1P9RA

Crystal structure of vibrio cholerae putative ntpase epse
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
401
structure length
378
Chain Sequence
DFFSLAEEAPIIKLINAMLGEAIKEGASDIHIETFEKTLSIRFRVDGVLREVLAPSRKLSSLLVSRVKVMAKLDIAEKRVPQDGRISLAVDVRVSTMPSSHGERVVMRLLDKNATRLDLHSLGMTAHNHDNFRRLIKRPHGIILVTGPTGSGKSTTLYAGLQELNSSERNILTVEDPIEFDIDGIGQTQVNPRVDMTFARGLRAILRQDPDVVMVGEIRDLETAQIAVQASLTGHLVMSTLHTNTAVGAVTRLRDMGIEPFLISSSLLGVLAQRLVRTLCPDCKEPYEADKEQRKLFEPLILYRATGCPKCNHKGYRGRTGIHELLLVDDALQELIHSEAGEQAMEKHIRATTPSIRDDGLDKVRQGITSLEEVMRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General secretion pathway protein E
publication title Crystal structure of the extracellular protein secretion NTPase EpsE of Vibrio cholerae
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Protein transport
total genus 103
structure length 378
sequence length 401
ec nomenclature
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1p9rA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p9rA02
4B6EA 5CJPA 1S2MA 4C0JA 2GHIA 4WOPA 3U3KA 4A8JB 1G6HA 4FMCB 2QN6A 4JS0A 1TQ4A 5G3YA 1MRSA 4BUJA 1H65A 3A37A 1Z3IX 2IW3A 2ZJOA 4MGZR 3AVVA 2JGNA 3B7GA 5F9HA 3UK6A 4A8JA 1E9BA 5JS7A 4LYFA 2ZI9A 2HXSA 3C5HA 2H1LA 1FMLA 1ZNXA 4P4TA 4GT1A 3A36A 2QAGC 2CLSA 3DKVA 1CP2A 3OFND 1CJVC 2G0NA 3I8SA 3IO5A 4QJ4A 1F48A 3GP8A 2FF7A 1KK1A 2A5YB 3OHMA 1G18A 4FI3C 4L9WA 3QENA 3A6PC 3THOA 2W0SA 5KDLA 2YJTD 4NU0A 2QBYB 1II8B 2VP2A 5H8WA 1RIFA 3CNOA 2J0QA 1NBME 1UEJA 3PUZA 1ZIOA 2ZU0C 2GTPA 2ZJ8A 3T15A 1HQCA 1II8A 3TW4A 3WYFA 2QBYA 2ZRBA 4TYYA 1ZD8A 1Q20A 1JQJC 5AK0A 5SZIA 3SC3A 4JYCA 2R65A 5IF9A 3LA6A 4QJ3A 5DI3B 4DRZA 5JCZA 2C96A 1X8LA 5FOWA 3LY5A 4LV5B 2QAGB 2FA9A 4II7A 3CB4A 4IDOA 5DI3A 3F5FA 3ONWA 2GZAA 3ND8A 5KHOC 4KBFA 2QAGA 3M4YA 4GP7A 1CXZA 1ZUNB 2EW1A 1E2EA 2C99A 2XZLA 3AF2A 4CT5A 4QGFA 3SFVA 4B6FA 4D81A 1T3SA 1FUKA 3B1WA 2WBLC 1KO8A 4QBIA 1ETUA 2FGJA 1MRNA 4ZIRB 4BFVA 3AF4A 3W90A 3JVVA 1W47A 2FSGA 2OXCA 4RJLA 1PLLA 2HJVA 4ZIRA 4LBWA 2QMEA 3QVVA 3GPLA 1YZTA 4JLDA 3KTAB 4LYJA 4WIAA 3UKDA 2IUTA 4QGHA 1YE8A 2HF9A 4FCTA 1XTIA 2ZRKA 3CRQA 1JECA 3U6BA 4L16A 2O8DB 4A0FA 5KPJA 2ODEA 3OAAA 4JLOA 2UZIR 3KTAA 5BQ5A 5FBVB 3IHLA 3IUYA 2QROA 3QG1A 4LHVA 2WHXA 2F43B 3BK7A 1GNQA 4WXPA 5EE1A 4ESHA 4A36A 2O8DA 1KDRA 4A0RA 3GLIE 2V1XA 1X1SA 1M7HA 3CPEA 3RSOA 1DAHA 1IAQA 2F43A 4TQUS 4PAOA 1G6OA 3DM9B 1S4QA 2V7QA 3AGQA 3OESA 4JJKA 1KI6B 1OIXA 1QZXA 2ZRLA 3EPJA 2CBZA 4P31A 5TMPA 1Q1EA 5F3WB 1XMVA 1D2MA 1XFAA 1SVLA 2ATVA 3C7KA 4B71A 1KI6A 4FWTA 3NBYC 3A1WA 5K8TA 1G8FA 2D2FA 1PJRA 3CM0A 4NYMR 3UMFA 1SVWA 1Z6TA 4DSOA 3LW8A 1DTSA 3QNUA 2ZR9A 4NHOA 5L8VA 3NC0C 1H8EA 1F3OA 2WTUA 4PO8A 1D9XA 1E79D 1E1QA 1T8UA 4B47A 2IX3A 2ZUBA 1EK0A 3DZDA 1Z0DA 2OAQ1 1O87A 3CH5A 1KSFX 1Q0UA 3GLHE 4UKDA 1E9CA 1QG4A 1UF9A 3FMOB 4PO9A 4ASUA 3K70C 5BN3A 3LNCA 4ILEA 2PLRA 2KJQA 3HP1A 3W9YA 1NKSA 3SJZA 1NLYA 1E0SA 1YZQA 1PUIA 1QHXA 5DE3A 4BRUA 4UJ3A 3AGPA 1ZNZA 4LJ4A 1GNPA 2Z4RA 3MWJA 2WJHA 2ZUDA 2VP5A 4YMTA 3I92A 5EP1A 1Q22A 4Q9KA 3R7WB 2MSCB 4PC6A 1HE1C 2CL6X 4B35A 1JR3A 3JVUA 1XZQA 2FN4A 3EZ7A 5CDFA 2OESA 4DLUA 5CLLA 3RANA 2CL7X 3WBKA 3REGA 3KUDA 1VDZA 3R7WA 3UATA 3KDSE 4EPRA 5A5GA 5HCNA 4URWR 2P0EA 3NWJA 2H92A 2DHRA 2R8RA 3HR7A 2WAXA 2ZJZA 3K70B 4PO1A 2LKCA 2ZR0A 3MD0A 1W0KA 1BO6A 3WRYC 3ZVNA 2H7VA 1IOZA 4OHXA 1N6HA 1OPXA 1U8YA 4JL8A 1FZQA 4HB3A 4DLYA 2QUZA 1D2EA 3PEYA 2OXRA 4IOJA 5TXGA 4LBVA 3D3QA 1H8HA 4W7SA 4JSTA 1MKYA 2ERXA 1E6CA 1N6NA 1OFTA 3RDPA 2JDIA 4HAXA 3B1YA 1BYUA 1SXJC 3LFUA 5DHFA 4EAQA 5FBQB 1M74A 3PIRA 2GZDA 4F4JA 4AYWA 3ZIAA 2WWXA 3MG9A 5FOTA 3X1XA 2JLXA 3TR0A 3W34A 1G7TA 2H57A 4C0HA 2CCGA 2CE2X 3FGNA 3QXCA 4MRNA 3P27A 1D8TA 1E98A 1CULC 4PHHA 4BLRA 4IW3B 4HDQB 2G83A 2ZI3A 4Y0VA 4DDUA 4Q47A 4WZBE 2C98A 4GZMA 1EFCA 4YXWD 2DFNA 1VG8A 2P5TB 4HZUB 1DAIA 1FMJA 1GVNB 2WJGA 1KK0A 4GMDA 1ANKA 3X2SA 5J4YA 2D06A 4TMZA 2YINC 3FMFA 2BEKA 2NPIA 3LVRE 4R2HA 4HZUA 5CIWA 3R8FA 1SXJB 2RGBA 1KAOA 4S2EA 2DBYA 2JLRA 3PFIA 3V9PA 2FJUA 4NYIQ 4G5RA 1KAGA 2FG5A 1SXJA 4A2WA 3W6OA 2ZSFA 4JJZA 1BMFD 5G3ZA 1EFHA 3L8YA 4U02A 1LB1B 3OFNA 4M53A 1E2FA 1G19A 1VIYA 2A5JA 2CNWD 4HYYA 3SYLA 3KX2A 4V02A 4JLJA 5E4FA 2Z0MA 3DKPA 1G64A 4TL7A 1QHGA 2NTYC 1XP8A 4IEIA 1MV5A 3IILA 1SVIA 4EKDA 2ZTSA 3LBIA 1S3SA 5LB4A 3WMFA 2VIIA 2ASEA 4URYR 1S0UA 3QQ5A 3AVUA 4ERNA 4NCIA 4M9XA 2EFCB 3MWYW 4O3MA 2GJAA 3VX3A 5JJIA 3NXSA 2XSZD 1VPLA 3WNDA 5K8IA 1RYHA 3BXZA 3EIEA 5FTKA 3SQWA 1AK2A 1J8YF 1G3QA 3A4LA 4QBGB 5FTNA 1TTTA 3RAPR 2XGJA 5JEEA 4GSYA 4H1VA 2MMCA 2Q3HA 2VRWA 3GFOA 4ABYA 3K0AB 1E0KA 1OH6A 3G5UA 3C16C 1EFUA 4NMMA 4C2UA 1TF2A 1YR7A 3QG5A 2E9SA 3AP3A 3UMSA 4AIIA 1DAMA 2FZ4A 2GDJA 2MSDB 5JHHB 1MR3F 3K0AA 4QBFA 3T34A 1GNRA 2A5DA 1SULA 4ZDIA 3UWKA 1SZPA 3AV0B 2AR7A 5DLQC 3VX4A 1LVGA 4PFSA 3EIQA 1AQYA 2NIPA 4LJ7A 4W9MC 1IY2A 1Z6XA 1R5BA 2VA8A 3HJNA 1E2IA 4JLPA 1XTSA 3PXGA 1AZTA 3ADKA 3QKRB 2J7KA 4D4KA 2P67A 3WRXC 1E1RD 3T35A 2JLQA 3EAQA 4BLSA 2Q9BA 3QKRA 4IJMA 4A6XA 1MOZA 1E2HA 2IYZA 3BH6A 1DPFA 4RD3A 2OO7A 4MKGA 1CRQA 3DPUA 3TVTA 3ZDQA 4ZKDA 4MKIA 1XD2B 1PUJA 1Z22A 4Q9JA 4ACBA 1G8HA 4QNMA 2CXXA 4MRVA 1N6OA 1QHSA 4JKIA 1XCPA 3SBDA 1LS1A 1A5TA 5KSYA 2W6JD 1XD2A 4KU4A 3ZGXA 2IUSA 4UJ5A 3AVXA 2JLZA 2ZS7A 2RHDA 3DZ8A 4NCHA 5KUTA 2QAJA 2IA5A 4V0LA 4FWIB 4DB2A 1SVKA 4PTLA 4Q1DA 3NH9A 1EX6A 4NL4H 1CJKC 3T1VA 1XTJA 1BIFA 5KNCA 3LDAA 1Z47A 1G4UR 3L8ZA 3FKSA 2EFEB 4JVMA 3QXHA 5CK4A 3SOPA 1DADA 2YV5A 3QY0A 4NDZA 2BEJA 4LCBA 1XMJA 1FW6A 1XTRA 2W00A 3SJBA 1ZVQA 1OB5A 1R2QA 3QKTA 3NEYA 4D0NA 4B3BA 3MGCA 3M1IA 1CRPA 2WJYA 5LPNA 3L82B 3OE7D 4TZ6A 5AJVB 2QTFA 2EWVA 1E79A 3IGFA 3L43A 1JPJA 3QJYA 3EPKA 1Z5ZA 1CIPA 4MGIR 4TYQA 1E2MA 3LBNA 4RD2A 1BOFA 1T9HA 2ZJAA 2ZSBA 3T1QA 4OYHA 3EA0A 4WVFA 4IFBA 3P26A 2FX3A 1MO3A 2DWPA 1JPNA 4PPGA 2ZROA 4CDGA 3U61B 3VHXA 2O8CB 4FN5A 1SVOA 2IXFA 3Q9LA 2QTVB 4NP6A 4DSNA 4Q7LA 3GJXC 2HYIC 1YJ5A 5K8UA 4DCSA 4FCWA 4AYXA 2O8CA 1RPZA 2IYWA 1R8QA 2VP9A 3BBPA 3OIUA 3PR1A 3TQCA 3VU9B 1PVOA 2WZQA 3VTKA 2QL6A 4D4JA 1QVRA 2JCSA 2XZPA 1Z6AA 3AB3A 1OFUX 3VU9A 4QKQA 4CIDA 1KIMA 3IEUA 4LYAA 1WB9A 2A78A 1DOAA 1ZINA 1CR1A 2REXB 2VF7A 2WICA 2JIZD 1GWNA 2N42A 4D0GA 2RKOA 4K81B 4E07A 5FOUA 1NRJB 3CO5A 3PUWA 4C9BA 4KXFB 5EXXA 3OEEA 2PZGA 4L15A 2QPAA 1YHNA 1NBMA 3IIJA 4PSKA 1JNYA 1XTKA 2B6HA 4A92A 2PL3A 4LBZA 1CJTC 4Q19A 2OT3B 1N0VC 4C30A 2W83A 3SI7A 1DARA 2G6BA 2Q9CA 3GMTA 2FFBA 2GILA 3D31A 5FUWA 1NY5A 3ZVRA 3CR7A 5BW8A 3EZ6A 4BGDA 2V3CC 1IN5A 2C9CA 1UAAA 1RRGA 2CCKA 3BE4A 1G291 2N1BA 4JMPA 1D2NA 1YQTA 3RRZA 4A2PA 3ZD6A 4UNRA 3VHLB 2VP0A 3P20A 4HZIA 4L4UA 2VYFA 2J7PA 1P3JA 5JMTA 4GZLA 4A1FA 4IVQA 1ZM2A 3ZS9A 1Z0KA 4B74A 4D4MA 1I4LD 3SJCA 2ZYWX 4Q4HB 2WJVA 2HDNB 4MKFA 3KKOA 3OAAD 3ZH9B 3T1TA 2HT6A 2RGDA 1NP6A 1HTWA 3WMGA 4RKEA 1UBFA 4IXMA 1QHNA 3A8TA 4Q4HA 1W44A 5JSZB 1IXSB 3THWB 4IKEA 2Z43A 5HKKA 2EU8A 1WP9A 2GF9A 4KVAA 4TN1A 4CEHB 5CB6A 5GVSA 1BMFA 5KOYA 3THWA 4JKYA 1GP2A 1KI1A 5JSZA 3GLIB 4DSUA 1M7BA 2V7QD 1C9KA 1KI7A 4CEHA 1N0UA 1P73A 2ZJ2A 2H8KA 3VR3A 3GLGE 4IVPA 2VL7A 2HXYA 2FOLA 4XIGS 1R7RA 2WSSA 2FGKA 3GLIA 1KZGB 2GCPA 2QP4A 3L0PA 1GRNA 2QRZA 3TVDA 3U3OA 4L9SA 1K5GA 3H0KA 5DYGA 2WMNB 4KSCA 2FFHA 4JVNA 221PA 2PCLA 2GEUA 2J46A 2AK2A 2QY9A 2XNDA 4Q1CA 4M1SA 1CR2A 3A4MA 3W8RA 1XD8A 3FFAA 3VR1A 3WYGA 1GL7A 4D6PA 1H8ED 2FEMA 3QXJA 4IVRA 1E1QD 2UZ3A 4K8OA 4M4SA 2WWFA 4NH0A 3LX5A 2ERYA 4HLCA 4BFSA 4BZQA 2OSBA 1N6IA 4JVLA 4M0LA 1ZBDA 3R9WA 3U7HB 3QVUA 3AP2A 1JJVA 2PLFA 1OKKD 3FFBA 3DM5A 3ASYA 4F91B 1KSJA 3TK1A 1KZ7B 2VTKA 5M04A 3I1FA 4Q18A 4XWAA 4C3ZA 3THXB 1W4CA 1N5KA 1E9DA 2FSFA 2YOHA 3O8BA 3TRFA 1W4AA 4GRAA 5EQTA 3SNHA 4I1OA 1Z83A 3WHLA 3THXA 2R6GA 3DDCA 5KSZA 1Z6GA 3FMPB 2ZETA 2XEXA 3LO5A 4MYUA 2QP9X 1Q3HA 4LJAA 2WPDD 3NG1A 3QBVA 1JR3D 1Z08A 4LX0A 5ANRB 2ANBA 3LW7A 4QHSA 3GLFE 3DHWC 4NYJQ 2RGEA 1Z0JA 2BM0A 2C9OA 3BJIC 3TLXA 3IQXA 5C18A 4Q4JB 1KK3A 3MAAC 3KQNA 2R6DA 4R9UC 4DB4A 4UNSA 4ZPXA 1A7JA 3B5JA 1W0KD 3QIAA 3TNFA 2PZFA 1XPOA 2D3WA 3MSXA 4DWJA 4Q4JA 3PITA 1Q1ZA 4DIDA 3RS2A 4P33A 1JI0A 3JZAA 5KSPA 4LJ8A 4B3XA 2ZIAA 3LWNA 3B9PA 5LBIA 1OXUA 1ZD1A 3P4XA 2NO1A 4OJQA 1FTSA 4G5GA 2B21A 1U8AA 2IYVA 4DEYA 2GVDC 3OEHD 5JWHA 1GKYA 1E2DA 4OK3A 1R10A 2GJ8A 2CHQA 2WV9A 4A6PA 2KBFA 5C2JB 4PXAA 3QF4B 4DEXA 1OHHA 4MKHA 3SEAA 4AWXA 2GJSA 1EFRA 3X1YA 4IDQA 1P4SA 4DCTA 2OEPA 4HUQB 1JB1A 4Q1FA 3QF4A 4OI2A 4XWOA 1UKZA 5FTJA 2GAOA 2CL0X 1FFHA 4RZ3A 1P72A 5A0FA 4GFDA 4HUQA 4AG5A 3KJHA 3KJIA 5TV2A 3WNBA 1ZNWA 1ZW6A 4X8MA 3RYTC 3OE7A 4JLKA 3SYNA 5FI0B 1IJFA 2AN9A 4QHTA 1Z06A 2ZSDA 2AHOA 2I1VB 2BOVA 1P5ZB 2JLWA 1M8PA 3AKDA 4NBSA 2QORA 2YHSA 3D7MA 1HA3A 1FQJA 4Q21A 3VNVA 3QBTA 4PR0A 2F1IA 4A9AA 3Q3JB 4OQNA 2J0SA 1KY2A 2E87A 4AG6A 3AVYA 1UEIA 421PA 2EWWA 1EFTA 3W5IA 1S1MA 1SXJD 4M1WA 1S1CA 3BWDD 3FWYA 3BFVA 1OYWA 2KSQA 4ZDJA 2YWFA 3J81k 1E94E 4V0OA 3LBHA 4UXHA 2EYUA 5L3SB 1HE8B 3TSWA 3UG6A 3GJ8A 4TLBA 5EXTA 5AWFC 3AUYA 3Q72A 2GF0A 5FUYA 2C2HA 1KJWA 2GCNA 5L3SA 4KHZA 1XJ0A 2QM7A 2MMGA 2BMJA 2IEZA 2QM8A 1XXHE 4OQLA 4KV9A 3PUVA 2JIZA 2ZITA 5B30A 1VYVA 4DVGA 2I3BA 4QRHA 1AGRA 3AP1A 4TL6A 1OH8A 2KI5A 4LHYA 2ATXA 4HB2A 1BYIA 4BWYA 1D5CA 1R0WA 8OHMA 1JR6A 1AQUA 1UFQA 3LQQA 2NZJA 2VO1A 4AKGA 2C95A 2A3RA 2QNRA 3G82C 5KDDA 1KDOA 4ZDWA 5CYPA 1DVRA 3L0OA 1IONA 1KTVA 5IHPA 1NL3A 3TIFA 2IBMA 1MT0A 4WAUA 3V00A 4EUNA 2IS6A 3RS0A 3UXMA 1VIAA 4XSGA 2B92A 1R5OA 2ZE7A 2ORVA 1GOTA 1NIPA 2OBLA 1G16A 2QRNA 3N70A 3HPRA 4PPQA 4OBEA 2ZUCA 1QBKC 2AXNA 4Q03A 4Q1BA 1GL9B 1ZC4A 2HF8A 4MRSA 4UNNA 5TDHA 2LKDA 4Q9LA 2OM2A 1FNMA 3CBQA 4TTQA 2LWIA 1TUEA 4MYTA 1MABB 1A2KC 2BWJA 2NO9A 2ODBA 4MRRA 2IS2A 1G21E 3UPUA 1OIVA 1J99A 1MO5A 3ZQ6A 3T61A 3C41J 4AI6A 5JRJA 1MABA 1NMZA 1UM8A 2C5LA 1COWD 4KAXA 4P32A 4ARZB 4ZI2A 1A4RA 2ZJYA 1E2JA 2QA5A 5CITA 1PLJA 4F93B 2PMDA 1FP7A 4CEJB 3D6TB 3PUXA 3PCRB 3RABA 3T5GA 3ZVLA 4ARZA 4PC7A 1CF4A 1NVXQ 2RGCA 4EPTA 2EVWX 1KDPA 2GETA 3IBYA 3FKSD 4CEJA 1EWRA 2IT1A 2RMKA 3FOZA 2DB3A 1E2QA 3TUJC 4G5SA 2P3SA 4L8GA 3EWSA 2YWGA 2OCYC 2OCAA 2YWHA 3QKSB 1N2CE 2GXUA 1HY3A 3TMKA 2XTZA 2WOOA 5FFMA 1OFIA 3EXAA 3QXSA 1W5TA 2W2TA 2P65A 3MWLA 3QKSA 4NPHA 2CHVA 1Z29A 1S9DA 1TU4A 2P5SA 3I72A 4M9SA 4NZYA 4AKIA 1U90A 4A0GA 2CE7A 1ZIPA 3VR5A 3B8HA 4A0HA 1NG9A 2GK7A 1TMKA 3UANA 4DLSA 1Z8FA 2ONJA 3ZZTA 1OH5A 3AM1A 5FPKA 4ZCLA 4BEBA 2BCGY 5JHGB 2F9LA 2IHBA 4CT4B 2EFHB 3IPXA 1OKKA 3JZMA 2C03A 4E22A 5KPDA 3CF0A 4IXNA 2IF0A 2MSEB 4YDHB 5L3QB 2JA1A 2YZ2A 2BBTA 3B9QA 2FPMA 1HT1E 4OJKA 2ZM5A 1PLKA 4BE7B 2WIBA 3THYB 4TMXA 2AFHE 5L3QA 1VG1A 4BFXA 3SQXA 5EE0A 4KITB 2FU5C 1YVDA 3VNUA 4RVCA 4TTPA 1P61B 5C4GB 3THYA 4KI0A 2D7CA 3IIMA 5FPSA 2WPDA 1KJYA 2GK6A 5CIQA 1NF3A 4POAA 2ZVQX 3FPAA 4OQMA 3W3AA 1NG1A 1E9FA 1VKJA 4G1UC 3Q7PA 3PEWA 3BFKA 1GITA 4U00A 2JASA 1KMHB 2WSMA 3CF6R 4MGKR 4KLNA 1KJZA 3QUSA 1OXSC 1T3HA 3OEED 4RCZA 3NBXX 3HPQA 1G9XA 1NBMD 2GESA 5J40A 1KMHA 2PEZA 3K0FB 4QGAA 4XVUA 1NN0A 2DWQA 1E2GA 3HU1A 4GOKA 5L3VA 1P75A 4GOXA 1LS6A 3AVPA 5FTLA 3EX7C 1DELA 3KXLA 3K0FA 4GMXA 3OEHA 1G7CA 4FXPA 5E95A 5GVRA 4E5UA 5KSOA 1IN6A 2OAP1 3TH5A 1CJMA 2KE5A 4B34A 4UNPA 2ZRDA 1XPRA 1EGAA 2OBNA 2OE2A 4M9ZA 5JWRA 4PPNA 3GEHA 3LD9A 4JVSB 4PZLA 1A2BA 3FYHA 2P6NA 1HURA 1IHUA 1CJUC 2A9KA 1KI8A 4ITRC 5JEDA 3U6KA 1XCMA 3KKPA 2DR3A 3T06B 2RGNC 1FUUA 2J7PD 2BMDA 4XVRA 4C0SA 5JZVA 4B48A 3KKNA 4D26A 4EPYA 5GJVC 1LF5A 2FSHA 4DZZA 4DC9A 4DBLC 2QEQA 1J90A 1TNDA 4QC2A 2CLDX 2ZE6A 2C78A 1AGPA 4FMDF 4GI7A 4URZR 2R6FA 2J1LA 2IUUA 2G1JA 4Z51A 1R6BX 5HKKD 2XITA 4OKSA 4E03A 3CX7A 5HZHA 1JALA 1OJLA 2ZSEA 1K6MA 3DL0A 3QPUA 1YR6A 3EC2A 2IYXA 2ZR7A 1G20E 4HDCA 4B2IA 5FUXA 3K0EA 1V5WA 2WM9B 1SVMA 1Z6YA 2CCJA 2GXQA 4HB4A 2WSSD 1PV4A 1YZGA 4RY2A 4QXAA 1R0ZA 1E96A 1MO4A 3KB1A 2XTMA 1XJQA 2WKRA 2XNDD 2PJRA 2RGNA 3FMIA 4KODA 4C2TA 4ZO4A 1BKDR 4M1OA 3FB4A 5HE8A 1E9EA 3U4QB 3U3MA 3RNLA 2F55A 3M0EA 4H1UA 4O0MA 1HYQA 1G3RA 1XX6A 3RVBA 4P4SB 2AD5A 4OQFA 1TQ2A 3LLUA 4XTCS 5EJEA 3U4QA 2IXEA 4TMTA 1E4YA 1U0JA 4PC2A 3TBKA 4OQXA 4P4SA 2QQEA 2J0UB 4QNRA 2CDNA 4O25A 4AKHA 1G1MA 2ZYUX 1M7GA 2GWHA 5FPYA 1VECA 2WWYA 4TZ0A 1KI9A 2JLVA 3FKQA 3AVWA 2VSXA 1GFIA 2J0UA 2F1HA 3P4YA 3QPVA 4KYUA 4KLZA 5KNDA 1OSNA 1GAJA 1GL6A 2CK3A 4FMCF 4DKXA 3Q7QA 3F8TA 3CLVA 3BAFA 1WBDA 4QG7A 4RD1A 2D2EA 1EWQA 4NYIR 3PG5A 4PHTA 3N2IA 3NH6A 1G5RA 3QPWA 4LWZA 2DFTA 1TX4B 5JJKA 2A5FA 4TQAA 3SJAA 4HLQB 4DIEA 3RS7A 2ZU6A 2NMVA 4EPVA 3RS3A 4AYTA 3CPJB 3RRMA 4KBGA 4ZV4A 4JLNA 1DEKA 2J9RA 2ZS8A 1W4BA 4W5JA 4PAMA 3QEJA 3MLEA 3WYAA 3K8YA 2FZLA 4X8LA 3ADCA 3CPHA 3HU2A 3I5YA 1EESA 1G8YA 1YR8A 3SR0A 5D3QA 4DLZA 1N3BA 2JAQA 2G77B 4I99A 3CNLA 5TARA 2X2EA 5EE9A 3G0HA 4Q02A 1AKYA 2BKUA 1COWA 3GD7A 1VG0B 2OILA 4M1MA 3F0TA 3SBEA 1KGDA 3GJ6A 3QXXA 1Q21A 2L0XA 4WBSA 3RWOA 4WXRA 1P9WA 3CR8A 4Q7KA 4EIWA 4AURA 4BLOA 5IDVA 3RSLA 1N5LA 3CRMA 1QVAA 2V8OA 3CH4B 1OHHD 2ZJ5A 5B64A 4RZ2A 2OFOA 4BPBA 3B1XA 3N5CA 4PSVA 1TF5A 1EFRD 5EUMA 1Z2AA 2P6RA 1OIWA 3O8DA 1LNZA 521PA 3V4FA 4BFTA 4NCNA 3PVSA 3RS4A 2IHYA 4LRWA 3ASZA 4R98A 4J0QA 2JJ8A 4NE2A 3QSYA 4V0MA 2OZEA 2WMOB 3KXKA 1XEWY 3PUYA 3RLFA 4LJ9A 4QFMA 3BRWD 2PT7A 3TAUA 1KNXA 1ZUHA 4PAQA 1XCGB 1V43A 1VCIA 2J45A 3A1VA 4Q00A 3W8NA 4MDEA 1NNEA 2ZRCA 4BLQA 5FOSA 3IPYA 1W49A 3I5XA 2WVJA 2JJ2A 2GVZC 3DOEA 5FL7D 721PA 1UADA 3NHBA 5DN6A 2RGXA 1GKUB 1WCV1 2ZEJA 2ZRFA 1N6RA 3CZPA 3K53A 2EYQA 5DI9A 5FH9A 2VP4A 5FPTA 5DYIA 5FPHA 5KU1A 3IO3A 2VF8A 2YC4C 3DMNA 2Z5FA 4R71A 4TL9A 3E2IA 3MJHA 2CLCX 3A1TA 1X86B 2OV2A 2Q6TA 4B3DA 1G8PA 1QHHB 5E7JA 5G41A 1W2HA 5CDFE 1QHYA 3VR6A 1FX0B 1OYYA 1ZJ6A 3IKJA 1QHHA 2AKAB 1DAKA 2QMOA 5LB2A 1W4RA 1XXHB 3H2YA 4G5OA 4LGMA 1T6NA 4YMVA 3C14C 1QF9A 4XH9B 3DO6A 1FX0A 3FDIA 1HV8A 1WMSA 1WQ1R 3LVQE 2QT0A 4C7OB 1PZNA 1XXHA 4JL5A 1JEEA 3RRNA 1ZM3A 4A15A 3OIWA 3X1DA 2X8AA 1B23P 2PX0A 1YRBA 4C7OA 3T5DA 3NIBA 1R8SA 3EIHA 1KO7A 5HTKA 2DFLA 5D3MB 1HQYE 4TMWA 3WXMA 4ZCIA 2QP3A 2A2ZA 2QI9C 3A1UA 5LDDC 1CR0A 5FBLB 1U94A 3CX8A 4YMWA 4DLTA 2C04A 4CF7A 1G41A 1I2MA 4FMBB 5D3MA 3CWQA 3FHCB 4PC1A 1NKTA 1L7VC 3B6EA 3KQLA 5SZJA 1L8QA 3CW2A 3E70C 4YONB 1AIPA 1KI3A 1DAEA 4E09A 2V9PA 3RHFA 1DO0A 2XNSA 1F6BA 1FOEB 621PA 3GJ7A 1IY0A 4B2PA 2QPTA 4PSAA 3TUZC 3NBZC 1NLZA 1AZSC 3GFTA 2QQ0A 3B60A 2AX4A 4KFSA 3DMDA 4PPFA 5B58C 4IFEA 1DBSA 1WDTA 2WWIA 2VHQA 4ON9A 3EWAA 2B8WA 2NO7A 4URXR 4GL2A 1VG9B 1NSFA 3B82A 1JEDA 3SHFA 5J5CA 4XVQA 5HE9A 1FPMA 1CTQA 4MUAA 5F2EA 2QPOA 4D82A 2PT5A 4LPSA 3ZQJA 4IEEA 3HR8A 1NJGA 4F92B 5EE3A 2LCFA 1WA5A 2KB0A 5EP3A 1VCOA 1KO1A 1XU4A 2QE7D 4US0R 4B76A 1NI3A 4AKEA 2UKDA 2QGZA 4MH0R 3PENA 2WOJA 3RRYA 2OBMA 2J87A 1XMIA 2GNOA 4AD8A 4C0AC 4LPKA 1EG7A 2HJGA 4XTRA 4IOMA 5GJCA 3AH8A 2OG2A 2FE4A 4KFRA 2HYDA 1E2NA 1LFDB 3CONA 3LLMA 3OZXA 2FNAA 1S8FA 2BBSA 4LJYA 4B3GA 1FQKA 1G7SA 2XJ9A 3OIYA 1JAHA 4S35A 3FHTA 4JBXA 5H70A 2ODNA 5LD2C 1SGWA 4OHZA 5C4MA 3B78A 3UIEA 2IC5A 1YZNA 1X1RA 3GLHB 4JLVA 3EC1A 4ESVA 3IQWA 1ZU5A 4PHGA 2V1UA 3LX8A 1CR4A 3VFDA 3I4LA 3GLHA 1ZD9A 1R4AA 5AUPB 2HT1A 4MQBA 4Q4AB 2O0HA 4URUR 1NJFA 2PCJA 3TSOA 3R9XA 4Z54A 2RCNA 2R6AA 5GADl 2ZRHA 3CF2A 4MYCA 2OUKA 4BLTA 3NKVA 2REBA 3WP0A 5J4LA 3ICQB 2NG1A 1ZRHA 4Q4AA 1RC8A 3ADBA 3A58B 1N25A 4OI1A 5C46F 1GM5A 4TMKA 1RE0A 1XD9A 2RAPA 3B1ZA 2O52A 3Q8XB 1SHKA 3VKWA 3WY9A 5LD2B 4D80A 1RRCA 2PX3A 4Q48A 4TT3D 4WZ6A 2AD1A 1G17A 2RHMA 1TUIA 3LXRA 1E0AA 1P9RA 1N5JA 5FR2A 2XB4A 5KTYA 4M1YA 2HCJB 4HB0A 4JLMA 2B8TA 2ORIA 1W0JA 2GA8A 5HCIA 1A1VA 3H1TA 121PA 1IM2A 1FTNA 2A5GA 3M6AA 3TGPA 2AKYA 1CBUA 3KFXA 1L4YA 4Q1AA 1J8MF 1AS0A 3GCGA 3O47A 3UG7A 4B73A 2Z83A 1T8TA 4OI0A 3KJGA 4DXAA 4WZAE 1M6NA 4PZZA 3IEVA 3R8CA 1VMAA 5DISB 5UKDA 2YOFA 3BIFA 4DLVA 3RC3A 4YMSA 1E2LA 5FR1A 2IYYA 3KQHA 5ELXA 1VYUA 3PEVA 2J59A 4QJ5A 1D9ZA 4W5WA 1C4OA 4LYHA 4US1R 5TB5A 2BCJQ 4OL0A 2GXSA 3BB3A 3K0CC 1XJCA 4YMUA 1YR9A 3FHOA 3X1ZA 1W48A 5BXQC 2GCOB 2WAYA 2BBOA 1NIJA 1TAGA 4QM6A 3N2EA 3EG5A 4GBMA 5JJLA 3EZ9A 2JATA 4DDWA 1W7AA 5JCPA 4QM7A 5CK5A 2GCOA 2I1QA 2ZYTX 4NYJR 1K5DA 3B2EA 2V6JA 2ZRNA 4G01B 3A4NA 5FL7A 5G40A 3RWMB 2DY1A 2CMKA 2W58A 4XSHA 4ZDKA 4XOIA 2GZHA 4LC0A 5F98A 3CRVA 1OB2A 1WBBA 3PQCA 1B0UA 4LHZA 2ZRJA 4EFMA 4KVGA 2WKPA 1NY6A 3EPHA 3ICEA 4TLDA 5FUVA 4KSBA 5E7IA 2YC2C 3H86A 3UWOA 3AKEA 4NKRA 4RSGA 4Q9IA 1Q1QA 5A4JA 1I4TD 2FH5B 2D7DA 1KY3A 2PZEA 1BS1A 2RB4A 4Q7MB 3K0CA 4GNKA 4LDJA 1IXZA 4PQFA 1E9AA 4QBHA 5KYKA 4IDPA 1YRAA 1W1WA 4G0NA 3CUEF 1QHIA 3EARA 3NHAA 1YZKA 4RFSB 1U0HC 2ZRMA 3LV8A 3TW8B 3EASA 3S1AB 3SYKA 2ZAMA 4RFSA 4DT1B 4QL3A 1G5TA 4M9QA 5L3RA 3TKLA 1XNJA 2XXAB 1QDEA 2BM1A 1O3YA 5E3HA 2QZ4A 4LK2A 2W0MA 5CYOA 3S1AA 1E69A 3K9NA 2REOA 4P4UA 2VHCA 3BS4A 4DT1A 3W5JA 4EFLA 4RD0A 2XXAA 4JBYA 1UBGA 3AF1A 3MJRA 4LI0A 4F38A 4GDFA 3QE0A 4F4IA 3KFVA 2CK3D 1CS4C 2P2LA 1G4AE 2WIAA 5C1BA 4CGZA 2GJKA 4O2RA 1J70A 1NN5A 3ZS8A 5TY0A 4O2LA 5SZHB 1XZPA 1QRAA 2OCPA 4UXJA 2HEIA 3VR4A 1UDXA 2IYQA 3DOFA 4B33A 2XTNA 5HPYB 2QU8A 6Q21A 4G3XA 3U3JA 2IK8A 1R0XA 2BC9A 4PZYA 4NYMQ 4I1SA 1NN3A 4TMVA 1Q57A 2WJIA 3BERA 4PHFA 5B2ZA 4F4CA 4IDHA 1Z0IA 3U44B 4HSEA 4FCVA 4TLEA 1W46A 5IK2D 2ODWA 5CJ2A 1X6VA 1GG2A 3V4RA 4HLDA 1VCMA 2HCBA 5IT5A 1T5LA 2R62A 3U44A 4M21A 5KDOA 2O5VA 5AUQA 3DVLA 3TE6A 3HYRA 2BKEA 2ZI5A 4YLGA 2AL7A 2ZRIA 4PQRA 5AJWA 4K46A 1E0JA 4QGGA 4EFNA 4HAYA 4LY6A 1GSIA 3LQRA 3NDBB 5FBRB 1JXOA 1FP6A 2W2VA 1Q12A 1KHTA 2QE7A 2R9VA 4BFYA 3ADDA 1VCNA 2BHRA 3HDTA 2ZI6A 3MRSA 3U7FB 3E1SA 4M1KA 2NOAA 4EPXA 2OCBA 1ZCBA 5AJZA 1UKEA 1T4GA 2ECKA 1VTKA 2FFQA 1KDTA 1IN7A 3W6PA 4Z1MD 2G9NA 1LF0A 4LZZA 1X3SA 3MUFA 4A2QA 5JS8A 2FEOA 1E99A 1UBEA 2G3YA 5DSZA 1JXMA 2WWGA 3SU8A 4RFVA 1ZUIA 2ONKA 1XEWX 4MITA 3CRRA 3CX6A 4W5HA 1IY1A 4JBWA 4DJTA 1II9A 2JJ2D 3MFYA 2IWRA 1NLFA 2F9MA 2EQBA 2W6IA 1P2TA 1M2OB 3KKMA 5CLQA 3GEIA 2DPXA 5DN6D 4FIDA 1SKYE 1S96A 2CEAA 1YZUA 2EFGA 2WWWA 1F2UB 1SKQA 1RJ9B 2C77A 4BFZA 1RZ3A 4XWKA 4BZXA 2R44A 1F2UA 2VHJA 2ORWA 2JJ1D 1RJ9A 2OFWA 2DYKA 2F3TA 4JT4A 1EX7A 2KWIA 2J5XA 2QTHA 3WHKA 1Q3TA 3CRW1 4LOAA 3SDZA 1ELOA 1NN1A 1U0LA 3VMFA 3GFPA 5HZKA 1HT2E 3H84A 1MO6A 4FINA 1UKVY 4IDNA 1LV7A 2ZANA 2X1VA 3NDPA 4LUCA 1II0A 1G8GA 1P60A 1N6KA 3FTQA 4TT3A 2ZE5A 4BFWA 4BECA 2RGAA 3GJ3A 1UPTA 1QG2A 5JBQA 1AKEA 2VEDA 2N46A 3OIVA 2Q0HA 3T12A 3K9GA 4Y0AA 1ZYUA 4U5XA 1KNQA 1IBRA 4HI0E 4LV8B 4N0DA 4DHEA 4V03A 4OHYA 2BJVA 2VHUA 3GJ0A 4HAZA 4XJXA 3U5ZB 1LTQA 2O0JA 1SVSA 1IN4A 1GDDA 1LY1A 4X8HA 4KFUA 2ZI4A 2C9YA 3L2OB 3O8RA 1W36C 4B44A 4QHYA 2OLJA 2V54A 3SFZA 2G1KA 3TJZA 5EE5B 2G88A 4BZPA 1ZM7A 2Q3MA 1L4UA 2FPLA 4TL8A 2VQSA 4JL6A 5JFGA 2VLIA 3BH7A 1XB2A 1OLOA 1LW7A 1WRBA 5EZ5A 1NVVQ 2TMKA 4V0NA 1Z2CA 4WA7A 4D0LB 2G0TA 3KB2A 1ZM4A 2BV3A 2VPPA 3IDQA 2WJJA 5EZ6B 4GOJA 4Z8YA 5JLJA 1VYTA 4HEJA 2D62A 3Q5EA 5J4HA 5K8LA 2J3EA 1G3IA 2W2XA 4BASA 1ZU4A 2BMEA 2PBRA 4KFTA 4C0KA 4ZCMA 5KO2A 1S3GA 3PV0A 5DH9A 1W36B 2X77A 4C0QC 2WWHA 2J0VA 3ZVMA 3LXXA 2NO6A 4EQ6B 2F3RA 3UMRA 3P1JA 1JJ7A 3VR2A 3SS8A 1A82A 2A7QA 2F7SA 4N0EA 2IXGA 4JSYA 4JT2A 4EQ6A 1GIAA 4RCYA 4US2R 4TTRA 1T0JB 1XDBA 5JWOA 1OXTA 3E5HA 4DCNA 3PEUA 1CLUA 3Q5DA 3GJ5A 3QI2A 1GILA 4KCGA 4NCJA 3GLGB 1AM4D 2OLKA 4N1AA 4DDVA 2VSOA 1L2TA 1G3UA 2XX3A 3KXIA 1X8JA 2I4IA 1UBCA 2DWOA 3H4MA 1TEVA 2VBCA 4MUBA 2QGNA 4AC9A 3GLGA 1GRRA 2Q21A 1ZNYA 1CKEA 5IRCD 2IS4A 5TVKA 1D6JA 4CVNA 1AS3A 4OK5A 1XWIA 2ZYVX 4ACAA 2GKSA 2IYLD 1US8B 2CVHA 2IS1A 1RW4A 1RYFA 3K9HA 1AA9A 2V4ZA 4A4DA 5FOVA 4YDSA 5DO9A 2R2AA 1NVVR 3CIOA 3BH0A 1VHLA 1KO5A 4V0KA 1US8A 2OHFA 2QENA 4RZUA 4R7ZA 1ODFA 4F7WA 1YU9A 4UQOA 2XJ4A 1U81A 4DLXA 4LJ6A 2Z6VA 4B43A 3Q85A 4D25A 4LC1A 2YVUA 1ONBA 1J7KA 4AY2A 3KKQA 2JLSA 2VHTA 2VH5R 1OE0A 1XEXB 1R0YA 2NZ8A 3BD9A 4A82A 4R2IA 1ZAKA 1TL7C 2FDCA 2HV8A 1OH7A 3NTUA 3KQUA 2XOKD 1GUAA 4XD7D 3O8CA 3L0IB 4TYPA 3B85A 3EZ2A 1XEXA 2H16A 4CZ2A 3SN6A 2B7CA 3KQKA 1R5NA 1RVDA 3B13B 1UKYA 2QT1A 1T5IA 1KKMA 2D74A 3U60B 3ECCA 1E4VA 2DFKB 3CZQA 1E2KA 4MGYR 3U7EB 3WBJA 4DSTA 1ZC3A 3GLFB 3BC1A 5J4VA 4TSFD 3K09C 3AKYA 5P21A 1E9SA 4DCUA 1J2JA 4UXIA 1HEIA 2EFDB 5IK2A 2NGRA 2F1JA 3GLFA 1W0JD 2H5EA 4OHWA 5AUNB 1DAFA 5BN5A 4TYNA 4LSGA 1XPUA 2CHGA 1BH2A 2XAUA 3HWSA 4Q5IA 4LBYA 1N6PA 1N5IA 1AJEA 2HUPA 4BFUA 3AQ4A 1Z0AA 2NQ2C 4NTZA 2O8EB 1XTQA 2YWEA 2BMFA 3L0SA 1OT3A 4TLAA 3C15C 3D8BA 4M2LA 2WKQA 4BLPA 2HLDD 4RKFA 4KJZA 1P62B 3IHWA 3AVTA 1IJEA 2NPFA 2Q9AA 2ZAOA 4X8OA 3VAAA 3I62A 2O8EA 2O8BB 2XZOA 1UJ2A 5H68A 4Z1MA 3AF0A 2ZQ5A 4GP6A 3REFA 4QOSA 2ZJBA 2ZRPA 2BVNA 3GQBA 4TLCA 3RC8A 4DUGD 2O8BA 1FL9A 1KI2A 3AF3A 4UNQA 3HU3A 2O8FB 3K09A 3KL4A 2H18A 4I81A 1IN8A 1YKSA 2X19A 4ZKEA 5G53C 4PC3A 2O8FA 1KSGA 1IQPA 3MMPA 1E3MA 2P6UA 2OFXA 4L5BA 4B32A 2VSFA 2XB2A 4U7DA 3KJEA 5DIFA 5B57C 1KSHA 1W2GA 2H17A 4I4LA 2QSZA 3CNNA 2CJWB 2GBLC 3BOSA 1G5PA 1ZP6A 1DE0A 4IOKA 1RKBA 4DDTA 1OXVA 4HAUA 4IRUB 2ZRAA 1DG1G 1UDWA 2CJWA 2IWHA 4CRWB 5AUOB 1EXMA 2ZVPX 1W5SA 3AVQA 3A1SA 1VHTA 2ZREA 1NMXA 1M34E 5EP2A 3OF5A 2JJ1A 5GJWC 1P9NA 3AUXA 4HAVA 4TQ9A 5F9FA 1ESNA 1XF9A 4M1TA 5FL3A 2PEYA 2K5UA 4WW0A 5EUQB 1JR3E 4Z8XA 1AS2A 4HUTA 2PJZA 4MYHA 3ZYCA 1M1YE 2GEDA 4HLUC 2V55B 2IL1A 4Q4LA 2SHKA 3EZFA 2A30A 2RH5A 1U8ZA 1TU3A 1OFHA 3C8UA 3I73A 4P0TA 3T1OA 1NMYA 1NVUQ 2JLUA 5FOXA 3IIKA 2J41A 2X2FA 1KK2A 1JQLB 3P32A 1ZCAA 4FD2A 2BJWA 2GBLA 3LRPA 4FW9A 5AJXA 3U7GA 3NBFA 4DLRA 821PA 1KOFA 3WMEA 3U3RA 4BQSA 2FMXA 1XBTA 4D4LA 2C8VA 2QMHA 3AEZA 1YZLA 1HUQA 3QF7A 4AK9A 2ZPTX 5CM9C 4B75A 3LH5A 3VKHA 3SE0A 1XEFA 3GJ4A 1C1YA 1WXQA 3NEJA 4M8NE 2D4HA 4H9GA 4C4PA 2IEYA 1GZSA 2PH1A 4Q9HA 3ZJYA 4D2IA 5DHAA 1Q44A 3C5CA 1SQ5A 1AN0A 1F5NA 3ETLA 3F3YA 3QKUA 2O0KA 4YC7A 3FE2A 4HAWA 1X8KA 1KI4A 3C4JA 2GXAA 3MWKA 3BB4A 4MRPA 4URVR 1HH4A 3KUCA 4DCVA 4CEIB 4HLUA 1U99A 4Q7JB 5JI2E 1P2UA 2YYZA 5EXPA 4P3YA 2DCUA 4LHWA 3ZD7A 3SZRA 1T3LA 4CEIA 3AVOA 1P7CA 1T91A 3ZZUA 3VQTA 1RRFA 3I3SR 4TYWA 4CYMA 1I4DD 3I32A 2PMKA 3MCAA 2VP6A 1DS6A 4I1UA 2IYUA 3IBGA 4EJSC 3W3ZB 1SHZA 2FWRA 4DLWA 4TWZA 2ZSAA 3CKLA 2FV8A 3ZLJA 3BFXA 4PQYA 4EDHA 1OV4A 1S9HA 5BWMA 1NSTA 1ZMXA 4YXWA 1SXJE 5KNBA 1F60A 1U9IC 3I8XA 1Y3AA 4LV6A 3ND9A 3EW9A 2YKGA 4NCKA 2AWOA 3BB1A 4B3FX 5BYKA 1TQ6A 1N6LA 5EXSA 4NONA 1E2PA 3TAHA 1MH1A 2GAAA 1KO4A 2IF2A 2YNMA 4BEJA 1DAGA 4C0LA 4EPWA 3TUIC 5J47A 1P2VA 1TQDA 2R6CA 5BYJA 2Q3FA 3EPLA 2B7BA 3PJRA 1F2TB 2CNWA 3TQFA 2CVFA 4EJSB 4KYIB 4ZI3A 5BN4A 4M22A 3X1WA 2V6IA 2KBEA 4OHVA 3TSZA 4MDFA 2BBWA 1ZM9A 1F2TA 2NO0A 1U2RA 2F1RA 5AJYA 3KZ1E 2E1RA 3WP1B 4EJSA 5JRZA 3CWZA 1I2DA 2ZI7A 2RGGA 2W6ID 5SZKB 1E32A 2IYTA 4Q1EA 4C0BA 1XRJA 4OK6A 4RD4A 1GTVA 2ZXUA 1G3MA 5CB8A 2FSIA 5DNYB 1KYIA 1GKIA 4MA4A 1E9RA 3BGWA 4PX9A 1U9IA 1WF3A 4Q01A 2JEOA 2XSZA 3EA5A 5GJBA 4IHQA 1SKYB 1JAIA 2XOKA 2FFAA 3K1JA 4XD7A 4HATA 4CW7A 2F6RA 1P2SA 3BORA 3NVAA 2ZS9A 1RFLA 4ASUD 4G5QA 1ESMA 1Z28A 2BIFA 1K8RA 1CEEA 2Z4SA 2QG6A 4BRWA 1TEXA 1Z07A 5FI1B 2JLYA 5FBWB 4TSFA 4B2LA 1NVWQ 4LJ5A 2ANCA 5H1YA 2ZE8A 5J4KA 2QMUA 4Q66C 3K0SA 3B1VA 1WE2A 1FNNA 2BDTA 5JECA 1KMQA 1DO2A 1N0WA 1CU1A 3AKCA 4JYBA 4OI4A 4FMDB 1DG3A 1E1RA 1U98A 4HDOB 5EP4A 4IOLA 1Z63A 3FVQA 4YQFA 1G7RA 2AWNA 4GPTA 3TR5A 1JBKA 1GRQA 3HYTA 4JLAA 1TF7A 2IYRA 3QOFA 2HLDA 3VKGA 1P6XA 1TPZA 4LHXA 1IXRC 2Y8EA 4RD6A 3K70D 2GRJA 2W6JA 2FPKA 1RRPA 1Z0FA 5AR1A 1H8HD 1Y63A 4N3NA 3RS5A 3GEEA 3WNCA 4A8JC 4B3CA 1KKLA 3R20A 4DUGA 1Q1BA 2AFIE 2JDID 4KO8A 1TADA 2YOGA 2QSYA 5JI3E 5DGXA 3ZZ0A 4RZXA 1T0HB 3SHWA 4V0ME 3ZIAD 2UVQA 2GEVA 4I1VA 3R9IA 3K9LA 3I61A 4JLBA 5HR5A 2AXPA 4PANA 4JIMA 1OF1A 2GJ9A 5FTMA 3W6NA 3QEOA 3NC1C 1OXXK 3U2QA 3LAWA 5E7MA 2ZRGA 4JZKA 1W36D 1OW3B 2AK3A 3DEFA 2IYSA 5CM8B 1XMSA
chains in the Genus database with same CATH superfamily
1MIOA 4IUHA 1BXRB 2E4VA 1RBQA 4JX8A 3UJ7A 1JMYA 4P2BA 3B7GA 1HSOA 1CS0A 3AETA 4GT1A 3DD5A 2ZB3A 3GLSA 3AM5A 4BTVA 2EHJA 3OHMA 3A6PC 2W0SA 3CN7A 3TRKA 4P1ZA 2FXIA 1RIFA 1NBME 3RQSA 4R8MA 1UPFA 3UE1A 5MGBA 5IF9A 3IB6A 3LA6A 4YROA 3RSFA 4ZREA 4ZTZB 3N6IA 3LT1A 5F6AA 4GP7A 1CXZA 1DDOA 3H4TA 2XZLA 3WJ2A 3S5JA 4YRPA 1KO8A 4GPBA 5FI5A 3PNBA 4JJ6A 2QUJA 2NVUB 1QU2A 4DRYA 3ULKA 5E0KB 3UKDA 3I6QA 1C14A 2J48A 4JLOA 5FBVB 2FHPA 5JU6A 1CR6A 1P0CA 3RROA 1KPHA 3ZWAA 5HIAA 1V48A 4XUXA 2V1XA 1Y1PA 3NHMA 2VTEA 2UU9B 4TRNA 5E2BA 3KQVA 1KZ4A 1Q1EA 1D2MA 1C2TA 3FR7A 9ABPA 3NY4A 4FWTA 4UZSA 3OQIB 2H6EA 1T1IA 4XFKA 4PYOA 1NXSA 2RGWA 1F3LA 1RJFA 3TRHA 1E1QA 1JSLA 5AJUA 2IX3A 2HEGA 2QI9F 3FMOB 4PO9A 2G1UA 4M55A 5AW6A 3A2LA 2C2KA 1PQYA 1ODCA 4LJ4A 1M34A 1MA3A 2EHDA 4BKUA 3T3HA 4EBLA 4BAUA 3R7WB 2OKGA 4DE2A 5DCLA 2D1SA 2WILA 1PKEA 5D6OA 1K6SA 1XZKA 1VLLA 4JL8A 2HGZA 2J3TC 1SZVA 5DNAA 3D3QA 5MFPA 1PDWA 3UPTA 4P08A 4AZ0A 5DEOA 1U0NA 3IHKA 3PWSA 1RXIA 3RFVA 4GE3A 4F8EA 4QTUB 4Y6SA 1GVNB 2OYSA 2XHZA 4HF7A 2W1TB 3SQNA 1L5SA 3LBFA 2DBYA 4NYIQ 4X25A 4YAOA 4CM8B 3OFNA 4M53A 2FPPA 3F5MA 5BRNA 5LUAA 4UHCA 1XP8A 3EEOA 5L8MA 5JADA 2FPRA 4IIYA 1QGDA 1CUJA 4EW7A 4L0QA 2ZTMA 4EARA 2VTBB 1AHHA 2RAUA 3T4XA 2RHCA 3TLJA 2Q4BA 5FQNA 3OC6A 3JS5A 4GSYA 2CFRA 4H1VA 1UC4B 4ABYA 3C16C 3IV7A 3QVKA 4U3JB 1DAMA 3OM0A 4RLQA 1K06A 1ZEJA 4E4YA 4G3VA 5KYUA 4MQEB 4D44A 3R40A 3IMEA 1NW8A 1QQTA 3CUEC 5DGIA 5JZOA 7AT1A 1BU8A 3TVTA 2PWYA 5WRFA 3P97A 4KACA 3SS3A 4MRVA 3L6CA 4KE9A 1ZGZA 4KI7A 1PW1A 1KEKA 3JQFC 2PRFA 1AB5A 5ADWA 3L49A 4FWIB 4QQKA 5REQA 4QLOA 1EX6A 5ESRA 1YQUA 5KNCA 2H2FA 1G4UR 2XOEA 1U2TA 2O5CA 5DJ5A 1WW2A 3NHQA 1S4RA 4EWLA 3M1IA 4L4ZA 1JWAB 5AJVB 4IX1A 1N77A 3L77A 1QQAA 2CJYA 1RAGA 1GKKA 2P9JA 2FX3A 3GCDA 1OAOA 4PFJA 3O0DA 3F74A 2X2PA 2O8CB 4EMTA 1BDBA 2BM9A 3NIFB 1M3SA 3C0KA 3KAJA 2J9PA 4R1OA 3OZEA 4QKQA 3TNLA 4LYAA 4QQNA 1QANA 2N42A 3FBWA 3ITNA 4MVJG 4K81B 3X2FA 2RG7A 5HIKA 4LDZA 5GHXA 3CO5A 3ETGA 2QPAA 4YDRA 3WGMA 3MJDA 2Q5OA 2Y2QA 4TXHA 4R1QA 1CJTC 1SXQA 3RYCA 1U5AA 4KPUA 3RVPA 4AX4A 4B83A 3CR7A 3PFHA 4HSGA 3RYIA 3EN0A 4PLFA 1YQTA 1W73A 1PX2A 2PHZA 2WT4A 1HGXA 4HZIA 1BH6A 1P3JA 2C7RA 1MC8A 4WXEA 1QIHA 3GBPA 2C5GA 5FA7A 5BW4A 1MKIA 1JW9B 2FFRA 4X00A 3U80A 4K28A 1KI7A 2FZCA 3GLIA 3E4PA 3L4EA 3TVDA 3I2JA 1UFRA 3LQ2A 2J46A 3LR5A 5CTAA 2BFAA 1XVAA 4FHFA 2UZ3A 3VR5D 4WL0A 3V7YA 3Q3VA 2H9IA 3SGLA 3VVLA 4N7JA 3C45A 2GPSA 5I8WA 3O8BA 1WZ2A 5HX7A 3FDJA 1RYDA 1Q3HA 2PZ8A 3AOEC 1YL7A 3W3AD 5C51B 1Z88A 2DWCA 4QHSA 1Z8DA 2B30A 2Z9CA 4DB4A 4B0OA 1IRXA 4G4IA 2XF8A 3CF4G 4DIDA 1J4AA 3H4IA 1GPYA 4LJ8A 2ZIAA 3LWNA 5LBIA 2Q9NA 1OXUA 1ZD1A 1EE2A 3T0IA 2JK0A 3EFEA 2CHQA 5C2JB 2C3PA 2ZSJA 4GQBA 4LZPA 1NKVA 1P72A 4QGBA 3WLHA 3KJHA 2E7ZA 4W8OA 1DKPA 2H4JA 2AN9A 4HGQA 5EJ5A 3DJYA 2HFKA 4MVJM 2I1VB 5AQ9A 2MSKA 5EWLA 421PA 5IABA 5HL6A 2ZJ3A 5DTJA 3TSWA 5IJ9A 4U6NA 4GLLA 5AWFC 4FX2A 2Y59A 3DMRA 2OLUA 4AS3A 2BMJA 2IEZA 1PGPA 3O92A 1ZZEA 4P8RA 4DVGA 3DMFA 1EUCA 3M1AA 4YH1A 5C5CA 2NUTA 4YJHB 1XDDA 2GBIA 2GN6A 4ZDWA 3JZDA 4MHSA 3OTHA 2OCDA 1G59A 4GOND 2VJPA 4TZTA 3L7HA 4Q9LA 1U2GA 3HGMA 3SH8A 4UCQA 4KAXA 4U7FA 1QRUA 2PMDA 3G0CA 3PNPA 1CY1A 4MN5A 5M3BA 1NRXA 3H2BA 1C3OB 2YWGA 3IQAA 3CPSA 3KJNA 3C1AA 3QKSA 3PDJA 2P5SA 4CM4A 4DW8A 4DLSA 1DEOA 1OBOA 3PQ4A 3GT4A 1DI0A 5AMXA 5B6PA 3SCZA 1EJ2A 1N5DA 5EMMA 3U40A 2ZM5A 1KFCB 4BQEA 2AFHE 1TW2A 5EE0A 1EU1A 1P61B 2WPDA 3LECA 2OP1A 5U4XA 4IP0A 2HZ5A 4MGEA 4MLLA 1KE2A 2P11A 2V7VA 2ALJA 4KLNA 1IBLB 3WHIA 4RJTA 4NXNB 3A70A 4QYXA 1NN0A 3PF9A 4F86A 2JGLA 3AVPA 4QOFA 3I04A 2LIVA 5HWTA 1G7CA 4E5UA 3G1UA 3TIVA 2NYVA 3TH5A 3AERB 4B34A 2HP9A 2J8ZA 5LQUA 3ESAA 1K27A 3IELA 4WASA 1L4KA 1V35A 4ROSA 2R751 1YS2X 4FYWA 4OY3A 1CQIA 1XFQA 3CLOA 4URZR 1GQRA 1DO8A 1P8JA 2FR8A 5FLXA 1T1JA 1FLNA 3PE6A 3G7UA 1Z7EA 1X1AA 1R4NB 4PFQA 3UXHA 3S68A 1P44A 2P7HA 4RY2A 1GPLA 1I32A 5TX7A 3MZ0A 1GYQA 1AZWA 5HF8A 3QPCA 2YUIA 4TMTA 1U0JA 2I7XA 3TBKA 4X1LA 2VCYA 3TLAA 3SNKA 2CNOA 4LGCA 3F8TA 2I99A 3KETA 3KWJA 2BI4A 1NE2A 1U2DC 1TX4B 2A5FA 2CLIB 4FFNA 5T6BA 5PGMA 1Z5UA 4EPVA 2FZLA 3Q7SA 1KJIA 2V6GA 3IXGA 2NU6B 3E7DA 5JZ9A 4MMYB 3CNLA 1JIKA 2AFVA 1COWA 2Q99A 2Z1MA 3T3PB 5FWAA 1NDUA 5AKYA 1VSBA 2JN7A 4YRSA 4U9HS 5EUMA 3DA8A 2XWPA 2QNIA 3BCSA 3RS4A 2YV3A 3G1WA 2Z8ZA 3HDVA 1L4NA 3MJCA 3NUZA 1YQ9A 3PHLA 1Z82A 3HXLA 5ICGA 1ZUHA 1MCZA 1L3BA 5FOSA 4A10A 3FDXA 1JIJA 4GLBA 2WW8A 5CVDA 2GK4A 3BD6A 3K4PA 3B7WA 3KB8A 5IULC 1HT3A 3W8FA 2OV2A 5KWJA 3NHFA 2BGJA 2I2DA 1QHHA 5LB2A 1B93A 2O3TA 3UMCA 4JHLA 5JARA 3I5AA 1CJBA 1LX6A 4KQJA 2QMIA 3PPWA 4N47A 3NIBA 1XQXA 1PVDA 1JILA 4RHTA 2YRWA 4UUQA 3DBLA 1B6GA 2C04A 2FWIA 2O23A 4Z7NB 5SZJA 5FHRA 2BM8A 4E09A 3DLPX 3A9WA 4N41A 1IOUA 3COSA 2MT9A 2BGLA 3C4PA 4AF6A 2ID7A 2ZKIA 6CHYA 2D5BA 1JZTA 2ZT8A 4C21A 4IBXA 1JEDA 1FPMA 1CTQA 3DTKA 1USUA 1ULUA 1NJGA 5BSMA 1YA4A 1Y8RB 1WS6A 2AR0A 1WCWA 1F1BA 1W1UA 1XMIA 4Q93A 1JTGA 3AEYA 3A28A 5GJCA 2HYDA 5B6JA 3CONA 1S8FA 3ZWQA 3H5RA 5K3FB 1FQKA 4BXOB 4MMZB 2JPDA 1TI7A 2ODNA 2WGWB 1SGWA 1NM5C 1UPXA 1CQJB 2QS9A 3NHKA 2Y2GA 1O6CA 3MYRA 2YMLA 3GECA 3CUSA 3I4LA 2HT1A 4G0XA 1DDGA 3WFIA 4ZN6A 4EG6A 4ZVLA 2ZD8A 3WK9A 1N25A 3BEDA 7ADHA 5ALTA 4MS1A 4NU6A 2RHMA 4YRFA 4JELA 1N5JA 2HMVA 1FC0A 3W79A 5FV7A 3P0HA 2KW5A 4RCVA 1CBUA 2VHYA 4KR3A 3TL3A 3T9BA 2C4KA 3L8CA 4NI5A 1OC4A 4WNYA 4PZZA 1VMAA 3M3PA 4BN0A 4EMBA 2IYYA 3JARB 4MPTA 1GXSB 1QFXA 2A88A 4LOKA 2PQMA 1G5QA 3FHOA 1A96A 3GGCA 2OSVA 1JDJA 4GBMA 3U7IA 4HNBA 1ZOPA 2GZHA 5F98A 3UB6A 3C6KA 1RDFA 5KQMA 3AKEA 2PNFA 1X7ZB 7MHTA 3U2AA 2P9FA 5IU1A 2QLNA 3IXMA 5FJIA 2XD4A 3C3EA 5JSUA 3W5CA 2V3WA 1U0HC 3F46A 4RYLA 1K6IA 5B37A 4KP7A 1BN7A 3AJEA 4LJKA 5CDUA 3N8SA 4LSZA 3I23A 1DBPA 2P9VA 4EFLA 2XXAA 3DE3X 5FPPA 4BD0A 2Z4TA 1XL0A 1PIOA 6Q21A 1H0HA 5E1BA 3QP2A 2A14A 2EX2A 4QOEA 4F11A 5KU7A 2V74B 4CPDA 5IK2D 2RIRA 3OPYA 3G8AA 4GD8A 5HJEA 3HVKA 4YP9A 2IU0A 3IUBA 1PS0A 1NVAA 3JALA 5T3UA 3ZEAA 2QE7A 3HDTA 2VA0A 4H3VA 5K0BA 4NV1A 1HXHA 1UKEA 3AIOA 1VTKA 3JAWA 2QT9A 1NV8A 1X3SA 4A2QA 2A3NA 4LZZA 5HOEA 5TS3A 2IPLA 5DSZA 4FHCA 2R6ZA 5I4KA 4KQEA 4MITA 4AZ3A 4D92A 5IBQA 3T7RA 1UBTS 3MWDB 5DN6D 1DY6A 3T38A 4C3VA 5KNLA 4WESB 1UCFA 2C4NA 1DQSA 2BZGA 2IUYA 1N2ZA 3OSZA 3OMXA 1XIVA 4Q3AA 1IYOA 1TUGA 4R16A 4ZJ1A 4IILA 1OTXA 2AJLI 1JJAA 2YMMA 4TRRA 4OHYA 4CQLA 4UEYA 3H8WA 1G8MA 5KWSA 5JUWA 1THTA 4QIHA 3GX1A 5K99A 5CA1B 4FR0A 3A2KA 2DJ5A 3F5DA 5FADA 1AMNA 3FSJX 3D3WA 2XWBF 3OICA 5C31A 1U0GA 5EZ5A 2P4SA 4FLFA 4ZOLF 2CHEA 4XA8A 4W6ZA 5DV9A 6LDHA 2H1WA 4FW8A 3VVMA 4F9TA 2QSUA 5BYAA 1CFJA 3KYZA 2Q4RA 5JNLA 1QOPB 3MINA 4O4IB 4Q0HA 4RTRA 1WDMA 4CMIB 3X2EA 4JUDX 4NCJA 2VSOA 1G3UA 4LE2A 1JG6A 4NXFA 1FRFS 3EXHA 2BY4A 3FGZA 3IT0A 2CV0A 3M6IA 3PJDA 4ACAA 2GKSA 4EX7A 3CIOA 5AK6A 4Y2XA 1QVWA 3SD7A 2EFJA 3UT5B 3DXZA 1Z39A 2VH5R 1U5BA 4MQMA 1XEXB 2VYVA 4YAKA 4IDBA 5IVPA 2JA2A 1FDWA 2IRWA 2X23A 1U8XX 2ZFUA 1OH7A 1GUAA 4UHJA 3PQEA 1G28A 3EZ2A 4QICA 3QP5A 3FTDA 3TD2A 3OZCA 2WYIA 2O06A 1YB4A 3E53A 2F1JA 4J1QA 1JLLB 2VN8A 4NPAA 4RQ9A 4MR8A 1DWPA 1P5HA 1QE5A 1E1CB 4MKZA 3VOZA 3AF0A 2BVNA 3DZIA 4I81A 1L5KA 4V1CI 2O8FA 3D6JA 3PL5A 2XB2A 1EX9A 4O4LB 4ENQA 1E4OA 2OGUA 1JEYB 4LX8A 2IXTA 1MH9A 1PUXA 1QM5A 3ORFA 3RIYA 3HGQA 2B98A 4O2AB 1E6MA 1ESNA 1XDWA 3MM4A 2C2ZA 2HHLA 1E20A 1EUZA 2RH5A 1VRCA 3I73A 5LC1A 1F8YA 1NVUQ 5CX1A 4KR2A 2I67A 3KYCA 2D8AA 5ESXA 4DQXA 5IBCA 2C8VA 3AEZA 2ZWMA 3LH5A 4M8NE 1WXQA 4CTOA 2BDUA 2IEYA 4R9VA 3C5CA 1SQ5A 5DYNA 1F5NA 1IZ0A 2ISQA 3FE2A 4C14A 1NF2A 4DQ0A 2PUFA 4UMEA 2VWGA 3ZDAA 3KUCA 1ORTA 2W2KB 1ZGBA 4B9EA 4KWTA 3ZY6A 3U3XA 5K2MA 2ZSAA 3C8MA 2IEDA 3RTBA 3QFFA 3NWPA 4LV6A 1Z75A 2C5SA 1THMA 3TTUA 4B3FX 5AJGA 3NASA 3FROA 5ALJA 1G68A 5DK6A 3F1NA 2OR3A 3FD8A 1M73E 3NUQA 3JQ7B 2OORC 4MDFA 1F2TA 3VR6H 5SZKB 3WLMA 1G3MA 2G9UA 1LDBA 4X24A 4WLUA 3EF1A 5IXYA 3K1JA 5HIMA 4YRIA 3A14A 1VMIA 5E9AA 3CSUA 5GINE 2NSJA 3G2KA 4R0NA 2Z4SA 1OU4A 2QG6A 4G3KA 3IUNA 1VHJA 1PQ4A 3I1JA 4ICIA 4EB6A 1U7PA 5G0UA 1RTTA 3FLAA 1U98A 4XT2B 4MI3A 2HTEA 1B7GO 2ZJ9A 4J7AA 2FEWB 1ID8A 2IYRA 3ZDDA 4V3CA 3WLTA 1RLJA 3RS5A 4K8RB 4O4JF 2JDID 5C4IA 3R0XA 1XQWA 2B4KA 5D01A 4YECA 3SOIA 2J9FB 1P1FA 1KEZA 3JQAD 3S99A 5KCZA 4AWAA 2IZOA 1MIOB 3IAS1 1MOQA 3LC7O 2AYZA 3FYZA 5KYNA 1QFYA 1VL2A 4FMCB 1CS0B 1MRSA 3AETB 3BHMA 1K56D 4KQCA 3GMSA 4AQYB 3BDAA 2HXSA 3GP3A 1W8DA 2X5XA 1E2BA 2IWBA 1F4PA 1F48A 4H6VA 4BQOA 4HWRA 2Y1KA 1VOTA 3Q3EA 2ADOA 3PUZA 3NATA 4UM8B 1HQCA 2C42A 5FLYA 2JAHA 5FNVF 3IT9A 4ECAA 5BMVF 2XLNA 4IMRA 4QRDA 3U9TA 3OQBA 4QJ3A 4LFCB 3LY5A 4H27A 4RADA 2BUCA 3LKDA 3PX7A 4O08A 3LYAA 3QY9A 3B6ZA 1A9YA 2E82A 2GAFA 1PZMA 1UK9A 1TAUA 1CY7A 1PZOA 3AUSA 2FGJA 1IEWA 2FSGA 1PLLA 4Y9RA 5EERA 1GTRA 3Q2KA 1JBQA 4YCDA 3OJ0A 4REOA 5BWBA 4J4BA 2X8BA 2QUAA 1SAYA 2ID8A 2LV8A 2OZLA 3AYXB 3DD1A 2QROA 1SBHA 4ESHA 4IMIB 3CPEA 3K6KA 4Z2YA 4TQUS 2AZTA 3OESA 2F8SA 3EPJA 1E64A 2WKWA 5TMPA 4ZAYA 4ZHSA 5SYNA 3KWLA 4WUJA 1Q92A 4RHFA 2HNKA 1AGNA 1W29A 3AXTA 1DTSA 4HJ3A 3DZDA 1PU2A 2OAQ1 1KSFX 1E9CA 4PHCA 2SKDA 1M34B 4P22A 4EVSA 4BRUA 5L7YA 1WOYA 1YJQA 2VP5A 4J3NA 4Q9KA 2ZMFA 2FPSA 1DRMA 2FSUA 5CLLA 5G1NA 4GKUA 5TE9A 1FFYA 2R8RA 4RENA 2WAXA 2ZJZA 5BWOA 2H7VA 3T7AA 4AJPA 4DLYA 1L5OA 1FZQA 3O3OB 4RPLA 4FDTA 4J90A 5HAIA 4EB8A 4AZ0B 3LFUA 3ZY3A 4PNPA 5F7OA 1PI5A 2CE2X 1X42A 4MRNA 3P27A 3F1OA 4DDUA 3ZZ1A 1RAIA 5BQFA 3E3NA 3FY4A 4AF8A 4OCZA 3L5KA 3MLAA 3LK7A 4TMZA 4HZUA 3QTLA 1PJCA 3EOAI 4G5RA 2FG5A 2FPPB 4ZVTA 3S1SA 1Q0PA 2YZKA 3SYLA 1YE3A 3A6DA 4AY5A 5BSGA 2ZTSA 1Q1GA 1TKBA 2NW6A 2VIIA 1TVCA 3VZPA 3ZBPA 3AU8A 3I9OA 4P4GA 2EKZA 5FATA 2R47A 1NZDA 3TI9A 5IMSA 4L74A 3EIEA 2ZJ0A 3G0BA 3QZUA 3PC8C 1MN6A 2Q3HA 4WEKA 1YR7A 4DCUA 3GDFA 3DL2A 5KQSA 5KYUB 3W6UA 4NK4A 1Z6XA 1KVRA 2ZWPA 4JLPA 1HK7A 1IPFA 2Z09A 5A7FA 1L5VA 5EUAA 1AY0A 2K31A 1XA1A 5J2UF 3EZGA 3SBDA 4HI4A 4PRZA 5REQB 1YS6A 3G2JA 5F73A 1CJKC 4QDXA 1BIFA 2V5UA 3LDAA 4HH3C 1OZAA 1PYOA 4L7QA 1J2RA 4NDZA 2HREA 4UHEA 2W00A 3SJBA 1QC5A 2D54A 2QMQA 1JDVA 1EVLA 4TXLA 4TZ6A 4PXYA 1E79A 3MT9A 2Y0EA 4OYHA 1X7XA 3ADOA 4NCAA 4EECA 2K87A 1RRMA 2HYIC 1R8QA 1J9ZA 1FDTA 2EZ9A 5I7SA 2XR1A 3I5UA 2JCSA 5CH5A 1KIMA 2O57A 3L0ZA 4YGXB 2RKOA 4R9SA 3PUWA 3RYCB 2B6HA 4KPUB 2VK1A 4QU5A 5HK9A 2OT3B 2PKRA 1ISHA 3R44A 3RYIB 3IHTA 3A4YA 1TDJA 1WNFA 2N1BA 1D2NA 3F6CA 1SXGA 4A2PA 3ZNYA 1IZ8A 1XKTA 1YR3A 3HFSA 3MRXA 3B8EA 1UZUA 4D4MA 2OYRA 2EDAA 2A1TR 2RGDA 4B09A 4QQFA 4ZQFA 4TN1A 1GSAA 5CB6A 2B0JA 2CUZA 3C7AA 3GLIB 1ZI8A 4XIGS 3NANA 4RK0A 4BNXA 2B5OA 3IAFA 5MHTA 2WNHA 1MW9X 3AGEA 3A4MA 2EDCA 1CEYA 1YU6A 4UNIA 3G85A 5IZ4A 1XWWA 1PT8A 4M4SA 4R8KA 4IAOA 4W4TA 1M5RA 3ENNA 3ZHSA 1ZBDA 1JJVA 3BXXA 3DM5A 3TK1A 2FAXA 4UREA 2R6R1 5DWQA 2CKMA 2BGIA 1KOJA 4N3CA 3DZJA 1L1QA 1CNFA 2R6GA 2BF4A 2CZQA 4LX0A 3MIIA 4DMCA 1TC2A 3Q40A 4BKOA 4E70A 4P0PB 1DWOA 4KAAA 3UHFA 4NCBA 3KUUA 3B5JA 4Y67A 3ZCXA 4NK5A 1HETA 1FIKA 4HQNA 3B5IA 5JWHA 3UJDA 4BKMA 5CXUA 4R70A 3WJ7A 4H0NA 3GFGA 1CW2B 3H5IA 1RABA 5E8RA 2QUHA 4QHTA 1TUBA 5EWLB 4C76A 1U04A 1I94B 4BVLA 5EWMA 2VOJA 4LNUA 2QORA 4PLPA 3NCKA 4LVUA 3HBMA 2POQX 2AZ4A 1T5TA 1NJ8A 2EWWA 1EFTA 2AW3A 2CLFB 5IJ9B 3PHJA 1P29A 4HO1X 2K7FA 3LO8A 2ZXFA 4TLBA 2A24A 4DIOA 2QM7A 4XGKA 4O0PA 3O6VA 2ZITA 1EUCB 2A58A 1JWVA 1PVVA 2NUTB 2ZJ6A 3F6PA 4H1WA 2H1SA 3PX3A 1A9XA 2A1UA 4LISA 5JBIA 5JH7A 1WSDA 5CYPA 3KEFA 3T4SA 2YKFA 3G35A 1Y9JA 1WPXA 3GLKA 3ZYZA 2OBXA 3CUKA 5JD5A 2BH9A 1KOGA 2I62A 1VHMA 4RXUA 5CYFA 4HRXA 1SIBE 4BY9E 1KERA 2NO9A 4BE9A 4YQZA 1OIVA 5GL9A 2E55A 2WSBA 4HDMA 2H7CA 2RGCA 5ESWA 3A3YA 3FKSD 2OCYC 3QKSB 1FTQA 4CM4B 3PKJA 4BBTA 3O82A 1Z29A 1QQ5A 3F1KA 4F5EA 3D8TA 1FNCA 4W1QA 4FFSA 2X0EA 2PAAA 2ZZKA 5CAEA 1LA2A 4JYPA 4KITB 3LOPA 2OWDA 2ZUTA 3SR3A 4RVCA 1FLAA 2Z6CA 1CVLA 3GJZA 2FUG6 2Q0SA 2G9QA 3CSSA 3ZFZA 3OEED 4WFKA 3NBXX 4DG8A 2XECA 1EHYA 3EGCA 1VGQA 2ZC5B 4IWYA 3R09A 3HEBA 2F59A 2KE5A 4ZVNA 3AM3A 2ZRDA 4WLAA 4U2GA 4FS8A 2OE2A 4M9ZA 4CE6A 4QFBA 4AFNA 1XCMA 2PV7A 2DR3A 4X90A 1CQIB 2BMDA 4L8WB 1WZEA 4EPYA 1L8LA 1J90A 1AF4A 1HOXA 1EP9A 4OKSA 2IYXA 3PHHA 1MT3A 1ONNA 4WA8A 2JGKA 5EMJA 3G8BA 2EP8A 4I0WB 3PE4A 4C2TA 1ODKA 1H2FA 5IS2A 3PD7A 2WM8A 4EU0A 3JQ6A 3RJTA 1D2AA 5EJEA 1D1QA 3BY9A 1ZNQO 3DAYA 5FPYA 2NWQA 2JLVA 2Q29A 4D97A 4EQZA 2XA1A 2CLMB 5IWCA 4XB6B 3SJAA 1U3CA 1DEKA 4IUYA 3N7UA 2OHVA 1MA0A 3U4AA 2Y77A 1Q0ZA 3GD7A 3QXXA 2P9CA 3CR8A 2D2IA 4OHRA 2FKAA 2V8OA 2SCUA 2W9XA 4FILA 3Q8LA 2P6RA 3O8DA 1C0EA 2VRCD 2C9DA 5D5QA 1Q19A 1GAXA 2JJ8A 3QSYA 3SVLA 4QFMA 2G7ZA 1OJGA 1W49A 1IBKB 4R6WA 2ZIUB 2J6BA 2XEPA 2EG9A 3AY6A 1WCV1 1UAGA 1SEPA 4QPNA 4RJIA 4ZYVA 4R71A 4G9EA 2XDYA 1UDCA 1TJ4A 1QHHB 5E7JA 4LGMA 2I2CA 4ENSA 1YMUA 1XKZA 1OFGA 2XUGA 5AVTA 2J80A 3SHOA 3DBLB 3UGQA 1U28C 1KFEB 3WXMA 3AGFA 3QMPA 1CR0A 4XCVA 5LQMA 2FDXA 1KI3A 2ZG6A 2VJDA 1B0PA 3SSOA 4EHKA 3WK7A 1AZSC 1FDUA 1QIMA 4QO7A 1OBVA 4PICA 4YRMA 1G0OA 3MZDA 4QDJA 4H4EA 3HA5A 2FEAA 1NI3A 3EBPA 2WOJA 3OIDA 4H7FA 3IAM1 2DBZA 3GHYA 3MNFA 2I2BA 1FFBA 4XQEA 2JIRA 2C4VA 2PDRA 1UMKA 2CXUA 3V4OA 5C53B 3F4LA 3L8HA 4L75A 3N0XA 3TECE 5LOVA 2L18A 1NOJA 4FUWA 1EP2B 2B0CA 5AM4A 3HXOA 1A8UA 1SUDA 1QS0A 3AEKA 4F04A 1XGKA 2EEZA 1GG5A 1NJFA 4Z54A 2R6AA 1INLA 2PKYX 2V0GA 4JC8A 1XKLA 3H04A 4MS1B 3ICQB 1ZG3A 3WWXA 3KE9A 5ICCA 1HC7A 4ENVA 2VOEA 1DIOB 3SFTA 4QOGA 2HCJB 3JU3A 3H1TA 5C3UA 1FTNA 2ZIGA 3NHYA 4F5YA 3GCGA 3N75A 3WLKX 3O47A 2IEGA 1K57A 3KQMA 3UW3A 4PNHA 3BIFA 5DXFA 4LXXA 1OGIA 2FN8A 4ZGBA 3BB3A 3K0CC 1RWOA 4QXOA 3ICPA 1SUAA 1GR1A 3KVNA 4A26A 3G2HA 2ZC6B 1TAGA 5JJLA 3RBVA 2JATA 2GCOA 5C81A 3L7AA 3EEYA 4LENA 5KKCA 4KSBA 3ZWMA 1LPNA 3UNWA 2J3LA 3Q7VA 1NRIA 3MCUA 4TWIA 4EG0A 4MEBA 1NJ2A 1E9AA 2NV0A 2XCIA 4NNPA 4IDPA 1ZUWA 3CJQA 1OBHA 3NHAA 5A06A 5AESA 4DWWA 2JKGA 2P9VB 2XXAB 2BM1A 3TW8A 2W0MA 5EE8A 3HKDA 3ZX4A 3K2EA 4GDFA 1TXGA 3I12A 2WIAA 4GI1A 2WDZA 4AJKA 1AUXA 1QTNA 3FZNA 1HF3A 3FRJA 1QUEA 2HEIA 3ORSA 3W7BA 1V1RA 4PXSA 4BP1A 5LCXA 4MJXA 4JP8A 2P6MA 3I01A 3OPYB 3VU0A 1NXTA 3UCEA 3KE8A 1JG7A 1W46A 4ZYWA 1XLUA 2PA0A 2QDXA 3RARA 3U44A 3JALB 3DVLA 2VPTA 3QYPA 3OE1A 2DRIA 4ARIA 5L4LA 3FOEC 2KDKA 2J5RA 2R9VA 3AILA 1L1EA 3JAWB 2ZI6A 4AM8A 2FMFA 2HMTA 1JQKA 2VNSA 4O2BA 1MX9A 1XR3A 3UK0A 4BBAA 4MCAA 4AZ3B 4L1KA 1FBNA 3K8ZA 5HF9A 2WK0A 5C5DA 3GWZA 4E3ZA 4LXHA 4HQKA 3HJRA 1P2GA 2ILVA 1LL9A 4GKAA 3KR0A 2HIAA 1J0BA 4IDEA 4KAJA 1RZ3A 3M9WA 4BZXA 3P2IA 4W9RA 1RJ9A 4IIEA 4H7HA 3I2FA 2HQRA 2HX1A 1G8GA 2RGAA 4CQLB 2N46A 4R5MA 4WBNF 3EW7A 4ZTUB 1WG8A 1GRCA 4WGGA 2WFZA 4UHKA 1NATA 4C6HA 2DLCX 3D3WB 5ECWA 1TYEB 2OLJA 2BE9A 3LBAA 3S29A 1FBTA 3HVFA 2WFMA 1UIMA 1CRWG 4ZAZA 4JL6A 3UMVA 2CGEA 5TS2A 2PH7A 1DIRA 3E9CA 5GONF 2H65A 4ME6A 2OZKA 4V0NA 3P2YA 2BTQA 4D9GA 1ACJA 1XTUA 2BMVA 3ISTA 5K51A 4J43A 4S04A 4RTPA 5LZ9A 3MINB 5DH9A 3NWOA 2F3RA 1J97A 4NZ9A 1WLSA 3ZDYB 2ASVA 1OXTA 3E5HA 2ISSD 3Q5DA 4X62B 3VHQA 3EXHB 1JVSA 2XX3A 4IIBA 2QGNA 4LZJA 4OFWA 4HNSA 5JDIC 4NEGA 2WK1A 1C1DA 1RS0A 4ES6A 3WB9A 2NUAA 1U5BB 4WKCA 3KKQA 3UENA 3KCNA 3WWPA 1QTIA 1ZEMA 4IX9A 2XYGA 4LRXA 3C3DA 5KHLB 2B69A 1RP7A 1CEXA 2WE8A 1DZIA 4Y6LA 2BF7A 1LDYA 2R87A 2JFQA 4MR8B 2XAUA 2OD7A 4LBYA 3LCMA 5B1EA 3SC2A 1P4JA 1JIQA 2NQ2C 4NTZA 2H07A 4R5HA 4KR7A 1GLGA 1OT9A 1GSVA 4Z1MA 5A04A 1TFUA 5J1TB 3QHQA 5AKIA 1I51A 2R7LA 2O8FB 3B33A 1A0OA 3E1KA 3E3OA 1H2XA 3G34A 1GHTA 3A6GA 5EN4A 4BVEA 2HDRA 1Q16A 3TINA 1GQYA 3CW9A 4XUEA 1D7EA 3C3PA 4XUCA 1KKUA 2YIDA 2ZBUA 3SDBA 1XTVA 4GEGA 1IHXA 4K6OA 2VDOB 4F71A 5CX1B 2IL1A 4QYWA 3KYCB 3T1OA 3EDMA 3ZWNA 1JQLB 3ZHVA 2BJWA 3LRPA 3U7GA 5IWAB 3OKCA 821PA 3U3RA 3OA0A 2PGJA 5E6UA 3C3CA 4B75A 1C1YA 2QD4A 2HSDA 4N8DA 4A5OA 2O0KA 4JJIA 1H2RS 1YB6A 3ORQA 1DJOA 1U99A 1X9HA 2YYZA 1CETA 4K9QA 4AT1A 4M3NA 1YAJA 5FYDA 3IBGA 4EJSC 3Q7TA 1YASA 2FV8A 4NFHA 4EDHA 1KP3A 2J4CA 3RRBA 1AXBA 3E4QA 4QRIA 4IO0A 3PFWO 3F1NB 3RR2A 3C98A 3TUIC 2QDKA 4CCSA 3BULA 3CYFA 3G59A 3D2CA 1F2TB 4OQDA 1NVFA 1ZM9A 3U3DA 2FW1A 5GHYA 4NICA 1H2EA 3N2KA 1QNFA 2V7BA 3U4DA 1SUIA 2MR6A 4ANFA 4XD7A 2GN9A 1DGQA 3P19A 3OX2A 2Q8NA 4BRWA 4EB6B 3RVDA 4BOYA 1Z07A 3PLAE 2R1UA 1KYYA 2EXXA 2F4NA 2BDTA 3WK5A 1NTRA 5A4IS 1E1RA 2BZ1A 1O6BA 1Z0UA 2JZOA 3F97A 4P7FA 1MJNA 2HLDA 2P69A 2VLGA 2JD1A 2Q3LA 4B3CA 5AQBA 3K94A 1Q1BA 4U7WA 3UAVA 3RHTA 2GEVA 3RHZA 4I1VA 1HYGA 2Z3ZA 2ZIFA 2FE1A 1JSCA 4N1XA 3FXAA 5DIZA 1CWUA 1M40A 3O4HA 5JAPA 1JWLA 3TOIA 2J3TD 3A37A 2ZJOA 2IDZA 3VDQA 5F9HA 3LT4A 4FP9A 4JCCA 4YRDA 3PXXA 3TRDA 3NIDB 4EF6A 3VZCA 1C9NA 3QHPA 1CP2A 3S40A 3EGOA 4BJHB 3LLCA 1JQDA 2FF7A 1UEJA 2DAPA 2GTPA 4O8ZA 1M1UA 4ZTKA 2FXVA 4L76A 5EXEA 2ZSIA 4LV5B 2J31A 4WQMA 3CB4A 5DI3A 5KWVA 3LHFA 1JVBA 4KQFA 1N8SA 1PSWA 2V8BA 1MRNA 4TMFA 4F1JA 3DZGA 5AVVA 3OPQA 4Y9SA 3IDZA 3GPLA 2OZLB 4LYJA 4WIAA 3HCEA 4A0FA 1L3LA 2QSJA 3OAAA 1O94A 4DCCA 3D4BA 3B47A 1L7EA 4OBBA 1GDTA 2INGX 1X1SA 4EAAA 4Z9QA 5IN5A 4BX9A 1IAQA 2BHNA 2Q2OA 4H18A 2V7QA 3Q0IA 4M7RA 2CBZA 1FLVA 3ZNQA 2ZYRA 1T6YA 4Y2SA 1QGZA 2LIPA 5HFNA 5C8YF 3MZFA 3QNUA 4FOLA 1NWHA 5EJ8A 5IP5A 3LX6A 4OXQA 3GLHE 1UF9A 4ASUA 1MY8A 5AIAA 4G2TA 4Z4EA 1QHXA 2RK3A 4YQEA 2DG2A 1QZ3A 3DULA 2EQAA 3R0QA 3JVUA 3JQ9A 1PG2A 1WTCA 3REGA 1VPTA 2GRUA 4E7PA 5A5GA 3AEUA 5K20A 1OPXA 4IH4A 5B7PA 4HWOA 3OECA 4DCOA 1JSXA 1XHEA 4Q12A 4K40A 3UB4A 2JLXA 3TR0A 3F1OB 3WIUA 1Y5RA 3WLOA 1S4MA 4FBGA 4BLRA 5F83A 3SHQA 2QW0X 1FJHA 2V7GA 3OCYA 4BVFA 4GZMA 4HZUB 4Y1GA 1HVBA 2NPIA 1TO2E 3KPVA 3EVFA 4LRQA 3FPKA 3M5DA 3DT9A 4DUZB 1WP4A 2A5JA 2QRQA 3KKEA 5KIAA 3IILA 4EKDA 3HQ4O 5GZ6A 3K8QA 2G28A 3S2FA 3HEMA 1DB3A 5HUJA 2KQUA 3MWYW 2O99A 1UXJA 3ROEA 4CV2A 1B76A 3A9VA 3T1NA 1MAVA 3RAPR 2GAIA 3AP3A 3IS3A 2AC4A 2A5DA 3MCWA 3VX4A 2HSGA 4J76A 2W93A 4WDRA 4W9MC 1Q0SA 3DEJA 4IGEA 3T35A 4W5RA 2GPBA 1ZQ9A 4UTPA 3N2ZB 3QP4A 4KU4A 5E1MA 4WMCD 2YMPA 4MZXA 1AURA 3AIKA 4DQKA 1PTKA 4DA0A 1THGA 1Z12A 3PB3A 1QC5B 4BCDA 2BTOA 1Y9DA 1XFNA 4DV1B 3MGCA 1CRPA 1PT5A 3DR3A 5A3QA 2P2GA 1X7XB 3SXPA 3GU3A 2DWPA 4XPZA 5LZ2A 2H4YA 2ZROA 3U61B 1ECCA </