YA 2XWJI 2MINB 4X93A 5L4NA 3AUAA 3NU1A 5FFMA 3H1BA 4D82A 5BSEA 3CIFA 4L7VA 3FTDA 4R2JA 3RUIA 3BORA 1ZLYA 3DDOA 10MHA 2NTVA 3U6BA 3SNHA 1NIPA 3VPXA 2H00A 1A88A 1F2UA 2DQSA 1FPQA 4MLZA 4R01A 3H83A 2I3BA 2NZ8A 2YXBA 4JLNA 4B3RB 3BD8A 3ZHYA 4PLCA 3LGXA 1JDBC 5COAA 3R24A 2C2YA 2DHDA 4LNHA 2B83A 4MJLA 4NARA 5FL7D 1QIIA 1JU9A 2D5AA 4JSTA 5IC6A 4EI7A 1ZU4A 4N7RA 4DY4A 1V5GA 3BMQA 1ODSA 2HREA 5A03A 1YJAA 2OYSA 2RIPA 4G1EB 3WIUA 2YMPA 4RTLA 5FTLA 1JAHA 1NI5A 5JMWA 4Y7DA 3CBGA 1K89A 3LMKA 1AN0A 3TX2A 1A9TA 1QP8A 4MYHA 1OLXB 3BTUA 1VPTA 1OC4A 1ZU5A 3R3JA 5AM5A 1Z4LA 3WQBA 5AQ1A 1FP4A 1PGJA 3B1YA 2WAMA 1Z4OA 1WB4A 3UA4A 1U8CB 4DARA 3OT1A 1J70A 1NTOA 2J4DA 3OEHA 5ADUS 2I3AA 1BW9B 4WK2B 4GNRA 3RAGA 3OM1A 5BPFA 2PR2A 5H4GA 1QAOA 4PIVA 5AVOA 3BHJA 1H5UA 2FPKA 4KUGA 1TW2A 4TVOA 1CULC 1F4LA 1PNTA 4RD1A 3K16A 4KLZA 3ZWVA 4MQUA 4IUDS 4TXMA 2WF9A 2OCDA 2VP4A 2GJ9A 4URVR 1GG2A 1X86B 2RHRA 1CUZA 2E89A 2RHHA 2W8BB 4XJXA 4ZMSA 3JQFA 4OIMA 2GMWA 4E4YA 2VC2B 4K9DA 1VP3A 1M2EA 2IXGA 1P0CA 1EWTA 1H93A 4QD3A 3GJ7A 4DV7B 1DB3A 2ANCA 3X43A 1VSVA 4D02A 5JFGA 2X4IA 5HFNA 2WU8A 1PJ2A 3OAAA 1TVEA 1IEXA 3H1GA 1JE1A 1T8TA 5LQMA 1I01A 4NZNA 3A37A 5FTWA 1HSOA 1H2FA 2Y1WA 4I55B 2I8LA 4WDRA 4BNKA 4BNDA 5EVCA 5LZ5A 1O54A 5EVJA 5TE9A 3EQ8A 1RAAA 1QDLB 2H1LA 5BQXA 5I9IA 2I99A 2QTZA 3LUFA 1V1MB 3W5HA 4MPJA 3COWA 4QYIA 1YIDA 5IKOA 3HGMA 4IIBA 4B3MB 1RKBA 4EAQA 3UT0A 1NN3A 3IAS1 2BISA 5U1PA 2G07A 3OF2A 2YOGA 4GDFA 2D8MA 5TXGA 2PSEA 4Z2AA 1ETUA 3QUCA 1QS0B 3IUBA 5ED0A 3P9KA 2P11A 3S68A 2GD1O 4PHFA 1XDBA 2A0UA 4PCAA 4OSPA 5LP6C 1YZ3A 3O82A 3GCWA 1X6VA 2K7ZA 2JHCA 3HJFA 3MJCA 2IRWA 4C0KA 5TMPA 1I33A 3ORHA 5EQTA 5TVGA 3S2ZA 4V0ME 1R6UA 4AMUA 1K8RA 1ZGZA 2F00A 1PX0A 2P67A 3CG0A 3CF2A 3EGVA 3EZGA 3IV9A 4DMHA 3HJRA 3BE6A 5FI3A 3GNTA 2W6ID 4FR0A 4GM0A 2DBQA 3BGWA 1RI4A 4ECAA 1RYDA 4M1QA 4LZLA 3SYRA 3NDJA 1MO2A 4B6QA 4V1CI 3UUEA 4UAGA 2D5CA 2JAPA 3MINB 3R7BA 4BEVA 2GGSA 4BO0A 2EKDA 4PBTA 3ASVA 5FWXA 3C3JA 3CPEA 3RAPR 1AHIA 2QZPA 3WRVA 5LD2B 1GZHB 3EVTA 2IK8A 1ZW1A 1KE2A 4MMXB 4N8DA 1G4HA 3TVTA 1JEYB 2CHEA 3E61A 4ENSA 3G9UA 3IBYA 3UHFA 2RJOA 4EJ0A 3UT5A 2N1MA 4DLKA 4EF6A 3QPDA 4FGLA 4QBKA 3DWFA 5CU7A 4EY7A 1AKVA 1BJRE 1NUTA 4U5QA 1OGJA 3C3WA 4A0HA 4DKJA 1P60A 5EZQA 1WHTA 5LL6P 3R75A 1RADA 1RRVA 1YBAA 2ZUCA 1BTOA 3AEXA 4WOBA 1G63A 2W2LA 3ZHCA 3OQ6A 2OE2A 1YNSA 2OV3A 2YY5A 1WUTA 3SEQA 2JRCA 2QSJA 4D8VA 4BFCA 4DEXA 1C7ZA 3PDJA 4NC9A 2E4WA 4DC9A 2AJCA 2FEPA 3GMTA 4YAKA 3JD3A 3L5KA 2QTHA 1AGRA 1W46A 1VDZA 1VB5A 1JIIA 3H1FA 4RFSA 5ER6A 4YRPA 2DTEA 4EL5A 4OD0A 2Y93A 1IFXA 1WF3A 2AMVA 2PQMA 4FYHA 4Q48A 3PJEA 1VCNA 4D9MA 4JYZA 1A4RA 2O4UX 1NBOA 3KZOA 4INOA 1X7YA 4DN6A 4J07A 4JOBA 4ZCLA 5MGBA 4DLSA 2P65A 4DT1B 5B36A 1ZD1A 1DKPA 2KB0A 1ZJJA 1DI0A 1KKLA 2WKSA 5KVSA 1XZLA 4F6RB 3GJSA 3NT4A 4Q1EA 2QQEA 1VCIA 3FNIA 3Q72A 2PWAA 4NG5A 4QREA 4EF4A 2WF5A 1FQOA 3CNOA 1DELA 2FRVA 3NB0A 3ZXXA 3THSA 5K05A 1EP9A 1ETHA 4WWHA 5D7NA 5K0LA 1P9RA 1E5VA 1LPNA 5JWRA 5BN3A 3M2PA 4MVJH 1NLUA 3ZW7A 1DV1A 4QDUA 4V38A 2O6LA 4OP2A 1AGNA 2ZOSA 4RK1A 1UBJS 3ZCPA 1J06A 3SICE 4A82A 2G40A 1QG0A 4FS8A 1XEWX 1N2JA 2AK2A 1I4DD 1SKYE 1Y4AE 2O1EA 3BBLA 3SY8A 2AEJA 1CB0A 2DSNA 3L05A 2VT6A 1QO0A 1J0XO 3E3LA 3FTCA 4LYYA 1QFXA 2FLKA 4C2AA 4Z0NA 1WKCA 3C8UA 3QWBA 4QFCA 2A4KA 1I9GA 3HWX1 4H35A 3TM5A 1K66A 1GNPA 2X7HA 2WYUA 4DXHA 5EIXA 3OQNA 2YZ2A 5KSWB 5K0FA 1QF7A 5LFAA 1SBYA 1PL7A 3BREA 4PAMA 4EM6A 1C3OB 4D9IA 1OWMA 4K9SA 2WPDA 4J03A 4OK6A 2IP2A 5KUTA 4DAOA 4JHLA 2ZTVA 5E7IA 1GQYA 3OETA 1JEEA 1MNQA 2UVDA 2QN3A 4KO2S 4DZRA 4NESA 3VOBA 3IBGA 5I7UA 2JGMA 4G5GA 1THZA 1Y3BE 4IG9A 4NNJA 5CEEA 4TTIA 2GEDA 2O2EA 3DCYA 2Q6LA 2B2CA 2FWRA 2P3OA 2J67A 2NWQA 3ODGA 1KYZA 3VU9B 3OOEA 3X1MA 5DLQC 2VHTA 3DAYA 2M2IA 4K5QA 3BXXA 4S2UA 3FOEC 5JLAA 2XT6A 1FFGA 3U37A 3R8FA 1N1DA 4XQGA 5EWMA 1KIFA 1ZRSA 2OVBA 3DP9A 1RJEA 1V6CA 3F49S 3FWYA 3H13A 3ZLJA 1A8PA 1YZVA 2QZZA 1ULHA 2D1TA 5GV8A 5B3JA 4LC9A 1G20E 5DEIA 3M6VA 4TTTS 5K1ZA 4MUEA 4LYDA 2ECKA 2I78A 4FINA 4R6XA 5I8ZA 1KOLA 2YHAA 5A5VA 3WGQA 5BV1A 4MV9A 5LUAA 1U81A 4YUWA 3ON5A 3IMGA 4D3DA 1P39A 1E1RD 1EVZA 1IWOA 2Q6OA 2ZB3A 1X77A 3NDRA 2GA8A 4MZDA 4Q1CA 4RIFA 3RROA 3B48A 3UZUA 4E46A 2HNKA 2QZ9A 3WBKA 4KN8A 1ZITA 1OU4A 4E2FA 1JE0A 4LPSA 3F78A 3QJ5A 3KVYA 1TJ3A 4GQAA 4K9RA 3VYUB 3D6TB 4PCLA 3H4IA 4C2TA 2VTBB 4PWZA 1M6EX 1YJCA 1MAVA 3SYTA 1YONA 3DULA 3D3KA 3JQGA 4R4JA 2YMQA 3AEZA 4QXAA 4EK9A 4WKBA 4OBWA 1BMFA 3LUBA 2B82A 1R4MB 3KCQA 5DASA 4NJEB 2YWJA 3PDCA 1R88A 4GXNA 4TTSA 4EI9A 4BMSA 2PHZA 3KJZA 2WAOA 1PWXA 4JR2A 4G5SA 1IPHA 1GGEA 2HBYA 3ZQUA 3PCTA 1FSZA 2GZ1A 2XDQB 3EH1A 4C7JA 4DVJA 2A14A 2DBZA 4EB0A 3UJCA 2ZRMA 3GVXA 1CYDA 1VIAA 2AZMA 5EERA 3FPFA 4M8KA 2ACKA 4W5HA 3F1KA 2C1EA 3C97A 4XD7A 4XPZA 4K9OA 5J59A 5H9VA 4Z3KA 2C4TA 1UK6A 3EZ7A 4JBNA 3CRQA 4CRWB 2N9UA 1OIVA 1TUGA 1E32A 4ZVOA 1OZAA 5JSUA 4CT5A 4KQXA 1YKSA 1I51A 4LWQA 2GEFA 4DA9A 4F85A 1A2BA 2IY9A 4MWDA 3QA3E 1E63A 4QBIA 3AWDA 3A25A 3DL4A 4FJ0A 5ALSA 1UDCA 1E79A 2MU1A 1OBHA 2BJVA 3KKOA 2BFNA 1YWGO 2CHQA 1UXJA 2I2CA 2ICAA 2NM0A 2PLFA 3P32A 4LIPD 3R3VA 4RHUA 4RK5A 1I24A 3DMYA 2P2GA 2WFZA 3FXAA 3OEEA 3OTHA 4PN7A 3KPYA 3T5PA 3AV3A 3G2OA 3M1LA 3OX2A 2OAEA 4Q01A 3GP8A 1OLXA 3ACDA 3GCZA 4AG3A 2VTDA 3IAHA 3QUQA 3EBOA 4W1PA 4KBFA 4AN4A 3ZDAA 1KRXA 1ZXXA 3AESA 4J90A 4BS9A 2F3TA 4AWXA 1U2GC 4CFYA 1DFIA 2QZ4A 1NY6A 3U4AA 4L9RA 4DDMA 2ARKA 4H3SA 2XMQA 2FFQA 1BW9A 4TXJA 1C0PA 2FWIA 2NXCA 1B0AA 2QTWB 3JZMA 4X63A 1X87A 3MILA 1BE0A 1F38A 3BWCA 3P2OA 4KQHA 2E0IA 2B1RA 1GCIA 2EL9A 2GF2A 2P9BA 2XMDA 3IIJA 3WTCA 3FOFC 2PY6A 2MYNA 3Q7RA 3LP6A 4WVFA 3RANA 1NE2A 2O2DA 1TYCA 4G1CA 2QMOA 1DBWA 3D43A 3DF7A 3IP5A 4LJ9A 4Z1MD 5JJBA 3A10A 3ICOA 1XVLA 1Z6PA 4R1PA 4QSHA 4CODB 2AZTA 2RGNA 1O9BA 2IIBA 1KIAA 1UXGA 3A6HA 3GZJA 4OXRA 5AIAA 4GSLA 1HG0A 4H7PA 4PSDA 3BWDD 2HPZA 1PWYE 3FPEA 5DGTA 4AQ7A 1EX6A 1AHNA 3LW7A 3PD7A 3N8NA 1B3BA 3NBKA 4DQVA 3PSAA 3K0KA 1XVAA 1MQ8B 1G8JA 4ED9A 1Z0FA 4G0QA 2F17A 3ELUA 3I04A 4I55A 3WRYC 1PR6A 4FTWA 3LCMA 2GFHA 1VKZA 5EHNA 1WZUA 1Q0ZA 3HACA 4G84A 1VHLA 5EHZA 2JS7A 1YAHA 5E4YA 3ZBPA 4QBGB 4MV8A 4DJFC 1V1MA 4JLWA 3UCEA 2ZDGA 2RARA 4HNTA 3PLRA 5BW8A 3GBSA 1U8XX 3HI6A 4GPBA 2P69A 4PQGA 5TGTA 3X1YA 4U7GA 3LA6A 1LF0A 2XWQA 5DJ5A 4B2PA 4TUYF 4BN0A 1BA2A 2P4QA 2AC4A 3BILA 1JEJA 2RHOA 4EI8A 1S3FA 1DADA 3RRFA 2QLJA 1SUEA 2AOTA 4J1NA 2NV2B 1QS0A 3N07A 2BW0A 1DAKA 4I9UA 1JWBB 4PC6A 5LBTA 1TRHA 3RSCA 4L74A 5IDQA 1WA5A 4MEAA 4RSMA 1R5NA 2VYND 2YWCA 3DEFA 4FN4A 3FWHA 2PBLA 4DLXA 1EIZA 3DZCA 1KSFX 2QLMA 1RXEA 3ILXA 4WKPA 4MI3A 2BUCA 2HCFA 1Z5OA 2P5TB 2R1ZA 3U4MA 1ZH4A 1ZLXA 1RWKA 3OY7A 4Z4CA 1XZEA 4RKRA 3KHUA 3U80A 2P78A 4ZI7F 2BH9A 2VN8A 1B93A 4BUCA 3IVAA 5M5BA 3L18A 3MINA 4IEFB 4UUAA 2ZKLA 3QITA 2VDJA 4G1FA 2IODA 1B74A 2O1SA 2QN6A 4Y9UA 3MHTA 4WZBE 1VHDA 1KOGA 2ZIUB 4W6QA 4QECA 5AESA 1L1QA 4RPCA 2D4AA 4LOKA 2BFCB 3C41J 1JEYA 3VQTA 2XCOA 1ISMA 4BEBA 3K8ZA 4BMNA 1T2CA 5I9NA 2Y0BA 3NAGA 2GCIA 2QT1A 4IIFA 4QUEA 2A0KA 1TZJA 3OCXA 4G07A 3OCWA 4W7SA 4Q7QA 1V48A 3E58A 4KRGA 3VDMA 5ALDA 4ECEA 1T9AA 1EINA 1SKYB 1YZLA 4XI9A 1Q15A 3ELWA 3ADDA 2W2OA 1F6BA 5BSMA 4IJUA 1OWNA 1QIDA 5F3DA 4MH0R 2Y0PA 5AJZA 5ECYA 3RB8A 1C8LA 1NE7A 1QTIA 1DQSA 1ZH6A 3MTJA 3QU9A 4K88A 5B58C 3MS2A 1XMPA 1HDOA 1ML3A 3I28A 1ZWKA 4YP6A 1SUDA 3A36A 4G5YA 1E1DA 2Y1FA 3CF6R 1S8FA 1V5EA 4MAMA 4QHSA 1AF7A 1PJLA 1KI3A 2AD1A 1RAHA 1JHMA 3VPBA 4BNXA 3LJKA 3A11A 4JT9A 1KK2A 2XUAA 3IHTA 2P0AA 2NU9B 2QRPA 3Q88A 4Q4LA 4TKMA 3FLMA 5JYEA 4I0WB 4LG1A 1WB6A 5FOSA 4Y2XA 1EFRD 1QFMA 3MEQA 3W3AH 4DY6A 5C3UA 4MGYR 4KRFA 2OORC 3MJFA 2ZRNA 4DT1A 2C99A 2OBNA 2YQ4A 4OHYA 4IX1A 1CUSA 1SUSA 1Q1EA 2HA3A 2O0LA 5AW2A 2BFEB 3ENVA 1BS9A 3L1UA 4C5AA 4DB2A 4F6RA 2Z56A 1ZK1A 4RJKA 4WBNB 3G5TA 4XJTA 3EIFA 5FIUA 4UE3S 1VL1A 1KETA 1I4OA 5JBNA 2XTZA 2C7OA 5CBPB 1AS0A 2GM5A 3L4BC 3V4LA 5FBHA 3MRTA 3D3JA 4AO6A 2EEZA 2HMYB 4KV9A 1TLLA 2D2XA 3WISA 1ZGJA 1V2HE 4BZPA 5DNUA 4DS3A 3KKLA 5KSZA 3GEDA 1XXLA 1E3QA 1L9KA 1WOMA 1G20B 2GAIA 1U2ZA 2GKGA 2GPJA 3FGPA 3HNPA 1KDYA 3RCBA 3TEFA 2OBYA 4KXFB 4QSMA 3ZCQA 3DM5A 3S44A 2PKQP 1L4MA 1PNRA 4CLXA 3WBBA 2PGJA 2WI8A 1ORDA 1YJ8A 3FX2A 3A0UA 4JL6A 3TUIC 1MO3A 4BV9A 1QQ7A 4CG1A 5JCJD 1XTIA 4FYIA 3MSXA 5JROA 1SD2A 2PSSA 2Q4OA 4LZPA 2X9QA 1WD5A 2F1OA 2H65A 1CDEA 2HQRA 2PKYX 3SBOA 5IC4A 1PF7E 1Z29A 4N5HX 4AJ4A 2RHLA 1MPXA 1Z06A 3HXKA 4JR0A 4ETIA 4QXPA 5CGZA 2FUCA 4ZHQB 3N1UA 1C3OA 4HNGA 3H04A 3HPRA 3VR6D 3RAJA 1QQTA 3PWKA 2ACWA 3FOCA 2C8VA 4NQRA 5JXIA 1TVCA 3GD7A 2X13A 3V2HA 4UVHA 4LQLA 1KQOA 3TLEA 2HWYA 1LI5A 1E62A 3V7FA 3GAFA 3OQHA 1EG7A 2I1WA 3DMDA 2ES4A 4DYHA 2O8BB 1YUBA 2PNFA 1NZFA 2ZUDA 3A70A 2CXUA 2WJ3A 1T8UA 1YDWA 2IP1A 2J0EA 1T6BY 1UXHA 2HU8A 4RK4A 2YASA 3AXSA 3QX7A 1T2NA 2R6AA 3I1IA 1VTKA 1BQ3A 4B44A 1BGXT 2PBZA 4HVTA 3EQ7A 1UPBA 2PO7A 4D9NA 1E0JA 4KSBA 1L5KA 4MS1B 2JI4A 1QGDA 2KLBA 2ZZKA 1OVMA 5EA2A 4F91B 5JQGB 1KEPA 1UJ2A 2QG9A 2YNMD 2XQKA 1W5TA 1V1RB 1Z75A 1L9XA 3HJHA 3VUEA 1SOWA 4ARCA 2ZDQA 2BGGA 2WM2A 1U7OA 4UTZA 5JNWA 3ETGA 4GVLA 2XZOA 4HEA6 2OD9A 2IHTA 2DKFA 5WRFA 1AKTA 1DIRA 4B8ZA 5AKKA 1DAGA 4KPEC 1OF1A 3IP8A 1NXXA 3HKDB 2X0JA 4PFKA 1MTZA 5DYYA 1U0EA 4B9EA 4JBWA 4BMYA 5JCXA 1M10A 1AHHA 2D13A 3ECCA 3ROPA 1CNMA 3SF8B 3UUGA 3U44A 2JH3A 3MMSA 1N6PA 4FW8A 3CZ4A 2O59A 2X5XA 1PGPA 1WG8A 3QVXA 4K6MA 5C1PA 4O1MA 1KO1A 4ZVVA 4MVJD 3W5JA 1DMSA 1ISGA 1S2DA 1XDUA 2KHZA 1AMUA 4HAZA 4HXGA 3PFNA 1KA9H 3U81A 1R4MA 2H52A 2VQSA 2RIRA 4MPTA 4NJEA 2P9TA 3W4KA 1Z8FA 4Q16A 4RKQA 1Z4PX 1XHLA 2NSDA 2XZPA 3QOFA 4RY0A 1L5HB 4Y1EA 3RHSA 2B94A 1XEAA 4RPKA 1JQBA 3GPIA 1VE5A 5A5GA 1WPRA 2YWBA 1B2RA 5DSZA 4BQQA 3H97A 3ZHSA 4KR6A 1QMGA 3GAMA 3GDFA 4NCNA 1MF7A 2YZ7A 3OZSA 3CCCA 2VSQA 5BT8A 4AJOA 1K6JA 2QGNA 1JJBA 3KVVA 2HH9A 3ZJ4A 4URHA 4EFLA 3DDNA 1DKRA 5EMMA 3AKDA 4DR5B 1KWKA 1KVQA 1Q20A 1GP2A 2CF5A 2V7TA 2VDKB 3KAPA 1IBLB 3LHIA 1QVAA 2X3YA 2WBLC 2WNHA 5IH3A 3OE7D 4PWYA 5HXAA 4Y0VA 1T26A 1W29A 1IBRA 1UQRA 3BRWD 1FW8A 2GXSA 3AHEA 3B5JA 5A1JA 2XD4A 2Q3FA 5FBKA 5EKDA 5IBPA 3F9IA 4DCMA 2I76A 4ARZB 2VDRB 2WWWA 3GFPA 1JFLA 3GVCA 3SDZA 2WTUA 1XLTC 2P27A 3AR9A 4MMZB 1Q0TA 1WY5A 3ZJYA 4EFMA 2SICE 3WA7A 2REOA 1NW5A 1YVEI 2FP4B 2JA2A 1RWXA 1WDTA 2QAJA 3Q9UA 2Q3DA 4LI3X 5DIFA 5T4FA 3LF2A 1J49A 2B35A 5E9JA 3MHPA 1FDSA 3GX1A 4EJFA 2JFYA 2WW8A 3BFVA 2CFTA 2BEKA 1G8SA 2XUHA 3CIOA 1B43A 1ENYA 3I0ZA 3KD2A 4LPKA 1J2UA 4X61A 1JHQA 1UDBA 1XG5A 4IV8A 4IV5A 4ARAA 4ZARA 2QAGB 4DTCA 2YBEA 4Z54A 1BDJA 1IJKA 1W5AA 3FPKA 2OSVA 1UZAA 2YXLA 4LOAA 3HWWA 4KLAA 3GRVA 1IJFA 3ORYA 5HQTA 1UPFA 2J1LA 4Z8YA 2VQFB 3PHHA 1JYFA 4B43A 1UBNA 2NYAA 3K5WA 3S2YA 3VX4A 4DUZB 1T29A 2BWJA 4DQDA 4WX2B 2FPXA 3DQZA 1ZRHA 5CB0A 3UMYA 4RIHA 1PD0A 1F5SA 4YPVA 5IM4A 2JBWA 4HMPA 2J07A 4PYLA 1TM1E 4LX8A 2CLMB 3D3QA 4CFSA 4Q4HB 1WDMA 4FXOA 1R16A 3KU1A 3QKTA 3ZHQA 4CKBA 1IBSA 4IJ6A 5F98A 4B34A 2PJUA 4OQFA 2BMJA 2XDAA 5G0TA 1W5EA 3TNJA 4ISBA 2C4MA 1I14A 1IB0A 4DNFA 1G66A 3PFCA 2O4CA 4KIGA 1DINA 3VA7A 4MVJI 2FRDC 1UKVY 2Z1DA 4DEVA 3RTCA 1NY5A 3LUJA 1GTJ1 3S29A 2DT5A 1B6TA 3BFKA 3KYCB 2LW7A 3FPGA 4QU8A 1A9PA 3BMNB 4JDPA 3VTFA 4KIWA 2TRSB 4DPLA 4AS1A 2XB8A 3BSSA 4QNNA 4Q39A 4CMCA 3COZA 3ONWA 3QRWA 4OFBA 5FWAA 3BT7A 3CUEF 4NIMA 1WM1A 3LLVA 5HQJA 5ES4B 5H16A 1SGWA 3OIDA 5SZHB 1ZCJA 3HSKA 2XWSA 1ICEA 2QMZA 1DT3A 2P9JA 2E5LB 4YN3A 1GEGA 1ZW6A 4OB6A 2JPDA 1EGMB 1TU4A 5EKSA 3BGVA 5F51A 3VR4H 4V1CB 5C52B 4ZRNA 4JKIA 5FBZA 5D00A 3WYGA 1VE6A 2Q0HA 3HNOA 4BO5A 1CEYA 1XRRA 1HL3A 1ZESA 1OH8A 2VBFA 5KEIA 5CHYA 1U1GA 2OCXA 4N7MA 1VI5A 2WF8A 2IIPA 1X1TA 1VIMA 2H7VA 4JLAA 3LVFO 3DZBA 3TXAA 2HA2A 1TJ4A 3EMKA 3FBWA 4D9BA 4KXLA 1FE8A 4UOEA 4JJZA 3D0QA 5HJ2A 1MAAA 5BR1A 5KQGA 3JWIA 3L6UA 3NKLA 2BFCA 3EEFA 4NPCA 5DN6A 5EIWA 3THWA 1JNYA 3RSLA 3DNPA 3G0BA 1UBCA 1VYTA 2QGZA 3SS7X 3PYLA 4P2GA 1W75A 3TPFA 4J49A 5LQSA 4REQB 2O5RA 1ECGA 1PQPA 4JUDX 2J6HA 1I6KA 3MD9A 3JW8A 5CW2A 1D4AA 4BE4A 2GN0A 3JWHA 5IAAA 2PT5A 1X14A 3ESCA 3HB1A 3KZNA 5B1EA 3MUEA 2WVHA 3C3AA 2OC9A 5J5AA 4BUZA 5A3JA 2O8CB 1JS1X 1I1HA 3B1WA 1QIEA 1E2GA 4Z9BA 1P5RA 4M86A 4K3UA 1E3EA 1FBNA 3HGTA 3OHPA 4O4JF 4TLLB 3NP9A 1G8MA 3CSSA 1DWOA 2G4CA 4M38A 4PYQA 1E9RA 1SBCA 4X45A 4Y98A 4RGBA 2M6RA 3B2NA 5HTKA 4EOGA 1XMOB 3UB4A 2G28A 3NV9A 4QQRA 1XRMA 4GX1A 2NU9A 3EA5A 4J75A 2OXRA 1VG9B 2MWMA 4LYEA 1R8XA 1ZI9A 3WGJA 2PS1A 1EWKA 1RKVA 2Q6TA 1BS1A 3ZV6A 4ZGWA 3INRA 4KMMA 1RVDA 2PUWA 3GGGA 2EKLA 2WU3A 3CJRA 4ASUD 1PFQA 4GICA 5BRAA 2C8JA 2XNHA 3WGYA 3FSRA 5CVDA 5K3FB 2YYYA 5JSHA 4KI0A 4M0DA 1SUBA 5HDQA 4MB0A 4EDFA 3T7EA 3K2IA 1P91A 5CBPA 3SLKA 3M9LA 3DTNA 2AYXA 3I1YA 4LRSB 2QR3A 2PX0A 4B09A 3USCS 1CVIA 5K8VA 5JASA 5ISMA 4EYKA 2IYYA 1ORWA 3QFRA 2ABWA 2ESRA 3ROKA 3OKPA 4N5DA 5JSZB 1G20A 1TMYA 4CLRA 1JDTA 3SBDA 3BULA 2YFHA 4WOCA 4GYKA 5C31A 2M32A 4YY3B 4LJSA 2W6JA 1KEVA 1Z4QA 1P3Y1 1QUFA 1T1SA 3ANLA 4C3UA 2OBXA 2RH9B 2PT9A 2QYHA 5KMGB 1UC8A 4RWEA 4WN9B 4EL0A 2FPIB 4M1WA 4MYDA 1G6Q1 3IBCA 3O7WA 4O2LA 4YAUA 1Y9ZA 2CB9A 4BVJA 2EZ9A 4F4UA 1N1MA 1BAPA 5LA6F 4AJIA 4Q3AA 4ZHQA 5FH9A 2QRUA 5FXMA 4KXUA 5TMBA 2Z6VA 4Y6OA 2ZITA 3EH2A 2XB9A 1KH2A 4KLNA 3PP8A 2Q1SA 1G9SA 2O7VA 2CDBA 1CEXA 3QLUA 5K0TA 4IJKA 2OBBA 2CBZA 3OCCA 2PUBA 2K6GA 3UT6A 3O03A 4P92A 5CJ2A 1NU6A 2H08A 2OO5C 2PIDA 3JWGA 3A9CA 3B12A 1L7AA 4OG2A 1YHYA 4A4DA 3CRRA 3GEIA 3N7TA 4QQKA 4IIHA 4YJ2B 4EBFA 1EXVA 2ZBEA 4O25A 2ZE6A 2IU4A 3QIAA 2QVGA 4JSYA 3FMVA 2G67A 4MARA 3ET5A 1XEXB 3TLCA 2UV8A 4D0NA 1Z9BA 2FP3A 2A67A 2H1OA 4QM7A 3F8TA 5HOEA 4TZKA 1UFVA 4NYJR 1P8JA 1HYGA 3UVEA 5KNDH 3EIXA 1V1RA 4R5HA 1AUPA 5CVCA 3ZY4A 3U60B 1ID1A 1EXNA 3B89A 4C4YA 1PG2A 1UR5A 1YRAA 2CLKB 3O4RA 5JH7F 1EA7A 3LPCA 5DM4A 1PG0A 3BJMA 3P4UA 4L3WA 2HADA 4NABA 4P5DA 5CIQA 5EUBA 3P19A 1ECFA 3UKOA 3HKDA 4C7VA 1LD3A 3VJKA 4EG5A 3H9GA 3I76A 2AQIA 4KQ1A 3QPVA 1J00A 4M4SA 5E6RA 4KXNA 3VRHA 1UP7A 5CCXA 3CVXA 1E98A 1GQSA 5ALEA 2CVFA 3HDVA 3SF8A 2CXHA 2HHLA 1KJZA 4NZMA 4CW7A 1SKUA 2ZAGA 1ZHHA 3RSOA 3KT6A 1HT2E 1DBIA 2AZ4A 2WM8A 3DL0A 3LW8A 1GN9A 4Q7LA 4ENRA 4HT3B 1GTRA 2B69A 1PT5A 4G65A 3TBHA 4W5NA 3BXZA 3PJFA 3GRFA 3BZUA 1EZZA 4JS0A 4RVSA 3W5AA 3I0MA 5FR1A 2UXDB 1U99A 2JGLA 3PNOA 3A6KA 1L5HA 4I08A 3HY3A 1ODIA 3USES 4W9MC 2YYZA 1K9SA 3S5JA 3FTQA 1IY1A 1MEOA 4RORA 4IGAA 2VL7A 3WYCA 1Y82A 4X62B 3A0RB 1QZUA 3LD9A 1U2DC 3A1TA 4HEA1 4MWEA 4TL7A 4A6EA 3I52A 1GL7A 2H9IA 1PL6A 4FEAA 1YQTA 3M81A 4BQFA 5KX5F 3L4KA 2CLOB 2G7MC 2C8KA 2PLRA 4LGVA 3FMFA 4C89A 1NXQA 2CMDA 3A26A 4TYQA 5IULC 1B6RA 4I50B 3IESA 4BNFA 2FXIA 3CEPB 3E82A 4RESA 5DO9A 4NK5A 4J2TA 1C3LA 2VF2A 5FQOA 2ZVDA 1UINA 1NNUA 5CW1A 3IRUA 2I2FA 4WLFA 4ARZA 3U09A 2XDYA 2PKCA 1ES9A 3P9ZA 5FI5A 5DLPA 1KH3A 3I01M 1VOTA 3OJOA 4UBJA 5IRCD 1RYMA 1HDGO 2FP4A 4ND4A 4RXUA 4RD3A 1A2QA 2PK3A 3UJDA 4ERNA 1K88A 4N41A 3ISTA 4L0CA 1HH4A 2E49A 4GOMD 4DA0A 3CT6A 1XTRA 4DV6B 3PZBA 4JK3A 1MD9A 3M5WA 3UJ9A 5EJAA 2VYCA 4JXZA 1YRHA 1UMBA 2CXOA 2GSDA 2I6XA 2ZB7A 4JZKA 4C03A 2ODQA 4NX2A 2QAGA 3QF7A 1JU3A 4DCVA 1E58A 4WGGA 2XHEA 4RPJA 4NBKA 3ANTA 4H0FA 4FR5A 4PZUA 5E8RA 2HXGA 4U7TB 4OEHA 1MKYA 1JQEA 5J23A 1J39A 1HKUA 4YAJA 2CXPA 1SIWA 2Q9AA 3RC8A 1T6NA 3I2YX 3PR1A 3UYKA 1N3YA 4GWGA 2IU6A 2CYAA 1WXHA 1R0CA 3CXRA 1B0UA 1TUEA 1XZJA 4IDPA 3SM9A 3WGTA 4AYWA 1J6UA 3L5OA 1X19A 5ABPA 3MPUA 5LLDA 4Y9RA 4FUTA 4C0LA 1UOQA 2VBCA 1C1YA 3OE5A 4Q4HA 2RHGB 3PXUA 1PX2A 2N3ZA 1UH5A 3W8RA 4WZBA 2P62A 4MMYB 3TW4A 1SVLA 2VSNA 2W5UA 3K3PA 4H7DA 4X95A 5JJIA 1FDIA 1DNPA 2LZ0A 3P5SA 4P3XA 5CAEB 4P2BA 4UXHA 3I34X 1SZPA 3ROFA 1E9SA 3H5RA 4C78A 2QP3A 3GGCA 3KBBA 2P9CA 4JITA 1CUVA 1Q21A 4OGWA 1YIAA 1M2FA 3B5IA 3E7XA 2XB6A 3TRKA 2F9MA 2RH4A 2ACVA 3KYCA 4IDBA 3C5VA 1UPAA 2O05A 2YXNA 3BMNA 3CSUA 4GYJA 3WAKA 4EUSA 1DTSA 2WMOB 5B6IA 3KQWA 1TMKA 5F9HA 3H84A 3V4OA 2P1ZA 2QSZA 3CEMA 3ADCA 3VH1A 3PUYA 4P53A 3STWA 5CXUA 3DDHA 5M7EA 2DSTA 3QHQA 4QDXA 5AK3A 3L0BA 1XTKA 3TDNA 4DCPA 2GASA 3RTDA 1WZNA 4IBOA 4AJ2A 2HRCA 5JZVA 5EJ4A 1PG5A 1RQNA 4NK4A 1Z7GA 1FTGA 5FL7A 1R6VA 1XZGA 1GPAA 3D4LA 3ZHRA 3JAWA 3O26A 2DQYA 2NPOA 1MJ5A 5KU1A 1N1GA 1SQ6A 3HH8A 3P4XA 4MGIR 4E5NA 4AT1A 1H9AA 1XAJA 4V1CA 1D4FA 1RHRA 2B61A 2W2QA 4A10A 3JZIA 4ZYUA 4ZYVA 4UMEA 2PG3A 4B4OA 3DAHA 1UPXA 1DAEA 3FOWA 4ALJA 5JD5A 1GGNA 1FQJA 4YT4A 3DLPX 1TECE 4D44A 4F72A 2ERYA 5EL0A 2POCA 3SEZA 1AZLA 3EIEA 1A0OA 3EFEA 2SHKA 3GEHA 4HFNA 5A3RA 3ER8A 1XDGA 1KYIA 3LRTA 4MVJE 3U31A 3VDRA 1O5TA 5ITVA 1V41E 3HO8A 3I39X 2FMKA 3OIYA 4ZJUA 2JJMA 1FMJA 2RDMA 4MUNA 3UB2A 2XLCA 4FC7A 4LQCA 5CDHA 3VR0A 4N5NA 1CJCA 1UANA 3C70A 1J20A 1CUUA 1BVYF 2EGGA 1YCFA 1ZGAA 3UMSA 3DGFC 3P9RA 5FOTA 1VL0A 2HBQA 4L28A 5EGSA 4REQA 3TW0A 4AX8A 5JR3A 1E2BA 2O8FB 2R62A 3OFND 4M1MA 2QVYX 4GEKA 2BV3A 3WQSB 5JBQA 1O87A 1LS1A 1KQFA 2BSAA 3NNNA 1SXJD 3OM9A 1NVKA 1JSLA 4PAQA 3K5HA 1U7DA 2O8CA 2QMUA 3A32A 2CV1A 3NNSA 2AKAB 4WOPA 5KOJB 1GPUA 1P72A 3FTNA 3PFKA 3EFHA 3NYIA 2RC6A 3UWOA 2G1AA 2V55B 1CLEA 5D6OA 5BRNA 5D2CA 3FVTA 2XQVA 4FLFA 5SICE 3RTEA 5AUPB 3I8SA 2Y67A 4JLVA 1SOMA 1LRKA 3OF3A 3Q2IA 3ORSA 4N76A 2B4QA 2XRMA 4N39A 3MQ2A 3GXOA 1SPXA 3FKQA 1S9HA 5CPFA 2PZAA 2WF7A 3ZW9A 1JHZA 2Q4EA 4HNQA 5H02A 2JAWA 3C8MA 3A9WA 3FDJA 3WGOA 1JIXA 1Q74A 4EUKA 4QFDA 5EPEA 2EGHA 3CVWA 2G80A 2QX9A 2ZUTA 2JCYA 4JLKA 3ZS8A 2VOEA 4C06A 2X2OA 4ZU1X 4MW6A 5EIAA 1U7WA 3K1ZA 3R6GA 1GLVA 3BL8A 1S2MA 3ZI7A 1CERA 2IQIA 3KQTA 2CBGA 2DTDA 2H0AA 3IPXA 4K9KA 1ACLA 5EE3A 3G9XA 5K3OA 1JHAA 4YEDA 4ZTBA 4EG3A 4GI7A 3O75A 5FI1B 1J2TA 3THXA 1QPBA 3HVKA 1HRDA 5K51A 3FHTA 5JSZA 4NH4A 2GM9A 3E15A 1IPFA 2KE5A 5KVAA 1WF6A 3D2CA 2CD9A 1XNHA 2RKBA 5DYGA 5F64A 2Q2VA 2W6IA 5EGNA 4KJXA 4L4SA 4XUEA 1RWQA 1UBFA 4N6GA 1JSCA 3PIIA 1RI3A 3ZD9A 4D0LB 3V42A 3MGCA 3WVNA 5JUWA 2OQIA 2JIOA 4WN9A 2ZYAA 3BGDA 5HZHA 5FV4A 4O1HA 5F21A 4OHPA 5CYPA 3ID6C 2LGJA 3MGBA 3KB2A 2CKDA 4I1UA 5E8JA 5FPKA 1E2HA 2Q2NA 1T8SA 5MDHA 1L7OA 2VHXA 1HTTA 3EDMA 4J1SA 1X70A 1O03A 4UREA 4ZJZA 1DC4A 3SJZA 4PHCA 5BMVF 1M6NA 1EJ2A 1Q7TA 1ORTA 2AJLI 4BMCA 5EJFA 1W36D 3ZU4A 4TLCA 3ZK7A 2HWWA 1RIIA 2NO6A 2OKCA 2QT9A 2CW5A 2GO7A 2WQZA 2ZTHA 4MQ6A 4F7DA 5JS2A 4ZCMA 3B9PA 5TMEA 4YJ2A 1O95D 3GP3A 5F7ZA 3DH0A 5JCOA 4DR2B 2DRIA 3TRDA 3DE6X 5YASA 5J43A 2XJ4A 2J3MA 5EJMA 3W1VA 4B35A 1YR6A 4Q4AB 3KUUA 4P08A 2YFKA 3QMPA 2QZJA 1N5DA 1NZJA 3EEBA 3TYXA 3SHWA 1F0PA 2GPAA 2QB5A 1HFEL 3M70A 4OBBA 3LL7A 3IO3A 9GPBA 3TAHA 1H4QA 1XNJA 4I1YA 2NAFA 1G64A 2R4UA 3AVOA 2XCUA 4Q18A 4ZQIA 1N6OA 4PYJA 2YIMA 2F1RA 3VHRA 3U1BA 1DL5A 2VOJA 3N05A 5CG2A 3LY8A 2OM2A 1DKMA 2AE1A 3JZDA 2OCGA 2IHBA 3NPMA 3OJWA 5EAIA 1JKJB 2IIQA 3IDQA 4P3NA 4JT4A 5IYZF 4ENQA 3E22B 3RFVA 3B6IA 3CSDA 3Q7PA 5D3MA 1PEKE 2W48A 2H9YA 4TMKA 4W7IA 3PRYA 1K97A 3P0HA 1TADA 2BELA 4RL4A 5C0OE 2CLLB 1G60A 1ZC3A 4PGMA 4QHYA 2Q4BA 1ZD3A 1L5YA 3AMVA 4FHZA 4QULA 1Y4ZA 4W7HA 8LDHA 5JW6A 5LYJF 4W5RA 1DAHA 1WCXA 4UC0A 1DIGA 3LRXA 2XYRA 1Z28A 1N2CB 2JCBA 3RPEA 2QUJA 3MWYW 5ICEA 4RADA 2ZRBA 1OJLA 4DQXA 2OECA 2K2QB 1VXRA 2NSHA 1DKLA 2GCEA 2V4MA 1RXUA 3HCDA 3W6NA 2HOQA 4ABYA 1WB5A 3O0DA 3RC9A 4XIIA 2F4NA 2JZNA 1Z0ZA 4RCVA 4C20A 4QNMA 1L0BA 4O4HB 3VO8A 1SIOA 3U7HB 1QRSA 3ZWCA 2VUTA 4FFPA 1CZRA 1DXYA 1E94E 3OZXA 3QNMA 4KK4A 5I6DA 4DA4A 3R9IA 4UTVA 4NATA 1X8JA 1RYZA 2FG6C 4CIVA 1YS6A 2C7BA 2DEUA 1AK2A 4I50A 2AEFA 3C6BA 5DTIA 4R3WA 5NULA 1BZYA 4JEMA 2YX1A 4LWOA 3SKXA 3L3BA 4KR7A 4CIXA 1T5LA 2PVCA 3AKYA 5COQA 5TX7A 2J85A 2CD7A 1SULA 5EZ5A 3WLKX 4CMEC 5I3CA 3OCZA 2XSZA 4UD2A 1ZNYA 4G0VA 1SOUA 2JANA 4JJ8A 4C88A 1KP9A 5ALUA 1QE3A 2PYDA 5JD4A 1F7UA 4J3JA 3S28A 4CR6A 2I6TA 1IIRA 2Z4TA 3DEYX 4LMAA 3TDMA 1Z22A 2FB9A 2MSNA 3QTLA 1HO3A 4FNMA 3O73A 2V6GA 2Q5HA 3VFDA 4QTZA 2QG6A 1Z13A 4BIMA 1L5FA 4QJBA 1ZK0A 1ZIYA 3PNMA 3K2BA 1B0ZA 3B51X 1Z12A 3DZHA 1I0LA 4MIKA 3AY7A 3BOSA 3KTDA 5DDIP 2NADA 1BX1A 2P9QA 4UNIA 5BO5A 3ZW8A 2ZT7A 2A92A 4YAFA 1Y1RA 4P8RA 3L6EA 4FXPA 1ESZA 1QRDA 2ZT6A 4R9SA 5BSTA 3O8LA 3KQQA 3C6XA 2XJ9A 1D2GA 2DCMA 3HWRA 3TLKA 4QE3A 5JYDA 1E1RA 2ZFUA 4QXQA 3RS5A 3T5GA 1E2JA 1SCBA 2CCJA 2YC2C 5EI5A 4EG8A 2LXNA 1UFQA 2HJHA 3INYA 4MVWA 3WL5A 5FO0A 1WBDA 4WNAA 2E4YA 3CZQA 3SXPA 4QGSA 1OXVA 3K9WA 2JBHA 1C41A 3A6ZA