1P9RA

Crystal structure of vibrio cholerae putative ntpase epse
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
401
structure length
378
Chain Sequence
DFFSLAEEAPIIKLINAMLGEAIKEGASDIHIETFEKTLSIRFRVDGVLREVLAPSRKLSSLLVSRVKVMAKLDIAEKRVPQDGRISLAVDVRVSTMPSSHGERVVMRLLDKNATRLDLHSLGMTAHNHDNFRRLIKRPHGIILVTGPTGSGKSTTLYAGLQELNSSERNILTVEDPIEFDIDGIGQTQVNPRVDMTFARGLRAILRQDPDVVMVGEIRDLETAQIAVQASLTGHLVMSTLHTNTAVGAVTRLRDMGIEPFLISSSLLGVLAQRLVRTLCPDCKEPYEADKEQRKLFEPLILYRATGCPKCNHKGYRGRTGIHELLLVDDALQELIHSEAGEQAMEKHIRATTPSIRDDGLDKVRQGITSLEEVMRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General secretion pathway protein E
publication title Crystal structure of the extracellular protein secretion NTPase EpsE of Vibrio cholerae
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Protein transport
total genus 103
structure length 378
sequence length 401
ec nomenclature
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1p9rA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p9rA02
5FUXA 3GPLA 4BZXA 4G0NA 2G1JA 4ZCMA 2J9RA 4KI0A 3OIYA 4Q9JA 3CX6A 3QENA 1XJ0A 2UZIR 4BZQA 3QKRB 3HR8A 3KKOA 3L8YA 2OT3B 2C96A 2OCPA 2OSBA 2ORWA 4JLBA 1N5KA 1T4GA 1XBTA 1EX6A 4RSGA 4B33A 4HUQA 4Q4JA 3KJGA 1CS4C 5DI3B 2WKRA 1GITA 4Q19A 1E4VA 3AEZA 3DKVA 3IHLA 4B3DA 2OHFA 1E9RA 2XEXA 1JECA 1ANKA 1DAGA 1NKTA 1X8LA 2VO1A 1P6XA 4Q9KA 5GJBA 1GL6A 4M1WA 2GXSA 2WBLC 4JLDA 2W2XA 4M9ZA 4TT3D 1W44A 5UKDA 4ZV4A 1R0XA 2ZSFA 3T12A 1UKYA 2XNDD 1QHHB 2KWIA 3A4LA 5FBLB 1HH4A 3PXGA 5B64A 3RYTC 1S1MA 2FSFA 1U94A 4W7SA 1OIWA 3KKNA 1KO1A 1JAIA 3Q8XB 1GWNA 4YDSA 3BH6A 1T8TA 2E87A 1OIXA 5KU1A 2J5XA 1GKYA 3IO3A 2VTKA 5EXSA 3D6TB 5KDLA 1E32A 4WZBE 4V03A 2H1LA 2SHKA 3VR5A 3THYB 4US0R 1I4DD 1BYUA 1QHGA 3UKDA 3EIHA 1XX6A 3PVSA 4DC9A 2RGBA 3ND8A 1G3RA 2GTPA 3VAAA 3PEVA 3B5JA 5EE3A 2YNMA 1Z6TA 2C77A 3FB4A 2A30A 3GP8A 3FHTA 1LFDB 4XVRA 5IK2A 2YOHA 3KB2A 3BIFA 4RD3A 4CF7A 1ZD9A 1FUKA 2WJYA 1SVIA 3PENA 4BPBA 2Z6VA 3IIKA 1W47A 1UBFA 3TH5A 4BWYA 2O8EB 1N6OA 5KHOC 4URVR 1E2MA 2RHMA 1CR1A 4TMKA 5JSZB 3QXSA 3U6BA 4Q7LA 3ADDA 1Z6GA 1P3JA 1P5ZB 3R20A 5DHFA 5FOXA 2OXRA 2ZJ5A 4MYHA 2V4ZA 2R65A 4F4IA 1JR3D 2RB4A 4UNRA 1HTWA 1QHNA 1NVXQ 2ZRMA 4K81B 2EFGA 4NYJR 1F60A 1AQUA 4NYJQ 1KDPA 2QBYA 3ETLA 3NHAA 1R2QA 1TQ6A 5L3SA 1GP2A 5JCZA 1YZGA 3B1XA 3NC0C 3I5YA 2WKQA 3GJ0A 3B1WA 3FKSD 3U44A 1FFHA 3B85A 2G1KA 2BEJA 2VHUA 2IYYA 3WP1B 3TVTA 4QHSA 2VHCA 4H1VA 2F43A 3U7FB 4DCSA 2X1VA 5FPKA 3IIMA 3CX7A 1GUAA 3VR6A 2CNWA 3E1SA 4IVPA 5D3MA 5FL7D 2FZ4A 1OXXK 2W0MA 3MWKA 3K70D 3Q5DA 1WBDA 2XXAB 2VH5R 1Q1BA 4XSHA 3REGA 2HT6A 1XD2A 2ZJOA 4LJYA 2DR3A 2Q6TA 1ZD1A 1FL9A 3FHCB 4LYJA 4P32A 3T1TA 5FPYA 4M1YA 2QNRA 4DWJA 5CDFE 5AK0A 5HE8A 1DO0A 1NBME 2QT0A 3TJZA 2AD1A 4OI0A 3S1AA 1DG3A 3QPWA 2FGJA 2JIZA 4HLCA 3W8NA 1F2UB 1S2MA 4OK5A 4JKYA 1W0JD 4G5RA 4AG6A 5JJIA 3EZFA 1H8HD 2YZ2A 1NIPA 5FBRB 5TDHA 4B34A 5C4MA 4XVUA 421PA 1IN7A 2GCOA 4B74A 4JL6A 5IF9A 2ECKA 1R8QA 1Z0KA 3IUYA 3SFVA 2IWRA 1OH7A 4ZPXA 1OPXA 1P60A 1D8TA 3DO6A 3SJZA 1EWQA 1KK0A 4IW3B 4C2UA 4DCTA 5GJVC 1UJ2A 1Q3HA 3OEED 3B60A 4ACAA 3NC1C 2P6UA 4C7OB 1E2FA 2JLUA 1T3HA 4IDOA 3WHKA 1TUIA 1XRJA 1CR4A 3ADBA 5AUQA 4PFSA 1Z6AA 5EXPA 3ZVLA 2XZOA 1S9DA 2BV3A 3GLFB 4GMDA 2H8KA 1CR2A 1SVKA 4IOLA 2I1VB 1Z0IA 5B58C 3RS7A 4ZDIA 1E9BA 3KFVA 2P3SA 2VHJA 4Q5IA 2GDJA 4M1SA 4PSKA 1NMZA 1XCGB 4M2LA 4YC7A 2W6IA 1C4OA 5HCNA 4RD0A 1T91A 5C46F 4AIIA 2ZRDA 1A2BA 1IHUA 4OKSA 4OI1A 3LX5A 1ZVQA 2GK6A 1RW4A 3QXCA 1TEXA 1QBKC 4URYR 4D25A 1U99A 1NMXA 1HA3A 1KJZA 3LW8A 2GVZC 4Q9IA 1NP6A 2C5LA 2D74A 4HAXA 3M6AA 4JMPA 2WSSD 2QE7A 5JS8A 1ZM2A 4NCNA 1SXJE 1KSJA 2HJGA 1DAKA 2C9OA 3WRXC 2BJWA 1Q57A 1WDTA 2FV8A 1FOEB 4Q18A 2FPKA 2ZRCA 1Z22A 3SI7A 1JXOA 4FW9A 3B7GA 3VQTA 2CHGA 4POAA 3NDPA 4AKIA 4EFLA 3MAAC 1G20E 3SYLA 1KZ7B 1E1RD 3M0EA 4MDFA 1AS2A 3V4RA 1MO5A 2GXQA 5HR5A 1E2HA 4XWOA 3SQWA 3VNVA 2AD5A 3W34A 1LVGA 2ZSBA 2IT1A 3SQXA 1XCMA 4MKFA 3CZQA 2QT1A 1AZSC 4NBSA 5G40A 1SQ5A 4RY2A 5DI3A 2JLVA 1KY3A 3A1SA 1EX7A 3W6PA 2KB0A 1SVSA 1XTRA 4ASUA 3DOFA 3AGQA 1G6OA 5SZJA 1CLUA 1KSFX 1GNQA 1R0WA 2KBFA 1F6BA 2QP9X 2FNAA 2R62A 2BM1A 4RD1A 1AKEA 2J3EA 2QRNA 4KXFB 1CJTC 1E98A 1TU3A 5L3VA 3U4QB 2OFXA 3SJBA 1YHNA 1L2TA 4TL7A 2R9VA 3V00A 2HYDA 2V3CC 1G18A 3DOEA 2VP2A 2WV9A 1E9CA 5E3HA 5K8TA 3PFIA 4V0ME 3DZDA 2H16A 1AJEA 1QHHA 3MJRA 2Q9BA 1E9EA 2Q3FA 1JEEA 1K5DA 1TQ4A 1AQYA 3C41J 3EW9A 4E5UA 4MGYR 2OAQ1 3RWOA 2BKEA 1M6NA 2RGNC 3JZAA 1DS6A 4HSEA 2FA9A 4MKGA 5JFGA 3VKGA 2N46A 2FSIA 4LC1A 3RRMA 2QMUA 2HCJB 1P2TA 3A36A 3CR7A 3LLUA 3Q7QA 3QI2A 4YDHB 4YMTA 4M1MA 1CTQA 1NI3A 2CMKA 2R6GA 3M4YA 2NOAA 4UNPA 3SU8A 2IS6A 1NVWQ 1OW3B 3KUCA 3EAQA 2QP4A 4P3YA 2ZRHA 1T6NA 2ZJAA 2VSOA 3PG5A 1UDXA 2ORIA 4II7A 4KAXA 2OILA 3MFYA 4DJTA 5IK2D 4ZI3A 2ZR0A 3JVUA 1N6HA 2VPPA 3LWNA 1V5WA 3JVVA 4BECA 4V02A 5CB8A 2O8EA 2IYUA 4NP6A 4LBVA 5JSZA 4RKFA 2DFNA 4QNMA 2CE7A 5JJKA 1JPJA 4HLUC 2XB4A 2BVNA 5BN4A 1FP6A 4MRPA 3RAPR 4L5BA 5JRJA 3B9PA 5CIWA 1JALA 2AL7A 4I1OA 1TTTA 3MLEA 2E1RA 3A8TA 3AP2A 2VF8A 1GL7A 4MA4A 4AWXA 3CPJB 1IN4A 4UXHA 5E7IA 2CLCX 4GRAA 3KJIA 1ZRHA 2O52A 5KO2A 1VDZA 1NN3A 1VKJA 1XF9A 4QBGB 2PL3A 3O8BA 3NXSA 3TUJC 4ZDJA 3SOPA 1Z06A 2GEVA 3CH4B 2B92A 3FDIA 3QNUA 3LFUA 1QHXA 4UJ3A 3P32A 1UKZA 2B8WA 2AXPA 5FI0B 5FTMA 4AK9A 1Z0JA 2ZANA 1WXQA 4FWIB 1KI8A 3FFBA 4AYWA 2R8RA 3NEYA 3C8UA 2HF8A 1YZKA 4A6PA 4R71A 3LQRA 4EIWA 4AC9A 4HI0E 1UFQA 2C78A 1XTSA 3GFOA 2CNWD 4BFXA 1OIVA 3AKDA 4JIMA 2NZ8A 3SYNA 3GD7A 4LUCA 2KSQA 2XXAA 5K8UA 2FSGA 5G41A 1W7AA 1KNQA 2QI9C 1AZTA 2O8FA 5L3QB 2IBMA 1A82A 3WYAA 4GZMA 3AKEA 3BFXA 2JLYA 4DKXA 5DN6A 3W5IA 1P2SA 3CWZA 1W4AA 1W49A 3LV8A 1F2UA 1UPTA 5EXXA 1NSTA 3AKYA 2JIZD 4O0MA 1XWIA 1CIPA 1J90A 1P2UA 2GJ8A 3B1VA 3GLHE 5GJWC 1AS0A 2OBMA 3BB3A 2DB3A 1TF7A 4PR0A 2NZJA 1E2EA 2FFQA 3RC3A 1ESMA 2MSCB 2IYTA 4XIGS 4PQFA 1OFTA 2ZJYA 3F5FA 4HAYA 4IEIA 4Q03A 1U81A 2IL1A 1T5LA 5JCPA 1GL9B 3WNDA 4F7WA 1YJ5A 4B6EA 3K0AA 3TQCA 3BC1A 4HLQB 3SJAA 2ZU0C 2F9MA 1F5NA 1KDTA 2CLDX 2ONJA 1P9NA 3CF0A 1D2MA 3QG1A 2D2EA 3QEOA 1MOZA 4TLDA 4D0GA 4NL4H 4ZO4A 4A36A 3FHOA 4G5GA 1IXZA 4Q7MB 3NH6A 4EPVA 3D3QA 1QVRA 1ZD8A 2ZYUX 3ND9A 5IDVA 3K0CC 2CHVA 1W2HA 1ZMXA 3ASZA 1IN8A 2C95A 1E9AA 2JLWA 4BQSA 1VMAA 2OXCA 2J1LA 5KSOA 2W6ID 4Z54A 1J99A 2QSZA 2ZI3A 4WAUA 3UIEA 2YOFA 3TSOA 3H0KA 1KDOA 3ASYA 2WWFA 1DEKA 4Q66C 1UBGA 1JQJC 1UKVY 3LVQE 4JVLA 3ECCA 1IBRA 4K46A 4P4UA 1OB2A 5CK5A 1OYWA 4B2PA 2HT1A 4MRSA 4PC2A 2N1BA 3X1YA 2QE7D 3VNUA 2CJWA 4JJKA 1LS6A 2ERYA 3SJCA 1OH5A 4Q4HA 1SXJC 2CVFA 2VLIA 5DO9A 5IHPA 2ZRJA 1FQKA 4DT1B 4HUTA 4OQXA 3KQUA 5BYJA 5GADl 2ZRFA 3CZPA 1OKKA 2R6DA 2REXB 4EPRA 1ZM9A 2HLDA 5HPYB 5LD2C 1TQ2A 2PX0A 1M74A 3HP1A 3SBEA 1HUQA 3BRWD 4QBHA 3RS2A 5FR2A 2LCFA 4KO8A 1VYVA 2JJ1A 4DSOA 1E0SA 1JQLB 1N6PA 4CEJB 2Z4SA 3AF0A 2AK2A 2D7CA 1IY2A 2GHIA 4LRWA 4YMSA 4O3MA 1FP7A 3O8CA 1S8FA 3DM9B 4LV5B 1E4YA 2VBCA 3LQQA 4URUR 4ASUD 1IJEA 1N6LA 1NF3A 4IEEA 1EFTA 3B8HA 1XDBA 1KYIA 3U4QA 2DY1A 5GVRA 4U00A 4LV8B 4TYWA 3H2YA 4MQBA 3ZS8A 4I81A 2ATVA 4KJZA 3QPVA 2YWHA 4JVNA 3TE6A 1RRPA 3HDTA 4N0DA 4B44A 1RYFA 2E9SA 4ZKEA 1CULC 2NPIA 2RGAA 3PUXA 3RSLA 2W58A 2FEMA 4KODA 2LKCA 1GVNB 1XNJA 3K0EA 3K09C 3MRSA 1UEIA 1P7CA 3IHWA 5CYPA 2W00A 1WBBA 1W36C 1QG4A 4HB3A 2GWHA 2VF7A 4LHWA 2GJAA 3VR1A 3NBXX 3SEAA 5CDFA 1Z29A 3FMPB 1KO8A 1EFCA 4CDGA 3X1XA 4HZUA 1G7CA 1G41A 2ZPTX 3GJ7A 3DZ8A 4DLTA 2IX3A 1Q0UA 4EPYA 1BS1A 2O0KA 3ZZUA 4OYHA 1NIJA 3IPXA 1ZP6A 1IOZA 2IUSA 2ODNA 3QOFA 2CXXA 2QPOA 3E70C 3L2OB 1TX4B 3BS4A 1II8A 1E69A 1F2TB 2VSXA 1B23P 4TQAA 4GMXA 3DL0A 3CF2A 1XEXA 1GNPA 2QMHA 3OIWA 3RWMB 4ZKDA 2J0VA 4OHVA 3MWLA 1KDRA 1KAOA 3ZD7A 4B47A 3HWSA 2V54A 1SKQA 2NMVA 3Q85A 1ZU4A 1G8FA 2Q0HA 4PC6A 4L15A 5M04A 4GP6A 1G19A 2TMKA 4D81A 2ZE6A 3AGPA 2J0SA 1D9XA 3D31A 3V9PA 2AK3A 3LD9A 3K0CA 1Q12A 2EW1A 1X8KA 3VX4A 3IPYA 4A4DA 2ZM5A 4FCWA 3I8XA 4P4SB 1XTJA 2ZI7A 1YR7A 4OI2A 1FNMA 1KO5A 3K53A 3GMTA 1RC8A 1KNXA 2OAP1 1A1VA 2BBWA 2H57A 3A4NA 1I2MA 2FG5A 3KKMA 2PH1A 4GFDA 4ARZB 1XZPA 3T06B 1JJ7A 1PLLA 4I99A 5A0FA 3WNBA 4D0NA 4N3NA 4BE7B 4EKDA 4XWKA 4WZAE 3CM0A 1G17A 2QEQA 5LBIA 2CL7X 1E2JA 1HV8A 3GQBA 3SZRA 1JEDA 4BFWA 2XZPA 4TMZA 1HEIA 3TIFA 5C1BA 5AJYA 1C1YA 1DE0A 3GJ6A 4GZLA 4B3GA 3WNCA 3ZIAA 1U98A 2MSDB 4ESVA 2ONKA 2UKDA 1ZUNB 1SXJA 1Z47A 2MSEB 2ZJBA 3DMNA 3NWJA 3QIAA 2BCJQ 4IDPA 1HE8B 2DBYA 4A82A 1XFAA 3K0SA 3LH5A 4U5XA 2G3YA 2NPFA 3QKSA 1H65A 2BEKA 1P4SA 2CEAA 3LX8A 4FINA 3THXB 3RRYA 4C0BA 1KY2A 4MRRA 3TBKA 2ZRNA 3N2EA 3QBVA 1NLZA 1KJWA 4OHZA 3QEJA 2ANBA 4F38A 5A5GA 3IILA 1E2DA 3H1TA 1FQJA 1ZM7A 4V0NA 1CF4A 3BERA 4TL6A 3U7GA 1DOAA 3LXRA 2A5DA 4FCVA 5DN6D 4LJ5A 2YOGA 4R7ZA 2HDNB 1W2GA 2QTHA 1K8RA 5KDOA 2J7PA 1RJ9B 2IF0A 4A6XA 3ICQB 3H84A 2UVQA 4CEIA 2VL7A 4W9MC 1SVMA 4XSGA 3KKPA 2FGKA 1CXZA 1L7VC 1VIAA 1LB1B 2AHOA 4WA7A 3CO5A 1PV4A 3MSXA 4KHZA 4JVMA 3EPKA 1CJVC 3BE4A 4HAZA 4TLBA 4B73A 2JLXA 4V0MA 4JLVA 3CWQA 4TLAA 1SULA 5JJLA 1N0VC 1E2LA 4IFEA 4NE2A 5K8LA 1Z0AA 3GJ5A 5H1YA 3GLFE 4KITB 1QG2A 2AFIE 1BOFA 2BMFA 4YXWA 1Z07A 5JHGB 3P26A 2AX4A 3CONA 4XVQA 1UDWA 3K09A 3AF3A 1QRAA 4TLCA 2WWIA 5E95A 2J45A 5TXGA 1RFLA 4G5QA 3WBKA 5FUVA 2ZE8A 4QBFA 4C0SA 3GEEA 4TMTA 4Z8YA 4M22A 4C0HA 3B13B 3EZ7A 4TTPA 4AYTA 3ADCA 3KQHA 3PJRA 3VR3A 1AGPA 5FOSA 3OEHA 4CRWB 1TMKA 1VYUA 3K9NA 3ZQ6A 1NN0A 2WOOA 2IYXA 4LJ7A 3BORA 3EZ2A 3PEYA 2ZAOA 3EC2A 1E99A 2IA5A 2NO0A 2RMKA 3K8YA 1JPNA 3SS8A 4ZIRB 1NVUQ 3CIOA 3PUWA 4NCHA 4HAUA 1RYHA 3OE7D 1PLJA 5CITA 3CW2A 3WMFA 1J70A 2A5GA 2WZQA 5EP2A 1N0UA 3CX8A 1S0UA 3AVQA 4K8OA 1RKBA 5FOVA 4OJQA 4MRNA 1A7JA 1CP2A 3WY9A 3R7WB 3QF4A 4C0LA 4CZ2A 5J4HA 4Z8XA 1E1QD 4M8NE 2ZSEA 5AWFC 5FTLA 1T3SA 3X2SA 2FEOA 3IEUA 2EFDB 3NKVA 3E2IA 4BFVA 1AKYA 3B6EA 5FI1B 4DCNA 4KYIB 3RABA 4CEJA 1KI1A 2R6AA 4L9WA 5E4FA 4Q4AA 4UKDA 4A0GA 4E03A 1IN5A 3KTAB 2DWOA 3QUSA 4LBYA 3J81k 2VP4A 5EJEA 4L16A 5IRCD 5F9HA 4ESHA 3RC8A 1KMHA 2QAGB 2V7QD 2ZJZA 3ZZ0A 2ODEA 4JL5A 4DDVA 2EQBA 4NYMR 4QJ3A 4PO8A 4M0LA 4YMVA 2RGXA 4NYMQ 1TF5A 1OSNA 1XCPA 2XAUA 1G4AE 1Q21A 1VHTA 3EZ9A 1Y63A 4TYQA 1IAQA 4B6FA 3F0TA 3BAFA 2C2HA 1DVRA 1XMVA 4HATA 1BH2A 1JNYA 2A3RA 1EESA 3T34A 2WJIA 3WMGA 1II0A 1Z2AA 1XTQA 3QBTA 2O5VA 3F3YA 5EP1A 1E94E 1NNEA 4Q48A 1ODFA 1MKYA 4L9SA 3AUXA 4KSCA 3I5XA 4QM6A 2ZI5A 1YRBA 1Z0DA 4KVAA 5F98A 2GKSA 4TMXA 1G3QA 1QF9A 2OE2A 1N6NA 1NBMD 4RZ3A 2IUTA 1VCOA 3MGCA 4JVSB 5H70A 4QXAA 5LDDC 1R7RA 2ZAMA 3C7KA 3T1QA 4EPWA 5KPDA 3HYTA 4QM7A 2YWGA 3GLHA 4JSTA 1KGDA 1R10A 4TZ6A 4DB4A 1OFIA 1T5IA 1I4TD 5B57C 4M9SA 1F2TA 3EA5A 5EUMA 4QJ4A 1P9RA 4NCJA 1MT0A 1XZQA 2VA8A 1T8UA 1N6KA 5B2ZA 5TMPA 4KFSA 4XD7A 2REBA 3AVYA 2GF0A 2Z0MA 1G3IA 2ZU6A 3BWDD 1VCMA 5JMTA 1VHLA 1EFHA 1E2KA 1YR9A 1P61B 3IO5A 2Y8EA 2IXFA 1VPLA 4TZ0A 3OHMA 3HJNA 3I32A 4U02A 1Z28A 2B6HA 3OFNA 3G82C 3R9WA 4JLJA 4P4SA 1D9ZA 1G8PA 4U7DA 2ODWA 3EASA 2ZSDA 5IT5A 1TNDA 4F4JA 4TYNA 3JZMA 3EXAA 1WA5A 3CRMA 4BRUA 4Z1MA 5DGXA 1L4YA 2P6NA 4ARZA 1W0KA 2GRJA 4MGKR 3L0OA 2IYRA 2BBOA 2GF9A 2MMCA 2ZRAA 4MGZR 4QFMA 1TL7C 4D6PA 3VMFA 3TW8B 3FOZA 1Q1QA 1KAGA 4R2HA 5FL3A 2BMDA 2R2AA 5J40A 4PPFA 221PA 3OIVA 4C0AC 3KXLA 5DH9A 3PIRA 2D3WA 3QKTA 4RFVA 1SVOA 4PQYA 4RD4A 2DFLA 1W4RA 3GJXC 3ZIAD 4EFMA 1EFRD 2ORVA 2VEDA 2RGCA 1SXJD 2HYIC 1KTVA 4IHQA 5JRZA 2ZI4A 4BLSA 4EQ6A 5LPNA 1HURA 3PUYA 1H8EA 2OZEA 1XXHB 5FBWB 1LTQA 2CK3A 3C14C 2WAYA 4JBYA 2GXUA 2XTNA 2BCGY 3VKHA 3QKRA 2ZXUA 3I8SA 3ZVNA 3ZYCA 1AA9A 3CR8A 1QHIA 1E3MA 1MO4A 1DAEA 1VYTA 4V0OA 1G3MA 1NJFA 4WVFA 3VR2A 2Z43A 1AK2A 1RJ9A 2REOA 2DCUA 3TNFA 2V1UA 2ZE7A 2WWHA 3RSOA 2IYLD 4IXNA 5HZHA 2J46A 2CCKA 3DKPA 2IW3A 2WKPA 4C30A 5KNDA 3AF4A 4M21A 1EK0A 1ZJ6A 3E5HA 3KFXA 2WAXA 4YQFA 4B32A 2ZVPX 2OUKA 3LA6A 3U2QA 2OFWA 3OAAA 1SVWA 4JLNA 1KIMA 1CJKC 4DEYA 5JLJA 2GZHA 4OHYA 4FXPA 4URXR 2QL6A 2QP3A 2ZREA 2JLRA 4AI6A 1J8YF 4A9AA 1GG2A 4KCGA 4M4SA 3O8RA 3TAHA 3A37A 1FX0B 4KLNA 3CKLA 4PAQA 2BDTA 2AFHE 4F4CA 3ZLJA 4FCTA 2Q9AA 1CRPA 2XGJA 3BFKA 4KBFA 5EE0A 4YXWD 3T1VA 1A4RA 3TQFA 2H92A 1W36D 1G291 1R0YA 5CM8B 5CM9C 4LHVA 2OCYC 3IBYA 4TSFA 1MO3A 3THWB 1PZNA 4B2IA 3THYA 3RS0A 2YWEA 4IKEA 4ZDWA 3PV0A 2BKUA 2AKAB 4M9XA 3TKLA 2J0UB 1OFUX 2QY9A 3ZQJA 3I92A 4Q9HA 3OEHD 3K70B 3LO5A 3U61B 1BO6A 3MCAA 2XNSA 1KO7A 1II9A 4H1UA 1Z08A 1D6JA 2GBLC 4JS0A 1G16A 1E2IA 5TY0A 3WMEA 1G8YA 1Q1EA 1MABB 1T0HB 2A78A 1OV4A 2P6RA 3CF6R 4QNRA 2FFBA 4DSNA 2ZTSA 2BHRA 1ZW6A 4BFUA 4FMBB 3ICEA 1SZPA 3NH9A 4LGMA 4PHFA 1DELA 1NN5A 2NO1A 5SZHB 3R7WA 1NVVR 4A92A 2ZS7A 3VFDA 5BN5A 3BH0A 1X1RA 1NVVQ 4XTCS 3AUYA 3TGPA 4LX0A 1U90A 2QTFA 4OI4A 3UATA 2GJSA 1AIPA 2PCJA 3BB4A 4M1TA 4MUBA 3X1ZA 4BFTA 3H86A 2C03A 4LYFA 4LHYA 4PQRA 4QOSA 4A2WA 4F91B 4ZDKA 3AM1A 2IS2A 4MUAA 3ZZTA 5FOTA 2GAOA 4C0KA 3RS5A 4QGGA 1ZU5A 2WIAA 5FH9A 2WWXA 1BYIA 1DAFA 2HV8A 3H4MA 4L4UA 1E9DA 3GLIB 1NN1A 2FE4A 1PLKA 4M53A 1OLOA 4NHOA 1R8SA 4MYUA 4A1FA 1XB2A 4OQNA 2YJTD 2CL0X 1CU1A 3AVOA 4GP7A 4C4PA 1TADA 1TF2A 2ZRIA 3T61A 1OJLA 3LW7A 3T35A 1D2EA 1HQYE 1KSHA 1OHHA 3HR7A 4KV9A 4F93B 1KKMA 1P73A 1R0ZA 2QMOA 1Q3TA 2VHTA 3EIQA 1R5NA 4OHXA 3FVQA 2NO7A 4G5OA 1UEJA 4JBXA 4GBMA 2F9LA 1GDDA 4H9GA 5HCIA 1HYQA 4OQFA 3KZ1E 5FTKA 1P9WA 4N1AA 4TMVA 1IJFA 4S35A 2FOLA 5BW8A 1E0JA 4PTLA 4CT4B 2I1QA 3PUZA 3G5UA 3A1VA 3Q7PA 1S96A 1PJRA 4KU4A 2GETA 4M1KA 2ZETA 2FH5B 121PA 2P67A 1PUJA 1US8B 1LF5A 4PSVA 2QMEA 2VRWA 4ABYA 4PHTA 1KI4A 2F6RA 4B3FX 1G7RA 4L8GA 1YRAA 4Q00A 2DFKB 2ZUDA 2C8VA 3Q5EA 3AF2A 1GIAA 3GLGE 3NBYC 4DLXA 2B7BA 1E2GA 5KPJA 3A4MA 1E2QA 4A2PA 3DVLA 2BIFA 4C7OA 4HDCA 4XOIA 4NH0A 3TW4A 2JDIA 2ZVQX 4HUQB 4XD7D 1A2KC 5EE9A 3R9XA 1VTKA 4NZYA 1NLYA 2FN4A 5CJ2A 1VG8A 2PT5A 1SVLA 4MYTA 2JLZA 5AUOB 3KUDA 3NBZC 3GLFA 4BLRA 1JBKA 4JZKA 1O87A 3B78A 4TLEA 4TT3A 3EPHA 1BIFA 1GNRA 2V55B 4Q21A 2EU8A 3BBPA 2CLSA 3OFND 3FFAA 1R4AA 5KSZA 2IYWA 3WXMA 2WWGA 3UG7A 2VP5A 2RHDA 4Q47A 4TTQA 3PEWA 2DYKA 2N42A 1KKLA 5J4YA 4Z1MD 4RCZA 4I1SA 3L43A 2CE2X 5EXTA 4D26A 2D06A 3KXKA 4EFNA 2Q21A 1KI3A 1M2OB 4EAQA 1G5PA 2NG1A 2XJ9A 2Z5FA 1NMYA 2JLSA 3QQ5A 1NSFA 1G7SA 1PUIA 4C2TA 2GBLA 2V6IA 2EFEB 3ZS9A 3KB1A 1X8JA 4QRHA 1S4QA 2C04A 5KSPA 2G0TA 2LWIA 3FE2A 2YINC 1ZINA 2F1HA 2G77B 4RZXA 4DXAA 1NKSA 1S1CA 1RVDA 2PZGA 4A0HA 2Q3MA 3TK1A 1X1SA 1OB5A 1OFHA 5J5CA 2V6JA 4MDEA 2JASA 1MR3F 2MMGA 2VHQA 4RCYA 3EA0A 3OESA 1H8ED 3SNHA 2CK3D 2ZRKA 2HCBA 4O2RA 4ERNA 3W6NA 4DLRA 4HAWA 2ZYTX 3SFZA 4AYXA 1ONBA 5B30A 4QGFA 4IOJA 5EZ5A 1IQPA 1NJGA 2GNOA 3U3OA 4DCVA 2FMXA 4X8MA 2VSFA 3NTUA 1M7BA 3CPEA 1J8MF 1N5LA 3IKJA 2EWVA 1ZNWA 1N6RA 1NRJB 2QA5A 3PQCA 4DEXA 3MUFA 2B7CA 2QM8A 1DADA 2XB2A 1UKEA 2YYZA 2BMEA 5F9FA 3OAAD 1U8YA 1XD8A 5KOYA 5AJZA 2VYFA 1U0HC 4XWAA 3K0FB 5GJCA 1WMSA 2RH5A 1JJVA 3KDSE 2PJZA 4B71A 4WZ6A 3B2EA 2QBYB 4FMCB 4DHEA 5L3SB 1E2PA 2X2FA 2XTZA 4R2IA 4JLMA 5KTYA 1FMLA 4TQ9A 3A1TA 3U44B 2OG2A 2PLFA 4GT1A 3TR5A 3NEJA 3QXHA 2WOJA 3VHLB 1GKIA 2WIBA 4V0KA 3UXMA 3W6OA 3THWA 2W83A 4UNNA 2GA8A 1CJUC 3EZ6A 3PR1A 4TSFD 1Z83A 1GFIA 3KQKA 1GAJA 2QG6A 2J0UA 1KMQA 2ZRLA 4LHZA 3REFA 1TQDA 5D3MB 2A7QA 5F2EA 3EWAA 1Q44A 4KFRA 5AUNB 2QRZA 2ZI6A 4ITRC 4LV6A 1XPRA 1QDEA 4PHHA 4C3ZA 3EPJA 2OBNA 5JWRA 3KKQA 2PEZA 4UXIA 5AJWA 1TUEA 4XTRA 3RRZA 4O25A 4D0LB 5GVSA 2O8CB 4UQOA 3GLGB 3S1AB 2CHQA 2JAQA 5EE1A 2FWRA 3L8ZA 4DIDA 1RZ3A 1Z5ZA 4FMDB 2DHRA 4X8HA 3LBHA 2PLRA 2F1RA 2JA1A 4RFSB 1AGRA 3UWOA 1QVAA 3L0PA 5EP3A 5CLQA 2NGRA 3WHLA 2O0HA 2ZE5A 2H18A 1GOTA 2ZUCA 3U3KA 1ZBDA 1Z3IX 4URZR 4PHGA 2FFAA 2V9PA 4B76A 4NYIR 4P0TA 5DI9A 3KXIA 5DYIA 1NY5A 3I4LA 2O8BB 1VCNA 4AG5A 1E6CA 4LWZA 3VHXA 4A0RA 2VP6A 2JATA 2PCLA 4Y0AA 3W5JA 4KLZA 4US2R 2F55A 2J0QA 3CRQA 3BGWA 1IXSB 1YR6A 2ZS9A 1DO2A 4BGDA 5HTKA 5ELXA 4RVCA 3UMRA 4EJSB 1XMJA 2JJ8A 1OHHD 4G5SA 1XPOA 3LVRE 3A6PC 1U8ZA 3W3AA 4KYUA 4B3CA 4B3XA 3TUZC 1E0AA 5FPHA 5L3QA 3IGFA 3W9YA 1JI0A 5HE9A 2QENA 4OBEA 3VKWA 2IYZA 5EE5B 3ZVMA 1E2NA 4CVNA 2CBZA 2FZLA 1I2DA 2EVWX 1P62B 1US8A 3B1ZA 1KI9A 1XTIA 1M7HA 3BOSA 5AJXA 2QTVB 1KHTA 2G0NA 4PO1A 4R98A 1G1MA 4LDJA 2ASEA 2QM7A 4B75A 2F3TA 3AB3A 3FMIA 3A1UA 3MG9A 5HKKA 1ZM3A 5DIFA 3F8TA 4OQLA 2DWPA 4DLVA 2C9YA 4Y0VA 3RNLA 1SHZA 3I3SR 2FU5C 1X6VA 1F48A 1LF0A 3C5CA 3WBJA 4LZZA 2JDID 3W8RA 1AM4D 1TAGA 2AWOA 4TN1A 4HB4A 2NO9A 2O8DB 5C2JB 1YQTA 2IXGA 1OXTA 3MMPA 1KK3A 2G9NA 4B35A 3AVWA 2KJQA 4BLOA 4ZCIA 4V0LA 1EG7A 3U60B 3LY5A 3ZD6A 2VP0A 1ZIPA 4YMUA 3T15A 2FFHA 4KFUA 2HXYA 2IYQA 2QGNA 5FBQB 4LHXA 2H7VA 5CIQA 2C9CA 3Q9LA 1Z6YA 2AXNA 2RAPA 4LJAA 5LB4A 3QXJA 2WWYA 1GZSA 3QPUA 1N25A 4AKEA 1G5TA 1YZUA 4CIDA 2JJ2A 4GOXA 4OL0A 4DDUA 3RANA 3L0SA 1J2JA 2WJGA 5JWOA 1L4UA 3AVUA 1XU4A 2PEYA 1D2NA 1OYYA 3P4YA 5J4LA 3DHWC 3LNCA 1ZUIA 3O8DA 1JXMA 2XOKA 1COWA 2WSMA 4DT1A 4EJSC 2CCGA 4JLOA 2QUZA 2Q3HA 4MH0R 4B3BA 1XXHE 1UM8A 1XJCA 1D5CA 4PANA 4NONA 3AP3A 5AR1A 2IUUA 1OKKD 4LYAA 3TUIC 3SN6A 2HLDD 4BEBA 3DPUA 1G21E 3PITA 2WMOB 2WWWA 4DLSA 1M1YE 4BZPA 5TB5A 1FNNA 2JJ1D 2A5JA 5DISB 1G5RA 3C15C 3QVUA 1C9KA 3P1JA 1MH1A 1ELOA 3W90A 4P4TA 5A4JA 3CNNA 4OQMA 1EFUA 2WJHA 1Z8FA 4E07A 4LPSA 4I4LA 2HF9A 1T0JB 3SHFA 5JECA 1XTKA 1LW7A 3SBDA 1DTSA 1GRQA 1JR3E 4R9UC 2OCBA 1HT1E 3NDBB 3NIBA 4BLQA 3SE0A 3K0FA 1G64A 3U7EB 2XSZA 2GAAA 2PZFA 3QY0A 3UK6A 5J47A 1YR8A 4DLYA 4WXPA 1OT3A 2A2ZA 2FPLA 2PT7A 2RGDA 4PC3A 3EPLA 4HAVA 1MO6A 4LJ6A 3FMFA 4IDNA 4JT2A 3RHFA 3MWYW 5K8IA 1G6HA 3N2IA 2R6FA 1XEWY 3X1WA 3ZH9B 1NL3A 4IOMA 4OK3A 3K1JA 4FMCF 4A8JB 4C0JA 4Q1CA 4KVGA 2NQ2C 4G1UC 1VG0B 3DMDA 3LBIA 2OESA 2QU8A 4IJMA 2PMDA 5DYGA 3ZVRA 1U9IC 2NIPA 1FW6A 2GK7A 2G83A 2CDNA 3NHBA 2W2TA 4MYCA 2ZRBA 4DUGA 1XPUA 2BOVA 2YVUA 4RZ2A 2OEPA 2VIIA 1GRNA 1OF1A 4JLKA 2Z83A 4NCIA 1S3GA 1FUUA 5JS7A 2HUPA 1N2CE 4LJ8A 4PPGA 4UNSA 3L82B 2J59A 2JLQA 1DAMA 2O8FB 3N70A 1SHKA 2B8TA 1W4CA 1OXVA 3FKQA 2P5TB 5AJVB 1B0UA 4N0EA 3RLFA 2O8CA 1BMFA 4BFYA 3GLGA 4JYCA 2XJ4A 4GI7A 1CR0A 4NDZA 3O47A 3AQ4A 2KE5A 1GM5A 4Q1FA 4JL8A 3C16C 2IYVA 3UPUA 3CNOA 3PCRB 4RFSA 5KNCA 4LPKA 1CRQA 3QJYA 3EIEA 2YC2C 4CEHB 1JB1A 1U0LA 3GJ3A 2V8OA 3HYRA 5L8VA 1YKSA 3B9QA 4PPNA 4FMDF 3IDQA 4IVRA 1YZLA 1E96A 3KL4A 2VQSA 3T1OA 4DLWA 2GVDC 2CL6X 3EWSA 2H5EA 3RRNA 1E79A 3DDCA 1S9HA 4DSUA 2L0XA 3K0AB 1KSGA 4Q7KA 3AVPA 5FBVB 3WYGA 4Q4LA 3GLIE 2FPMA 4PSAA 4XH9B 1ZNXA 1NLFA 2QAGC 2O8BA 4GOJA 4CT5A 3VTKA 5E7JA 3WP0A 3FYHA 2X19A 1MRSA 1RE0A 2IEZA 5G3YA 2X2EA 2WM9B 4XJXA 2P65A 4IOKA 4PZYA 5FFMA 1SGWA 2B21A 3P4XA 1CKEA 3D8BA 5H68A 5SZIA 2HEIA 2KI5A 4EJSA 2NO6A 2EWWA 2EFCB 4PZZA 2ZYWX 3GFTA 4QBIA 3THXA 5SZKB 1CJMA 1TU4A 1A5TA 3GEIA 4UXJA 4GL2A 2CVHA 4Q7JB 4WOPA 5L3RA 2OO7A 3SR0A 1VG1A 3CRW1 4Q01A 3TSWA 2A5FA 2LKDA 2QGZA 2ZS8A 1KI2A 1ZNYA 3LLMA 4JBWA 4A8JC 4EPTA 1T3LA 1UBEA 4FWTA 2CJWB 2G6BA 4MRVA 2ZJ8A 2PJRA 4Q4HB 1JR6A 3NVAA 1M8PA 4HZIA 4GOKA 4PC1A 4G01B 4ON9A 3BB1A 2J7PD 2IK8A 4DIEA 3AVTA 3KJEA 4ILEA 2CCJA 1WB9A 2GJ9A 1W5TA 4W5JA 4HEJA 4IVQA 3TRFA 1V43A 4P31A 1G8GA 4DVGA 2IHYA 4Q9LA 5HKKD 4AKGA 4D82A 4D4JA 4I1VA 3P27A 2V1XA 3EX7C 2EYUA 4IDHA 5P21A 2P2LA 2RCNA 2YHSA 4HDQB 4HDOB 3ONWA 1Y3AA 2F7SA 4C0QC 2R6CA 3AF1A 2OV2A 1UF9A 3LAWA 2IWHA 4BRWA 4DSTA 2JCSA 3GEHA 5FOUA 5FTNA 4Q1BA 3QF7A 2O8DA 1WP9A 2I4IA 4W5WA 1E0KA 2WPDA 3HPRA 4JYBA 4JSYA 1EXMA 4QL3A 4E09A 3OIUA 1ETUA 4QJ5A 4WIAA 4Q02A 1DAHA 1HQCA 3RDPA 2IXEA 3AVVA 1U9IA 3EARA 3G0HA 3W3ZB 4D4MA 2BWJA 4CGZA 4CW7A 1DG1G 1AN0A 3TLXA 2F1IA 3FGNA 4MKHA 2QORA 2OLJA 2YV5A 3R8CA 1HY3A 2UZ3A 2BBSA 1RRCA 4PAOA 3MJHA 4ZIRA 2W6JA 1KOFA 3K9GA 4WBSA 2JJ2D 2QQ0A 4GNKA 1X3SA 3VU9B 3Q3JB 5AUPB 1JAHA 3ADKA 3I61A 4TYYA 1G3UA 2XOKD 3DEFA 1COWD 5LB2A 5TVKA 2ZJ2A 4HZUB 4BASA 2QN6A 1W1WA 4RD2A 4UNQA 4LYHA 3WYFA 1DAIA 3KQNA 3K9HA 2IEYA 4QC2A 1WCV1 3CRRA 4ACBA 1Q22A 2YWFA 4Q1AA 2IC5A 1NG9A 1VIYA 1N5JA 4BFSA 1II8B 1G8HA 1WE2A 3BH7A 2XTMA 4MITA 3TVDA 4KFTA 2J87A 3NBFA 1E9SA 2GZAA 4J0QA 3IQXA 1OXUA 3U5ZB 2QPAA 3KTAA 1XEXB 1ZUHA 3SYKA 2FSHA 1G4UR 5FUWA 4A0FA 3R8FA 2QAGA 2QZ4A 1LNZA 2EYQA 3U6KA 5DSZA 1EGAA 2ZSAA 3CLVA 4DLUA 3CB4A 2DFTA 1KI6B 2PX3A 3WRYC 3BD9A 3FWYA 3L0IB 4RD6A 5FTJA 3HPQA 4DZZA 4LJ9A 2W0SA 4D4KA 4PX9A 2QAJA 3BJIC 1ZCAA 3KJHA 1IN6A 1ZC4A 3I1FA 1YZTA 4Z51A 2XSZD 5BYKA 2IS1A 1N3BA 1MV5A 4LCBA 4NCKA 2ODBA 4NKRA 4BFZA 4PC7A 1I4LD 5JHHB 1WQ1R 2ZYVX 2R44A 1ZIOA 3QKUA 3EG5A 3U3JA 3U3RA 2ZEJA 2OM2A 4PAMA 1DARA 4A8JA 4BLPA 3GJ4A 3SDZA 3UANA 2KBEA 2HXSA 1LS1A 1FZQA 3QE0A 1RIFA 2OFOA 2NTYC 3UG6A 5BXQC 2FDCA 4LSGA 1SXJB 3GFPA 4OHWA 1FMJA 1WRBA 2GEUA 2RGEA 3B82A 4NTZA 4TL9A 5JEEA 3K70C 5E7MA 1XEFA 3QXXA 4JLAA 3THOA 3QKSB 4DUGD 4FD2A 3FPAA 3HU2A 2PBRA 1J7KA 721PA 1UADA 1Z0FA 2W2VA 4TTRA 5LD2B 2FF7A 3RVBA 3IBGA 2IHBA 1YZNA 3D7MA 4KBGA 1W4BA 1GILA 4FIDA 3MWJA 1SKYE 4OK6A 1P72A 5JZVA 3CNLA 4HYYA 3AVXA 6Q21A 1IONA 2QQEA 5KSYA 3KX2A 1P75A 1BMFD 2GEDA 3GJ8A 1BKDR 2D7DA 1HE1C 2QPTA 4Q4JB 4YLGA 1Z2CA 4S2EA 2RKOA 2AN9A 1ZM4A 3ZGXA 4WW0A 3T5DA 4CEIB 3V4FA 1EWRA 3M1IA 4QHYA 4CEHA 4GDFA 4WXRA 3C4JA 4O2LA 5EUQB 2WJVA 4GSYA 2OCAA 3K9LA 1T9HA 4NPHA 1R6BX 5BQ5A 5H8WA 1G9XA 2XNDA 4LI0A 4HB0A 3KQLA 3UWKA 2BC9A 5JEDA 1E79D 2ATXA 2ZIAA 2ZQ5A 3I72A 2A5YB 2RGGA 2XX3A 5TV2A 4QGHA 621PA 1GRRA 1MRNA 1NG1A 1W0KD 2DWQA 5DLQC 4LJ4A 1Q20A 2FX3A 2BBTA 2RGNA 3TSZA 2QSYA 4QHTA 2GCPA 1O3YA 2F1JA 1W36B 1YU9A 2H17A 4PO9A 1KO4A 2BJVA 2HJVA 1GSIA 3LXXA 3MD0A 4LY6A 4ZI2A 1AS3A 1TEVA 1ZYUA 1R5OA 3RS3A 3ZDQA 4YMWA 4HLDA 5D3QA 4EUNA 1TPZA 1XMSA 2WICA 3SHWA 3CRVA 4IDQA 3RS4A 3X1DA 4AY2A 1IXRC 3UMFA 5HZKA 1XXHA 3OZXA 5FOWA 5BN3A 2I3BA 3AKCA 1W5SA 3IQWA 5CK4A 2WMNB 1DBSA 3IEVA 1XD9A 4IXMA 4FI3C 2EFHB 3HU3A 2P5SA 4D4LA 4BEJA 5JWHA 3Q72A 2GXAA 1RRFA 1VCIA 1K5GA 4G3XA 3OE7A 4C9BA 1Z63A 5KNBA 1E9FA 3FTQA 5FUYA 4DDWA 4OJKA 1IM2A 1U2RA 2VP9A 5FPSA 3DM5A 2D2FA 3CPHA 4HB2A 2D62A 2O0JA 4LC0A 2XZLA 4LBZA 1RPZA 1XEWX 2IYSA 4HLUA 3BXZA 1E1QA 5J4VA 4DRZA 4P33A 3QF4B 4DDTA 3QG5A 5CYOA 5JI2E 1YE8A 4UJ5A 4LOAA 1NY6A 1VG9B 4GPTA 4X8LA 4AURA 1QHYA 4DBLC 1JR3A 2GZDA 2JGNA 4LBWA 1FTSA 3R9IA 4X8OA 5G3ZA 5JBQA 5CJPA 4Q4AB 1FX0A 3AV0B 4QGAA 1HT2E 1QHSA 3P20A 4US1R 5BWMA 3FMOB 5EP4A 2V7QA 2ZITA 3FKSA 2P0EA 4D2IA 1KMHB 4M9QA 4RZUA 5KUTA 1Z6XA 3C5HA 1OH6A 4TMWA 4JJZA 2C99A 2BMJA 5J4KA 2DPXA 1N0WA 2ERXA 4D80A 2WPDD 4DB2A 1YZQA 1QZXA 2BM0A 2D4HA 2F43B 4M1OA 4I1UA 4Q1DA 2ANCA 5FL7A 3U3MA 5DHAA 5DE3A 1W48A 2C98A 1KK1A 2ZR7A 3A58B 3LDAA 4QG7A 4Q1EA 1GTVA 2GJKA 4EDHA 1M7GA 1S3SA 3PEUA 1VECA 1XD2B 1ZCBA 1R5BA 5EZ6B 5F3WB 2GCNA 3IIJA 3U7HB 3GCGA 4JT4A 1MABA 3VU9A 3QVVA 1IY0A 2W6JD 2YC4C 2ZI9A 5FPTA 4B43A 3I73A 1X86B 2IF2A 4ZCLA 4BLTA 4DLZA 4E22A 1KZGB 1ZAKA 1FTNA 1NBMA 1SKYB 1XMIA 3AP1A 4JKIA 5KDDA 1DPFA 1U8AA 1W0JA 3B1YA 4IFBA 1K6MA 1XJQA 3NG1A 1H8HA 1IY1A 5CB6A 1F3OA 2X8AA 2WJJA 1FPMA 3AH8A 5FR1A 2WHXA 3LRPA 2K5UA 4RJLA 821PA 5G53C 3GLHB 4A2QA 2IS4A 2GCOB 2J41A 2A9KA 4TYPA 3QSYA 1XP8A 4TWZA 1KI7A 2GILA 2J7KA 5ANRB 1CEEA 4NU0A 3I62A 4AD8A 3OEEA 2ZR9A 2QROA 4YONB 1ZC3A 2PMKA 3VR4A 5DNYB 4TQUS 4RKEA 1KJYA 1RRGA 2AKYA 2YKGA 4NYIQ 2ZUBA 1UBCA 2X77A 3GLIA 3ZJYA 4KSBA 4CYMA 3EC1A 8OHMA 1KI6A 2G88A 4PZLA 3SC3A 1OXSC 2OLKA 2Z4RA 1LY1A 1U0JA 4B48A 2AWNA 1PVOA 4PPQA 5JI3E 4JLPA 3TMKA 2OBLA 2XITA 1CBUA 1GKUB 3HU1A 2F3RA 3T5GA 1LV7A 1Q1ZA 2JEOA 1G7TA 3BK7A 1OH8A 2Q9CA 4DCUA 2WVJA 2WTUA 3PUVA 1YVDA 3VX3A 5C4GB 4B2LA 1UAAA 4F92B 1KK2A 1N5IA 3OF5A 4MGIR 1W46A 3BFVA 3CH5A 2WSSA 5TARA 1L8QA 4PXAA 1ZNZA 5KYKA 4TL8A 4URWR 4IRUB 4QKQA 2PZEA 1OE0A 1WF3A 4FN5A 1P2VA 3TR0A 3TAUA 2FJUA 1EFRA 2ZRPA 4AKHA 5EQTA 4W5HA 4A15A 2ZROA 5C18A 2GESA 2ZRGA 2AR7A 1N6IA 4EPXA 4MKIA 5CLLA 1M34E 4BUJA 3UMSA 521PA 4LK2A 1E1RA 1ESNA 4NMMA 3LBNA 4EQ6B 3N5CA 3CUEF 3A1WA 3CBQA
chains in the Genus database with same CATH superfamily
2WNIA 4BZXA 3ORYA 3QKRB 4G6ZA 4O4IB 3L7DA 2OCPA 4Q4JA 1AVTA 3L40A 5I47A 4N01A 2W6CX 5AVEA 2EWMA 1A71A 5GJBA 2GK4A 4RBNA 5ALRA 3IAS6 1UMKA 4AZTA 3VPHA 4DR5B 3H17A 2YHAA 4HQFA 3ICVA 1JNXX 3MW8A 4RM3A 1A9XB 1BYUA 3FIUA 4JU9A 3PVSA 4X84A 5EJ9A 1XP5A 3FHLA 3H1AA 4K88A 1LFDB 1TC1A 1QGUA 1N34B 1RWOA 1W47A 2O8EB 1QH1A 4GEGA 1IEXA 4YT8A 1P3JA 4G65A 5DHFA 4MYHA 1ABEA 3EGWA 2GCIA 3AERB 2BHLA 3AFMA 4K81B 5DKKA 3BA1A 4MN7A 2LCIA 3OD1A 2XDAA 5KCZA 2C61A 2F43A 1XVTA 3BF7A 1GUAA 5D3MA 4GX0A 5FPPA 3TFWA 2NTEA 1UINA 2VOJA 4YJHA 1K57C 3OQJA 3JQDA 1K4FA 2XXAB 4P36A 2DR3A 4LYJA 2YS6A 2XCOA 3AYZB 4YAEA 4COKA 5AVQA 5IJAA 2F3UA 1XA1A 1ZVJA 3EQ8A 1XZCA 4XVUA 1AF4A 3SFVA 3BHNA 4GDMA 1RABA 5CRFA 1T1JA 3O26A 3S44A 4H1TA 3LCRA 5D6OA 1MC8A 3FZGA 4RPGA 5AUQA 3DVAA 1OMOA 2PSSA 3A4TA 4LDZA 5ICFA 1YI0A 4AL4A 4GMDA 1CR2A 3EHDA 1NMZA 4KQ1A 2J9OA 4I8DA 5C46F 5FWNA 4RVOA 2O9JA 1IVSA 1GARA 2GK6A 3MINA 4DMUB 3SF8B 1C8BA 1VOTA 3DLIA 4B9OA 3KPYA 2Y1EA 3R0JA 5T6BA 4LJLA 3AUKA 4OQHA 5JNSA 3ILHA 3X0DA 3F6PA 3A2KA 3RF6A 1UJ5A 3V4RA 4TKVA 1PR6A 1LVGA 3MJQA 2IT1A 5A4IS 5BSWA 1PK9A 4OBWA 4Y1RB 1I4EB 4ASUA 1ZOPA 5BR1A 3DZCA 4RHCA 3WLHA 2ZSKA 1P44A 4KJXA 3V00A 5ALMA 1XKTA 5JD4A 4MBFA 1ZIYA 2GLTA 3V3KA 3I28A 1TQ4A 5HWVA 1VB3A 2GO1A 1WD5A 3ZDCA 1YSPA 4MKGA 2HCJB 1TMGE 1K98A 3BWVA 4UUPA 3BL6A 5KQMA 3F5DA 1O9GA 1W1UA 1QZTA 2H10A 2DBZA 2WZZA 4O3FA 3C5EA 1NM5C 1FSYA 2AT1A 1JG3A 3SXPA 4CGYA 1WSBA 3LXMA 4GJ4A 1STOA 3BDIA 1U7UA 4X20A 4GPD1 5CHEA 3AF6A 5CIWA 1JALA 1GUFA 3DE7X 5CW2A 3U9LA 1P3DA 3HCEA 4U3TA 4QREA 1CUGA 3VZRA 2PL3A 5EOVA 2XB9A 1ZOLA 3IXDA 4UJ3A 4PZAA 1TKCA 1E3JA 2ZM6B 1WXQA 3HACA 4NE7A 2FX2A 2Z6AA 5LZ2A 5GM1A 2B4KA 2H9YA 4YCAA 4BO4A 2B3DA 3DC7A 4BBJA 4PNHA 2O8FA 1U2GC 2AI1A 2GD0A 5K9ZA 1DIOB 2PRJA 4D57A 3BFXA 3EXHA 3HSYA 4Z4EA 9ATCA 1CIVA 1E7RA 1W59A 1XRSB 3G8BA 4PICA 2NYRA 3EF0A 3QOWA 1D04A 3WNDA 4JJ8A 4XE5A 2VFAA 1K75A 2BEUA 2Q6OA 4B6EA 3SJAA 1OLXA 4EW1A 2PUJA 1D2MA 1LPMA 1I6WA 1TA4A 3WNVA 1GRCA 1K56A 4LXGA 1JIVA 1NZDA 1FNSA 2JLWA 4ZFNA 3GO4A 2IZ0A 2I4OA 5BN1A 3GGJA 3OLXA 4DVJA 2QUJA 1TCVA 5E7QA 4O59O 3LVQE 4B31A 1AOXA 4PKYG 3WJ2A 3T5TA 1UBTS 1NBEA 3VC2A 2P9GA 2FEXA 4E33A 1J56A 1TVEA 4AZSA 4K9NA 1ESCA 2H0TA 2VOEA 5JH7F 2WD7A 3RVNA 4Z1OA 1YGPA 4NJMA 4LV5B 5EAIA 3CZMA 4NOJA 1IJEA 1H94A 3ZV6A 4YRLA 3HA7A 4TYWA 4XB2A 4N0DA 2PRFA 3LY3A 2B4QA 1EAMA 3MR0A 2Q4RA 2EJBA 5ADVA 1PT5A 2ZIFA 1ZK4A 2NNLD 3I58A 3NHRA 2GJAA 5TBMA 2H1IA 2CZCA 3U13A 4Y7CA 2QZJA 3DZ8A 1KKUA 2O0KA 2QMZA 4DJJA 1CQIA 3KKLA 4PZDA 3GFQA 4WK4B 1JTGA 1BYWA 3NBLA 2YH2A 5I5LA 4FR2A 4Y6OA 4NK5A 1NW5A 4B2YA 4X41A 1QAOA 2XCLA 4OI2A 5IBRA 1HMYA 4JUDX 4N3NA 4G0PA 1LBHA 2XMDA 4NJEB 1HEIA 4HR7A 3K71B 3KC2A 4BJ6A 1QFJA 2DBYA 4U5QA 2F4VB 3T50A 4MRRA 5FLKA 1NLZA 1E20A 3OBIA 3ZGNA 1SHVA 2AOUA 1RU3A 4TL6A 3Q87B 2I9PA 1I30A 1MA3A 5CVDA 1XRPA 2KX7A 2JL1A 2DH6A 4FEYA 4KXNA 3PJGA 4XSGA 3RS8A 5MGBA 5HSQA 1R00A 3JYHA 1YFLA 4C3OB 3EPKA 4G1BA 2LD4A 4QUKA 2GZSA 3DTVA 1N0VC 1T13A 2HOQA 2J3QA 4GI1A 4QU5A 3K09A 4RLFA 4JP3A 2HJWA 3B13B 2VHYA 2XWBF 2W2LA 3ZQ6A 4MW0A 1M6WA 2N1MA 4EZEA 3B53X 2ZAOA 1Q2XA 5BUCA 1J1UA 3BDVA 2JHEA 1FP1D 2DETA 5F83A 1JSZA 3AVQA 4CUKA 3G0CA 1BH6A 5EECA 4F9GA 3IEUA 1V4NA 2CV2A 3SK0A 1KRHA 1JAXA 3UFBA 4KXYA 1K4KA 1ZGBA 3HUDA 1TU0A 2ZMVA 1NWZA 5CVCA 2H85A 2NW6A 4CQMA 3N6IA 2PM8A 1XTQA 1WHTB 4CV2A 3F3YA 3T38A 2HH9A 1P1JA 4GKAA 1V3TA 2CWWA 1U2ZA 2VGKA 1G3QA 1NBMD 2JIDA 2WK0A 1IKIA 5A3QA 5KPDA 2YWBA 3L41A 1YLTA 1IZ9A 4TZ6A 1XELA 2XQFA 2X8JA 5H9VA 3UH0A 3G0GA 2IP4A 3CXUA 3WQRA 4ZYZA 1ODSA 4EO9A 2AMYA 4FOSA 1YR9A 1E2KA 5B1DA 2UDPA 4F4HA 2PBLA 1XALA 4N5HX 5DEIA 3R9WA 3TPZA 4JLSA 3BHMA 1CUYA 2I2WA 4P53A 1BCRB 5DGXA 2IDZA 3DT9A 4XYGA 2Y2IA 3O83A 2Q7OE 4W1SA 1JL3A 3VU8A 1RR6A 1MEOA 3QV1A 4NBTA 3FPVA 1SVOA 3SE7A 3ZIAD 1QR6A 2VEDA 2RGCA 4IAOA 4OJTA 1X9GA 2P9CA 1RHKA 3C14C 2OPBA 3DQPA 1GPJA 1CUWA 1ZN9A 1VYTA 1RHRA 3MMZA 2V1UA 3NRBA 3I37X 2J46A 3EJ6A 4C30A 3RC1A 3C4VA 4HWSA 1JN0A 4B32A 1FCMA 4DDYA 4X1OA 2JLRA 3URKA 1CDZA 5I5GA 3UAGA 1QV9A 4FOLA 5EWMB 4NZMA 5HF5A 5IDWA 3MA0A 1ONNA 4FYXA 3LC2O 5CM8B 5BWNA 4TSFA 2MTBA 1MUUA 4LMBA 4WBNB 4UU1A 2AKAB 2GUGA 3ABZA 4EG0A 3BY9A 2GBLC 2PT9A 3VVBA 1JDBB 4XLTA 1MABB 1IFQA 1C7QA 2QF7A 4LXQA 4Z4HA 2Q1XA 2BHRA 5E6SB 4YCJA 1I0LA 3HN7A 1FJHA 3Q3HA 5A1TA 1OX6A 4FOOA 2VGLS 3P98A 4MUAA 1E61A 5KYXA 5JJ5A 3OCUA 3INTA 4AB1A 5FH9A 4XUCA 2GEJA 3C6QA 4WZAA 1QIMA 1R8SA 1M33A 3RVJA 2XR0A 1A04A 4QATA 2W3DA 4KNWA 4YMIA 1WXWA 5LN1A 1FTGA 1M1UA 4OHXA 2NO7A 5GINE 3CSUA 4Y9DA 4JOQA 2YRWA 4Y6RA 1K7FB 5IXSA 1L7QA 4M1KA 2C57A 2DTXA 1DZIA 2NU9A 4MV7A 4B3FX 3WGKA 3WV5A 3NORA 1YOVA 1CUBA 3DC2A 4JUIA 5K0CA 2O2JA 4YPOA 2BIFA 5F69A 4NZYA 1UFOA 4WMLA 1SVLA 3C8DA 1O87A 4TLEA 1JILA 4TT3A 4UEOA 3ZE9A 3F74A 3C48A 3BBPA 4XPIA 5BUQA 2HWYA 5TRTA 4BCBA 1W1IA 1E4DA 1LDEA 4B4VA 3C43A 3SH9A 3KXKA 5HDBB 5CB4F 4RIGA 2XTJA 5CA0F 3GN2A 3GOQA 3HI4A 4ZO8A 1PJQA 1KXJA 2AKEA 1YDEA 1T1AA 2XUIA 3OQBA 2PZGA 3BMNB 2GFQA 4JXVA 1PL8A 2VHQA 1H8ED 2O3JA 3SHVA 4ZAYA 2X1HA 2GNOA 3ETDA 1N2ZA 2DKOA 5MN6A 3VJLA 3CPEA 1P1CA 3COPA 2RI0A 2EF1A 1JLSA 5KOYA 3OZHA 4V1CI 2ZLYA 5I7EA 5GJCA 4RTRA 3KTDA 3WYBA 3MRXA 1ENPA 3T7AA 2ON6A 4TKMA 1RXYA 9LDBA 3WWXA 3AZPA 4NDAA 2WOJA 4PONA 3UXMA 5E9WA 4JJFA 2YUTA 3RIYA 4YUAA 2ZRLA 4Z4QA 3C98A 1T4DA 1Q44A 5AUNB 1LLUA 1KFKB 2CUZA 3MFQA 4KB5A 1CY0A 2Z9DA 1M2EA 3UPTA 3L04A 4HHEA 4DIDA 4W9RA 3VISA 3UWOA 4F2PA 3L0PA 2WDPA 4OA5A 2B5WA 5CLQA 1YLJA 2WU4A 1N9OA 4XARA 1QC5B 3PE3A 3NBUA 1EDOA 2GYYA 3PX3A 3U3XA 4KRYA 1NY5A 3TYXA 3GDWA 8ADHA 2VP6A 2OHVA 2JATA 3B3XA 4MJ3A 4FS8A 4XCQA 5JS6A 2FRDA 3UB6A 4TZKA 3N75A 4MAFA 2X01A 3DS8A 3PLRA 3ADPA 3A6PC 3GWZA 4B3XA 4IWYA 1C1XA 4H7IA 5I3ZA 3K3CA 2DQYA 4BB9A 4HMOA 1N2IA 1OUMA 1C0IA 3VGPA 2ZOSA 2HF7A 2QM7A 5LA6A 4JEHA 4F0JA 2V6FA 2H1SA 4OHCA 1YSCA 4ZK2A 1AB5A 4DLVA 3GVXA 4Z1WA 3RNLA 3A3YA 1V9CA 2H59A 1T4CB 2O8DB 1OXTA 4G9EA 3KP1A 4ZCIA 4BLOA 2QJTA 3VHQA 1X87A 2FHPA 1GZ6A 2QGNA 1YT4A 4LHXA 4PIPA 3GJTA 3Q9LA 4EOGA 4FZJA 4LJAA 1RGYA 4AQYB 2JJ2A 4FSHA 1JHMA 3EXG1 5E2BA 2PEYA 1EWZA 3ZNNA 2VJCA 5AHWA 4HXFB 2ZIEA 3WGOA 4G1CA 3WHIA 4GR9A 1L8XA 3PR2B 4DLSA 1M1YE 2A5JA 3HVJA 4PM7A 2QLTA 2WLTA 4KIUA 5CGSA 1LLDA 2BTEA 5B3JC 1NRJA 4P4TA 1Z8FA 2Z56A 4I4LA 3SBDA 1QK5A 3BPSA 1ZO8A 5KIAA 3E2KA 4QPJC 4NXEA 4KZ6A 3ZU2A 2FPLA 5HUJA 4HAVA 1YZVA 4R5HA 1G6HA 3D7NA 3M4JA 2O8VA 1H3EA 1THZA 4UAVA 4IJMA 2PMDA 1OREA 2QV7A 4DUGA 4RZ2A 2NQ8A 1GRNA 3KYJB 3BWYA 4NCIA 2DLNA 3IQHX 1EI5A 4BFYA 4IUDS 3P8ZA 4NDZA 5HX9A 4LY3A 2V1ZA 3D6HA 4Q1FA 5J58A 3JD2A 4L6IA 2V8OA 4IVRA 1YZLA 2C0PA 4JGIA 3OPVA 4F2DA 4N9QA 3H42B 1VLQA 4C6RA 3D0RA 4OUKX 1E1MA 3PAEA 1DO8A 2QTWB 4DIOA 4WD3A 1DRWA 1RE0A 3RUCA 1ZUNA 2PUCA 3OT1B 3EGXB 2Y05A 4PFJA 3ZGOA 2Z08A 1FUYB 1SKOA 5IMBA 5KB3A 2CJWB 3VDQA 1JR6A 3SSOA 4HZIA 2QTVA 9MHTA 3OFKA 1WB9A 1EK5A 4ZZ2A 3D4FA 1NW9B 3ORSA 5BW6B 2C3PA 4FX2A 2YXNA 3A25A 4TV9A 3T4KA 3WIBA 4KTTE 1V95A 3DTVD 1Y89A 4RF5A 3QF7A 4F4UA 1VHWA 4JYBA 1M0SA 1U2DA 3DCIA 2QYOA 1TD1A 4B80A 3OETA 2CFCA 1AN0A 3TLXA 1SU8A 4IHJF 2QORA 3MSCA 2JC7A 1LBQA 5E43A 3KEQA 3NI9A 1KOFA 2JKGA 3JPYA 1GSWA 1W93A 1NA5A 4GGOA 1W1WA 2XT9A 3TTXA 5FB3A 1T9BA 3K9HA 2IC5A 2H0YA 2XTMA 1OXUA 2H9IA 4QRDA 2WAOA 1L3BA 4MCAA 2FSHA 1CVLA 4LHSA 3IR5A 1QGED 3E3NA 2AR0A 3IWOA 3CLVA 5JAPA 4O4JA 1ZXXA 1T34A 4PSDA 2FSVC 2PGIA 5EZYB 4CM9D 5EM1A 4LJ9A 4AVYA 3Q82A 1YZTA 1LC0A 5DBEX 1MV5A 2V8CA 2Q0XA 2PVPA 4CF6A 3A0SA 2I2DA 5A05A 3OICA 2PV7A 2OM2A 4L5AA 2IZZA 3M6UA 1DXOA 4P08A 1LS1A 2QDXA 1V45E 3D6FA 2DERA 3C38A 1N2SA 3N7WA 3ZV5A 1J9GA 2NSHA 2JGDB 2QXUA 4X95A 3UJNA 2FWBA 1SKYE 1O97C 3KX2A 1R0KA 2RKOA 4FJ0A 3PUJA 4GDFA 3IF5A 4CEHA 1EJ6A 3PC3A 2X42A 4Z9QA 5BQ5A 1X9HA 1DFHA 1HDZA 1ZD2P 3FPFA 1DPGA 2FX3A 2G6TA 2QD2A 4JGGA 1UK8A 4C4TA 4W5NA 1YU9A 1KO4A 2VNIA 3NTVA 1ZYUA 3ZDQA 3K73O 2WKEA 5A5FA 5FOWA 3IQWA 1Q84A 4D4LA 3AGEA 1K5GA 1QDUA 2O23A 1XEWX 4HPWA 4JR2A 3BXZA 1E1QA 2C9MA 4DRZA 2HWUA 2D5LA 3PNBA 4GPTA 5T4FA 4AY3A 4I39A 2VPYA 1FLDA 1BZYA 5CVJA 3V67A 4OATA 1U3CA 3AINA 4OPYA 3PJFA 2PMBA 2B3TA 4TMWA 2HPBA 1L5QA 2WYVA 3RVKA 2BZ0A 1PFQA 2GCEA 1VL6A 4LGWA 3IHKA 4EDHA 2FUCA 2E2WA 3A9RA 5H59A 3GWGA 2GCNA 4WBXC 2DFPA 2KDKA 4CLHA 5F5YA 3M6LA 3EG9A 4QDTA 4KZ8A 3GRRA 2YICA 1WKVA 821PA 4MGHA 1FS6A 3TDKA 4KEAA 4YJDA 2QN7A 3MBOA 4E6EA 2Z9CA 3REQA 2AKYA 2ZUBA 5KI6A 1FRVA 3EC1A 4W5OA 5IZ4A 1BKYA 2Z4RA 4B48A 2OBLA 4JT9A 4IMRA 2F3RA 1LV7A 4JKTA 2CGEA 1KIAA 3VX3A 1AA6A 1KK2A 1TJ3A 4MGIR 4CNQA 1ORVA 2R8XA 4E2WA 3PYXA 2X9GA 3O95A 2OYSA 1NXSA 1GHTA 5HFOA 3UJ7A 5CLLA 3FXAA 1ST2A 3BWLA 5ADUS 1A0OA 3LUJA 2FPOA 3K6KA 3CUEF 1Z88A 3G1TA 4YJ2B 5ENVA 1XBTA 4FSXA 4Z7JA 1JU4A 4WGFA 4BN4A 1F17A 2A59A 2XEXA 3IT3A 5HF6A 4U2KA 3CF4A 1SUWA 4M1WA 2RL3A 4TT3D 2WTNA 2J3IA 1B43A 1EFVA 3ZV7A 1T2NA 4QUDA 1UZNA 6CHYA 3IXMA 1JAIA 3U7QB 3E3OA 3KKKA 3LUDA 4BLMA 3W4KA 5TQ2A 4WZBE 3HLKA 2XT6A 1KBZA 2PLNA 2JIRA 1ADCA 4JLUA 4CF7A 3ETHA 4ZAWA 2V8BA 1N6OA 1NF9A 1E59A 5DSXA 3ZOZA 1L8AA 3HCBA 3TRHA 5HBRA 2XB6A 1EVLA 3GT3A 3MWDB 3GCZA 1QHNA 3DQQA 3DV9A 3IVGA 4YWZA 2IYYA 4QHSA 5A04A 5LZ4A 4JI1B 2FZ4A 1CG6A 1S7CA 4Z0HO 2H0RA 2W8BA 1VLZA 3B38A 5HJEA 2NO4A 5AKEA 1RC0A 3ZKWA 1NBME 1JFRA 4HLCA 1KYYA 1DTWA 4J29A 4BX9A 2C3OA 3HQ4O 1AKQA 4CHTA 2FX5A 1GNLA 4YV1A 4I9HA 3MGGA 2VGJA 2X4DA 1T3HA 2SCUA 4D74A 4R8LA 3OQNA 3QLUA 3CWFA 4WLFA 3ZVLA 2NU7B 3N0XA 2WAFA 2H8KA 1X19A 5B58C 3KFVA 2Z8YA 4YDQA 3CKMA 4ZT5A 3CITA 4OKIA 5JS8A 1GSHA 3LOQA 3PSHA 3SI7A 2HV9A 3B7GA 4LY0A 3MAAC 2NT3A 3JZDA 2PG3A 3IWIA 1WDKA 3KR2A 2AW3A 1U0SY 2W1TA 2HRBA 3BCHA 1EX7A 3SIWA 1EUYA 3PGKA 3AI7A 4RD1A 4DRXA 3U4QB 3SJBA 1OX4B 2R9VA 5ESWA 4L76A 2NNWB 3QMMA 4DJDC 2Q3FA 2HHLA 1SO8A 1YL5A 3V80A 3RWOA 1C7IA 3JZAA 1DS6A 1U1IA 3C5WP 2XYVA 3O3MB 4AS3A 2N46A 3JAWA 3TWOA 3EVGA 3EDOA 3RRMA 3JATB 4XLLA 1P2TA 3R7FA 3UEOA 4L4RA 1UZAA 3PRYA 4NULA 3H1GA 3JARB 3IBJA 4QTXA 1MAHA 4GR4A 3AHGA 2W42A 3B89A 2JAUA 3JVDA 3EY4A 1FJXA 2LE0A 3BA6A 3UY6A 4X68A 3O86A 4ZJUA 4G0YA 4IBXA 3ZJ4A 2UYQA 4RPKA 4EGFA 2BVNA 1HFJA 4CM4B 4CL3A 1ZRSA 1J2EA 4I1OA 4OV6B 1TTTA 3A8TA 3EYWA 2O52A 4QQNA 1VDZA 2Y1KA 1AB6A 3OKFA 1CUJA 4ZEOA 1LSJA 4KXWA 5FI0B 4NBRA 3LQRA 1C8LA 1QLWA 2JJYA 2V96A 4LYGA 3M2TA 3SAJA 4MZXA 4JLFA 1G4HA 1STZA 1TM3E 5L3QB 1A82A 1ZWKA 2P08A 7YASA 1I94B 4EMSA 4KZ3A 1Z5UA 1WVIA 1TF7A 3EGDA 2MSCB 4HT3B 1OFTA 4IEIA 2IL1A 4F7WA 5MF6A 3HNRA 2UUCB 5EVIC 2V1BA 3K0AA 1CZKA 2CLDX 4NL4H 1CVRA 1G63A 1MQ8B 4KQWA 4CF5A 3O2NA 1GRVA 1RADA 4KPEC 2W6ID 1U6KA 1HYGA 1J99A 4ZO6A 4P7KA 3UIEA 4QXQA 3ELYA 4E12A 4KIFA 1AKRA 4URHA 4YGXB 2W98A 5THKA 9LDTA 3TRIA 2ZRFA 5J43A 2E18A 1JS1X 4CEJB 4TTVA 4C7JA 2WJZB 2HX1A 4REOA 4LRWA 1B2LA 4BQOA 3EULA 4AFNA 1V6SA 4I4IA 4RTKA 1RYFA 1H2ZA 4E70A 2E85A 4G4IA 4NECA 3K1AB 1U04A 2XUZA 5LJIA 5CYPA 1W79A 5FLYA 2VF7A 2GPNA 3NYQA 3G32A 1TZCA 2OHJA 3GROA 1RYNA 4B40A 2Q5JA 3EOBI 4IIJB 3EVCA 3L2OB 4XJVA 1YD7A 5J59A 2QMHA 1Y8AA 3HP7A 3CZCA 4BIIA 1ODVA 1U9YA 2J0SA 3OHSX 3GIWA 1QO9A 2NXWA 3UGJA 1KO5A 3K53A 4UU8A 4ZRRA 4GFDA 2PH1A 3H8WA 2DSTA 1B8PA 2ZC3B 2QEQA 1ZN8A 3HC7A 3K0KA 3H5VA 3SQMA 1QBGA 2EFXA 4YS6A 1XVAA 1A9OA 4JBFA 4UDNA 2NPFA 4JSRA 4UU0A 4FCFA 2Q45A 3IVRA 4YLEA 3UE3A 2QTHA 2D4AA 5E4YA 1H6DA 1RMTA 2SNIE 1PI5A 3RF7A 4MWZA 3RUAA 4AP9A 3BY8A 1BCSB 2ADMA 4I1YA 2CXQA 1Z0AA 3GJ5A 3HLTA 5K4HA 5JHGB 4P3PA 2AX4A 3CONA 4Y2PA 4FGSA 1KZ1A 4M6WA 1FYXA 4C0SA 1M6VA 2QU7A 3AIMA 3ADCA 2Q8PA 1U0NA 2ZYIA 4FHEA 4LF4B 4HGYA 3KV3O 4FQ7A 4ZJZA 4UBJA 4NCHA 2FEWB 1CC1S 5INTA 4K8OA 1C3OB 5B3AA 1E1QD 4M8NE 1SBZA 4HDMA 1EUCA 1VPDA 3MJSA 2R6AA 4L9WA 4M3NA 4LZLA 4G4SP 3JALB 4LBYA 3T3GA 5EJEA 3ILXA 2WHQA 5IRCD 1TVCA 5D3OA 4DDVA 1ZH4A 5DV9A 3PI7A 1YV9A 3EZ9A 2GH1A 3F0TA 3NOXA 1SQFA 5HAPA 2IIPA 2O57A 3FVRA 4GC9A 2F62A 5EP1A 5L4LA 4QM6A 5F98A 4W99A 1JBEA 1L5VA 1SKMA 3GCWA 2F9FA 1GPDG 2PIDA 3QEMB 3TLJA 1XZKA 2EDCA 2I76A 3LYUA 2MHCA 5EUMA 4QPCA 1Y9AA 1Y4OA 4PLFA 2Z3ZA 4HX2A 1C1DB 3AWDA 3A06A 4HEFA 3RKSA 2IBSA 4DUZB 2ODWA 5EPEA 1TEHA 4D99A 2MMCA 3GLRA 3VMFA 3AB7A 4EGJA 4G4GA 2HTFA 3OIVA 3CVYA 2FPSA 2DFLA 1SXJD 3NGLA 1ISFA 1K6XA 5A1JA 1XU9A 4EQ6A 4AX4A 2J3WA 4JDPA 1SC3A 3L7NA 4XM0A 1RXEA 1V8ZA 4ZVOA 2IODA 2ZG6A 4CDMA 1MO4A 3H1PA 3VR2A 3NECA 3N8LA 2REOA 3AY7A 3UHPA 2X8BA 2G25A 1WYBA 3HNOA 1HE3A 3BFJA 5EJGA 3OAAA 1PDOA 3LPCA 5CDUA 2XOXA 4DPMA 1COZA 4LKRA 3VI4B 2I0FA 3ELDA 3ZLJA 1X7ZA 4KE9A 1YQ9A 5IJZA 3V6MA 5TEWA 2YVAA 3DF9A 3LUHA 1DMRA 2C0CA 3H9EO 1QTNA 3THYA 3PV0A 2ZR8A 1POWA 2CHFA 2J0UB 1OFUX 1PG2A 5B4TA 2Z2KA 1KO7A 3FLMA 3G1UA 2GN9A 1NURA 1X1TA 2HDSA 1OV4A 1TYZA 4CLCA 1NVVR 4DV0B 3NHFA 3GT0A 3DFKA 1XZJA 4OLBA 4NXFA 3AUAA 2PYIA 2C03A 1GADO 4P3OA 2GLXA 2IS2A 2J5QA 4RESA 3RT9A 1K4YA 1HYEA 2PX2A 3RS5A 4RXMA 4IQ4A 3KB8A 4I9FA 4M53A 4V38A 3KYIB 4G8BA 1VEUA 1RWQA 3L7HA 3IP3A 3L1IA 4NCBA 4CCWA 1GDDA 4Q82A 4N1AA 3NVKI 3B7WA 2I1QA 2GETA 2GFIA 2JGLA 2F6RA 3I5MA 2DFKB 2ZUDA 4NFLA 4Q0MA 4OPMA 3E23A 3FCCA 3QELB 3V2IA 4PBRA 2R97A 4S12A 1VTKA 3SQOA 1Y81A 4EB3A 3LKBA 3GMDA 4MB2A 4BAUA 4EBBA 2IYWA 2VP5A 1JH9A 2OO3A 5IANA 3TW8A 2OQRA 4FQ5A 1M2OB 4U7GA 4U0TA 2NUAA 3IUPA 2GZ3A 1AC5A 1E7SA 1G2PA 2V6JA 5GY7A 3I04A 3OESA 4MUJA 4LCEA 2YWCA 4KQ6A 1O95D 3H4TA 4DLRA 4HAWA 3PFBA 3L8GA 3UK0A 1NJGA 2FMXA 3NAQA 3LFHA 1G8SA 4OP8A 4LZWA 2WABA 5LQKA 4N8EA 4BKQA 4HWRA 4FDVA 4JQSA 4KX3A 2PJZA 3E53A 4NZ9A 3HEMA 3U44B 3NEJA 4L5CA 1N8KA 2PH5A 1Z83A 2YXBA 2VGLM 1UQTA 4R54A 5ALZA 2XVXA 5G1OA 4BENA 3L92A 3RRZA 1SPXA 2X1LA 2NAFA 5AD1A 2BAGA 4W8HA 2F1RA 1AZWA 3H5LA 2WD9A 4IG4A 2O2SA 5BOHA 2PZMA 2H18A 5LBUA 1GNTA 2V9PA 3EW7A 1WV1A 4WHMA 1GA1A 5E2EA 4JF5A 1RAAA 4KPYA 1H1LA 4GOOD 2C5BA 1M6EX 2G4CA 3JPUA 1QFZA 3BGWA 4I4NA 3D6JA 1DLIA 5ERXA 4IJUA 3GMWA 4B3SB 2PS9A 1N9KA 2UYGA 4WNCA 4I19A 3P0FA 1MQSA 1IIRA 4L08A 5KVSA 2X0EA 4GPAA 3SLKA 1X2EA 1JB9A 1U31A 5DIFA 3QNWA 5HWSA 1N3IA 1LZLA 1TT7A 4RDHA 5J2UB 1SCJA 4L2IA 3V4PB 3W5HA 2YL2A 3NJAA 5L45A 1TQHA 5FEUA 3ORQA 3LSTA 1SD5A 1NX9A 3T15A 1U8CB 1BFDA 1Z4NA 2QUHA 3JAKA 5A06A 2XUQA 4GICA 3IOBA 4ER3A 5AM2A 3OPXA 4YMGA 5JWOA 2J9FB 4KE7A 1B4DA 1I5QA 1V4BA 4GRDA 1N0IA 4RM2A 4N1XA 4BEBA 1L7MA 5IFKA 5C1PA 4B9AA 3RC7A 4CCAA 4LRYA 3IAEA 3CW9A 1XROA 1R0CA 3INGA 3SHFA 4CCYA 4BNXA 4CU2A 2OR3A 3D7KA 2XV1A 3HJBA 3CLOA 1QP7A 2R3SA 3NKLA 3TQRA 5CFNA 1DFIA 2ZRQA 5F1KA 1ECGA 3ZVRA 4KPFC 2JCBA 4DRTA 4X24A 3PDJA 4A6EA 3OCYA 4UUQA 1EAYA 2Q9UA 1Y5LA 3L82B 1DQPA 4Y9TA 2ONZA 1OXVA 5KYNA 4CMGA 1B0UA 2N0SA 4F3TA 4GI7A 2WYHA 3GVPA 3L8MA 1OLUB 4R8KA 2P1ZA 4TGLA 2FUG6 1CRQA 3ZUGA 2Q4BA 3LOPA 2H5EA 3VOBA 2O48X 1XTBA 2L0XA 5TIIA 3L6DA 5GOZA 3BLMA 1H3QA 3GAZA 1ZNXA 4CT5A 3VTKA 1GGMA 5JNLA 3CNQS 5H68A 1XXMA 4KIJA 1AZLA 1YNOA 2G76A 4QBIA 1WPQA 5CDTA 3PQ4A 4OGLA 3DFUA 5EL0A 1UUFA 4Q6WA 2YJ5A 4R16A 3STHA 2IYPA 3H6HA 3QP4A 5KZMB 1KFBB 1ECLA 1E5XA 2GJ9A 2O7QA 3SC4A 5LQDA 3P9KA 4X7MA 3OTOB 3UB8A 2EYUA 3KE8A 4PNEA 2FQXA 3PHLA 5M3BA 2K2WA 4AY5A 3LAWA 4BRWA 3NYWA 2EERA 4RA9B 5FOUA 4ZCSA 4W5WA 4QL3A 1WB5A 1XDSA 3RDPA 2QTZA 1I6MA 2NZYA 3F3KA 3L5KA 3NI2A 4WBGA 1RRVA 1F5SA 3JQ6A 4EYOA 2BD0A 2DPGA 1RAFA 1FZTA 1FFGA 1B6TA 1ZCFA 1P7ZA 1FJGB 2ZJ2A 4GSKA 5CLFA 3SX2A 1Z25A 5KX5B 4HH0A 2IOYA 3QRWA 2IEYA 3BXEA 5EI5A 4GLFA 2YKFA 1Q22A 4CDNA 1VPVA 1IOWA 2J87A 4OKNA 2DU8A 3I9OA 1K9VF 5JAQA 2Y0BA 2D00A 1A5ZA 2OTCA 4Y9RA 3L0IB 3CRNA 1ND5A 4KQKA 5BYKA 4EQ1A 4DS3A 5ITSA 4WA8A 3AI2A 3I1YA 2WYOA 2OCIA 1R0SA 3GNLA 3GFPA 3BTVA 1IOUA 2FOXA 2E6UX 3HU2A 2O4UX 2WPNA 2ZZKA 1XP4A 2IHBA 2IPXA 1DP6A 3MWJA 3DEIA 3L9XA 1O8CA 3WK4A 3GJ8A 5A6SA 2OENG 3S8MA 3M1IA 4ZYVA 4S2MA 1DKNA 1G5IA 2IZ5A 1G9XA 4NK3A 2XNDA 5KWSA 1MXFA 2ZQ5A 4TOIA 2ZSJA 4ND2A 3GLKA 4QHTA 2D13A 4ZMSA 1D0IA 1PFVA 2H17A 4MS4B 2BJVA 4X6LA 2WW8A 3IEKA 1M8FA 5JTTA 1ZLYA 3CRVA 2GF2A 2OZKA 1XXHA 4KN5A 1NQWA 3L7YA 5LNK1 4BEJA 1B15A 3WL8A 1Z63A 3KSIA 2VP9A 5HKOA 3F1OB 4R3UC 4GQAA 5KWIA 5CYOA 4PQGA 2Y93A 4F96A 4X8LA 2GAFA 3D6NB 4AWBA 3NOVA 5G3ZA 1B8OA 3Q6MA 3HXKA 3D3OA 3CFYA 3MCVA 3SBOA 1NFFA 2R4UA 5CXXA 3PCTA 2P0EA 3L8EA 2K31A 3RBAA 4WEJA 1U7TA 4CUJA 2BGUA 3ZTWA 2BP7A 4LSMA 3RU2A 1VJDA 1SCUA 4L4XA 3IT1A 3MMHA 2GJKA 3HCDA 3Q3IA 1VECA 2A9JA 1V8BA 2J3KA 1XJ3A 6GPBA 1IY0A 2ZI9A 4BL3A 4DLZA 1IK4A 3KQTA 1N8TA 1V3QE 3COVA 2B18A 4CLCD 1W35A 4RJLA 4EERA 2Q5QA 1RHUA 2XMRA 4YJGB 3OEEA 5C5KA 3LT2A 4WESB 1ZC3A 5B1YA 4XW2A 4UMVA 1HLDA 2YKGA 4NYIQ 2GS9A 1YVEI 2PKEA 3I45A 4DIBA 4EUKA 1HSZA 1X8XA 1K89A 3IURA 1OBVA 4BNWA 2XK1A 1F0KA 1U6IA 5AKYA 2F1OA 4XA8A 1EFRA 4D5EA 4EHKA 1S8OA 3AQIA 4BUJA 1IULA 4NMMA 3ZXXA 3N5CA 4Q3OA 4G0NA 4ZCMA 4WDRA 1MH9A 2P2YA 3VFHA 3VJRA 1H93A 1T4GA 3VGJA 3ZWQA 3OJ0A 4HUQA 4AS2A 3ZVWA 4KYVA 1NV9A 3DKVA 4B3DA 3HKDB 1JECA 2IUFA 3HV0A 3AR9A 4BWFB 4M9ZA 5A91A 3OMXA 1WXHA 4QOHA 1UKYA 1J20A 1P2GA 1GPAA 5D5PA 4FDTA 1S8AA 3FN4A 5G0UA 4UM8B 4L3OA 3UFXB 2Y2HA 1C9DB 1OIXA 1JDVA 1MIOA 3P9XA 3GSGA 4E88A 4AZWA 1QDLB 2FJPA 1XG5A 5EE3A 2VTBA 2A30A 3P0IA 3VTZA 2C2BA 3BFPA 3IQFA 3ROFA 4NU6A 2WSYB 4KDFA 3GRPA 1KJIA 4ER0A 2OVFA 1ZRMA 3U6BA 1OZGA 4CCSA 3D6VA 2VH1A 5HS6A 4WUVA 4Y2SA 1EFLA 1FTWA 1UFVA 2M1ZA 4Y0UA 2YY7A 4LVUA 3NTRA 4UNIA 1QF6A 5JDIC 4D6XA 3E7WA 3V1TC 3UJDA 3LSYA 5FUBA 3B1XA 3K8QA 2ZBBA 2R1UA 3FWZA 5LWQA 3MBZA 1C2TA 1C29B 1S2LA 5KYYA 2D8AA 3T52A 3DFMA 1V16B 1FSSA 2V0UA 3CPTB 3VR6A 3ZCQA 3TSCA 3P52A 4OJMX 1UC8A 4GXNA 5LYJB 3R3HA 1RZVA 4QXMA 1YCHA 1SCWA 5EYPA 1NNI1 3RREA 4BQPA 4XGKA 1W0JD 5D84A 3VH2A 5C4MA 3Q3EA 1IN7A 4D9HA 3K94A 2IWRA 3DO6A 1EVYA 3S2GA 4DIMA 3B60A 3EVTA 3AEUB 4O4LB 3HUEA 2C42A 4KPUB 4X3OA 2E37A 2PXAA 5L9AA 1Z0IA 1EDBA 1SOWA 3QBJA 1E9BA 4Q5IA 3ZDFA 5HCNA 4J90A 2RCYA 4K08A 4F6LA 4FNMA 3QUBA 2P3OA 3BRSA 1VI6A 1IHUA 4MO9A 1TEXA 1MA0A 1IHPA 3GFFA 3OX4A 4HAXA 1Z7YA 1FLNA 4NCNA 4R6XA 2WC1A 2DT5A 5F4ZA 1SXJE 5B4VA 1WDTA 4I3AA 4ZQHA 1FB5A 1U3VA 3UA3A 3PFNA 2HDHA 4MKZA 4UUOA 6REQB 1E1RD 1D6MA 1EIWA 5HR5A 3VNVA 2CDCA 3RUHA 3MQ2A 2WT4A 1Q0PA 4CL8A 3G4PA 4R3JA 3USCS 4IBRA 2C2KA 2FQQA 2ZVJA 3H0CA 2D1FA 4DLLA 1YHNA 2Y0EA 3SX0A 1QFMA 4MA0A 3GR6A </