1P9OA

Crystal structure of phosphopantothenoylcysteine synthetase
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
290
structure length
269
Chain Sequence
RWAEVMARFAARLGAQGRRVVLVTSGGTKVPLEARPVRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFPPQTWLSALRPSGPLSGLLSLEAEENALPGFAEALRSYQEAAAAGTFLVVEFTTLADYLHLLQAAAQALNPLGPSAMFYLAAAVSDFYVPPLQITMKMVPKLLSPLVKDWAPKAFIISFKLETDPAIVINRARKALEIYQHQVVVANIFVLIVTKDSETKLLLSEEEIEKGVEIEEKIVDNLQSRHTAFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human phosphopantothenoylcysteine synthetase at 2.3 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Phosphopantothenoylcysteine synthetase
total genus 84
structure length 269
sequence length 290
chains with identical sequence B
ec nomenclature ec 6.3.2.5: Phosphopantothenate--cysteine ligase (CTP).
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04127 DFP DNA / pantothenate metabolism flavoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold CoaB-like 1p9oA00
1U80A 1U7UA 2GK4A 1U7ZA 4QJIA 5INTA 1P9OA 1U7WA
chains in the Genus database with same CATH superfamily
3LYHA 1IBKB 4F4JA 2V54A 2HT6A 1G3RA 1IJBA 3EW9A 3MILA 4B74A 5HQ3B 1R4NA 1U28A 1ZAKA 4EZIA 2QT1A 4FU0A 4XGNA 4Y6GB 1EJ6A 1VG8A 3AJEA 5EIBC 2B8TA 3OAAA 4YRDA 4UUQA 1ZD2P 5KWVA 3FWYA 1PYOA 3UOGA 4M8KA 4NBKA 2R4QA 1W5TA 1JA1A 1KO7A 2VPZA 2EHJA 1V95A 1DOHA 4JC0A 4L5CA 4P3KA 4Y2HA 5H59A 3UXEA 4UUAA 1CRLA 1UPBA 2AEMA 5J40A 1UBCA 3KR1A 4AB1A 1M2EA 2O19A 4DV0B 4KI0A 3CTMA 2RGAA 2G28A 4CTJA 1ZMTA 3SHFA 4FLMA 3G7UA 1HOTA 2J3IA 1L7RA 3BK1A 4XQCA 3UJBA 2V7QD 1EHIA 3BB3A 1B26A 3CLHA 3PFNA 4MUJA 3JATB 3N8HA 1B6SA 2DVMA 3KKKA 2IYQA 4MGZR 1ZXBA 4F5EA 1RC1A 3NHPA 3HACA 4PR3A 4RFVA 5CH8A 3IGFA 3EZ6A 4YAOA 5AI4A 4LF4B 3JATA 4N49A 2XMQA 3OFNA 1LBTA 4HG2A 1XALA 4N5LA 5IC6A 5AVVA 3UFXB 4Z0HO 1X1DA 4MVJM 3RWBA 3FZYA 1U1EA 3DLIA 5CGQB 2Q21A 3SK0A 3B7WA 2I7TA 4P9NA 2FW7A 4ZWNA 4WH0A 4C14A 4PNEA 1KDVA 1JG7A 1GO2A 1KHTA 3A0UA 1EE9A 2ZI9A 3OCUA 2Y76A 1Z7YA 1JR3E 1E2IA 3LDAA 4JJIA 3ZCSA 4WZAA 4B84A 3PNLA 3VPBA 1PEKE 4OP2A 2G9QA 5ULLA 2ODTX 4JLUA 3VC3A 5IT0A 3GJ4A 3JYHA 3I04M 4LY9A 1TNDA 2C4UA 2F8LA 4MUYA 4O0MA 4JEMA 5DP2A 3G85A 4J0GA 3RRFA 1U3DA 2VSNA 2ZI5A 1PFVA 2F9MA 3BBLA 3GLKA 2X3UA 1KOFA 3BE4A 2PZMA 3AUAA 4JYZA 2IV3A 3QSGA 1T13A 2Q4BA 4UTZA 5FUYA 2HA4A 3DAPA 4YDQA 4GX0A 1TD9A 4BWVA 4KREA 3RVRA 4F9TA 4JC8A 4NOMA 3M1LA 1DO0A 4LRUA 3TLEA 1BH6A 1I3MA 1XP5A 3FZNA 4IHAA 2F43A 2Q45A 4RV4A 3BHNA 4RVFA 3OZAA 1RRVA 3PPVA 1RQRA 2PH3A 3ENVA 3QNMA 2AN3A 1ACJA 2XD4A 5JV5A 1HDZA 3LVBA 4L1KA 1P39A 3HY6A 5D01A 3I39X 3K0CA 3KLMX 3I37X 1GSIA 5CFNA 1XMVA 4PAGA 4Q1BA 4YBRA 3BD8A 3K9QO 1Z68A 3LQYA 1V3VA 4KAFA 3CNLA 1K6IA 1U2SA 5B3KA 1NBMA 3PPIA 3ENZA 3QUQA 2O2HA 2FMXA 1Q22A 3LCCA 3P26A 4G25A 2Q9BA 4LSMA 2O1WA 3SF8A 3B89A 3H42B 3X1YA 1A82A 4R8VA 3FBTA 4A92A 4EAAA 2HJHA 4J2OA 1H6CA 2P6NA 3VR6H 1U7PA 3PJFA 5AYVA 4PHCA 1GPUA 5LUAA 2E4UA 4L50A 1UK9A 1U7WA 1XD2A 1YNOA 2CNBA 2J5XA 2P2GA 3EGWA 3O3NB 1XN1A 3R6DA 1WUHS 2DP4E 3N87A 1FPMA 1W2WB 5DX8A 3RC2A 4EKNB 4MJLA 3NHYA 3U7JA 4PSDA 1C8VB 5IYZB 1K8XB 3IC5A 3EGXA 1C4KA 4EHJA 3DE6X 1KZGB 1JDNA 1OX5A 2DFTA 4G56A 2LTAA 2Q4OA 4MDHA 1JTEA 1WCXA 1TVKA 2XMPA 3MTEA 1ZMBA 4IJWA 3A6HA 3SDZA 3UAWA 4ATNA 1NQOA 1YR2A 3RS9A 3VC7A 4IGKA 4OI4A 3QLVC 1ZD1A 1G5RA 3PNSA 1M6VA 2E18A 4YRPA 2HX1A 4C89A 2PT7A 4RYDA 4JOSA 4FGKA 3RNLA 4CLOB 4XVHA 3Q8WA 1JDPA 4ZDIA 4EUKA 1RAFA 3HB7A 4GI1A 4GI7A 3HDVA 4I9UA 5EUMA 2AEEA 3H1GA 3T52A 3CZRA 3KV3O 3L6BA 5C7OO 3U7FB 1OVMA 1B0ZA 3FTEA 3K73O 2WHPB 4Q21A 2PIAA 2BISA 4KWTA 2AOUA 4NICA 2ZXEA 1Q57A 2H8GA 2ZROA 4Y6SA 1S7GA 1DC8A 2PKRA 4XYLA 1RXVA 1UJMA 2Z8XA 3OZWA 3S2FA 4F7DA 4QU8A 5F2EA 3F67A 1E63A 1S2LA 1NONA 3A3OA 3AGPA 4MKFA 3ZNPA 2YR0A 2XUQA 2PWPA 4X9XA 3BMCA 1N7GA 4ERXA 1BDJA 1G9TA 1XRMA 3WHIA 1UOEA 4I5DA 1T6YA 2C3OA 2HRCA 2R8XA 4MP3A 4LJ6A 3OLVA 1IN8A 1KVSA 2W00A 4UUBA 4ZT5A 4I4CA 1N4AA 5K4AA 1XMQB 1L7VC 3G5MA 4RCVA 1E60A 1HFWA 2VJMA 4KEAA 4YPOA 5TMPA 4LWZA 1SH7A 4PE5B 1W1IA 3BD7A 3GWZA 3OIUA 5KNBA 1UPTA 3M6WA 5K8VA 3CUWA 1AQNA 4Q18A 4LSGA 1SU6A 4D81A 5IH7A 4B4UA 1WD5A 1Z7WA 3G5LA 1EHYA 1QIIA 2VTVA 3C8DA 3L06A 1E5LA 4GXQA 5GV8A 2PRZA 2YC4C 3PNYA 3LL7A 3QF4A 2GLUA 5AWFC 1K4YA 1A9SA 2I2DA 1IHXA 4YWHA 5JBQA 2CWWA 1TUGA 2WI8A 4DCSA 4I55F 4NCBA 3MNFA 3M49A 1J9EA 4YPVA 2JJQA 1YKFA 3RT9A 4EUHA 2PZJA 3ENNA 1RWVA 2QVYX 2WU8A 3LY5A 4LZZA 5K3FB 1TQHA 1YHYA 2ONJA 4QA9A 4OX9B 1GWNA 1WIWA 2CHUA 4E4YA 2JKYA 1MFPA 2H1IA 2R8OA 2AJCA 2QVXX 5BV8A 1GTRA 4I6JA 3CR3C 4RDCA 5CMLA 3V3TA 1C50A 3PQCA 2QY6A 4H7HA 2VP9A 2YIJA 3NC4A 2YDXA 3WLAA 2ZQYA 2OD2A 2X9VA 521PA 1C1YA 5FLYA 1H6DA 3TK1A 3E84A 5GZ6A 3TS1A 3GUCA 4QBGB 4UEQA 2NV6A 5CAEB 4S1WA 3AGQA 3N3BC 2BFFA 4J0JA 3RNOA 4AC9A 4CQMD 4UNSA 5IC4A 2DHQA 3RYFB 2WYOA 2VA8A 2F4VB 2AV6A 4D0GA 5DK6A 5T41A 1TT5B 2J67A 4EKYA 1II8B 4NCXA 1J7JA 5CA0A 4DB4A 4OXKA 2ZB3A 3LLUA 4X8OA 4B2PA 1WUIS 1NMSA 2XGOA 3CISA 2GFIA 4QDJA 1Z7EA 1TZJA 2OKCA 4W5JA 1MRSA 3ZIAA 3D7MA 3FJ1A 4UHCA 1VCMA 2A14A 3SZOA 2QZPA 1WUKS 3ZWWA 5JC1A 1IY2A 3DKKA 3ZPXA 1F0KA 2WSLA 3K5WA 3QUAA 2IRWA 5D3ZA 5PGMA 2XECA 4OHCA 3FXAA 3TLMA 2XV1A 4B4KA 1SUSA 1OBFO 3MTBA 3K3PA 1MHPA 2BEKA 2VQ6A 3G13A 4LWQA 4QTZA 3WSWA 1XWIA 4I46A 2YYYA 2FZGA 3D59A 3FGNA 1X15A 3UJAA 3C6MA 1KO5A 4JSRA 3ZWMA 4C7MA 1YVRA 4NECA 4EDHA 4FOTA 1P0CA 2NZWA 4Z8XA 1R3DA 1GOTA 1F1BA 5K45A 2HDOA 3VVMA 3U44A 1OZAA 3UWOA 4BVAA 5IVKA 2B92A 1AQYA 3O95A 3PD7A 5A5FA 2FUKA 1X7YA 3DE4X 1FUIA 4FFWA 3EEOA 2J30A 3ERCA 5BSWA 1O95C 1E4EB 3AEUA 2ZR7A 2OZVA 4M76B 2J3LA 4A82A 3Q2OA 3ZHBA 1FBTA 2QI9C 5C5EA 2F1JA 4B6OA 3RANA 1FSSA 4CF5A 2C5GA 3Q5EA 4Y1RA 4DSZA 1Z6PA 4DUGA 4ZK6A 3P96A 1I3NA 5GINE 1VPDA 4JP5A 4R2HA 3R8XA 4O08A 3FSJX 3BEOA 1Q91A 3C3XA 4RABA 3C5HA 1VJ0A 4HWOA 2JH9A 5CCBA 2JFPA 2ZQZA 4OUDA 5FAXA 2A1TS 4TYWA 1E9VA 5BWBA 2AUNA 3BA1A 4QXRA 1TO1E 2R47A 2EL7A 2QJOA 1MX1A 1Z39A 3DBHA 3JQ9C 3ADPA 1ZS9A 3DVLA 1JA9A 4R2WA 4URUR 1Z08A 3MJHA 5TV2A 2BM8A 2H7YA 2RKBA 2DJ5A 4W9RA 1IN5A 5L3VA 2DKFA 4LMAA 3C0KA 4S0ZA 3IP9A 3PXGA 2EKLA 1A04A 2ISSD 4C5BA 3V2IA 5FR2A 2JVJA 3V3KA 2CE7A 4KUGA 3L05A 3PXXA 3VC2A 3ZHQA 5DIFA 4ITVA 1P33A 2PWAA 1TMOA 3RWMB 1P8AA 1XDZA 1FDIA 3AVOA 2PRJA 4JSYA 4RQBA 4C07A 3PENA 2FFJA 3W5AA 1VZ3A 3Q0EA 4WZAB 2PV7A 3ICCA 3DD1A 4EITA 1BTOA 1A97A 1U2ZA 1EK5A 2CBXA 2QQGA 4HWGA 4XQGA 2ZRMA 4EGQA 5DT2A 3A1SA 5KNDA 1XMSA 4V0NA 3NP9A 2CLFB 1P4HA 1W5EA 3K15A 3MFYA 1CUZA 2Z4RA 1SBZA 3B1FA 5CNJA 2HHHB 1C80A 1HFJA 3CEHA 1MAAA 4N82A 4PQGA 1JU3A 3N0WA 4QATA 5E2AA 4YCMA 3HVKA 1Z5VA 4MQFA 4FTWA 5K6RA 1VGQA 4HN9A 3FTNA 2UYQA 1BAPA 4XWYA 1SBYA 3DPSA 4IZOA 4MEBA 3KTOA 3CNNA 1KJQA 2C2ZA 1H1LB 4BHTA 5TSDA 1NLZA 2YV3A 5BN4B 4H1TA 4YAKA 1OHHA 3Q1KA 4Q3DA 1N8TA 2C3UA 1JFRA 2ODWA 3LCRA 3ZS8A 1SZPA 1CR6A 2OAP1 2PXHA 3COYA 1FP2A 3G2MA 4CKBB 1EFUA 2OAQ1 4ER5A 4FIDA 2SCUB 3M6VA 1XEFA 1I2MA 4FLEA 2P5UA 5KJFA 2H2FA 3QRWA 4L3VA 3GFOA 3FWZA 4OB8A 3GEMA 3OPVA 4Q3BA 1CB0A 3RO7A 4GPBA 5C3UA 2YWCA 4H1HA 3KB2A 5ERYA 2DBZA 5AIAA 2OZKA 3F2VA 4O3MA 3A9RA 5LA6F 2R87A 1R4NB 1T8SA 3I09A 3KE8A 4IGFA 1QGUB 1PDWA 1IUPA 1OXKB 2X8WA 4A8PA 4G0WA 4A0FA 3FKQA 1NN1A 4IINA 2BKLA 5K03A 2FPPA 2Q6IA 4LDAA 5HZHA 1TTHA 4BO2A 3NBFA 2AG6A 3IV6A 3MN1A 3A1UA 3QVVA 4G5SA 1J99A 1OV6A 1PZNA 2I22A 1E1MA 1MDFA 2VYNA 3HFRA 2XJ9A 3C97A 3I2KA 4HYYA 4PQFA 1T43A 1V1MB 4HNUA 1ACMA 2KB0A 2N3ZA 2A0XA 4UNRA 2VHWA 3STYA 1NXWA 4D4LA 1QCDA 1KKUA 1WCIA 1HOXA 1R0BA 1PJ3A 4GBMA 4QOHA 4UHEA 1I7QB 1PWYE 5KYWA 1THZA 5LOVA 1LVUA 3LD9A 1NFQA 3EUWA 1UOOA 3F6YA 4LYFA 2G1AA 5FNVF 2A2ZA 4ZT4A 4BP8A 2EW2A 3A1NA 2V7TA 4LYAA 1V96A 2INGX 3EXHA 4C7XA 2ZE6A 1EK1A 5FBLB 3U31A 1L5ZA 2OZLA 1W1WA 2SKDA 2W93A 3NJRA 3R6GA 4H0FA 1PEYA 4B7UA 1DKNA 3TTVA 1EFKA 2QTHA 4MKHA 4HNAB 1PEDA 1ISPA 4L22A 1XKXA 2H17A 5P21A 5M7EA 3DWGA 5EE0A 2GZDA 2Q1XA 4H59A 1ZZGA 2EV9A 3LLCA 4RHEA 5C31A 4GZMA 2O1EA 3LPAA 4I5FA 1M2NA 1PWHA 1YIDA 4TSRA 4U8HA 4M89A 3RJZA 3TKAA 2NV0A 4G5GA 3M4ZA 2OUKA 2XWBF 1M34E 1SFRA 1TC2A 3HKBB 4CMKA 3KDAA 3BMXA 3PUJA 3UCFA 4KWIA 4XSGA 3HUFA 1RZRA 1HQCA 2ADFA 4D4JA 1U5CA 1QQBA 1E1CB 3EG5A 4KP7A 4Q47A 5BUSA 3E9ZA 4EG1A 3GCDA 3GLFE 1XHFA 4K0RA 5JCOC 4DDTA 1J09A 1RM4A 4MPRA 1NE2A 3WYAA 2LW7A 5TQ2B 4XJVA 4A6DA 6REQA 2J0SA 1G3MA 1TJ3A 1XTQA 1W5BA 1ZXXA 2PM8A 1HURA 1HUQA 3QX7A 1D9XA 1OBOA 2EKPA 3EJWA 1M2OB 4M1YA 4MKXA 4RVSA 5TR9A 3T38A 2NPOA 3D5QA 4EY8A 1UDBA 3CURA 3ORRA 4CM9A 1Q95A 5ALWA 3H2JA 3ONWA 2OXTA 3EC7A 2D00A 1ZPDA 3FMPB 5GJCA 1EVIA 3WL3A 1X77A 2HRZA 1QP8A 1RWNA 3DDUA 4J8PA 2IP1A 5HKBA 4CL2A 3VDQA 1YSCA 3LWZA 1RCUA 4FFDA 3TN7A 2VF8A 2LIVA 1QGOA 2GVDC 1BQEA 4PZDA 1JQ5A 2OO5A 1XLUA 3AI3A 2VZ8A 2E87A 3O7WA 4G0ZA 4Q7MB 4YUZA 5E0KB 3UMRA 3UWMA 4HATA 1GTVA 1RTTA 4CEJA 5F7ZA 2MYPA 2Q2WA 2NO1A 5KNDH 3URMA 2GBLA 5JZVA 1ZU5A 3FLMA 4O3FA 2YN4A 3MUOA 5TQ2A 3GLGE 1A1VA 1DG9A 1YASA 2VSFA 1MB9A 3QP9A 1R16A 3NP7A 3K0FB 1LKZA 3D43A 1SVOA 4MA5A 2PQ0A 4AJHA 4QASA 3KU1A 5TC4A 2DQKA 3LLMA 4OQYA 3SMQA 3AF1A 3UJPA 3DMPA 5AVSA 5EJ4A 3Q7PA 3QHQA 2EJTA 4BQSA 4DANA 4WZBB 1POXA 2VWPA 4D3XA 3KR2A 4HMQA 4JB8A 4X92A 2X4DA 3CTPA 4YJ3F 4R1SA 4FCVA 5ALIA 1Z6AA 1K9VF 2GEDA 3QYAA 3BDVA 1ONSA 2EFEB 4I8XA 1PUIA 4OGLA 1DJPA 2WIDA 3ONEA 4HQLA 3N58A 3HG7A 3TZBA 3KQHA 1ATZA 5HF5A 1UADA 1GAJA 4BKPA 2RHWA 4ZAGA 2REXB 3V4PB 2C8LA 5ITVA 2J4CA 4CF6A 5BQ5A 4P86A 1S5PA 2ID7A 4YR9A 5IJ9B 4ZCRA 1R12A 1L3CA 1XF9A 3GLHB 3HCBA 4KLNA 1KOLA 1NBIA 2I3GA 2OZLB 2WU1A 4X62B 4XM1A 2CFCA 4TXNA 2FK8A 2HA3A 2W2KB 1KJZA 3GFBA 3DDOA 3FPLA 2O2ZA 3QENA 1M2FA 4KQFA 4IWYA 4ZAVA 4AG3A 2CMFA 4EX6A 1CRPA 3BSFA 4Y2XA 1RLOA 2PGJA 2CMHA 3R41A 4M99A 4AVYA 4MR8B 3U62A 4W7HA 1Z82A 1BX1A 4MVJA 3PUZA 4HUJA 5I51A 1SCKA 5KX5A 2QPTA 2VHVA 3FUUA 1SCJA 4JGIA 3ZWKA 3RBVA 3UMSA 1ZVKA 4Z0NA 3GG9A 4D4GA 4FFPA 3WL8A 1MC4A 5BRJA 5KOIA 1SKYB 2XXAB 4AJJA 3W9YA 1E9RA 2BE9A 1X80B 1TAHA 3C98A 4C9BA 2IDJA 2APJA 1R0LA 4LNAA 4IO0A 1SZJG 4B7CA 3HJFA 4GLLA 1U0SY 2TYSB 3CRVA 4MP6A 4DIMA 1DC5A 1IDN1 1P7YA 2YJZA 1QYWA 3DE5X 3IXQA 5CEJA 2DPLA 5F3WB 4F45A 1B1AA 1UP6A 1O0BA 5CHEA 2DLDA 4UM5A 3HKEA 5JSUA 3STWA 4EW1A 3KQUA 1GJRA 2Q6OA 2VAPA 3OTIA 2IT1A 2OCBA 5M34A 1XR3A 2VJOA 4L51A 2ZCJA 3D4LA 2FX2A 3TJZA 5CTJA 2Q0QA 1RT9A 2VVTA 3TLGA 1BHO1 2X14A 1J5XA 2W48A 2ZEJA 5DHAA 5EE5B 5GQSA 3UC5A 1TPZA 2V7QA 3O73A 2IPOA 3LAWA 4JA0A 5A3QA 1SMKA 4BOYA 5FPPA 2IY8A 4RKEA 5IAAA 5CR9A 1AH2A 1RLTA 2G07A 4FHFA 5FB3A 3PHJA 3GJ0A 1P5RA 3WGHA 2D2IA 3QF7A 1D1SA 1Y48E 2PGOA 5DYWA 4BFXA 3GU3A 3EN0A 3A0RB 3O0TA 3JQFC 1VBMA 5DWQA 3GJ5A 5CT4A 4YCCA 5BT9A 4J75A 2FMIA 4IIJF 4ZO9A 3RVBA 3S40A 5J3JA 2IK8A 3GUVA 2JD1A 3VI4B 2P2LA 4XLLA 1QUFA 2IX3A 2PRKA 4MSUA 4R81A 2EWVA 2BMAA 2FRXA 5KIAA 1C3OB 2D4AA 3U4IA 5CM2Z 5I9BA 5MN6A 2WWYA 2QLMA 1QK4A 4Y0VA 3S2GA 2OAEA 3GDWA 1XE3A 3G1WA 4MHSA 3ISJA 3P2OA 4ESHA 2C7RA 1CRQA 1T91A 1UJBA 1KJJA 2V59A 1BXRB 4WK2B 1N6OA 1GQOA 2VTEA 1YT5A 3K9HA 3O1IC 3H1BA 3LGSA 4GLJA 3WQHA 2FV8A 3TD6A 3P1JA 3S70A 5CCEA 1GT6A 1PN3A 4TMXA 5D84A 2G17A 1NY6A 4S04A 2I65A 2WF6A 2Y3IA 2ZB2A 3CF0A 3GNSA 4FK8A 2B3DA 3IAS1 3NKVA 4ZC1A 4DZTA 1F8YA 3CRW1 3SYKA 1NJ2A 2FWPA 3TYXA 4BBAA 4J0KA 3ZE7A 3ES9A 3VU3A 1OGIA 3GZNB 1RQ2A 3VA7A 1ECJA 1PS0A 1C3EA 3A10A 4NH0A 4XE5A 1NP3A 3UF0A 4PHGA 3EGEA 5B7PA 3D5EA 2RAUA 4UTOA 1WXDA 4DY4A 1VIAA 4M8LA 3TSOA 4RIHA 4DDVA 4FDLA 3TEMA 5CFPA 1ND5A 1IM8A 1O08A 3UT6A 2QG4A 1T4DA 2XOEA 4GPD1 4PBRA 4TL7A 4DCGA 3MT9A 4D42A 1USKA 4NMWA 2DHRA 4OHVA 4WZ6A 4OI2A 5AJVB 4B45A 1OLSB 5JASA 1VJ1A 3W2FA 5C35A 1DOZA 5EZSA 2JVIA 1F4PA 1JF8A 1JIVA 3HKDA 3VO9A 5G3ZA 2QVCA 1Z34A 4M22A 4C88A 1JP7A 1IIBA 1DX6A 2P9GA 4R8MA 3MTIA 1XHLA 3HYNA 3C87A 1E4EA 1ISGA 2M6RA 3IJPA 4IGIA 5FA5A 3RYIB 5J5AA 4AXBA 1IRXA 3UVEA 1X39A 2I8CA 3PEUA 4LYGA 4MW4A 5DXJA 3RVNA 5JCXA 4O63O 4EGCB 1E2HA 3U39A 4F5ZA 3WOHA 2F55A 3VX3A 2NACA 3RJ5A 3IA2A 2QRUA 5T4BA 1KDPA 4DQDA 4N0PA 2CXHA 1N9GA 2P2DA 2W2NA 2JH3A 1VL2A 3ZD8A 2C7QA 4GC9A 5U9CA 2YW9A 2V9PA 1DTEA 1XZLA 4J1TA 1M5UA 5DHQA 4D4IA 3KZKA 3F5MA 2WJ6A 2IPXA 4TUYF 4ZEOA 2HU7A 1DEHA 3VNVA 2YWBA 3C6KA 3CPEA 3FLAA 4FMCB 1M33A 1ABEA 1PR6A 2VKQA 3I8XA 9ATCA 4GWLA 4I1UA 4IV5A 4TN1A 4PYRA 3FDIA 1J20A 1P91A 1Q0SA 4DW8A 4UPEA 5AI6A 1ZMOA 1G0OA 2MSKA 1U0RA 4BNWA 1W8IA 1DT3A 2HBYA 2OLKA 5DW3A 2I3DA 4GP9A 2AUTA 2R6FA 4IHJB 4HLUA 3CJRA 4GVLA 4Y2VA 3F4KA 4LQLA 1QIHA 4PCLA 1J1UA 2B8WA 3Q3CA 1U2GA 3AESB 1RCTE 4YI3A 3FOEC 1G4HA 4MWEA 5BRNA 3HDYA 1Y7PA 4KJZA 1GPDG 1VLQA 5FPQA 5EJMA 2XVXA 4PS1A 3INYA 4AQ7A 1VBKA 1G21A 2I55A 4TKVB 3SQNA 3FCEA 1R6BX 2HHAA 1O89A 2Y05A 3JPYA 4I9HA 4ER0A 3BPSA 2AQIA 4CIDA 1UZAA 2JFBA 4QXPA 5FTLA 4J03A 1FYFA 2O06A 2ZTUA 3OCYA 3QUTA 4OY3A 5IUJC 1VL5A 4GUDA 4DMMA 1QBKC 1RI4A 5A06A 2MMCA 4FMPA 4IOLA 3FOCA 1N92A 3ZWBA 3AT1A 2OORC 2X2PA 1XTJA 1JQAA 1YDWA 3FHLA 3H2HA 4Z7QB 4RESA 1T8PA 1YCDA 5L3SB 1B8PA 3EH1A 5JVDB 3OP4A 5C1DA 4QFCA 3BJEA 2GZ1A 4ZC8A 3DR5A 4ND1A 4HR7A 1MJNA 1EGQA 2BSQA 1E6EA 3USES 4Q19A 4YJGB 1YQTA 2IYYA 2O05A 1SVLA 3F4BA 3TPCA 2PMBA 3C6YA 4AS2A 3C41J 4OU5A 3AM3A 1XNJA 1E2EA 1FVFA 5J2TF 1Q7RA 3EZNA 3GVPA 3VPGA 1B6GA 2PSHA 3B8EA 3CRRA 2UXCB 1S8NA 4A2PA 3O83A 3CW8X 1VCIA 2V9ZA 3LP6A 2Q62A 4FYYA 1EK6A 4YMUA 1XZFA 4Y3UA 3LUFA 3LYLA 3TRJA 4CIWA 2CNWD 2VLIA 5TS3A 3ZE0B 4IY1A 3ZNOA 1C8LA 4DMHA 4KXYA 4XIYA 1QF9A 4GSLA 2QBYB 5JNRA 3OEEA 3GYBA 2QM8A 4YP0A 3L0YA 3WGZA 3NIGB 2A7XA 3A3KA 2V3WA 2AFHB 4UU0A 4Q9DA 1P2FA 5ECDA 4QSHA 1GSAA 5HIMA 5IT4A 2UVPB 4YMSA 1JMKC 1MR3F 2IOQA 1B8UA 2Y68A 2OGZA 1HZZA 2AJBA 4XZ3A 3OEHA 2VRCA 3EULA 4MUNA 5ILQA 4YQEA 4YRAA 5YASA 3P5BA 2XCRB 1CR2A 4RPKA 5JWRA 1B3BA 3FAZA 1UT5A 1P1IA 1TK3A 3NVMB 2GHQA 2B8EA 3Q0IA 1VI2A 1T24A 3TL2A 1VRCA 4QVGA 3WNVA 3ZI7A 3ONDA 5IWAB 2P5YA 3L8HA 5FBVB 4L75A 5DNCA 2R751 3HA3A 1WNTA 2JFZA 1F20A 3L4BA 4X5OA 3U1BA 3CU5A 1NXTA 2Y1GA 3MW8A 1EUDA 5EHIA 2ICAA 3PDHA 2H54A 5DP1A 2PJUA 3DZKA 3F8TA 1UBLS 3HY3A 3M4NA 4C7OA 1ZW6A 5I3ZA 3E9CA 3NC1C 3LUPA 2YMMA 4D44A 1ESZA 2HZ7A 2H9AA 2PKEA 2AC4A 1JXQA 4K7JA 4RD1A 1OT3A 3BXHA 4P3PA 4ESOA 4QJ3A 3KNZA 2R86A 4OTZA 5HS4A 1NFFA 5G53C 4C3UA 3FPAA 5B3JA 1UBNA 1SHKA 2HQBA 1P2UA 2Y66A 3MYYA 1FSZA 4KQ2A 4ON9A 5J4KA 5MN5A 2OVBA 2VN8A 3ACBA 4HAIA 2D1FA 3U7EB 4BEVA 4V2UA 1XLTC 2FWBA 1MENA 3U7RA 1K06A 5K2MA 3SDBA 4ARZA 4C2TA 1SB9A 4J1NA 1U1FA 1LPMA 2GS9A 3U48A 3OPYI 3F73A 1GVNB 1WB9A 1TGYA 1XLWA 2ACEA 1MOQA 3KSZO 1MIHA 5AUPB 4TQAA 4XSHA 4MYRA 5DHSA 3KV1A 4JI2B 13PKA 4EGJA 4US2R 3UMVA 1DCFA 1VL8A 1GFWA 2YWEA 1QCZA 3PJDA 2QMYA 1ZNQO 4IUCS 3ROEA 2QT9A 3NIWA 5CHYA 1G2IA 1P2DA 2QTZA 5LIRA 1IHOA 2VUHB 1A5BB 3C6ZA 3F3MA 4X64B 3LFUA 1E5TA 2AOVA 4S2UA 2Q1SA 3GGCA 4R0NA 2PKYX 2PZBA 3GFPA 1UXIA 3LHFA 4EVIA 3E18A 2WTAA 2PO5A 1YCHA 2HQRA 3D6HA 3MG9A 2JJ8A 1Z5WA 5ALZA 4C29A 2R7NA 5LQKA 1WCYA 4LDNA 3THWA 2OO3A 3QELA 4M6WB 3INNA 5BMVB 5EJ8A 1P4JA 5FEUA 3CZ5A 3NU1A 1LK5A 3PGXA 4QVKA 1XJ5A 5IM4F 2Q5EA 2ZSBA 3O8DA 4RUKA 2VYQA 1T5HX 1QE3A 1JU4A 2PXAA 4LMBA 1MHTA 2QI9F 3ZV5A 1JVBA 3TUIC 1TIPA 2AFHA 4FX2A 1IJKA 1NF3A 1NMZA 3P97A 2HYDA 1E1RD 3OZFA 4IHJF 4O2RA 1CUYA 2RAVA 4ZQCB 4ARVA 1TYEB 1XJCA 2AZDA 4LXYA 2WZBA 1W30A 1GRCA 4CLOA 3ZW7A 1E2UA 2WLSA 4M0CA 3BL5A 3GLIA 2JCBA 1QB8A 4QX6A 5K0NA 3TIVA 1P7VA 2IEBA 4PS0A 6PFKA 4Q7KA 2F9FA 1V6CA 1E1DA 2P9FA 3HJCA 3MTDA 3O4IA 4QGHA 2PRSA 2DBQA 3RK1A 3ZGYA 5HA5A 3KYCA 4KVAA 2ANBA 1TF2A 2K5UA 1COZA 2H59A 3CO0S 1V45E 2BDEA 1O94D 2DLNA 2OPHA 4DPLA 4DRXA 1KH2A 2RONA 2ZDQA 5KB3A 3WR5A 4IR7A 4EENA 4KI7A 1M0EA 5CT9A 2X5NA 3O82A 5IHXA 3QX9A 1XTZA 3KT8A 4UXIA 4XRRA 5E3IA 1T1JA 1T3SA 4N9WA 4UM9D 121PA 4RK6A 4Y6QA 3EBOA 3FVVA 4YP5A 5HFNA 3WADA 1BCRA 4PSCA 3R9XB 5DTJA 1OWMA 1GTG1 3AHEA 1EAYA 2RSLA 5AK3A 2VK1A 4XD7A 4R0MA 2ZWIA 2FLKA 3EGIA 1F8XA 3ABIA 4WKOA 3SX4A 3F78A 1NVVR 4LJAA 5AK0A 5E7MA 5JU6A 1NKVA 3RM3A 5LYJF 4FPXA 4O4IA 3DBRA 4C0KA 5EI5A 1E1QD 1EG7A 1MH1A 2GEUA 4X60A 4F86A 3HRKA 4WOBA 5F7OA 4BRZA 3OJ0A 3DGFC 4XIFA 1E3WA 1UQTA 3KHSA 5LLDA 2JK1A 1KK1A 3H9GA 3IIKA 1NZJA 1PAUA 3F74A 2HPAA 3LPLA 5CPFA 5E1OA 2NPIA 3I0NA 1WO8A 1ZU4A 2Q8QA 3HNRA 2YL2A 2FUEA 4BNZA 2AVDA 1NC1A 1NT4A 4JT9A 3BZWA 3DVSX 4UMEA 4WAUA 1QV9A 4K9LA 3EXIA 1PGPA 1LC0A 1W25A 2RCYA 2YWGA 1L5RA 3DAOA 3FTCA 3W3AH 4E1AA 5LR6A 5F9FA 2G4CA 5BVHA 4Q4JB 1IRIA 4TL8A 1Q1QA 2KJQA 4RV9A 5DTEA 3DFMA 4E5VA 4NK4A 4BB9A 3VOAA 2V74B 1JHRA 1UZNA 2OCYC 1N0HA 2HSWA 1ZK3A 2V58A 2ZJOA 4KDFA 5T6MA 5T4FA 5F1PA 4TRNA 4YRLA 3D7KA 3T9EA 3WLNA 5KOHA 4TSFD 1NVMB 3O9ZA 1NG9A 1Y7LA 5HFAA 1TX4B 2HMTA 4A0RA 3NANA 6CHYA 3KKNA 1Z37A 4MKIA 4MYHA 5C3MA 2NU9A 1VC2A 1QV7A 3CONA 4B3SB 1D0SA 1OZFA 4IUDS 2PE5A 4DZRA 2JGMA 3WXMA 1GAXA 2W2LA 4HQNA 2WYVA 3WC4A 2C4MA 3TW4A 3ZJVA 2YRXA 1I4LD 3IURA 3E9DA 3GROA 4YONB 4J3NA 5HZKA 5IFLA 2B5OA 1N4DA 2P9ZA 2QL5A 2AOXA 3COSA 4FUTA 4IMPA 4RD6A 5D1HA 2DGDA 2OECA 4ZD6A 3PIDA 3D7LA 1L8LA 3EODA 3W8FA 5ICEA 2IYXA 5DMHA 5A2GA 1YONA 1UBOS 5GP1A 4TM8A 3ZWPA 2HPHA 4F8YA 1E1QA 2CWDA 1QHSA 3JV7A 5BW5A 2QP4A 4EF4A 3UATA 4KK4A 3IJRA 3LQKA 4RFSB 3ZBUA 3EXFA 4HTFA 1SXJE 4DC1A 1P9NA 3KR0A 2WW8A 1RC8A 4FHDA 5LQJA 2I4IA 2A33A 2CJFA 3CS3A 3JQAA 2BI4A 4DWWA 1WB6A 1HDGO 4RSGA 1Q7BA 2QRVB 1UAYA 1TL7C 2EW8A 4M0EA 1ONOA 3IMKA 4JBIA 4TX1A 1P2SA 3S8EA 3DMHA 3MT0A 4ZJYA 1JG3A 3CSSA 3I1JA 2OKGA 5CFOA 3FBWA 4KU4A 2GD0A 2I6FA 5HF6A 1J8DA 4RACA 2KHZA 3NO4A 1HDIA 4BKOA 2GHRA 1JHOA 3O26A 1WY5A 2ID4A 2PCLA 4LXUA 4BMCA 1NC3A 3NHAA 1QG2A 2FEXA 4KTTE 1MG5A 1QYDA 1NWHA 2EKQA 2V7XA 3RJ9A 4R71A 1XNRB 2HSZA 1ZVMA 2YHSA 2QN2A 2HJ9A 4IKPA 4PHFA 4MS3A 2R6GA 1CEYA 1NW8A 1TFRA 3O8CA 4LHZA 2TS1A 3OX1A 3ST7A 3K2BA 1M2VA 4LSWA 3GAZA 4Y18A 4EEKA 4DR1B 4CG2A 2B1RA 1I5RA 2ZBVA 2ZS9A 1FC0A 4IXTA 2VJBA 3B2EA 5CX4A 1FIUA 3STXA 4F97A 5AW8A 1CVRA 5AJXA 2FZWA 3TLYA 4Q4HB 1DHTA 4PGAA 3D7SA 1Y1KE 3H6KA 2XOKA 1RZ3A 4J2HA 4HS9A 4NC9A 5F7JA 2I9PA 3H17A 1WXQA 3C70A 1V3UA 4TT8A 3ZNNA 4GXRA 1CG6A 1SA0B 4B3JA 1QFXA 2P69A 2X8JA 5KYVA 1VE3A 1QR2A 2NADA 4R2MA 4FEGA 4NEQA 4CDMA 4AURA 1LPBB 1GN9A 2VWGA 1FRFS 2NZXA 3ZU4A 3X3HA 4EYQA 3B3AA 2C4HA 5H68A 4N76A 3P4YA 3I52A 3P4UA 3B1VA 5E4FA 3TVDA 3SXUB 2WWXA 3DKIA 3HZZA 1CJKC 1QJ4A 5LQRA 3UOAB 4TS1A 3D6MA 5FBHA 3V8BA 2IH2A 3CEAA 3VYRB 3PDIA 4J6EA 3HA5A 3JYOA 4CPDA 4PG4A 2RH4A 4GLFA 1G291 4EJ0A 3DZFA 1YZ3A 1KYIA 4G63A 4H7JA 1XKLA 3TR6A 4P4SB 1JTFA 1CERA 1P44A 2P2CA 4FYVA 4K03A 3NBZC 4MW2A 2GXUA 3MELA 4KNWA 4LDJA 4ZOLB 1C9DB 4N8EA 4YV0A 2VDMB 5TARA 1GL6A 4MCAA 4MLDA 4NOLA 4OEHA 3ZDFA 5SY6A 4GYKA 1Q1AA 1T3TA 2ZSUA 2OHFA 3REFA 5KX5B 5CDYA 2GPTA 2IEZA 3THXB 3MWGA 3IXLA 3IEPA 1MFZA 2VFAA 4KO8A 1TQ2A 4Q15A 1E98A 2Z08A 4MUEA 3IEKA 4YACA 1WETA 4BN0A 4BQOA 3PKJA 4FKMA 1D2NA 3ZS9A 4CMCA 1R5OA 2W2KA 1VJRA 2W5UA 4NULA 3KSBC 4H1UA 3GXBA 1WTCA 3TSWA 4CKWB 1N57A 1XYYA 4QGAA 1PR4A 1YFJA 4O8ZA 1YS7A 1GV1A 2PMDA 3TIIA 2Y0BA 1GL9B 4ZT7A 3BQ9A 1Y5MA 1V3TA 3ESZA 1YZYA 2UZ4A 1MVNA 1A8QA 1G3IA 1W85B 3R6WA 4N48A 3PDIB 3HU2A 3NYWA 1ZNXA 4IIFA 4NZMA 3X1DA 2NU8A 2VK2A 1AKQA 4IVPA 2VHUA 4L15A 3SXUA 2W6IA 4JOQA 5AM0A 1NVVQ 3O4GA 1BRTA 2G71A 4KQWA 3TI7A 2NO6A 1YTLA 3HCEA 2I6QA 5CFLA 3I5AA 3QVKA 1XVUA 3GI1A 1YUMA 5UKDA 4MWSA 4QYSA 5LP6B 3T7EA 3TZKA 3NXKA 1OYWA 3D3EA 3D8RA 1EFAA 2PANA 4R8KA 4K05A 3L5OA 5ALGA 1G19A 1VHTA 3AHJA 4IUBS 2QQ5A 4OBBA 4NONA 4EI9A 1Y8RB 4JX8A 4ZDKA 1DAOA 1XJWA 2MSLA 2ZETA 2OFOA 1RD4A 1I24A 2IHKA 3CUUA 3OESA 5F3RA 4URHA 4BVKA 4XPIA 4TZKA 4FDAA 4GZLA 4MVCA 2BBTA 4EL0A 1JFTA 4WXPA 4REMA 1H9CA 3ZQKA 2X5KO 4JI1B 1U9IA 3WVNA 3WNZA 2BFPA 3D8HA 3QNWA 4D80A 3L4KA 2EHDA 2NXWA 3I92A 4B34A 1J0DA 4KMOA 1KP2A 1GU7A 3Q12A 2IYTA 2VDJA 4ALNA 1PBNA 2WSBA 1Q12A 4G2TA 1U7HA 4PG5A 5AHWA 5K9ZA 5DM60 2FZ5A 2ZT6A 2GOYA 3P9XA 1QR6A 1U0FA 2AYZA 4Q7LA 5LLSA 3I2HA 1QHYA 4NBNA 2B6NA 1Y4UA 4BQPA 1FXWF 1V47A 1W0CA 4C4ZA 1QX3A 2CLEB 1WDTA 2KBEA 4MITA 2ZYAA 3A6KA 1RAHA 2Z1NA 4D3ZA 3M6IA 2VDNB 3LBIA 2J0EA 4IX9A 1PQPA 2QU8A 2XKAA 1NN5A 4BNDA 5C1BA 2W6JD 3WAJA 2AD1A 1UXOA 2PSJA 4I50F 1VPVA 1IVYA 3JQ7A 2E37A 3JY6A 1P2GA 1SU7A 1BHJA 4GMXA 4N5IX 1G2PA 5CNMA 4RSRA 2GWHA 5A9RA 1UPUA 2FHPA 5ALDA 3R7SA 4NDAA 4OLHA 1C2TA 3PFIA 6ADHA 5HRAA 4E2XA 3IO3A 2P2YA 2BBSA 2EF0A 4QLBA 1THTA 4ANFA 4C2BA 1LDMA 1H2YA 3AVUA 3HXMA 1I13A 1JJFA 5TGTA 1ZGJA 3FZGA 3R74A 5C5DA 2QRVA 1T0PA 3RODA 4XEUA 3IKJA 1PI3A 3JQAB 2PUBA 2VT7A 2A94A 5F5LA 1XDGA 4CV2A 1GZ6A 4EJSC 2PYDA 4HNVA 3CX7A 2ZZMA 2EX0A 2Y27A 2M1ZA 2R1ZA 3GGSA 5ELMA 2RGDA 3NWPA 2X19A 2CL0X 2WD7B 2Y4NA 3Q3EA 1GPWB 4LRYA 4PC7A 4PZAA 1AKNA 4ZI3A 4I55B 3A6EA 1VKZA 5THQA 2F8MA 3OQNA 3JQDA 1JG1A 4DLVA 5I4KA 5A7HA 4BBJA 4MRRA 3CH5A 4KQHA 1MV5A 4D3YA 1UKZA 1PGOA 1VA4A 2G5GX 3JWJA 4B3HA 2QAJA 4BQIA 2M32A 1Z0UA 4XI9A 3VX4A 5TXGA 2Z9DA 2CUNA 3F3SA 1VKNA 1X8XA 4NU6A 3ONFA 4RGYA 3A2KA 3RS8A 2P8JA 4CM4B 3HDQA 1WEHA 4OB7A 4RE6A 4YRQA 3A05A 2G82A 2QSUA 4JVOA 4C0JA 2GAIA 5EKUA 4KFRA 4AYTA 2R25B 4L73A 4CGZA 1WD7A 2FPPB 3OTGA 5LXTA 1THGA 3TTXA 3SEQA 1ZL0A 3IQFA 3W78A 3X2EA 4EQZA 1FOEB 4ZK2A 5JIBA 2NSYA 4JT4A 4JITA 2MSNA 1M2GA 1A9OA 2O2EA 4PG7A 1YHZA 4P7JA 3O8OB 5EXDA 4IJQA 1E2PA 3ZI4A 4B3GA 2ENUA 3JVEA 2D1YA 3IPCA 1SBHA 3QYFA 4Q6BA 1AUXA 3H5RA 3PVCA 4U8GA 1RRFA 5IK2A 4DA0A 3T4EA 1O6GA 3GDOA 3B5IA 4QPCA 4UHDA 1FQKA 2CK3A 3SJCA 2ZRHA 1V6SA 1V8ZA 4R8RA 2YCBA 1HC7A 4IEIA 1HEYA 3EXIB 3HHPA 2ZJYA 4U0JA 4TMTA 1V25A 1C2YA 1ZJYA 2EEPA 1TTPB 2CLSA 3E5HA 4GDFA 2WYWA 1VBNA 3P0FA 2JIMA 2CVHA 1OLUB 5KNLA 2A1IA 4FGJA 1XQ1A 1Y1TA 4ETIA 2WJZB 3CKYA 1QU2A 5ILGA 1YI0A 2CFSA 1FFYA 2C4VA 3FR8A 2BH9A 2PKXA 3FKJA 3K0AB 3K8QA 4UMVA 3W7AA 5U1PA 2P4HX 4HQRA 4KRXA 3WLLA 1G42A 4NV3A 1P3JA 2BJHA 4EGFA 5KOJA 3BTUA 4W6ZA 4BB0A 5E8JA 3FD8A 1Y3BE 1C14A 2VPXA 2CHQA 3IDFA 1PFYA 1DUSA 3U4AA 4D02A 4ZYWA 3I9KA 2K2QB 3UV7A 3UXYA 3WGLA 3R9XA 4CL8A 4UUOA 5L4LA 4C7JA 3CE9A 1DKRA 3QEMA 1OHHD 2ZUFA 4D99A 1IULA 3PI7A 1AHNA 2HWKA 2J7KA 3RRYA 1TIBA 1V11A 3AB3A 1CY8A 4WLUA 3R7NA 3S2IA 4C4SA 4MK4A 4EYOA 1G55A 2BFNA 2PTHA 2XZLA 1M66A 2EBHX 2XODA 5I5GA 1BROA 2AW5A 1Y98A 3UN1A 1H2EA 3IELA 2HF7A 1E69A 4EI8A 2C31A 1PWEA 2XKKA 1T0JB 1JZSA 1W47A 2CBZA 3FUTA 2CL6X 2FR8A 2ZAOA 4JYMA 1I2AA 1KFEB 4K87A 1YRYE 4DLPA 1BQ4A 4PLHA 2VDKB 2N75A 4XTRA 4CM6A 3NLLA 1SCQA 1GSOA 3ET5A 3UO8B 1IYZA 3QKRA 4CM8A 1PV4A 1QHIA 1XT6A 2O1XA 4BQRA 1P72A 1IBSA 1JWAB 2DH5A 3MB8A 1MB0A 5F23A 1K89A 1LWOA 3C2QA 3G1UA 1N9KA 4FE3A 4CCAA 5AP9A 4CIVA 4YCLA 3WMXA 1KY2A 2PGAA 1USIA 1I9CA 3KPVA 4LXGA 5AT1A 1HPLA 2JJ1A 1EFPA 1X2BA 5AESA 3GRYA 4RZ3A 2A9OA 2WRZA 3KEGA 4XJTA 2QAIA 3MWEB 2X3YA 3SX0A 5LNK6 5LP1A 2PNFA 1N1DA 1D8AA 2NSHA 1NT2A 3EEYA 5HOQA 2MWMA 2VPPA 4HJRA 4P4NA 4WVFA 4GR5A 4G1FA 2CVPA 1FNSA 1QG6A 2PSDA 4KGZA 4UBNA 1KO8A 2EFCB 1KQPA 1NUAA 3ASZA 3QMWA 4IO1A 3FRIA 4O02B 3PX3A 2WUEA 2XQVA 4ALLA 2QE6A 3CF4A 1JTVA 1BOFA 1CDDA 2CLOB 5MN4A 3H1FA 2Y92A 3OJWA 3TW0A 1M5RA 2V0NA 3E2MA 1RJFA 1BA2A 1WZUA 2C42A 1RRCA 3EF1A 2HOQA 1MG0A 3OKAA 2B1GA 3ZZTA 4LSZA 2RE8A 4W8OA 4KTVE 5BVGB 1JAZA 3GMTA 1YOBA 4B4WA 3RIGA 4YWJA 2NOAA 5TMEA 1PSDA 1AS3A 1CJSA 1BCSA 1JBEA 1DXHA 3RG2A 2RG7A 2ZE7A 3WIVA 4DSNA 3LNTA 2WKWA 2BTQB 4V3BA 2B30A 3N8NA 5F12A 1QQAA 2OSBA 4QOEA 2QLLA 1BSVA 2ONKA 3BGDA 3DTYA 3SZGA 2F1HA 3L0DA 1JQEA 1M0TA 5CLLA 1V71A 4HAVA 1IHPA 4RS4A 2P9JA 1EINA 1O8BA 4CNBA 2PL5A 2AH5A 5HKKD 2XYVA 1NX9A 1P0MA 5ADUS 1XZIA 3VHXB 4NFLA 5C81A 5KNBH 3IEMA 4WMLA 2GGSA 5A3JA 1DQRA 1SU8A 2Q4TA 3DLPX 3UB3A 5LQDA 3PXCX 2YV5A 2IY9A 3VM6A 3C3CA 3BGSA 2HCFA 2XMCA 1N75A 3EVAA 1JQBA 4PX5A 3O31A 4Y0NA 3NNNA 4NZYA 3VR4D 3G88A 3RADC 2VPYA 1TC1A 2FP3A 3O2QB 4A5OA 2OZEA 2R60A 1GCAA 1ANKA 3WDKA 2BMJA 1JN0A 2GYVA 1XXHB 4FT2A 4Z9YA 5JS7A 4L3OA 5AQ1A 3L0SA 2ADOA 4LWOA 5I8WA 3F47A 3WO0A 3QVJA 4HDCA 1BXGA 1QIGA 2C2XA 3BIJA 4E31A 3LX6A 4BWYA 4Y6PA 2EARA 3PC8A 4G1VA 4DCMA 3GJYA 1A5SB 1XP8A 2O2XA 2ZSEA 1ORWA 1NW7A 4EY3A 3AZQA 4BVJA 2C2BA 3MINB 1ADGA 4FYKA 5ELLA 4N3CA 1AKVA 1ZO8A 1BJRE 3E9RA 2P35A 4G37A 4HHEA 3EQ6A 3WYBA 4CQMA 4EKEA 2XGJA 1Z06A 5E4YA 4L76A 1R0YA 3SLRA 1CUHA 1BA3A 1D04A 5EVCA 5L3RA 5KS2A 4I1RA 1G5TA 4B3MB 5F9MA 4BUCA 3HR4A 2ZI7A 1HE8B 4ZI7F 5BY2A 3QXJA 1U94A 2YXBA 1ONBA 4Q02A 4ZQHA 1SIUA 1CUSA 3OIWA 1HH4A 1NI4B 1ODTC 1RWPA 1IMOA 1F2TA 4CT4B 1FDUA 1DFIA 1GARA 3L0PA 4QDKA 3TOVA 1JKFA 1QNLA 4Q3KA 4PFQA 4HFMA 4P80A 4WKPA 1CQJB 2E85A 4PZCA 5LBUA 4EPWA 3LPMA 3KIPA 2O57A 1Z9BA 4B44A 3PSAA 1BMQA 5IUKC 3CNHA 3UH0A 3VR2D 2XBLA 3TBFA 2W6PA 3FSEA 1P0IA 3LE8A 2VJMB 2MCFA 2VQEB 2VDOB 2G3YA 2AMFA 3BBPA 2PS3A 2J3QA 4JGGA 5A1JA 1UDWA 4K86A 1ORRA 2DPGA 3OOEA 1TJYA 4QTUB 1Q92A 3GLTA 1TCBA 2Y99A 4KYTA 2H2HA 3BUSA 2YINC 3HL4A 3WK4A 3CSUA 1QHHB 2V6GA 1Z4NA 3OJXA 4NK5A 1QZXA 3PYLA 4ZU6X 2JA2A 1VB5A 1L5HB 3RIMA 2GXQA 1SK8A 3NEYA 1U1DA 2D2FA 3ZH9B 1FW6A 3WRYC 1DIGA 2MR5A 1GUDA 2H1FA 3UPTA 2E4WA 2Y0EA 3U17A 1Q84A 1WB4A 3ADKA 4FC6A 4U7FA 3MD9A 4I1YA 4TYMA 4YRJA 1KJ8A 4MCHA 2FXVA 2I6UA 3PC4A 5AVZA 1RYEA 1E1KA 2GF9A 4X71A 4E4TA 1RJWA 4LYJA 4NBVA 3ETGA 2IZ1A 1RXSA 4RKFA 3B3FA 1WF3A 1CFJA 1KXJA 3CLKA 4U6SA 3DH0A 1DDIA 2OGTA 1PT9A 1IVSA 3QLUC 2OK8A 5LP6C 3TQIA 4FYWA 3M6FA 1S3IA 4G9GA 5G0VA 3VR6A 2HFKA 2XVAA 1E6LA 3ZW9A 2ZS8A 1Y1QA 1ZCJA 4LYEA 1NLYA 1C1DA 1QGDA 1IHUA 3A4TA 1TVKB 3ER6A 1F4VA 4QBHA 4QHSA 4HGNA 3OZUA 4JLKA 2VJQA 3UMJA 3KEFA 5L6LB 2A9VA 4NZZA 1YULA 1KO1A 1P1HA 3VU0A 1UBRS 5JW6A 4Q9LA 2IPNA 1NNEA 5IYZA 1MAUA 1NVFA 1EGVB 1JGTA 3IKTA 5KJEA 5CVVA 1XD2B 1YMVA 4ZO7A 1NJFA 1JIXA 3A1FA 5ALOA 2WSIA 2YWJA 3TZEA 5CVUA 4RFSA 1ZUD1 2H16A 4NPCA 3J7TA 2QROA 1B4DA 2FXIA 5DN9A 4KYIB 1PJ2A 3TNDA 2R8EA 1HE4A 3HKDB 2PUDA 2B2NA 1E0SA 1TCVA 3BH0A 3TSZA 4UM9B 4WFQA 1O2DA 2FN7A 3GDHA 4C4PA 4B31A 1TIKA 2NU6B 5KWJA 5JPIA 2BAGA 4QXOA 5G1PA 1LVHA 1EBBA 2IEYA 5CD1A 4GMHA 1O4WA 2FEMA 4JB0A 4ZJPA 1J49A 4FB4A 5B1DA 1SVSA 1Y89A 5EKTA 3V33A 1EFTA 3NETA 3VR3D 3I72A 4MQ4A 1IXZA 1EWQA 1JKMA 1EA7A 1RWMA 1X7DA 2IZ7A 5TPWA 3OE7D 1E8NA 1OBVA 4P58A 5A71A 5WRFA 4BE7B 2LZ0A 3AC0A 1DGQA 3S3TA 1UBMS 1H42A 1E7SA 1X9HA 3BJRA 1SHLA 5IJ0B 1TYCA 1XNQB 3I1IA 1GCUA 4OQQA 2HNBA 1ZDMA 1DV1A 1DQYA 2C5AA 4HGOA 1DKMA 3GPBA 4NFYA 5KYTA 3ETNA 3IR7A 5DRTA 4Q03A 4RA6A 3O74A 4N7RA 2GBLC 4L0DA 3ETLA 4OIFA 1ZWLA 3R0JA 3IP7A 1I94B 3HCFA 3PCXA 4NCKA 1LZKA 2C7PA 1MIOB 1XZEA 5AUNB 1Y3IA 1M3SA 3QBTA 4MDYA 1Q3HA 3IBFA 4BCBA 3WHLA 4KR9A 3AHGA 4BVFA 1Z6TA 3CLUC 3GGGA 2BUBA 1VHLA 1GA1A 2JC3A 2Q9CA 1XO1A 5F64A 3RLIA 4EUSA 5EJ6A 4Y8VA 2OOSA 2RFLA 5B4TA 4YO7A 3U3OA 1EUQA 2ZJ3A 4HDRA 3SFTA 4IXWA 1PFQA 2O8FB 3CV3A 4XDYA 4JIMA 1U63A 2H0RA 4OK5A 4W5RA 5KCMA 4M1TA 2AI1A 1DEAA 4Q3EA 3OKCA 4ZA2A 4DIUA 1C9NA 4XB6B 5BYKA 1DLJA 4TYYA 4XX0B 2OHHA 3DO8A 5BUZA 2C5BA 2WWHA 1SWWA 1Z0JA 3B13B 1H2RS 2NO7A 3K0BA 2RK4A 3Q3IA 4O59O 5FKJA 3VZCA 3DMYA 1JHXA 3TFQA 1MABA 3F97A 4WUVA 2F64A 2WU3A 3U7HB 2X1VA 4PTLA 4NJMB 1GCGA 2JDID 4IEEA 5JQGB 5HGXA 1UPFA 1RDFA 3ZGOA 2OM2A 3FMGA 2VJAA 5BOVA 4Q4AB 2WPNA 3GJ8A 3OMXA 3TOCA 2X8BA 3KWJA 3RUCA 4Y1GA 1SOAA 2Q5HA 1SHUX 1RPNA 3TX6A 1QANA 3DVAB 4DLLA 5KTRA 3DZHA 2F3RA 2P9QA 3HN2A 3KU4A 2XQIA 3LZDA 4K9KA 5B2ZA 2O23A 1NI4A 2X1MA 3GN2A 3Q1LA 5AJZA 4AMBA 1FMTA 4NR0A 5DIZA 4XKJA 4U2BA 4E6PA 5MGNA 1KEZA 2AOWA 4D9HA 3HKEB 4R4JA 2DTXA 2RCNA 4LX8A 3BGVA 3I9NA 4RLSA 4S1OA 3TR5A 4AY4A 1ZX1A 3T3EA 3L1UA 5FI1B 2H51A 1GLVA 1GTZA 3AXTA 4O2BF 3T1NA 5LZ2A 2YMQA 3BFKA 1HDEA 1RPZA 4WESA 5AJYA 1Z4OA 1QV6A 3OHMA 1HKUA 1PLJA 4FSHA 5JATA 3TLCA 3J81A 2SICE 1XDSA 4TWIA 4XQ0A 4E2ZA 2ZM5A 1O54A 5H80A 2FNAA 4WZBE 4ERNA 2DPHA 2IIQA 5DULA 5A4AA 3WJAA 1LJ8A 1ECFA 2AQHA 2PMEA 3U26A 1JEJA 1FFBA 2X8LA 2EFGA 2YHUA 1LSJA 3QVUA 3I62A 4YLYA 2B5VA 5H82A 4CUJA 4ABYA 5COAA 2CY0A 1E6CA 1M0WA 3U49A 3A70A 3EMBA 3OA0A 2X0IA 1JALA 4KN8A 3KDPA 1V7QA 2RK6A 4ZOCA 1E18A 4DIFA 4L5YA 4LHWA 4RVOA 4C0SA 1W87A 4L07A 4RQTA 1S7CA 2X7JA 4UEOA 4UU7A 5B1YA 3KB8A 4W63A 1Y33E 4WXHA 4AICA 1QVWA 2EFJA 5JNUA 4RKRA 2XNCA 4HKTA 3T3DA 3HDJA 4JL8A 3P0JA 1PCXA 5GMOA 1ULTA 2ALJA 3IUQA 4UQPA 3S0JA 3DHNA 4TRMA 1BOOA 4U4AA 3VU8A 4MR7B 2C61A 3FYUB 3LF2A 3MWYW 3WKCA 1JRLA 3V2GA 2DTDA 2F7SA 3FUCA 3M3HA 5C34B 3WFJA 1UK6A 1J2TA 3OZEA 3AHIA 2PMKA 1A8HA 5G0TA 3RSCA 4A2QA 4C5AA 5I01A 1MW8X 4KB5A 1CY1A 2O7VA 2I4RA 4ZVNA 4JY7A 3M3PA 5CXUA 2YYZA 3ZUPA 1G8KA 3FZQA 1IXSB 1KAMA 1NMXA 2XNSA 3OBIA 4FDVA 5EG5A 5T8KC 1E7QA 1MQAA 2IGTA 1JYFA 4ZU1X 2PFSA 2BMWA 5MFZA 1ZN2A 4AY2A 1UWKA 2BKVA 2IV7A 2VNJA 3KQKA 3L8FA 4RVCA 5A5DA 2QK4A 5TJHA 1UFKA 2DZDA 1JEOA 1N2CB 3UENA 3QPWA 1YU6A 4LE0A 3WKDA 5I7FA 1N34B 2ZJ7A 4HMPA 3WLSA 1U7ZA 4KAJA 4KNYA 3WIBA 1MVLA 1Z38A 1L7MA 3TLJA 3KVNA 1G5IA 1SKMA 2BGTA 3HB9A 4RD2A 1GA6A 6LDHA 2YBEA 3QPUA 4AO6A 2HNKA 3PIIA 1PX2A 3ZXSA 1T8UA 3P9QA 1EUCA 1FFDA 3G49A 2PX8A 2QUKA 3DEFA 3WQRA 2HK7A 1J8YF 2CJPA 1JB1A 2GNPA 5C8YF 2DYKA 3G5TA 5DE3A 1MA3A 1G8YA 3ZDXB 1N32B 5CFMA 1V4BA 4HEA6 3V42A 1W5FA 4HO1X 2V7VA 2RGRA 2J41A 4NZ9A 2WKPA 4MVJH 4NYIR 5B1SA 1UT8A 2GN4A 1UXGA 2F1IA 3VPXA 1QO9A 2BM9A 1JG2A 4L5IA 3ZZ0A 1R4ZA 4EJSB 3RRBA 3LTEA 2ERXA 3B1KA 3NGLA 1LZLA 2QW8A 1O6CA 3DUWA 2XH8A 2FE1A 3FMIA 1PG2A 3AZPA 1YI8A 1P80A 3E35A 1J6UA 1ZUHA 2R97A 1JA0A 2PUTA 4FSXA 5CVDA 3WGUA 4EFMA 3GT4A 1G64A 1VYUA 5AK6A 5ALJA 1K08A 5DYTA 3GV0A 4MV8A 1BW9A 4NH4A 1IY9A 2VJCA 2A35A 1VTKA 4PEVA 1G7RA 1PGQA 3BIFA 1L8OA 1GU1A 2VWQA 5E7QA 3T9DA 2I8AA 3TR0A 1AXGA 2CLLB 2JAXA 1I7DA 2Y4OA 1QE0A 4NCAA 2FDCA 5JNVA 2GR9A 1YVPA 3A3PA 5L3SA 4UW9A 1JX6A 1G3UA 5JXIA 1ST2A 1Y8QB 2XTNA 5L6MB 4J43A 1E99A 1YJBA 3SC2B 1ORVA 1UAGA 2HHJA 1YU9A 2ECPA 4FOOA 3WGJA 5FOQA 3ZWAA 1FRQA 2O20A 1BHQ1 4XFJA 1E2NA 2B61A 3NBQA 5KTOA 5JLJA 5EIAA 3WL4A 3VPFA 3GA5A 5D8DA 2BI7A 4PZYA 5KOJB 1YBFA 3LVRE 1GGKA 5DASA 1N5JA 3SS7X 1KWGA 4MEJA 1AGRA 1O9GA 3EFHA 1UFRA 4XFDA 4KITB 2IUFA 5C4IA 3VJRA 2GPJA 2DTEA 1R8QA 1YC5A 1XOIA 2YS6A 3AESA 3GJSA 3QU5A 1TU4A 5FHRA 5B3JC 1OLUA 4C6TB 4OD0A 1AVTA 1X3SA 4FE4A 4AMUA 3ASYA 2LCFA 4P53A 4YT2A 2JLBA 2HXYA 3QXCA 5CCDA 1EJ0A 3BTSA 3QE3A 4I4IA 1BS2A 1LBEA 4EFLA 5ITWA 5MDHA 3EZ2A 1TJ4A 4XGKA 1BWRA 4IMIB 4X00A 1E6WA 1HE3A 3GVHA 1RAIA 1TYAE 2GKSA 2V65A 1JSZA 3G6WA 3WB2A 3X1XA 4PFJA 5BQFA 3KJFA 1M73E 2SCUA 4B4OA 4HWRA 3E8XA 1XGKA 4TV8A 3HL0A 4MWCA 2JFOA 4QYMA 4EHBA 3KOYA 2JFXA 2OAGA 4EFKA 4RA6B 4KKVA 4DV7B 3I9JA 4JYPA 4PBTA 3QSYA 3B60A 4Y9TA 2QU7A 3NKFA 2BGUA 4FEAA 4G1UC 4HLQB 1FJHA 1L7XA 5FTMA 3T95A 1AMNA 3FI0A 3FX2A 4NZOA 1D2GA 2X0JA 4RH3A 5AKKA 1J07A 3QFCA 5HK9A 3CIOA 1DJMA 2XF8A 4QOGA 1NJ6A 1YIAA 1OIWA 5EIEA 2QRQA 5BR1A 5H81A 5CD9A 3IE0A 2W6MA 2J3HA 1B74A 1RE1A 3F90A 5I9MA 2PIDA 4ZYTA 5DJ5A 4YJ2B 4FQ8A 5CXSA 3OY2A 3AF6A 3CGGA 3VYVA 3H9EO 3WHKA 3QIVA 2QJWA 1P73A 4M60A 2NU6A 4D5GA 2RMKA 3QPVA 3VDNB 5CVJA 3DZ8A 3R0ZA 1T4GA 4GLBA 1OCEA 2WK1A 5K0BA 1G3QA 4WASA 2ORIA 3HNOA 2A9KA 4KQ6A 2X1HA 2KPOA 1ESMA 1PTJC 2ZJ1A 3EPRA 3GH3A 2NTJA 3QK7A 4JBLA 3C1UA 5A4DA 1D0IA 2OC9A 3OA2A 3AWDA 4C0HA 5EE1A 1AZSC 3LRPA 5BSGA 2ZTLA 3L7OA 5AJTA 3HUDA 2XY4A 4ZJUA 3QITA 1AHIA 4J9VA 2C9YA 2LGJA 1OXBB 1IAQA 4HDMB 2H1CA 3LL4A 3RGGA 1EX6A 4FJ2A 3AI7A 2CV2A 4OHYA 1SC1A 1SK9A 4QIHA 4WOKA 4X85A 4LHVA 3KXIA 2AA3A 3VNAA 2FQYA 3DE2X 4PWZA 4DKXA 3ZU5A 1MPTA 1DWPA 2WE8A 4U3JA 4PCAA 2BLNA 3WLKX 2BCJQ 4WT7A 1S2DA 5CIYA 4DQKA 1A4UA 3NHFA 1IB6A 1ULUA 3I05A 3TBKA 5DGIA 5BPFA 1JILA 2PTGA 1D2RA 1O94C 4WCVA 3AOGA 1CDEA 2Q3JA 1IOZA 1O5TA 3FKSD 4BXOA 2NIPA 4GVXA 2R00C 4IGEA 1LPOA 1OYYA 1YL7A 2FN4A 4CMJA 3MM4A 3PTLA 4FXPA 1V8DA 4BKRA 4PLFA 1B73A 4CKEB 2EZ9A 3AR3A 4ABTA 3MT8A 3STUA 1PJRA 2E82A 5I48A 1Z56C 5DYYA 4KZKA 1C3OA 4XCQA 3WAGA 3Q85A 5K3CA 2DY0A 5JSZB 3PPYA 4ZOQI 3SZUA 2QTLA 2Z2JA 3EXAA 1ZJ6A 4G89A 1IUNA 1XCBA 4PCUA 1LLDA 1OH6A 1SQ6A 4LXHA 7REQB 4HDKA 3L8MA 5DNEA 1GRVA 3IMEA 4WBNB 3NFYA 2XGSA 1HBJA 2O5RA 3QLVA 4DQUA 4HSEA 1YZQA 4OJQA 1ZGBA 4LRQA 5B30A 4ESVA 4XPZA 1H93A 5DNVA 4TQUS 3MTAA 1GQ2A 3EAGA 3IE1A 5DZSA 1K5DA 2EIXA 4QPZA 3F1KA 4N03A 1J24A 1BRMA 1W19A 4EYGA 3LKDA 4K9RA 1NR1A 3E9NA 3T5GA 1GV0A 3KKEA 3DLCA 2VEDA 4KXLA 4XX1A 1RZRD 3IUNA 2VQSA 1XXLA 2DBYA 3G7NA 2EQBA 5IKEA 1CF2O 1V5IA 1MTZA 3IALA 3M34A 4A10A 5DTQA 4C78A 4CMAA 4D97A 6AT1A 4FBGA 4EY7A 3CEPB 3L1VA 4UUPA 3EDRA 1KAEA 1PR0A 3K2EA 3LGXA 4HAOA 1A8PA 3LDHA 5JRZA 3BFXA 1ZA1A 1S8FA 2WINI 1GL3A 1MO5A 4ZQFA 4EX7A 3C1TA 2IOHA 1PP4A 4HH0A 4MH0R 3RJMA 5K51A 5ARBA 1HR0B 2DHEA 2IHZA 2C99A 4EY5A 1VL6A 1YGYA 2A59A 3U5TA 4CQMB 4I3GA 3CPHA 4B73A 3OLWA 3HM9A 1AY0A 2FFRA 4X90A 3W5IA 3I4CA 1RZUA 1XJ0A 2HUNA 1EE2A 2JI6A 2VDPB 4L9RA 4MW6A 5LP6F 3C5CA 5HPYB 1Y4SA 2C3YA 1QWSA 1H4VB 3D5TA 5CBPA 4PZ9A 1E1RA 3IMFA 4LYDA 3GK3A 3HV2A 4B9EA 2RBKA 3W8EA 4FR0A 1LTQA 3GJTA 4Y2YA 5C1OA 1ISMA 1X1RA 3JZIA 4KVGA 1AHPA 4R1MA 4CT0A 1RYBA 3GA7A 4IRXA 5C0OE 1X2EA 2BOVA 1UEXC 1XAJA 2JI7A 4GOOD 5CG1A 3N39C 2P0EA 3RTEA 2ZIVB 1NG1A 2O2SA 2RD2A 5E3JA 4PGHA 3SC4A 2HJSA 2SHKA 3QY0A 3RKRA 3AUUA 2VPWA 4AAYA 4X84A 2WSSD 4BIMA 1OAKA 1WBJB 2FDRA 3I9OA 3VHXA 1E7YA 3GHHA 1RNLA 3ROZA 2C9BA 1W96A 1QP4A 2ZUCA 4MKZA 5BNFA 3GHYA 1O77A 4GR9A 2H0AA 1VSUA 4BX0A 1WX1A 3VJLA 4HXEB 3OZXA 2I4OA 4OCZA 4Q9IA 3ZE1B 2RHMA 4HRAA 4AN1A 3HJUA 5BW4A 2ZWVA 3HBMA 1KVRA 1HE2A 2E6KA 4UBJA 2EVWX 3PICA 1JEQB 3GPCA 1JLMA 1HL7A 3K1JA 2QRPA 3WWZA 4TS9A 3VKHA 1YB7A 3Q4GA 5DSZA 3SHVA 5B36A 2G9UA 4DV2B 1W36C 4BDSA 2FPGA 3IHTA 3ZIDA 1A4IA 1I4OA 4D8TA 3EAFA 5K2OA 2CT8A 4E2FA 3ZJUA 4ZZ0A 4JODA 5G0WA 3O6VA 3PC3A 3COVA 4AZ0B 2OV1A 2ACVA 3QYJA 2BELA 1LS6A 5ITSA 3BK7A 7REQA 3HBAA 4K6OA 4PXAA 1P0QA 4F60A 5JQGF 2VDVE 2HL6A 3A1EA 4WL0A 1U2PA 3FOAA 2WQ6A 1AN9A 2X5OA 1CR4A 3H3XA 4IUYA 2AZTA 3CFYA 3RK0A 5DM4A 5A9SA 1Z26A 2HCJB 2Q3BA 1I0IA 5BWLA 1BFUA 1N6NA 2NXNA 3G2HA 3A9WA 5J4LA 4UCQA 1IZ8A 3LT5A 3UA3A 3R5KA 4NY1A 4NL4H 1XQYA 1KY4A 4R31A 5EY5B 3SEAA 4AF7A 4Q1EA 2JBAA 2E4AA 3FYUC 3ICWA 4J4TA 3BRWD 1KKLA 1XTSA 2DT8A 2FX3A 4TXHA 2H11A 1QH1B 3G2KA 2PKCA 1DCTA 3K1TA 3D2BA 3VR2A 4EUNA 1C1XA 1Y9EA 2IF2A 1JHUA 2WIGA 4TLDA 5BR4A 3PE3A 1Z5UA 1V7CA 3HKBA 4OGKA 5CH3A 1IEQA 4BLTA 4M0KA 5K6AC 1GZSA 3W8DA 1RXIA 1T10A 1XA3A 3KZXA 1RXEA 1IHYA 2WM2A 3ECCA 3JZAA 4WFKA 1KDZA 4ZVQA 4NYMR 3WLOA 1BX3A 3H8JA 5CXXA 4RSMA 4RAOA 1DAFA 2GEFA 1WABA 2BKAA 3D0KA 4A23A 1PD0A 2NZUG 3PKZA 1WA5A 4CUZA 4R16A 5ICMA 3CKLA 3G0OA 2IJGX 3BORA 3PF8A 1UWVA 4X6YA 3U13A 4ZVRA 3SQWA 1T9BA 4MV4A 1AK1A 1TQ6A 1NNSA 8ATCA 4ZN6A 1GQYA 3MD0A 4O2BA 2J7PD 1X7GA 3H7AA 1G41A 1E6UA 3GN1A 4BNYA 3UANA 5JPCA 4UVHA 3TECE 2X1LA 4TKZA 4N0DA 1JJ7A 4IG9A 1XROA 2HHLA 4DJFC 2ORVA 4YAGA 4RWZA 1SKYE 5I7EA 4I19A 3DDZX 3A4LA 1VLLA 4P92A 4P54A 3RS0A 3GB9A 1IEVA 1RAGA 4PRYA 1H6BA 3OX3A 3TUJC 1VHQA 4LV8B 3NT5A 2IQ5A 3TL6A 3LLSA 4HVLA 3TFWA 2FUCA 1WZNA 2J0UB 1L9XA 1LD3A 3NALA 1HQKA 1XELA 1FSGA 3OOYA 2NYVA 5ICSA 2O8NA 2YVKA 1PJ4A 1I8TA 1GZ3A 3R3WA 2LNDA 2P9YA 2A92A 2YMPA 3AP3A 3OTWA 2ZIXB 3NTXA 3OZVA 4QUEA 3DEAA 1G1AA 4H2DA 1EVJA 1HMPA 1UODA 4LN1A 3H65A 1DIRA 3DL0A 3GIWA 5FUVA 5I9SA 3O4FA 4LOKA 1LNSA 2PPLA 3F7MA 4JDUA 3UJCA 1FCJA 1JKIA 1OWPA 4HEJA 1P60A 3ZVLA 2MIIA 2IHJA 2HNAA 3ETHA 5CYPA 3RT1A 4YV7A 4GKKB 5JAHA 1PZFA 1ILWA 1A96A 5JY6A 3KFXA 2YWRA 1RMQA 1VG9B 4URFA 5HE9A 4QT4A 1G8HA 2AD5A 2GARA 4QYWA 4MLZA 5H3HA 1Q14A 2AKAB 4G4SP 4UHHA 1VLMA 1J1IA 2O7RA 5JALA 5JAIA 2X40A 5LXTB 1GNVA 1FMCA 5EIHA 1RXUA 3TXXA 2X9QA 4PGFA 1P1BA 1UBSB 3EA4A 4E21A 2W8ZA 2DQYA 4BEBA 5JFTA 5CW1A 4GPEA 2AFIE 4BNIA 1SVKA 1HT1E 4L5AA 4OXRA 5DI9A 1EXDA 4IDHA 1L4LA 1HFEL 1Z62A 4N5NA 4AP5A 4ILEA 2ECOA 1HSOA 3WYCA 5ALYA 3M2PA 4JQZA 4ZGBA 4CXMA 3HVRA 1ZITA 2I2BA 5CB4F 4A36A 4PYIA 2PH1A 3UHAA 3OFND 4AT1A 1EG2A 1P7CA 3UTCA 1AKMA 5LKAA 4DQVA 2C8VA 4DRXB 3ETDA 3AKDA 1JR4A 1XZGA 3L7KA 1Y3DE 1I30A 2B78A 2UAGA 3MIZA 3QG5A 5GGYA 3BG5A 1YQXA 2VZLA 3KKZA 5GWXA 1GYRA 1RQNA 1EXNA 5DKFA 4CKCA 2CZCA 5AI9A 3ELDA 4RKQA 1WSWA 2AKYA 2VZ9A 1C0PA 2H92A 3D3NA 3EDMA 4PAQA 4Z9AA 3H9QA 3SI7A 3VOTA 1U7TA 3H6GA 3DCIA 3K6KA 3T35A 2OCLA 5SZIA 3QEJA 4NX2A 2JW5A 3K16A 1UMDA 4EHIA 4EQ6A 1RXWA 3LHIA 1FDOA 1LF5A 3LA6A 1USUA 2VUSA 4QRDA 1JJVA 2F90A 1KJIA 3DT6A 4L9WA 1CUWA 4NU8X 2GUGA 4YJFB 4YYEA 4ZI2A 1B7GO 3ESRA 2NO4A 3EXEB 1ZOLA 4KVFA 3MPUA 3SIPA 5C32A 3ZZUA 5KEIA 4MIKA 1R6DA 4MDFA 1AKTA 1DFHA 1G9SA 1GG2A 1GITA 2GJ4A 2A1UB 1M8JA 4NJEA 4Q16A 1Z4KA 1M1NB 3SSMA 2RIRA 4GP6A 4DNOA 1CIPA 1PFUA 4HDSB 1JUDA 1DQPA 1K6MA 3MGCA 4B40A 4X3OA 1FFXB 4YMVA 2XB6A 5B2FA 2I76A 2IL1A 1KORA 4M9ZA 2W71A 4D4MA 1JDZA 2FFAA 2JFFA 2OHIA 5A0TA 3HYLA 1RLJA 1UCFA 3O3MB 5BWCA 2JIRA 1VM6A 3CLRC 3VHQA 3AFHA 4L8YA 3ANSA 3ROFA 4P3YA 4HNRA 3RRZA 4AJIA 2HJGA 5A0VA 4B43A 3A7EA 4W5NA 2ISQA 4KODA 1BZYA 2NO5A 2PA0A 3GQBB 4P4UA 1QM5A 4RX1A 5JCJA 2QPOA 1IZ0A 3FYCA 4EA7A 1KL7A 2AQ8A 3HXTA 1TQ4A 3SQOA 5JBNA 3V2UA 5CURA 1LV7A 2BFEB 4E5KA 1GKLA 4XPIB 3IO5A 4GVPA 1COWD 1Z4LA 4MIEA 4NOJA 4XCXA 5L3ZA 2KM1A 1JQKA 2WG2A 4GOKA 1L4NA 1UIRA 2FRDA 2IUYA 2WM8A 2OQ2A 4JWTA 4UJ5A 4OSEA 1O0SA 3CZQA 4KQGA 4MS1A 3F5FA 5E9AA 5DTIA 2Z8ZA 4RTJA 3BHJA 2PBLA 2QTTA 3S81A 2Z2ZA 1PR2A 2PS0A 1E8MA 2R1TA 4ID3A 4TLCA 3TD2A 1SCDA 1Z36A 2ZPUA 3SFZA 3LTNC 3MSXA 3AM1A 3M6AA 1YO6A 1EZZA 2GI4A 2GEBA 4LQDA 4NSNA 1WHTB 2YNMA 4MR7A 4YGXB 5DHFA 3WYDA 3I2YX 3TRIA 2ZYDA 4EFNA 2QMEA 5GY7A 1P7WA 4YJDA 1IBLB 4YRBA 2H63A 5FV7A 4OU4A 1R1DA 5ENDA 3EHEA 3UZUA 1KU6A 1C30B 4R8LA 1FU8A 3DQPA 2JHAA 4ILKA 3T5CA 4G9BA 3T7KA 4KX5A 1QYIA 2CD7A 1JHDA 3EZYA 5CYFA 1TZKA 3ILSA 4JA2A 4K26A 2HSGA 5GJBA 1TYZA 4RDHA 3RFCA 5EFZA 5MF6A 1DO2A 4NF2A 3KQQA 2VIIA 1EK2A 3Q2IA 3I58A 1UMCA 5G2OA 4IVRA 1G20A 3T61A 4ENTA 1Y7HA 2C7OA 1O6ZA 3A6DA 4FN4A 1DS6A 3DDWA 1E79D 5A04A 2EC5A 5AJUA 3VYUB 3M4XA 2PYIA 2C88A 1VJGA 4NYMQ 4AK9A 1DBIA 4QT0A 3WLRA 3CF2A 4PV7A 4LW8A 4WKGA 3LO5A 3RD5A 2AZ4A 7MDHA 1VCNA 3WRWA 4DRZA 4GRAA 3THOA 3KUUA 3L4EA 4MMXB 4KKXB 3BWVA 1VXOA 2QBYA 1NHGA 1CJVC 1SQ5A 4RGVA 3W6PA 5LU9A 2BBOA 4KK3A 3SCZA 3BH7A 2NQ2C 4ZDJA 1YOVB 1QGYA 5EE9A 3E1GA 1I1HA 3K1AB 1KDYA 2PX0A 4RNDB 2NZ2A 1FXSA 1Z5NA 2R5NA 2UZAA 5LQNA 4Y1FA 4WGGA 2P9EA 5IKOA 2AXEA 2O2YA 4WQMA 1T1RA 4E30A 3MYRA 2XB2A 1GEGA 3HLYA 3QVGA 5EINA 4B3CA 3PEWA 3OMWA 4ICIA 5IF3A 3C39A 3RABA 1FJ2A 4A1OA 1JSLA 2B98A 1HKHA 2PD4A 4Y0AA 4S05A 2EG9A 1O96A 3SNHA 2XCSB 3TH5A 2OQIA 2UZ0A 1TMGE 2ZRQA 3BX1A 5EMHA 5IXSA 1XD9A 4DR2B 3QFHA 4M1QA 1A5AB 1XCGB 5CDSA 4R2IA 3HUUA 4ZDWA 2OV8A 3F9IA 3SIWA 5CUQA 5BR7A 5LL6P 3ZVMA 2ATXA 3V7NA 1U8ZA 2XMRA 2BGKA 1AZTA 3HR7A 1SXGA 3O1LA 1QOQB 1ECPA 1ACLA 1JDBC 1QH8A 1KAOA 4B7XA 1DZ3A 2GT1A 1GPBA 2I1VB 4LFCB 4P7FA 2CYBA 4EA8A 1E9SA 2QY9A 1CWUA 3EJ6A 5H02A 2D2VA 4IDOA 4RLQA 1DL5A 3FHCB 1JPJA 1DRUA 1RS0A 1T2EA 4B5LA 1XMXA 3BWYA 1N0UA 4JEIA 2O8EA 1D2MA 1ZZEA 3TB6A 3U09A 5C18A 2WAXA 3MSCA 2XDYA 4BO9A 2V6IA 4FYXA 1JU9A 1G6OA 1ORTA 1OZ0A 2C2HA 5JZOA 3ON5A 2W43A 2OFWA 2HM7A 3GR6A 1ZONA 3OFSA 3MEQA 1TUBA 3PEVA 3SN6A 4LZNA 4OHOA 2YIMA 1DAEA 5ENVA 1TK9A 5AIBA 3FJOA 4YYZA 4ZCLA 5EL0A 2X3FA 3TZHA 5BV7A 4B87A 4PNHA 1OTXA 2YJ3A 4XGRA 3U2QA 3V4ZA 1J2EA 4Z3OA 1BFKA 1QS0B 1OKKA 2WV7A 1XNHA 2CHGA 2Y0PA 3KBBA 4ND8A 4QBTA 4IXNA 5COBA 5HKLA 1QO7A 1JYEA 4QJIA 5G1NA 2O0KA 5AHKA 5TPWB 4FCCA 5A5EA 3TW6A 2GJSA 2WJGA 2ZI4A 3D2LA 4LDZA 4LBZA 5TRTA 4C1BA 2ZYWX 2I7DA 3UM9A 1DSSG 5E2BA 4BAUA 3Q7IA 1RAEA 1EESA 3OQHA 3NBXX 3HCOA 1V8FA 4RIEA 4YAEA 5HE8A 1C3LA 1MJFA 2AT1A 3OIDA 4X8LA 3TTSA 2V7WA 3AXSA 3R7LA 2HV9A 2HWWA 4HH3C 1C7FA 3OBBA 16PKA 4GIBA 4XVQA 4XWKA 3E2PA 4DCJA 2VQFB 2YW2A 3SDSA 1K8RA 1JI3A 3GLVA 1LF0A 2ZREA 3AJ8A 3WK7A 1KH1A 2O4UX 3SBDA 4X41A 2GZ3A 3I32A 2R44A 3ZZ1A 1G59A 3CLSC 2RBGA 3MERA 3PRYA 3ZHVA 4EZEA 3WBKA 5K8LA 3H1AA 4JV5B 2UZ1A 4WACA 2BFOA 5DV9A 3K9NA 3OTHA 5KVAA 1DG3A 3BXPA 4HNTA 4RGBA 4BLSA 2HBRA 3T1QA 3SKXA 1FDVA 4JU8A 3S4YA 1CFZA 4ND8B 1R9MA 2UKDA 4OXXA 4D9GA 1QS0A 2B1QA 3H6HA 3I83A 1FFCA 1IEWA 4AY6A 3VNQA 3ZHOA 4TRRA 1C0KA 1QQ6A 2PUWA 4XYEA 4IIYA 3IV7A 5BWMA 1B3RA 5TPZA 1HORA 4ALKA 3QUBA 1ZM2A 3LGAA 3AB8A 1CJCA 2WAAA 4DR7B 3B8HA 3DEIA 2FUG1 2QUIA 3OX2A 4L9AA 5ADHA 4XXHA 4CMIB 4YS6A 1H9BA 2QP9X 3F8WA 3GLSA 3TIGA 2O50A 3L6CA 4Q4JA 1N3LA 1TJ5A 5GJVC 1T8YA 4LBWA 3GFQA 3WLJA 3HI4A 3RFXA 4FHCA 3NRJA 3PCRB 4V38A 3LH5A 1T3LA 4R1PA 4RDXA 5SZKB 4O8CA 3HCRA 3J81k 2D13A 3CJQA 3ZUGA 2VJDA 1NPYA 2ZRCA 5J58A 1YQUA 3CJTA 2YXNA 3RV3A 3NGMA 2NP7A 5F4ZA 2FWMX 1E3WB 2CXSA 3E4DA 1YRHA 1TAQA 2RGGA 1YB2A 3HZRA 3QVXA 3S2SA 3BWEA 4CKYA 1S2NA 2O2IA 5A6SA 5BORA 2X23A 2D7DA 2C4KA 2C4TA 1FDSA 3BC1A 3D0QA 1HLFA 3HN7A 4QWWA 4MVJF 3H2KA 5FI3A 2N1MA 3V9AA 4OOEA 5IANA 1I2DA 2PGXA 4GE3A 1HV8A 2EBFX 3GY0A 4HYQA 1FVHA 3EW7A 1WDKA 4RTRA 5T4EA 4KHZA 2YRFA 3IAHA 3NVAA 1G2QA 1ZK1A 2EKDA 3DV0B 5KQGA 4KR7A 1OY1A 3FROA 3WV4A 1Y37A 2QN7A 4NQZA 1JHYA 1UJ5A 1LEHA 3IVRA 4IL5A 3GAFA 3VSCA 2RG1A 3QVGB 4JBNA 1QPZA 2YXDA 3TJRA 4C0QC 4K9PA 4BB6A 4IMRA 3AVPA 1KJWA 2A9FA 3T5MA 3ADBA 3LQ2A 1AU9A 1ODSA 4MW5A 4QNNA 2GYYA 1P3DA 5KUTA 3DOOA 1LBHA 1YOVA 1KEKA 3KSAC 3L43A 1Q0RA 1BS1A 3REGA 2ZRLA 4QQRA 4YXWA 5DYIA 2ZRBA 1MZPA 4H60A 5K4GA 4ALIA 1UM9A 4DLNA 3UIEA 5FT9A 2AE1A 1YK0A 3AG6A 3WWEA 3JSXA 2JLVA 4E5SA 1WQ4A 2IU3A 3CKKA 4OG2A 2JDIA 5E0OA 5TE9A 4R2JA 1X80A 3CUKA 4L9SA 3E53A 2YFHA 4MAFA 3DS8A 3CW9A 1L5VA 5AVRA 3JD3A 1PQWA 4OJNA 1NXQA 2G6TA 3IMCA 3L8DA 3FGZA 1JQLB 4R1TA 4HAZA 5IDYA 2OK7A 2YJ4A 3PIRA 1PFGA 3ORSA 3VVLA 4EBBA 3T1TA 1TQ8A 4UASA 2KI5A 1BXGB 1W93A 3F7TA 1UAAA 2CEKA 4HGPA 3M4JA 1ZM9A 3PUVA 1IZ9A 1YI1A 3B3QA 3N7TA 2E55A 3IQIX 3ENWA 1ZVJA 3G0CA 2BFDB 4C04A 3OJEA 1W581 1JJAA 2JLRA 4CGYA 2IUTA 4M9CA 1SZDA 3U19A 2P30A 1C30A 2WU4A 1WPRA 1UMKA 2OHOA 3P2YA 5KPDA 4AX8A 4ZO8A 2C97A 2A0YA 4CCWA 2FY8A 3BWBA 4ZO4A 1Z0IA 1BEZA 4DVGA 1N2JA 1P9OA 5CYOA 1WMSA 1NQ5A 1Z28A 1A1SA 1GCOA 2QRZA 3E48A 3PCTA 1D6MA 3L1IA 3L0OA 5THKA 3VOBA 2XOKD 4JSTA 5HKOA 5KOYA 2GUWA 2QX6A 4YCDA 3VTFA 4IIGA 4CYMA 1DDOA 5C2JB 1PL0A 4DMRA 2QSJA 4IQ4A 1EYZA 2VP3A 3M0EA 4ZYYA 4UBOA 1TQDA 2GBCA 3VFDA 3PQ8A 4Y2SA 5BNIA 1BCSB 1WQ3A 2GWRA 4CUKA 4NFSA 1GUFA 4WEOA