1P9RA

Crystal structure of vibrio cholerae putative ntpase epse
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
401
structure length
378
Chain Sequence
DFFSLAEEAPIIKLINAMLGEAIKEGASDIHIETFEKTLSIRFRVDGVLREVLAPSRKLSSLLVSRVKVMAKLDIAEKRVPQDGRISLAVDVRVSTMPSSHGERVVMRLLDKNATRLDLHSLGMTAHNHDNFRRLIKRPHGIILVTGPTGSGKSTTLYAGLQELNSSERNILTVEDPIEFDIDGIGQTQVNPRVDMTFARGLRAILRQDPDVVMVGEIRDLETAQIAVQASLTGHLVMSTLHTNTAVGAVTRLRDMGIEPFLISSSLLGVLAQRLVRTLCPDCKEPYEADKEQRKLFEPLILYRATGCPKCNHKGYRGRTGIHELLLVDDALQELIHSEAGEQAMEKHIRATTPSIRDDGLDKVRQGITSLEEVMRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the extracellular protein secretion NTPase EpsE of Vibrio cholerae
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Protein transport
molecule keywords General secretion pathway protein E
total genus 103
structure length 378
sequence length 401
ec nomenclature
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1p9rA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p9rA02
2R9VA 4K8OA 3E1SA 3KXIA 2ECKA 3ZVMA 5L3QB 3UIEA 1P2UA 2WJGA 2QMEA 3S1AA 4F4CA 2JLYA 2BCGY 2IYWA 4DIDA 2FPMA 2IWRA 3FFBA 2W6IA 5FBLB 1NKSA 4BWYA 3T1VA 1AQUA 1KNQA 1H65A 2REXB 3FE2A 5JJIA 2PJRA 1FMLA 4RZ2A 3ND9A 3OFND 4B43A 1WP9A 2BWJA 2OV2A 1HA3A 1E2NA 3KL4A 1AQYA 1MRSA 1EGAA 1JPNA 1L2TA 4URXR 1TUEA 1UM8A 521PA 2J7PD 1K8RA 3QKSB 2CJWA 1BH2A 1QHHA 3TRFA 1BO6A 1E2FA 3R9XA 2IC5A 1F2TB 3BB4A 3WY9A 3BJIC 3UG6A 4I1OA 1E1RD 3IIJA 4JT2A 3EZ6A 2ZANA 4BEBA 5FPKA 1S9HA 1VKJA 1JALA 2QU8A 3K0SA 1IN7A 5CLQA 3L8ZA 4I81A 1JR3D 4LV5B 4NYIR 4LHWA 4M21A 3NDBB 4NL4H 2YKGA 4R9UC 1DELA 1GZSA 2GXQA 3BD9A 3X2SA 1DAGA 2GK6A 3FMPB 1OXXK 1RRPA 4HLQB 4FINA 4H1VA 2JEOA 2B21A 1DARA 4BZXA 1N25A 3LWNA 4KBFA 5E95A 3GJ5A 4A8JC 3DPUA 3LO5A 3I73A 4OL0A 4DLTA 3CLVA 5JI2E 1J7KA 4IOKA 5EE5B 4FMDB 2VHTA 2JASA 2ZI7A 1KKLA 2ZUBA 4A8JB 4LC0A 4NP6A 3WYGA 6Q21A 2ZE7A 2QPOA 3R9IA 5CDFE 3CR8A 2DWPA 5P21A 1F60A 4DLZA 2VP4A 5FBRB 4WW0A 1W36B 2XSZA 2W2XA 3WNBA 5J4VA 3HU2A 2FSHA 2AXNA 4M0LA 3FKSD 4MYCA 1EFTA 3A8TA 4LBYA 2QBYB 3RNLA 1COWA 3X1DA 2FGKA 3GFPA 1ZM7A 2AFIE 1CR4A 2GJ8A 2JJ8A 2WM9B 5FOTA 4AI6A 4DEXA 3A37A 2VTKA 2QL6A 2WZQA 3QXXA 4RVCA 4U7DA 3AB3A 3AVOA 4LJ8A 4B2PA 1ELOA 3Q7QA 3AVPA 1E2GA 2VEDA 3OF5A 4BRWA 1NVWQ 1JB1A 1UEIA 1Q1EA 4GZMA 2PEZA 5D3MA 3UPUA 3BH0A 1VG0B 1GOTA 4JLOA 3CRMA 2NOAA 2H18A 4NYJR 5JFGA 5M04A 1CJVC 5HE8A 5CYOA 1JNYA 3S1AB 2C8VA 4JBYA 3TSZA 1HEIA 2D2FA 3PUXA 1GM5A 3P26A 4KXFB 2IT1A 2ZJAA 4OK6A 5CYPA 4RZ3A 5FPTA 1YZKA 2GWHA 2XNDD 2JLVA 2L0XA 2RGBA 1M34E 221PA 4AYTA 5TMPA 2QMUA 3WHLA 1W0JD 1WF3A 1XD8A 2GAOA 3E5HA 1R0WA 5K8UA 3WRXC 1JI0A 4YDHB 2WICA 2BDTA 4LC1A 5KUTA 1XXHA 4BECA 2GRJA 5EP2A 1W4CA 2XZLA 3TAHA 5DHAA 4URUR 3LBHA 3GPLA 5FOXA 4PQYA 4TMZA 5ANRB 3WHKA 5KHOC 3QKUA 3QKRA 3GLGE 3HJNA 1E4VA 2VP5A 2F1JA 2I1VB 3QKTA 3UMSA 1ZBDA 3I72A 3ZDQA 3ZLJA 2KB0A 4G5RA 1OXTA 2GJSA 4DDUA 4TLEA 4P4UA 4JBWA 2IYQA 4JIMA 3V4FA 5JLJA 2H16A 4IJMA 1N6OA 1JR6A 2QAGA 4JT4A 3N2EA 3THXA 2VP0A 3B8HA 4BASA 5KO2A 2NIPA 821PA 4JL8A 2NPIA 4GP6A 3H2YA 2O8CB 5TXGA 4JLBA 3B1VA 2X1VA 1UBCA 4AWXA 1JXMA 5JHHB 1WXQA 2P6NA 2BBWA 5CM8B 1V43A 4Q18A 2WMNB 4TYPA 2C9OA 4BFWA 2FF7A 4PQRA 4LJYA 2WWWA 4NCHA 3VX3A 4NH0A 4G5GA 1SXJA 3I8XA 4KCGA 4XVUA 1I4DD 3WP1B 3B2EA 1ZC3A 3QEOA 1VHLA 3AGPA 4LYFA 4D0NA 1F6BA 4YDSA 3QNUA 1NN1A 2FU5C 1MO5A 5J4LA 3B85A 3LBNA 3V00A 2V3CC 4CF7A 3GLFB 1DE0A 4ZCLA 2BCJQ 5AUOB 3B13B 2REOA 4EPRA 2QBYA 1Z2CA 5JZVA 2XJ4A 1GSIA 3OZXA 4KLZA 5E4FA 3ZQ6A 4LK2A 1CKEA 2RGGA 4JLAA 1LF5A 4PHFA 2QP4A 4W7SA 3MGCA 5FTLA 4LCBA 2DWQA 1VECA 5FL3A 1TQDA 2V9PA 5DGXA 3CX8A 2I1QA 2WKRA 3ZD6A 1XEWY 2ZR7A 2IXGA 1VYUA 3ZVLA 3IDQA 2IUSA 2ZS7A 3T1TA 4DLSA 4BFVA 2GESA 2J0VA 1SVSA 4Q4HA 4MKGA 3RDPA 3IIKA 1DO0A 3TW4A 1E9FA 3BRWD 4HSEA 1YKSA 3P4XA 2IS2A 3CRW1 1TX4B 1XTKA 4IW3B 1QBKC 5DI9A 2FWRA 1KTVA 1LTQA 1D9ZA 3U61B 1P73A 4DCUA 5EXTA 1GKUB 4D6PA 3L0SA 1AM4D 1GDDA 3VKGA 1GP2A 2GBLC 4TQAA 4MUAA 4DCNA 4JYCA 1G9XA 1JJ7A 2PCLA 1DG3A 2W6JA 1Z0DA 1AN0A 1QHYA 3ADDA 1JJVA 4EDHA 2ZRLA 3KJIA 4URYR 2WWFA 1S4QA 2ZYWX 1NMYA 3BXZA 3DEFA 3RWOA 5C4MA 1NI3A 2K5UA 4JVSB 5KPJA 721PA 5GVSA 4TL9A 1H8ED 1Z06A 2BIFA 3BC1A 3ZZTA 4PTLA 1DPFA 2CVFA 2AK2A 1W36C 3GLIA 3U3OA 3SJAA 4ERNA 4IDHA 3PEWA 4DB2A 3R7WB 2B7BA 3NWJA 3LW8A 4A2WA 3AVTA 2XTMA 2DBYA 4LPKA 3BOSA 3THYA 2AL7A 4JYBA 3GFTA 4KHZA 1XBTA 2O8EA 3DDCA 4DZZA 1IHUA 4Q48A 5IDVA 4TQ9A 1CEEA 1DEKA 3W6NA 1ZM4A 4LGMA 5EE0A 4DHEA 5CM9C 4C0BA 4YMTA 1A4RA 1RRFA 1QVRA 4KU4A 4MITA 4B3DA 3FOZA 1RZ3A 4EJSA 2LKCA 1U0LA 5KDLA 1Q12A 1OKKA 1KO5A 4US2R 5H1YA 4TYYA 4L4UA 2JLXA 3HR7A 3T61A 2H17A 3Q8XB 4LV8B 1KI6B 3OIVA 4M2LA 1TAGA 2RGNC 2WIBA 5AJXA 3ZJYA 2CE2X 3SOPA 1GL6A 1Q1QA 3NG1A 2D7DA 2ZI9A 1FL9A 1GNRA 3QG5A 5FFMA 3W9YA 3MWYW 1OHHA 1VG1A 3UXMA 5DIFA 3MCAA 3I8SA 4D4MA 3TVDA 3KKNA 1DTSA 5GJWC 3AF0A 4MGZR 1C4OA 3QXHA 3K9LA 2Q0HA 5K8TA 4Q19A 3ZD7A 1COWD 1FFHA 5SZKB 1F2TA 3QBTA 2V6IA 4RCYA 1LNZA 3FPAA 1E0SA 4BLRA 2BMJA 1XRJA 5EP1A 1C1YA 1P3JA 2J9RA 3FYHA 5JBQA 4JVMA 1J8YF 1VTKA 2IYZA 4MRPA 4QBIA 1I2MA 4Q4HB 3ZIAD 4CRWB 2QGNA 2JCSA 2WSSD 2UKDA 5IHPA 4Q00A 2HXSA 4M1SA 3PEVA 1G6OA 1KJWA 8OHMA 4Y0AA 1KSJA 2QA5A 4OQNA 4A6PA 1E2QA 3IEUA 5CJ2A 5JEDA 4Q4JA 2F43A 1XXHE 1E99A 2VYFA 3TVTA 3UK6A 2HJGA 2O8BB 2AFHE 2BVNA 4DLUA 4I1SA 1ONBA 1W49A 1UJ2A 1H8HD 1FX0B 4TMXA 3BH7A 3T34A 1E69A 2R6GA 1AIPA 3BWDD 1QG2A 5D3MB 1QRAA 2C98A 3MWJA 4YLGA 1HYQA 2YWGA 5KDDA 1ZNXA 4TYQA 4Q03A 1GFIA 1PV4A 4LI0A 4A0HA 1HV8A 1UBGA 4AG6A 2YVUA 3DL0A 1Y63A 4M1YA 3U3MA 5LD2C 3L0PA 1Q1ZA 2ZRIA 4HZUA 4MKHA 2HF8A 2WBLC 5EQTA 5C1BA 3RVBA 3EXAA 3K0CA 2DFNA 3CB4A 1QZXA 1UKYA 2V7QA 3EWAA 3KFXA 4OI1A 3REFA 1DAMA 4LJ5A 3U5ZB 4H9GA 2WTUA 1HT2E 5CB8A 2GHIA 2F9MA 1WDTA 3VR5A 4EUNA 3VFDA 2GEDA 1VCNA 2J1LA 4L5BA 1U9IC 4B34A 2H1LA 1J90A 3ZZUA 2QGZA 5DYIA 3I5YA 4PC7A 2E9SA 1JXOA 1AZTA 2W6ID 2ONJA 5CLLA 1P75A 2YWHA 4QNRA 3K09A 3OFNA 3R8FA 2AD5A 4GI7A 5E7MA 1KSHA 3FDIA 2KWIA 4YC7A 3GJ0A 1D9XA 3FMOB 4HAZA 4TMWA 2FPKA 2C77A 1Z08A 1UAAA 3ZZ0A 1Z47A 4C7OA 2GVZC 3A1SA 2MSDB 2VLIA 3WYAA 1JR3A 3FWYA 3K9NA 4TQUS 3RC3A 4DSOA 4LOAA 2AKAB 3CIOA 4MKIA 5JSZA 4MYTA 2FDCA 2D74A 2YC2C 4FMCF 4US1R 3RS5A 3X1ZA 3GFOA 3ZS9A 5FPYA 3I3SR 1OXVA 1IM2A 2WOOA 3IBYA 3U44A 3PJRA 4HYYA 3C16C 1NG1A 4LPSA 3IPXA 4LBVA 3PG5A 1Z63A 3TQCA 3D31A 1E2IA 3RS3A 2IXFA 3NBXX 1ZRHA 2XTZA 4B35A 1AS2A 2W0MA 4PSVA 4RJLA 4Q4AA 2PH1A 3THXB 5JS7A 4BQSA 1G5RA 4M9SA 1V5WA 3GCGA 1N5LA 4Q1EA 3TAUA 1W5TA 2HT6A 2QENA 1ZW6A 3NIBA 3HU3A 4Q4JB 2VF8A 3R20A 1N2CE 2FEOA 4IEIA 4Z8XA 2W0SA 1CR1A 3C8UA 2RH5A 2HYIC 4NPHA 3VMFA 2IYUA 3QKSA 4TTQA 4OJKA 2H8KA 4O3MA 3KX2A 4ARZA 3L8YA 4CGZA 1M6NA 2GCPA 1E2DA 3T15A 1M2OB 2OCPA 5DISB 1Q1BA 1QHGA 3KQKA 4G5QA 4DIEA 1XEFA 2EW1A 1G8HA 3RS0A 3P27A 1JQLB 2FZLA 4PZYA 1FTSA 1DG1G 1WMSA 1XU4A 4E03A 3M1IA 1A1VA 1N6KA 1U0JA 1OKKD 4HB3A 1KJYA 4B2IA 3DO6A 1Z0KA 4PC1A 1L4YA 3ZS8A 2O8DB 1MT0A 4HZUB 2NGRA 4TLBA 1H8EA 1MO4A 4PANA 1MABB 1M8PA 1N6PA 1T4GA 1XD2A 1XWIA 4GFDA 1G8PA 3ICEA 5B58C 1PUIA 3IO5A 1F5NA 2OT3B 1MO3A 5FTNA 1VG9B 3SQWA 1R10A 3CR7A 5A4JA 4YONB 1W0JA 5LPNA 2EYQA 3U7GA 2JGNA 1D2NA 3IHWA 1P5ZB 2G6BA 4MRSA 3I5XA 1GNPA 3VKHA 2J0SA 2IF2A 2XX3A 3V4RA 2D62A 4Q1BA 4BEJA 1U8YA 2PL3A 2JJ2A 2RHDA 1FP6A 2ERXA 4M4SA 5J5CA 4D4JA 2F9LA 3KZ1E 4NYMQ 3UANA 1UKZA 2RHMA 4JZKA 1RW4A 4HUQB 2IBMA 2QSZA 1E9EA 3EPJA 1KAOA 3LFUA 2C95A 5DHFA 1P9NA 3EIHA 1JAHA 4BZPA 4KAXA 4DLXA 4XD7D 4PR0A 1MH1A 5KSYA 5KSZA 2FFBA 3M0EA 3DZDA 3OESA 5EE3A 4A6XA 3KXLA 2O8EB 3ZGXA 4Q7MB 4DLWA 5BN5A 1U2RA 3U44B 2IW3A 3NBYC 5CIWA 1E2PA 4FXPA 3TE6A 4MRNA 2ZJYA 3I4LA 5AUPB 4LSGA 1S9DA 2PT5A 3CF0A 1X3SA 4IVQA 3SN6A 4AD8A 2IUTA 4AURA 1W2HA 4NHOA 4IRUB 3NKVA 4XSGA 3CNNA 3KJGA 1KSFX 4RZXA 3PENA 2QTVB 3GJ7A 2H57A 1SULA 2W00A 2LKDA 5BYKA 2GF9A 1KK2A 4YMUA 4FCTA 1SKQA 1YZLA 2A5YB 2O5VA 3DVLA 3X1YA 2R6CA 2FSIA 4MYHA 4O2LA 1NNEA 4B71A 2X8AA 4OK3A 3QKRB 4M9QA 2ONKA 4DCSA 1ZM9A 4PSAA 4QBHA 4NYMR 4CZ2A 2FFQA 2BBOA 2GJKA 4B6EA 3QF7A 4DSTA 2VH5R 4D82A 3QVUA 3WMFA 2MMGA 1VMAA 2FV8A 5DSZA 1SVKA 1KSGA 3PCRB 4BLPA 4FIDA 1S2MA 3KXKA 4OI2A 4FI3C 4QGHA 4Q1FA 4KFUA 3NXSA 1OV4A 2P65A 4DB4A 2X2FA 4BZQA 5JRJA 2O8CA 4G5OA 4TTRA 3VNUA 1G5TA 4J0QA 2WWYA 3EC1A 4QGFA 2OAQ1 1G8YA 2VBCA 3TQFA 1BMFA 1VG8A 2DY1A 2FGJA 2LCFA 3OE7A 2FOLA 3R8CA 2ANBA 2ZAOA 2I4IA 3CRQA 3RRNA 4A0RA 2J0UB 5F9HA 3BB3A 1OJLA 1QG4A 4UNPA 1G7RA 1YZNA 3VHXA 3HDTA 3AVVA 2J87A 3UWOA 2CLDX 1R4AA 1DADA 1SXJE 2GAAA 2P3SA 1P6XA 2Z5FA 3GEHA 4RD2A 4E22A 3EX7C 4HB4A 2CL6X 2YOFA 2BC9A 4UNQA 1IJFA 1TPZA 1R6BX 3GLHB 3NHAA 1P2VA 5K8IA 2ZRHA 1E2HA 2VHUA 3ETLA 1NL3A 3IKJA 2JLZA 5LDDC 1NLFA 2V8OA 1E0AA 3OEED 2XNDA 2GDJA 4XWAA 2GCOB 5SZIA 2PBRA 3CH5A 3GLFE 1NJFA 3AKCA 2QAJA 3K70B 5FUYA 4WVFA 5FR1A 3WMEA 3MUFA 1T91A 5G3YA 3EA5A 2QPTA 4Q9HA 2IWHA 1KKMA 1OH7A 3LQQA 1Z07A 1UKEA 5G41A 3ZH9B 1CJTC 4QFMA 1N6HA 1EFRD 1VYTA 5C4GB 2P6RA 1JEDA 3GJ6A 4D80A 3R9WA 4K46A 4OI4A 4RD3A 1CULC 2P67A 4UQOA 121PA 3A1UA 3DM5A 1US8B 4CEHA 3NDPA 1VDZA 1G7CA 2KJQA 3RANA 1IY1A 3A36A 4HAVA 4NCNA 1NLZA 2J0QA 4LJ9A 3FFAA 3ZIAA 3A1WA 1N3BA 3DMDA 3KUCA 3AKDA 4WIAA 2JIZD 2GNOA 1S0UA 2FJUA 1NIJA 1NLYA 1VIYA 1RKBA 1XF9A 4JLKA 4KODA 4DBLC 4JLMA 4CVNA 1M74A 2ODBA 3SHWA 4AK9A 1NJGA 2Z6VA 2ZROA 2AXPA 2KBFA 4Q02A 1CLUA 1BIFA 1NMXA 5JRZA 5L3QA 3GP8A 2ZUDA 1S8FA 3VR6A 5EXPA 3OEEA 5IRCD 3IIMA 1IN5A 4GP7A 4HLUA 2ATXA 2VRWA 4MYUA 2YJTD 3CZQA 1NBMA 4KFRA 1G17A 2CXXA 2Q3MA 4YMVA 1IN6A 2EU8A 4EPVA 4UXIA 4YXWA 3D8BA 2QI9C 4GBMA 4TLAA 1S1MA 4HLUC 4BLSA 1IN4A 3K0AB 2VHQA 1DAHA 4ZPXA 4UNSA 1FQKA 3MLEA 3U6BA 3Q9LA 2NMVA 2FFAA 4JMPA 3HWSA 4C0QC 3SS8A 1HURA 1OYWA 4LYAA 3NC1C 2ZSDA 5KU1A 4L8GA 4B44A 3LX8A 3RRMA 4US0R 3CUEF 3PFIA 3IHLA 2ZRJA 2ZS9A 4KV9A 4QM7A 4JKIA 4D0LB 2VL7A 2EWWA 4ACAA 4OQMA 1GRQA 2F3TA 3HYTA 1UKVY 1XCGB 2FPLA 3WYFA 5C46F 2OAP1 1F2UB 3REGA 2PLFA 2EVWX 5AUQA 3JVVA 2ZU0C 1ZAKA 1RE0A 1OFHA 2XTNA 1S1CA 1NVUQ 3CF2A 2A30A 2G1KA 5GADl 1QF9A 3AF4A 5GVRA 4GL2A 3VU9B 2OM2A 3GEIA 3X1XA 4DT1A 3EZ9A 4WZAE 4EFLA 3QJYA 4D4KA 2QMHA 2RGXA 2D4HA 1YVDA 1VPLA 2ZRFA 4ITRC 3T35A 1ODFA 4LV6A 2VO1A 4NTZA 3CRVA 4A4DA 1XDBA 2NZ8A 1J2JA 2IYTA 2OBMA 2QPAA 1G3UA 1MO6A 1XZPA 1YR6A 2F55A 2CHGA 1KDOA 2CNWA 4V0ME 4QGGA 3ADKA 5DYGA 1FUUA 4B3CA 4A8JA 3A4NA 1SVMA 5JI3E 2OO7A 3QPWA 5BW8A 4HAWA 2ZXUA 3L43A 1KMQA 2BHRA 2ZRAA 1KDRA 3KKMA 2IEYA 5GJVC 3C14C 2W83A 4NKRA 2WWXA 3NEYA 1Z29A 4GSYA 1SKYB 2D3WA 2AWOA 4HLDA 3DHWC 2XAUA 2R62A 2EFDB 1J99A 4Z54A 1OT3A 4AKIA 1SZPA 2F1HA 1KYIA 4L9SA 2MSEB 1OB5A 3FHCB 4GT1A 1UBFA 4HATA 3QOFA 1UPTA 4PPQA 2H92A 3RS7A 4WXRA 3B9QA 4LZZA 4BLTA 4G01B 3THYB 1NP6A 3NVAA 1D6JA 4WBSA 3P20A 1S96A 5L8VA 5EZ5A 2HJVA 1AGRA 3DOFA 1FX0A 3W6PA 4Q66C 5L3VA 5BWMA 4ZIRB 3ASZA 2ZRKA 3EPLA 5DLQC 2ZETA 3EZ2A 3WBKA 3AP2A 4OK5A 3AF1A 3MG9A 2FA9A 2N1BA 1P60A 2BBTA 1R0ZA 1RJ9A 2ZPTX 1XCPA 2IXEA 2UZIR 1E2JA 3LVRE 4YXWD 1Q3HA 3MJHA 1VCOA 3BIFA 1NRJB 4PSKA 2J59A 3D6TB 4QNMA 3EPHA 2XB4A 1BKDR 1PLJA 5C2JB 1T5IA 3C5CA 3PEUA 3G5UA 3PXGA 3ZYCA 1W44A 2ZYTX 3TMKA 4TMTA 2ZJZA 3LAWA 5F98A 1DAKA 5TY0A 4XVRA 3OIWA 2GVDC 2GXSA 2ZE8A 4M1OA 4G3XA 3KFVA 4GNKA 4E07A 1XJCA 2YWEA 3PR1A 1G41A 1RYFA 3AQ4A 3RYTC 2HCJB 2WKQA 3KKQA 4KJZA 4LHXA 3U7HB 4XIGS 3KKPA 2XXAA 3AVXA 3G82C 4RD4A 1NSFA 4DUGD 3LRPA 1IQPA 2C78A 2RKOA 2WJIA 2ZJ8A 3B6EA 2RGNA 3CWQA 4RKFA 3HR8A 5EE9A 5DI3B 4OJQA 2BV3A 5EXSA 2XNSA 1S3SA 3HPQA 4R7ZA 5FL7A 4WZ6A 2YOHA 4JKYA 4KI0A 1OFTA 5EXXA 4A82A 5F3WB 1HQYE 3AUXA 3U6KA 1IBRA 1SVWA 5FBQB 3U2QA 1RC8A 1G6HA 4RD0A 4TLCA 1W0KA 2X77A 1YR8A 3O8BA 4NZYA 4MDEA 3SI7A 3JVUA 3BORA 5DE3A 3PEYA 1N6IA 1YZQA 3T1OA 4B32A 1RRGA 3BE4A 2IF0A 2DPXA 4DKXA 4IVRA 4QL3A 2CBZA 2FE4A 1YHNA 4MRVA 5A0FA 2GK7A 2QY9A 2OESA 1G1MA 2RGAA 4X8HA 1FP7A 5FR2A 3RSOA 4EFMA 5TARA 2PLRA 2ZI5A 3PUZA 2X19A 2XJ9A 1XMIA 3BFKA 1HTWA 4OQXA 1ESNA 5G3ZA 4HAYA 3QF4A 3FGNA 1CJUC 2P2LA 2WHXA 3GLHA 1KI4A 3LXRA 4B3GA 1KMHA 1WQ1R 1Z2AA 2ZJOA 4IEEA 1XB2A 3W34A 1Z6YA 2XSZD 3CF6R 4HDQB 3MMPA 5BN4A 2QQ0A 4JLJA 4MGKR 2KBEA 1OLOA 1UDXA 1ZD8A 5GJBA 3RRZA 4GPTA 1GNQA 2RMKA 2R6AA 4PPNA 2JIZA 2REBA 4CIDA 3QXCA 5HKKA 1G4AE 3ICQB 1NBME 1X86B 1LS6A 2ZE5A 1M7GA 3BBPA 4TL6A 3BH6A 4G0NA 3UATA 2IYLD 5AR1A 2OFXA 1NN0A 2X2EA 3A1TA 2HLDD 2JAQA 4KLNA 2VPPA 2PX3A 3SJZA 2ZYVX 4QM6A 4ZV4A 4HI0E 3TH5A 3K0CC 1Q3TA 2WWHA 4G1UC 4V0NA 2ZRNA 4A9AA 2ZSBA 3EIQA 2A78A 2Q9BA 1US8A 4FCWA 4PHTA 2WKPA 2YINC 2UVQA 3GLIB 2O8DA 3GMTA 4HB2A 1XPRA 1KK0A 2QRZA 5FOUA 1E2LA 1F48A 1FPMA 1TEXA 1TUIA 4BRUA 1IXSB 1XD2B 4DC9A 4Z1MD 4LBWA 3LD9A 4PHHA 1G3QA 2J7PA 3FB4A 1EFUA 5BXQC 1GUAA 2G0TA 5LB2A 4NYJQ 2QN6A 5CK5A 1Z0JA 4C9BA 1E4YA 1A82A 4TL7A 1OPXA 4EJSB 4I99A 2BJWA 2QORA 1II0A 4FN5A 2XITA 3T5DA 3H0KA 4YQFA 3OEHD 3TIFA 1YR7A 5E7IA 4W5JA 1ETUA 3U4QB 4HEJA 3E2IA 1N6NA 3SYNA 1BYUA 4BFSA 3GQBA 5F9FA 1DO2A 3F8TA 1TU4A 1T0JB 3P32A 1GL7A 3OAAD 3VAAA 4ZI2A 1T0HB 1LVGA 2IS6A 2VP2A 2NZJA 1A2BA 2A7QA 3MSXA 1C9KA 4C0HA 2Q21A 4N1AA 4XJXA 1KJZA 1X6VA 2GZDA 3L0IB 3PUVA 1OIWA 5TB5A 3SFVA 4QHSA 4PAQA 4P3YA 3SDZA 2PMDA 4KFSA 2BKUA 3KTAA 5K8LA 2BEKA 2OG2A 2ZJ2A 3U60B 1EXMA 1O87A 2QP9X 2IHBA 3RS2A 3B60A 1DBSA 3E70C 1Q44A 3K0AA 4BUJA 4FW9A 4UNNA 1K5GA 1IXRC 2MSCB 3K8YA 4MKFA 4U00A 4B3BA 3PUYA 4C2UA 2GTPA 5DO9A 2HLDA 1W48A 2QQEA 1E2MA 1K5DA 3A4LA 5D3QA 2ORIA 2EFHB 3M4YA 1VIAA 2OUKA 1JR3E 5J4YA 4XD7A 1M1YE 4NONA 3O47A 5FTJA 3AV0B 4Q7JB 2B92A 3OIYA 2ZRGA 1OE0A 3SJBA 4MDFA 2HDNB 4PQFA 5HCNA 4B6FA 1W7AA 2FFHA 3U7EB 2WPDD 3OIUA 5H8WA 2B8WA 4RFSA 3Q7PA 3GJ4A 2DB3A 4PC6A 2JJ2D 1GILA 3TUJC 3GLGA 3LY5A 4DT1B 2WJVA 4ZI3A 3QG1A 1ZNWA 2ZREA 4FMDF 4UJ3A 1ZC4A 3CO5A 4LX0A 1X8JA 1OXUA 1G20E 4M8NE 3IQXA 2QUZA 1U9IA 1VCIA 2C2HA 4C0JA 2QE7D 2VIIA 1SGWA 3LDAA 2R65A 1YE8A 1UBEA 1OH8A 4CEIA 4Q21A 4PHGA 5JCZA 2UZ3A 3AVUA 3MWKA 1PJRA 2CEAA 4F7WA 2FEMA 1T6NA 1P72A 3EARA 4A36A 3BK7A 3WMGA 1P9WA 1KHTA 2J5XA 2D7CA 2NTYC 2J3EA 5JEEA 2F1RA 2F1IA 3B7GA 4D26A 3SQXA 1QHSA 3NBFA 3H4MA 2NO7A 3U3RA 4EPTA 1B0UA 2OLKA 4RD6A 2QTFA 4MGYR 3EIEA 4GZLA 2FZ4A 3DM9B 5L3RA 1NBMD 4DUGA 4FWTA 3T06B 3O8CA 1G3MA 2ATVA 2OXRA 1R5BA 2D2EA 2ZIAA 3KKOA 4PO1A 2WAYA 3OE7D 1XJQA 2FSGA 4RCZA 1IXZA 1E9AA 2C03A 2BKEA 1X1SA 1QHHB 2WWGA 4Q9JA 4A2QA 4RY2A 1S3GA 3KB2A 5DNYB 1QDEA 3QXJA 2BMFA 1W0KD 1OIXA 2WJYA 2N46A 1SQ5A 2JJ1A 3Q85A 4RFVA 4OHZA 3TBKA 3RLFA 5ELXA 4Q4AB 4NDZA 3MD0A 1JPJA 3PITA 2DFKB 1CS4C 3HYRA 1GITA 1ZD1A 2ZTSA 3IQWA 2XOKD 2YZ2A 5IK2D 1NVVR 2CCGA 2QAGC 3SYLA 2V6JA 5A5GA 3K1JA 1G18A 2AN9A 1E9SA 4A1FA 1WBDA 5IF9A 1G3RA 3IPYA 1G19A 1EG7A 2XXAB 1KOFA 2ANCA 2NG1A 3X1WA 3KB1A 1LV7A 5AJVB 4GDFA 3K9HA 4M1MA 1Q22A 1GIAA 3N2IA 4TSFA 3ZQJA 1KO7A 1FUKA 3W3ZB 2C96A 1G16A 2F7SA 2ORVA 1AZSC 4QHTA 1TTTA 2QE7A 2ZYUX 4LJAA 2QRNA 4OQLA 4XSHA 5FI1B 1E79A 4M22A 5BQ5A 4CDGA 3I32A 1G3IA 2CLCX 3MWLA 3EPKA 3K0EA 2KE5A 1J70A 1CJKC 5FOSA 1UEJA 2QM7A 1KMHB 3RWMB 1A5TA 1AKYA 2BJVA 3QXSA 2DWOA 4PFSA 2B7CA 1EESA 1U8ZA 1T8UA 2F3RA 3ASYA 2ZRCA 3OEHA 4G5SA 4TMVA 4LY6A 1HQCA 1H8HA 1P4SA 3A6PC 1ZCAA 2VHJA 1G7SA 1CJMA 1W46A 1YU9A 2CE7A 4WXPA 1AJEA 2EFGA 1W4AA 3K70D 3FTQA 3K53A 1GG2A 1Q57A 4QRHA 1FZQA 4CYMA 1NF3A 2VSFA 3QVVA 3T5GA 1XEXA 2B8TA 2NO6A 4AIIA 2A2ZA 5KSPA 1QHNA 2HYDA 3WXMA 4JL5A 1ESMA 4BPBA 1B23P 2WSMA 4BFZA 2DCUA 4OHYA 2GCNA 2EFCB 4DEYA 1R8QA 1E1QA 2DFTA 2Q9CA 1KZGB 1ZD9A 4P31A 4JJKA 4PO9A 1I4LD 4ZKDA 1N6LA 1U94A 1W2GA 3AVYA 2ASEA 4PPFA 1CR0A 5F2EA 5LBIA 2HT1A 1XJ0A 2YWFA 4Q47A 3Q72A 4JVLA 4HB0A 3SJCA 1O3YA 4TSFD 4DJTA 3NEJA 1NN3A 4A0GA 1XPOA 4TTPA 2W58A 1Z5ZA 4IXNA 2QEQA 5EZ6B 2V7QD 1TEVA 2AD1A 3ADCA 1KI2A 2GILA 3QENA 4JBXA 2OBNA 2OBLA 3W5JA 2XOKA 4ASUD 5JS8A 2G83A 4C0SA 1P62B 2R2AA 4D2IA 5IK2A 2HF9A 3RABA 3KUDA 2V1XA 3CRRA 3BB1A 4NE2A 2GXUA 1G8FA 4II7A 3QSYA 2KI5A 3RC8A 3CX6A 2VP6A 3K9GA 3M6AA 1Z3IX 5FL7D 2IS4A 2WPDA 3CONA 2ZQ5A 1A2KC 1XTIA 5FH9A 2V4ZA 4DLYA 3C5HA 5B30A 4B48A 1YZTA 5KNCA 4Q01A 4C4PA 4FCVA 2BMEA 4EJSC 3TR0A 1VCMA 2IS1A 3GLHE 3PVSA 1EX7A 2GXAA 5HKKD 4OQFA 4QJ4A 4IHQA 5FTKA 621PA 1XPUA 2OSBA 1G4UR 3LV8A 4XTCS 1MKYA 3T1QA 2J41A 2RGDA 5E7JA 5SZHB 1E94E 4XWOA 1DS6A 4D25A 1CTQA 1U81A 2DHRA 3NC0C 2ZI6A 3MJRA 4DLVA 3TW8B 5JHGB 1WA5A 2OE2A 2A5JA 4ZDIA 2QP3A 2OXCA 1TMKA 1TF2A 5DN6D 4OBEA 1E0JA 1NSTA 1W1WA 2C99A 2VSOA 4B73A 3GLFA 1EFHA 4ESVA 1TQ4A 2CK3A 1XEWX 2ZRDA 4UKDA 4OHVA 4OYHA 3KJHA 2Q3FA 4W5WA 3SE0A 1ZJ6A 4URWR 4P0TA 4DXAA 2FN4A 1HE8B 2PZEA 1DAIA 5CIQA 2FSFA 2VQSA 3G0HA 5TVKA 4JSTA 4EIWA 3U7FB 5CDFA 2VSXA 1BMFD 5DI3A 3QI2A 4CEJB 1XZQA 4KSCA 1SHKA 1NN5A 1IAQA 2PEYA 4OHWA 1KAGA 1FQJA 3UKDA 1G5PA 3WP0A 4BFXA 3SC3A 3VNVA 4CT5A 3LA6A 2R44A 4A92A 1BS1A 4ASUA 4ABYA 3MRSA 1CIPA 1W4BA 1N0WA 3TSWA 3VR1A 2ZVQX 4E5UA 4PAOA 2CMKA 2OILA 1T9HA 4GOJA 3P4YA 2CCJA 2PZGA 3MFYA 4P4SA 3QIAA 1OF1A 1Z6XA 3W3AA 4EQ6B 4WZBE 4Z1MA 2QTHA 2VF7A 1EK0A 3UG7A 2JATA 4PXAA 4AY2A 4EPXA 3JZAA 1TNDA 2WJJA 1RVDA 2J7KA 4DWJA 2ZITA 1WE2A 1FOEB 2BMDA 1YRAA 4FMBB 3TR5A 3RS4A 5BYJA 2Z4SA 3QEJA 2OFWA 4BLOA 5LB4A 4D81A 5KDOA 5KNBA 1XTQA 1E79D 1E2KA 4TT3D 1ZNZA 4ILEA 1AA9A 2TMKA 2PMKA 1E32A 3SBEA 2Z43A 1MABA 1XXHB 1YZUA 4AKGA 3GEEA 1GAJA 2H7VA 2XZOA 4PAMA 3GLIE 2C04A 5CB6A 3LLUA 1ZM3A 2GEVA 5HZHA 4PO8A 2OEPA 3I62A 2WWIA 3SR0A 4F4IA 4D4LA 4U02A 4WA7A 3AEZA 4PC2A 4LHVA 3FHOA 2G9NA 1W47A 2E1RA 1BOFA 4DCVA 5HTKA 2F6RA 2YV5A 1CP2A 3O8RA 4Q1CA 4BLQA 3FHTA 2G3YA 1NKTA 2HEIA 1AK2A 1P2SA 2QMOA 5FTMA 2PZFA 3WNCA 1TU3A 2JLRA 3SEAA 4S35A 2H5EA 2J46A 2P5SA 5FUXA 3B82A 4B76A 4EPWA 2HXYA 1P61B 5L3SA 2C9CA 4TWZA 2XGJA 1W36D 2WIAA 1ZUIA 2JLWA 1L4UA 2ZI4A 1WRBA 1ZUHA 4LWZA 3ZVRA 3RAPR 4RSGA 2ZR0A 4BGDA 2JDID 4OI0A 1GKIA 3CPEA 1SVLA 3B78A 4TT3A 3PV0A 1XCMA 3QPVA 1KGDA 1ZINA 5JWOA 4IFBA 2ZRMA 2ORWA 2W2VA 1N6RA 1ZU5A 4H1UA 4Q9KA 3U4QA 1CBUA 4IXMA 1M7BA 3EZFA 2QAGB 4AYWA 3C41J 3CW2A 3QF4B 4LHZA 2NPFA 4A2PA 1DAEA 4JJZA 5E3HA 2JLUA 2A5GA 2IEZA 4KSBA 1U98A 1PZNA 1XFAA 3TKLA 1NY5A 1N0UA 3IILA 2G88A 3WBJA 4XWKA 2F43B 4DDTA 1SHZA 4U5XA 1GRNA 1ANKA 4LJ6A 2QNRA 4JLNA 2FMXA 4FD2A 4M9XA 1U90A 4K81B 1PUJA 3AGQA 3VKWA 4P4SB 4Z51A 2O8BA 1E9RA 2IYSA 2B6HA 2G0NA 1IN8A 4GOKA 5KYKA 5EUMA 1W4RA 4UXJA 1AS0A 1U0HC 2AHOA 5EP4A 1R7RA 1CR2A 3AUYA 3CNOA 1LY1A 1ZUNB 2IHYA 4AKEA 3P1JA 2BM0A 1P2TA 1R5NA 4BFTA 1T3LA 4MUBA 3TGPA 2NQ2C 2OCAA 3VU9A 2EYUA 1ZVQA 4LHYA 4I4LA 4QXAA 4GMXA 3SHFA 4KYIB 4A15A 1XTRA 2HV8A 1E98A 2ZUCA 3CBQA 3LNCA 4KVGA 4Q5IA 5J4HA 1KY2A 2GBLA 3U3JA 1RPZA 1OW3B 1JECA 3NTUA 3OHMA 4RKEA 1X8KA 2GA8A 1WCV1 3H86A 1KO8A 5KSOA 5FPHA 1NY6A 2GZHA 1HUQA 4M9ZA 3F0TA 4TZ0A 4QBFA 4TLDA 5AWFC 4EPYA 3I61A 4R2HA 2FH5B 3D3QA 2VHCA 4ZIRA 4UNRA 4LJ4A 3AP1A 2JLSA 3VTKA 3VR2A 1RJ9B 3NH9A 4TL8A 3GJ8A 1NG9A 1TF7A 1ZCBA 5KOYA 3EC2A 1FTNA 3ND8A 4XVQA 1PVOA 4HAXA 1P7CA 1TL7C 4F4JA 1Y3AA 3B9PA 3U3KA 3PQCA 2O0KA 4XOIA 1E2EA 2Q6TA 5EE1A 3R7WA 1IONA 2CL7X 3BFVA 5JSZB 4KO8A 2JA1A 2ZM5A 1FW6A 2ZU6A 3CM0A 1YRBA 2W6JD 3SYKA 4AYXA 3IUYA 3IEVA 1SVOA 1RFLA 2CHQA 1XMJA 3EASA 5UKDA 4IVPA 5J40A 1XMVA 4Z8YA 3OAAA 2RCNA 4LDJA 1Z22A 2D06A 2XB2A 2GZAA 1SKYE 3KJEA 1MR3F 4QHYA 2IUUA 4DDVA 1KI8A 3KDSE 2ZR9A 4L16A 3QQ5A 1XX6A 5KTYA 3CPHA 4POAA 1R5OA 4JLPA 2Z0MA 4PZLA 5TDHA 4ZCMA 4GMDA 4IDNA 4TMKA 3AVWA 2ERYA 4MH0R 1RYHA 3L82B 1E6CA 4ESHA 4F93B 5FUWA 1KDTA 4FWIB 3LBIA 4X8LA 2A5FA 2PCJA 3QUSA 1CU1A 4O0MA 3CPJB 2CCKA 2Y8EA 5AJWA 3AH8A 1N5KA 3IBGA 1XNJA 2EWVA 3Q3JB 4ARZB 2CNWD 3AKYA 3ECCA 3SZRA 1KI9A 4URZR 2ZE6A 4I1VA 4RD1A 2PT7A 1IOZA 2OHFA 4O25A 4KBGA 2BM1A 1IY2A 4NCKA 3VR4A 1LF0A 1F3OA 1KO1A 4LUCA 2YOGA 3W8RA 4AC9A 1OSNA 5JWRA 2R8RA 3GLGB 4LJ7A 1E1RA 1T8TA 2HCBA 3H84A 1Q20A 1TQ2A 2DYKA 4MQBA 3SBDA 5J47A 3EWSA 5CJPA 1T3SA 4V03A 2YNMA 4BE7B 1LB1B 2CLSA 2IYRA 3F5FA 4C3ZA 3A1VA 3HU1A 1CXZA 2P6UA 1GWNA 1E9CA 1G291 1UDWA 1ZU4A 1GVNB 2O8FB 2A3RA 3AVQA 1JQJC 4CEJA 5AJYA 3BGWA 5B64A 1FNMA 1E0KA 4R2IA 1F2UA 1GL9B 2CDNA 1OFIA 4HZIA 4D0GA 1EWRA 2NO9A 3HP1A 1II9A 1DOAA 1NVXQ 3BS4A 4BFYA 4B75A 1Z8FA 2G77B 3SNHA 3RHFA 1KI1A 1CF4A 2P5TB 1OH5A 4NBSA 4WOPA 4AG5A 3ZVNA 2WMOB 2DFLA 2WSSA 3HPRA 2VA8A 5HE9A 3DMNA 4P4TA 4HUQA 3CZPA 1D5CA 3B1XA 3D7MA 3B1YA 4EFNA 1KY3A 5JMTA 4OKSA 2FG5A 2Q3HA 4EQ6A 1OHHD 2CL0X 4NU0A 1YQTA 2ZJBA 1ZMXA 5FOWA 4OHXA 2ZVPX 5EJEA 2XEXA 2A9KA 5GJCA 4PX9A 3N70A 4B47A 4KITB 3NH6A 1TF5A 1XEXB 3LH5A 4NYIQ 1KDPA 2AKYA 4M1TA 3T12A 2YC4C 5HPYB 4PC3A 1XTSA 3WRYC 3W8NA 2GETA 3FKQA 4MGIR 1K6MA 1FMJA 3UMFA 4W9MC 2N42A 2ZSEA 1OH6A 3LQRA 1EFRA 1II8B 3N5CA 4PPGA 3DOEA 4L9WA 2OLJA 1D8TA 3WNDA 5L3SB 1QHXA 2RGEA 4QC2A 1NVVQ 5IT5A 3QE0A 3IO3A 3V9PA 5KNDA 2CVHA 3RSLA 2EFEB 3K70C 1G21E 2IL1A 1GRRA 1VYVA 4V02A 3ADBA 3C4JA 2OCYC 4R98A 2CJWB 3GJXC 1TQ6A 3FVQA 4QBGB 3AF2A 1QHIA 1XP8A 1Z0AA 1VHTA 2YHSA 4IDOA 4XH9B 2Z83A 4F38A 1TADA 1ZIPA 1SVIA 2I3BA 5FPSA 4C7OB 1YR9A 1YZGA 2V55B 1WBBA 4M1KA 4DDWA 2A5DA 2VP9A 3AF3A 5G53C 4F91B 3FKSA 1X8LA 3CX7A 4R71A 3W5IA 1Z6AA 2V1UA 1ZIOA 4IKEA 1NMZA 1A7JA 3TK1A 1Q0UA 1RIFA 4QKQA 1W5SA 4B2LA 1EFCA 1OB2A 2ZEJA 2QSYA 4NMMA 2ZRPA 3AP3A 1MRNA 5H70A 4IOJA 2ODEA 1JEEA 2AX4A 2J0UA 3TUIC 2PJZA 4Q1AA 2P0EA 4HDCA 3DZ8A 4M53A 4QJ5A 1J8MF 2WV9A 1QVAA 1CRPA 1Z0IA 3KQUA 1UFQA 5AK0A 1Z6TA 5JJLA 4JL6A 2O0HA 1UADA 1AKEA 3C7KA 4FMCB 2Z4RA 3VX4A 1HY3A 4EKDA 4RFSB 5C18A 4M1WA 4HAUA 1OFUX 5B2ZA 3GJ3A 3AKEA 1Q21A 4S2EA 2ZS8A 4GRAA 2RGCA 1E96A 3K0FA 4YMSA 4ZO4A 3UMRA 1E9DA 1R8SA 3LW7A 4Q4LA 5EUQB 4EAQA 4ZDKA 1Z0FA 4NCIA 4C0KA 1DAFA 2QT0A 1I2DA 5FOVA 2ZSAA 3BFXA 4RZUA 3VHLB 4CT4B 1JAIA 3B1WA 3TLXA 4LYJA 1U8AA 1G64A 1D2MA 2IYXA 1Z6GA 3AM1A 2JDIA 4QJ3A 5FUVA 3TNFA 1G7TA 3IGFA 1KZ7B 3O8DA 4LBZA 1P9RA 1N5JA 3EA0A 3F3YA 1L8QA 5DH9A 1E3MA 5FI0B 4B3XA 1IJEA 2WAXA 4BFUA 3W6OA 4CW7A 2PX0A 3THWA 2ZRBA 1HT1E 1ZM2A 4V0LA 5H68A 4AKHA 4KFTA 4W5HA 3I92A 4ACBA 1T5LA 4X8MA 3CH4B 1EWQA 3MAAC 1II8A 2XZPA 3Q5EA 1R0XA 1KIMA 1YJ5A 2AR7A 3FMIA 1Z28A 4P32A 3EW9A 4ZCIA 2RAPA 3PUWA 2QROA 4N0DA 5BN3A 2KSQA 4TYNA 4Q1DA 4QOSA 1EX6A 1I4TD 4JS0A 3LX5A 4IFEA 4DVGA 5B57C 1IY0A 1LW7A 5JECA 4TYWA 3BERA 4DSNA 2GKSA 4A0FA 4QG7A 1ZNYA 1PLLA 4Q9IA 3C15C 5CK4A 2G1JA 1BYIA 1WB9A 2NO0A 4Q7LA 3THOA 4DCTA 4TZ6A 5LD2B 2MMCA 2V54A 1KO4A 2CHVA 1GTVA 1PLKA 4C0AC 3CKLA 1AS3A 4V0MA 3EG5A 2BBSA 1KI6A 3J81k 1N0VC 4JLVA 3B5JA 4HLCA 3CWZA 1D2EA 3H1TA 1R0YA 2FX3A 2GEUA 3FMFA 2ZSFA 2ODWA 3Q5DA 2GJ9A 1XD9A 5HCIA 1G8GA 1LFDB 4MA4A 5AJZA 5EP3A 3DKPA 4LRWA 1FNNA 3LLMA 4IOLA 4ON9A 1XTJA 3EAQA 5DN6A 5HZKA 1KI3A 2BOVA 2ZI3A 1Z83A 4DRZA 2W2TA 1M7HA 2CK3D 2YYZA 3W90A 2R6DA 2WOJA 4B33A 5HR5A 1DVRA 2DR3A 4PZZA 3L0OA 4TN1A 2JJ1D 5J4KA 1MOZA 3K0FB 1U99A 3BAFA 5JWHA 2WVJA 4B3FX 4N0EA 4QGAA 4N3NA 5SZJA 3CNLA 4HUTA 2FNAA 3VR3A 1KNXA 4URVR 3QY0A 4ZDJA 2O0JA 2IYVA 3A4MA 3L2OB 1JBKA 4O2RA 2QG6A 2ZJ5A 2AWNA 3TJZA 1KI7A 2GJAA 2GF0A 4C2TA 2C9YA 3LXXA 5FBWB 2WJHA 2Q9AA 5G40A 3DKVA 2IYYA 1RRCA 2O8FA 3QPUA 1SXJB 3I1FA 2HUPA 2LWIA 1N5IA 2C5LA 2J45A 3A58B 4YMWA 3KTAB 3LVQE 2OFOA 2IX3A 2BEJA 4X8OA 3UWKA 2ZAMA 1NIPA 3PIRA 5JJKA 1SXJC 1E1QD 5AUNB 1XMSA 4P33A 1OYYA 5FBVB 3THWB 1L7VC 1X1RA 4JVNA 1R2QA 3QBVA 3ONWA 1T3HA 4UJ5A 4GOXA 3SU8A 4JSYA 4V0OA 2GCOA 4C30A 4Y0VA 3TUZC 3SFZA 4IDPA 4Q7KA 1OXSC 3VQTA 4WAUA 1CRQA 3GD7A 1KK1A 2R6FA 4UXHA 4I1UA 4B74A 1AGPA 3RRYA 5KPDA 3KQHA 2EQBA 1HE1C 1ZYUA 3B1ZA 1E9BA 4LYHA 3EZ7A 4NCJA 4JLDA 421PA 4V0KA 4HDOB 2NO1A 2QT1A 3KQNA 4DSUA 1LS1A 1UF9A 1ZP6A 2IK8A 4Q9LA 3JZMA 4E09A 4F92B 4ZDWA 2E87A 1KK3A 4MRRA 2RB4A 1MV5A 2IA5A 2O52A 4IOMA 2OZEA 3KQLA 4CEHB 4ZKEA 4XTRA 3TSOA 1HH4A 4KYUA 2QM8A 5TV2A 2ODNA 5JCPA 1SXJD 4KVAA 5CITA 2JLQA 4DLRA 4L15A 3NBZC 4CEIB 2QZ4A 4C0LA 4IDQA 3K09C 3NHBA 2OCBA 2AK3A 1OIVA 2SHKA 1GKYA
chains in the Genus database with same CATH superfamily
4HDRA 4MV0A 4N5DA 4O4JA 4NU6A 5AKGA 3N7TA 1BWQA 1T6XA 2PU7A 3H0EA 5KNCD 1NYMA 3OZIA 4F4CA 1GTMA 3FRIA 3RK0A 4ZAZA 2PZ8A 3BXHA 4BNDA 1ZC2A 5C5DA 3QHQA 1TVKB 1FDOA 1I10A 3NCHA 4I4CA 3FFBA 4U7PB 3WYBA 3KC2A 1NRIA 1H2RS 1PYDA 1QAMA 2RG7A 2W6IA 2Z8ZA 3PA8A 1AGYA 2O4UX 1MB2A 1UR5A 4WKPA 5FBLB 1KNQA 3GLTA 2PD4A 2REXB 5IM5A 4HVAA 3HKEB 5D3KA 4UHFA 3ITAA 1JHVA 3BQMB 1YCDA 1SQSA 4RZ2A 1J1ZA 3ND9A 3OCUA 3C5VA 3OFND 2PD8A 2NU8A 1WP9A 3VR4D 3AJ8A 3OPHA 4Y1FA 2DAPA 1D1PA 3DMHA 4G4IA 2I7VA 2MINB 2QYOA 1QU2A 1MRSA 1YRHA 1EGAA 1UM8A 4W6QA 1GCEA 4H7IA 4R5HA 2J7PD 4G8DA 2GPTA 1BH2A 1QHHA 2RL3A 2GX5A 1IVNA 1R9GA 1F2TB 1TM4E 6AT1A 2O7VA 3O9ZA 4I1OA 3DWZA 3OC2A 1IEVA 3IIJA 4CIXA 4AKSA 4O0LA 2GB4A 3W4KA 4MUJA 4TS1A 2FK8A 1PGOA 4WXMA 3ZXXA 5CA0F 3K0SA 3ET4A 3OQOA 2KM1A 4D8TA 2A1UA 4ZQCB 3T4XA 1OTAA 1QTIA 3O91A 4ZVNA 5K0EA 3ZQUA 3NDBB 3GI1A 4PPRA 4GDNA 3UTCA 1MENA 2HK7A 2HNKA 3BD9A 3A6EA 3LZDA 2J30A 1B14A 1OXXK 1MDFA 1RRPA 3WLRA 1OTYA 2JAHA 4H1VA 1PJCA 2JEOA 1FDIA 1WEKA 3CW8X 1HQDA 3LWNA 3IBFA 3WMWA 3P2JA 3LO5A 3DDZX 2PXXA 2OGZA 5TMEA 3SXJA 5CCEA 3L6EA 2ZPAA 2ZJ7A 3UE3A 3CLVA 1J7KA 1DIAA 1FFWA 1GA4A 4J7CA 3LRXA 3V5NA 4QZVA 2VHTA 2DXIA 2JASA 2ZI7A 2ZUBA 1M2JA 3SYRA 3PL1A 1G55A 4H17A 3WYGA 3FVWA 3G5TA 1G2QA 3E2KA 2QPOA 4FFRA 4ZYLA 4KQRA 1DTEA 1QMGA 4GHIA 3CR8A 2DWPA 4ZU3A 1YJXA 5P21A 3WGLA 1F60A 4K1XA 4BYMA 5EIBC 4UW9A 4OHCA 2B5VA 4ZVPA 2BR3A 3WNBA 3HU2A 4ZDXA 3E3OA 3ZWQA 4CQLB 4RKQA 5IDQA 2PL5A 2ZUFA 2AXNA 4ME4A 3VOLA 2J07A 1ZXLA 3PQEA 4JP5A 2H5SA 4MYCA 4X3OA 3SHQA 4QGBA 4DGSA 3FPKA 5GHYA 1LPSA 4EG8A 4JXVA 1VB6A 2FGKA 2GFIA 3OICA 4OEHA 5F5XA 1EP1B 3O8QA 1CR4A 4HKTA 4WZAB 2PA0A 4BKMA 2G67A 1XLUA 1Z6PA 2VTKA 3H18A 4OREX 4RVCA 4J2HA 3EEQA 3GO4A 3AB3A 3QE2A 5CEEA 1P29A 3T7JA 4BU1A 3RVLA 4M9CA 3L6OO 3Q7QA 1A9XA 3H04A 2N0SA 3OF5A 4V0QA 2WYXA 4JGQA 1KYVA 1PT5A 4ZYYA 1Q1EA 3SS5A 3IRVA 2VT7A 2YXPX 3JQPA 1QFMA 3UPDA 3VSBA 1QP7A 3IHTA 1PS9A 3SNKA 1EKXA 1WDLA 2Y2OA 5HKAA 2CV2A 2FLWA 1Z5WA 3CRMA 2YCBA 1C0KA 1DO8A 2H18A 3AWDA 2B5RA 1CJVC 3QRWA 3TRHA 4WK4B 1A9YA 1VBMA 1Q92A 4KFCA 1CCWA 5JSUA 2D2FA 2V59A 4XGRA 4G1FA 5AK4A 4QPPA 2ZZKA 3PGKA 2IT1A 3CO0S 3KPJA 1BD3A 5CYPA 2O54A 1NZFA 3L9WA 4JEMA 1L7NA 3JQGA 2RGBA 221PA 2RHBA 4XX0B 5FCDA 3SXPA 3ZCQA 4AYTA 1XD8A 2BGIA 5DU2A 1R0WA 5K8UA 2AMVA 3EMVA 4WERA 2WICA 2BDTA 1J9ZA 1XL0A 3V80A 4BB5A 1ES9A 1SK8A 3PRKE 1KAMA 3R5TA 4GYWA 3IOEA 4BECA 1QMFA 1W4CA 3ISVA 2CFCA 2XZLA 1U65A 1Q14A 4OQQA 1DP9A 5AJGA 4TZKA 5DXFA 3GNQA 2NM0A 1MXOA 4NPCA 4TMZA 1XOIA 4Z9QA 2OBMA 3PI7A 2HPAA 5ANRB 3JRWA 5HPIA 2OXEA 4FHZA 3QKRA 3WHKA 1DGQA 4ZAVA 3RJUA 1E3LA 3PD0A 1E4VA 3G7SA 3CKYA 2Y1FA 4LZJA 4RV9A 2F1JA 1VETB 4CCYB 1K6RA 1IFXA 4BQPA 1LBEA 2A24A 4BATA 3H8VA 3E9QA 5LA6F 1AUPA 5AM0A 4KQWA 4TLEA 4P4UA 4AZSA 4DSAA 5BWLA 4TV8B 1PQUA 5A5DA 1JR6A 4IIJB 2QPNA 1M40A 2VOJA 3CCBA 5K0TA 1RI3A 2QYSA 3B8HA 4UAAA 5KO2A 4F2WA 2BM8A 3E1KA 5D7BA 4LCMA 1X74A 2NPIA 1BZYA 2OP0A 2O8CB 2UWXA 1ULTA 1DKUA 5EUBA 4RO0A 5JHHB 4DSZA 3C5EA 2FZGA 1R0CA 4N5MA 1JMYA 3CLSD 1QV7A 4XFKA 2WZDA 2I67A 4DS3A 5E4YA 2Q5IA 5KYUB 3OEYA 1M2EA 5IZCA 4GDBA 1EE1A 4NCHA 2BFWA 3RYFA 4NH0A 4G5GA 3WYDA 4C43A 3BRWA 3I8XA 2OXFA 5IFKA 4KCGA 5ICCA 4TKZA 4JBGA 3B2EA 3PWKA 2H4XA 3S2EA 4IS3A 1Z39A 1VHLA 1BH6A 5HUHA 4GGMX 3MVEA 1AKRA 4YALA 3TLKA 1NN1A 3BMNB 1CX9B 3KCQA 4QAQA 2D5CA 2HSJA 4A6DA 3FZNA 4OU4A 3TW0A 3NR2A 3V00A 4QYIA 2V3CC 4ZCLA 1UDCA 2REOA 1YQ9A 1DFGA 2IGTA 2XJ4A 5IANA 3AQIA 3AI1A 1F8YA 1Z18A 2VNKA 3OZXA 2ZJ6A 1E77A 4QARA 3GMIA 2J3TD 5I01A 5G4ZA 3ISJA 1AKQA 4IJUA 1T19A 2FN3A 3EJWA 5EVJA 1ZL0A 2HLHA 5HL1A 1ISJA 2FPXA 2RGGA 3R74A 3TQFA 3CY6A 4TKLA 4TXLA 4FHCA 3G8AA 3LFTA 3AM4A 5ALIA 2JFWA 2V9PA 5B6IA 3ITEA 2PKQO 3CX8A 4S2UA 2WKRA 2OV4A 1QHEA 5TGTA 5AVOA 2ZR7A 3ZVLA 5HS6A 3IDQA 2IUSA 3T1TA 5GMOA 2KPOA 3UK7A 2J0VA 3QPAA 1AKMA 4MKGA 1YIAA 3N07A 2GYUA 3BTOA 3KOMA 2BFFA 3ZWKA 1AUOA 4G0WA 1G21B 1E9FA 5ERXA 3TW4A 1NYYA 3A06A 2Q62A 1X2EA 3QI7A 2IS2A 1XTKA 4Z4IA 3ILVA 4YREA 1C30A 1MTZA 1UXIA 2XD9A 5DI9A 4N1HA 2OORC 1YAXA 2EZ8A 2HHCA 3G2OA 3JW8A 5E8JA 4AJNA 4DCUA 1T1BA 2PK3A 4D6PA 1OAAA 3HG7A 3NI9A 2D5LA 2PZMA 3L0SA 1AM4D 1GDDA 4J9VA 4LCLA 3VKGA 1GP2A 4LV1A 3UAYA 1S7GA 1RXUA 1ULUA 4D96A 3RVPA 2FCRA 4JYCA 4OUKX 1JJ7A 1MT3A 2PCLA 5DM60 2YKFA 3JV7A 1OJGA 4OOYA 1O58A 1AN0A 1RE1A 1QB7A 2YVKA 1FTYA 2P0YA 1XZAA 2IUFA 2B5WA 3ICPA 2J3LA 3KJIA 3CRNA 4X6YA 4E94A 5TFQA 5FQMA 4URYR 3SX2A 2ZYWX 3RWOA 2WLSA 1GLNA 1SUBA 3BXZA 1NI3A 2K5UA 2V03A 2XMSA 4JVSB 1JG4A 2WNHA 3KOWA 3BJRA 2QTGA 1HETA 1NI5A 4QRDA 2ZM6B 4L02A 3CCCA 3GRZA 4J0IA 1SWVA 4U8GA 3R7SA 2AA3A 1WA9A 4QWWA 5ADUS 3D4BA 2O9CA 1W87A 1WB6A 3JWIA 3U3OA 2ZWIA 3A9UA 3HHEA 5BSMA 2W42A 1LSWA 2ZXEA 4QE3A 2WT9A 1ACFA 3NWJA 3UPPA 2FX5A 16PKA 3P2MA 2DBYA 4C7XA 4JI8B 4RAQA 2AL7A 3KSRA 4D02A 3V50A 3GFTA 3OZEA 5IS2A 4J6EA 1TJ5A 3G9UA 5LLDA 1XBTA 4BL3A 4G24A 4IBXA 3DDCA 4U39A 4W8OA 5FJJA 3RADC 4Q48A 2O8EA 3WV4A 1CEEA 3CX4A 4IICA 1DEKA 3W6NA 3U0BA 4LGMA 1IK6A 1J4AA 3PXBA 4HGQA 4IPTA 1Q6YA 3I39X 1HMYA 1VJ0A 2XIQA 5EE0A 5BURA 3UH1A 3IXDA 3NJ4A 2WJZB 3BSSA 4MV7A 2DGDA 2EGHA 2VGLS 2QTCA 3NUGA 4FILA 1RZ3A 4KU4A 4UEWA 4B80A 3FOZA 2W5UA 5KDLA 3JWEA 1H3QA 4FFWA 3L0BA 2WFLA 4TYYA 5IKXA 4NV0A 1XX2A 3K0KA 4UTPA 1Y1QA 3ZV3A 3ETNA 1UBMS 3IKMB 2BFEB 3OZBA 5D5HA 5A7HA 3T61A 2H17A 1H4SA 4C3QA 3FYUB 1ZD5A 4PFKA 1KVUA 5B7GA 4F45A 2Z6QA 2WZZA 1JZQA 3NGLA 4JEHA 1OBHA 4RE5A 2PAAA 2WIBA 2BSQA 5FYDA 2BGUA 2FDXA 3FNEA 4R7GA 1E5XA 3SOPA 4E31A 2D7DA 3JRXA 2XW6A 4GPAA 2G9RA 4ZXPA 1FL9A 3ML1A 4QRIA 2YRXA 3QG5A 4UARA 5FLEX 4OGGA 1VG1A 3QFCA 3RTCA 3UXMA 4Y7DA 3AZPA 1MA3A 2G04A 3DV0A 3HA3A 4HGOA 1DTSA 2OL4A 2J9XB 3PX2A 4F86A 4MGZR 4YPFA 3S8EA 2EOAA 2PUGA 4IMPA 3ROTA 3P9KA 4M0PA 5SZKB 4BO8A 3HCRA 3NEAA 4NXGA 2YWJA 3KYDB 4DRXB 4RCYA 4N6NA 4EO4A 4Q0IA 4TT8A 4UQIS 3AF5A 3KDAA 1E0SA 1MZVA 3T1HB 2BMJA 4IIFA 5EP1A 3PGVA 4NEHB 4MVJE 3AZQA 4EBNA 3DW1X 3GZTB 3IDZA 4ISCA 5AI9A 4IL5A 1YA4A 4Q4HB 1I2MA 4EGFA 2DX7A 3NM6B 2WSSD 1GNLA 3IOBA 5EZSA 1U7XA 1KSJA 1SOAA 2JI7A 3G35A 1BW9B 1WZEA 1UH5A 3CF4G 3ETEA 3CSUA 5JEDA 4Q4JA 1T36B 4XYLA 2DCMA 4KG6A 1XXHE 3FHJA 1R6TA 4UM9B 1Q0QA 3TVTA 1CE8A 1JU4A 1QP0A 3IS2A 3K8OE 4U7WA 3QUBA 4G9GA 2O8BB 2AVNA 4JR0A 3K5IA 4Q00A 2AFVA 1UJ2A 4J0KA 3IERA 3ESYA 4WH0A 4IF4A 4WKCA 1FX0B 3RTEA 3TZQA 4C6RA 5EVCA 2M6RA 3FNRA 4GEGA 3CWCA 1AIPA 1ZJ4A 3GAMA 1UFVA 4O4LF 5AW9A 4AULA 3VKUA 1JQ5A 4EESA 3CUKA 1QANA 1MX1A 2FZWA 3N74A 3WLOA 3A26A 1BULA 1HFWA 1UPCA 1LBIA 2R4QA 4O1MA 3JZIA 3NFYA 3Q4GA 3O3VA 1RJWA 1GAEO 1GTJ1 5E1MA 3IAAA 2WNIA 1ZW1A 4JYAB 1AMOA 5LD2C 2I34A 3U3MA 4LRYC 2IV7A 1Q1ZA 2D8MA 3IX8A 5C1BA 2HF8A 3QFSA 5HIKA 5KVAA 1K56A 2C2ZA 4QAJA 3EXAA 5D85A 3V4VB 3CB4A 4ARCA 1UKYA 3EWAA 2VUUA 2XLCA 3C3PA 2Y2JA 3REFA 4XM2A 4LJ5A 3DT8A 5CW1A 3UC9A 5KCMA 3E7WA 4EUNA 3ZHVA 2J1LA 4RLQA 3O73A 2XMRA 2EJUA 3KP1A 2ODAA 3GA5A 4D3FA 2CLFB 5FF9A 4ZVOA 5DYIA 3I5YA 1ZNQO 1JXOA 3IV9A 2Z3ZA 4UATA 1I1HA 2ZWMA 4NCXA 4LOKA 2ONJA 1H66A 5J3WA 3A9WA 5E2HA 3HEAA 1ESDA 1R12A 1UMCB 2BGNA 3RUHA 4ZRMA 3GIWA 4XWTA 1RYDA 3FMOB 4CL2A 1ECLA 4HAZA 1KU0A 1UAAA 1Z08A 2VPIA 3PQ4A 5LC1A 1GSHA 4Q05A 4N47A 3VFHA 3A1SA 4KIUA 5DJUA 3RVDA 3GR2A 1PW7A 1NRXA 2FDRA 3K9NA 4H59A 4TQUS 4DSOA 4F2DA 4LOAA 2BTFP 1V8DA 1XLVA 2PYDA 4MKIA 5EZYA 3E05A 3ZWXA 1DBPA 2D74A 1G2OA 3U9TA 1G1AA 4FEAA 4YRGA 2YC2C 4DM3A 2CB9A 3R41A 4RHYA 2V0WA 3UHFA 1WU7A 3GFOA 5JU6A 1ECBA 1KVQA 1RMQA 2CVQA 3WJ7A 3I3SR 4AS3A 5BQXA 3TR6A 3PDHA 1VLJA 3CTPA 5GINE 1T9AA 4J4HA 4CTOA 2VJKA 5LR6A 4HYYA 3CN7A 4HBZA 3TGWA 3R0XA 4HH3A 4OPRA 3DONA 1JWLA 3PG5A 4X68A 5AQAA 3ACDA 4C4RA 4Y2UA 4RPGA 1YC2A 1YOBA 1JMVA 1UXOA 4FS8A 4LF9B 2GH1A 2XTZA 5D00A 5REQB 5YASA 2C1XA 3EDYA 3W9BA 2W0MA 3DWGA 4B35A 4Z3DA 1YFZA 1BHO1 3VAYA 1KYYA 4NS1A 1MP0A 4RJLA 3CVXA 1MB3A 4PYOA 2F67A 3O8NA 3VKFA 1CUVA 3EQVA 1V3TA 4Z1WA 1E1YA 1WXGA 2FW1A 5L09A 4LDNA 3DF7A 4BVFA 3BEBA 2EX0A 2UZ1A 2QX8A 4J16C 5A5EA 5LWHA 3UAZA 4EU0A 4FE7A 3S28A 2QENA 3BZWA 3F7NA 3O1JC 4HYTA 2VF8A 4AS1A 2FEOA 1ZHFA 4U8HA 2W0SA 4DADA 4TSRA 1L5GB 1XK6A 4YAGA 3HJAA 4N9LA 2QNIA 4FWBA 2HYIC 4D9GA 1OR8A 4OJKA 4QVKA 3M3DA 4AU1A 4ARZA 1GL3A 1RPTA 1XN1A 3ZTWA 2AGVA 4CGZA 2I4LA 4N03A 5EJGA 2GCPA 1A9QA 5CRFA 3SR3A 2DRIA 3RIYA 3AJ9A 3GK3A 3G2NA 4ME6A 5J7EA 1QHGA 3I3OA 3RJTA 1NXPA 4WTOA 2VTDA 2ISQA 3VP0A 1N0IA 5EKXA 1XZKA 4G5QA 4INZA 1TCCA 4DIEA 1WV0A 1TJNA 2EW1A 5LJIA 3RS0A 3DBIA 1I1NA 4PZYA 1N3YA 2VPYA 2AMJA 1DG1G 1FMTA 1XU4A 2FPGB 3F7MA 4E03A 1WVGA 2UXBB 3HZHA 3W8FA 3M1IA 5D1NA 1U0JA 4YI5A 1F1BA 3AEUA 3DO6A 4MB0A 2Y2GA 4CF3A 1ZRSA 1I51A 1QO0D 4AL4A 3B6IA 4HZUB 5BWCA 3OT1B 4JASB 5HIAA 4A5OA 4TLBA 1TA4A 3SIXA 5EL0A 4KXVA 3G6WA 1M8PA 4W5TA 1X19A 4D45A 5CECA 1G8PA 4GFDA 5GGXA 4Z4GA 5FT9A 4F06A 3B2QA 4WK0B 4EJ2A 3R5JA 5ENZA 1EVQA 1IB6A 1V8OA 2TRSB 1NI4A 4IIUA 1R10A 5A5FA 3UMYA 2G1UA 2AMYA 2C5SA 5BVGA 2JGMA 5HDBB 1VKZA 4YONB 4M1QA 4ZAYA 3U7GA 5KWEA 4ZGWA 2G6BA 4MRSA 5DFAA 1PZGA 4DLPA 4HEFA 3DBVO 2XX3A 1T18A 2D62A 4TX1A 3BGVA 4BEJA 1FSYA 3I4CA 3N2NA 1FP6A 4JXKA 1R8XA 2ERXA 2W70A 4K0WA 3ZE8A 2QYHA 4UREA 4D4JA 2K2WA 4Q6WA 2HF7A 3OCJA 4XDGA 1DCFA 3H1EA 4XYEA 3ZY3A 1D1TA 1RW4A 3RKUA 3OFJA 3K7EA 5G4KB 3GNLA 1U0RA 3OOYA 3BTSA 4EW6A 2W8BB 5EMHA 4CT0A 1P9NA 1BCRA 1JAHA 1KJQA 4BZPA 3CLSC 2TS1A 4F9GA 4YCCA 2FW7A 1SUSA 3MUNA 3LC2O 3NW9A 1M34B 5A4DA 4BC1A 4XXRA 2FFBA 4K9PA 4A6XA 5KSYA 1HDXA 4XUDA 4LLOB 2BUCA 4EI9A 1U2RA 3ON5A 2IW3A 4Z9BA 4HFRA 4E2WA 1NTRA 1IUPA 3ZCTA 1CB0A 2HV1A 2IZ5A 3HUTA 3FX2A 5AM2A 1WABA 1ZZEA 1R15A 3A70A 1MJFA 1DV2A 3DBOB 3F2VA 4MRNA 4PAGA 3TE6A 5E2FA 1O89A 3FYZA 4DE3A 2X6TA 3CF0A 3GG2A 3INGA 3N1UA 4IVQA 1UBUS 3SN6A 3WL5A 3EJ6A 2C20A 4BB0A 2YKHA 3N2GB 4IXWA 4DDSA 2GUGA 4NHOA 4X93A 5LZ2A 1YTUA 1YACA 2MJLA 3CNNA 4G2TA 4RZXA 3PENA 4M1ZA 4FH2A 3GJ7A 4L8FA 4K2HA 2LKDA 3LI8A 5BYKA 1N0HA 4CG3A 1KK2A 4DF3A 1YZLA 2PYIA 1N36B 2W6ZA 3X1YA 4DZRA 3ZR4B 2AOUB 3KJZA 4MYHA 3N8RA 3UVEA 3CT4A 1Q6ZA 1VE9A 2IVFA 2AOXA 5FDFA 4KPEC 4R1GA 1YZHA 3JQAB 4M9QA 1HNNA 3CVUA 4MV8A 3FUCA 3PYLA 3LBAA 4N5IX 1MU0A 4WKOA 5SV2A 2R751 4PSAA 1CNMA 2NYUA 5DASA 1RPNA 5AVKA 3RAGA 4CZ2A 1R0RE 2CVOA 2GJKA 1XJ3A 5JCXA 5JC1A 5KREA 1K06A 4D82A 2NAPA 1SVUA 1KE3A 2QU7A 1PD1A 3QVUA 5GQSA 4PGGA 1C3OA 3UPNA 4LXIA 1O7JA 3U5TA 1P31A 2EQ5A 3DAOA 5JMOA 3EIUA 1JLRA 1KSGA 3BJEA 2JCGA 1NVEA 4P1ZA 3SH9A 5C37A 2FW9A 3HN2A 3AESA 5HDSA 3G8BA 4YIKA 4AMBA 4BLPA 1QH8A 1ZN9A 1S2MA 3GMSA 3KD3A 3KXKA 1XTBA 4YASA 5L45A 1IN1A 4QGHA 3MILA 4FP9A 4KACA 1DB3A 4Q1FA 4KFUA 1K1EA 1OV4A 3NVDA 4RIFA 4ETIA 4UEYA 1C0LA 1Y3DE 1TT5B 4L0LA 2C9ZA 3AOGA 4M8KA 1TRHA 4TTRA 3VNUA 2ZSKA 4JIGA 1NXYA 4RHCA 4MIEA 5D6OA 1NBWB 1G8YA 1LGYA 1XTPA 1BMFA 4R3BA 2X1HA 4JUCA 5CGSA 1EGQA 1SBIA 2CXPA 3L7BA 3EGXC 2I4IA 2PWZA 3RRNA 3BB3A 1W73A 1QG4A 2HA6A 3C3EA 3LUDA 3N7UA 5DGHA 3COWA 5JXWA 3VHXA 3AVVA 3HDTA 1DQNA 2FZVA 3F4KA 4EERA 2JH3A 5TEVA 3VDXA 2CYAA 4QTUB 1GU0A 4UAJA 3TFQA 1XYGA 2Y2MA 1HZZC 2CLDX 1SXJE 3GEHA 3OCWA 3IQHX 3EX7C 2C9MA 3T8YA 1X8XA 3CR3C 3GLHB 1ZI6A 1XZBA 2D1SA 3GUUA 4JC8A 2ZRHA 2VHUA 4L1KA 3ETLA 4KKVA 5CVJA 4CLCA 5IDYA 3OQNA 2E1PA 2MOKA 1DRMA 2QXTA 2P90A 2LW7A 3OEED 3THSA 2R78A 2PFSA 2XYGA 3PP8A 2EX9A 1RC0A 2PBRA 2H65A 2GPBA 1RP7A 3GEGA 4EB3A 2IWDA 5TQ0A 5BMVB 5FR1A 5ICEA 3F49S 1IZZA 5MN5A 3L40A 4XWYA 3V3RA 3ROPA 4DCOA 4E3NA 3E48A 1XNQB 4UCXA 5AD1A 4CU2A 1VLLA 5H3LA 3EA5A 2QPTA 3GRVA 2IWHA 5KYNA 1AX9A 4D60A 1OH7A 1A8UA 4HH1A 3CLUC 1N92A 4LSMA 3ZH9B 4LTMA 2QZSA 1N6HA 1EFRD 1VI6A 4O4JB 3R9WA 3VOTA 3BX1A 4K46A 3HBJA 2ZZNA 3W2EA 5EJAA 3ZWCA 4BBPA 1KWGA 3KUXA 3TIVA 2P67A 4IKOA 5M19A 4W6ZA 121PA 3A1UA 1Y3HA 3HU5A 1ESIA 2E3JA 5CJJA 2PAVP 2V0UA 2C4MA 3A6FA 4R1PA 3WRYA 2BUAA 2E89A 3NDPA 2GN9A 2R60A 1IY1A 1GPDG 4I08A 3RANA 3QU2A 3PR2B 3R7FA 5JJ5A 4AECA 4FHEA 4BNXA 4DPMA 1FDTA 4HCJA 4LCJA 4WIAA 2FWBA 1IHOA 4AZ0B 2DERA 1UKBA 2WJ3A 1SZVA 3I6BA 3L6RA 4RV5A 4XQCA 1SXGA 1ZJZA 3N0WA 3RG8A 1C2TA 2FJUA 1NLYA 4X56A 2ZMVA 4ZTZB 1E3WB 3MPOA 4CVNA 3D1LA 2ODBA 3S4XA 1NJGA 2ZROA 4WMLA 2KBFA 4CMKA 1G5HA 5JRZA 4JI4B 3LEQA 1N2SA 4L22A 2I03A 5EXPA 2UVDA 3OEEA 1UMBA 1ZJYA 4Z6KA 5CVTA 5GIPE 2VRWA 4X94A 4XAQA 4ZYTA 5EHZA 1FIUA 3OTOB 3AJEA 1L0FA 2BJHA 4RZQA 5LJLA 1IN6A 3SM3A 4B4UA 2YHBA 4UXIA 1DV1A 3D8BA 4YXWA 4GBMA 5B58T 4LFCB 4HNBA 3UCEA 2IXDA 3KVRA 4YFMA 4RJJA 4WZ4A 1S1MA 4M54A 3RF6A 4RABA 1Z2DA 3G02A 3FTFA 3JASA 2VHQA 2I2DA 1BU5A 3FNFA 4JP1A 4KG7A 4CCYA 3IAHA 4UNSA 1LCIA 2ZIZA 1TGYA 4OFWA 2CDRA 3Q9LA 4RVDA 4YCJA 3IP1A 4DLAA 2QSUA 2JFQA 3KSMA 1G9TA 3BMXA 4JMPA 3NCTA 3HWSA 5BW5A 2W4MA 4CLCE 5DNAA 3SS8A 4ANFA 4X1MA 2ZSDA 3JCZA 3F8WA 4AN4A 4LK3A 2EG9A 1SBYA 4CQHA 3LX8A 1QGUB 2OZPA 3ETDA 2R8YA 3OLVA 1L1FA 4B44A 3NS7A 5JDIC 3WLFA 2C5AA 3GCZA 4JKIA 4L0QA 1PKXA 2HQRA 2GOYA 5JOQA 3UJ3X 1Z9BA 4AUEA 1GGHA 4P35A 4YJHB 4KJXA 2GBCA 4XIYA 4WCFB 4ENTA 2OAP1 1RWQA 1F2UB 2A1UB 2OBBA 3KEOA 4R1NA 4BAUA 3LIDA 2R3SA 1RE0A 3OU7A 1S1CA 1NVUQ 4G8JA 4WZBA 3CUEA 4NMHA 1RM0A 4BVKA 5CHYA 5GVRA 3UB4A 3VU9B 2NV2B 4IV8A 4DT1A 3EZ9A 1ECJA 3JZFA 1ISFA 3OZUA 3KLOA 4TXNA 2VAXA 3PBSA 1VPLA 2X5NA 2ZRFA 1ONSA 5J23A 4AF6A 1ODFA 5B55A 2VO1A 4N92A 4AX8A 1LDYA 5JSFA 4AJOA 1XDBA 4PG7A 3V4LA 3IP3A 3L7HA 4L57A 4PLFA 3WQSB 2QPAA 4P58A 1E3UD 2ZATA 1WUHS 4FCFA 5DNWA 4C0XA 5DYGA 4YXFA 4B3CA 2I3DA 3ER9A 3B3XA 5MFPA 3UC5A 5JI3E 1T1CA 4HAWA 2GERA 2FEWB 3FI0A 4UOQA 1TLTA 3KKMA 3X3HA 3HXMA 5GJVC 2PX2A 2VBGA 4NBRA 4UHJA 1YMVA 3K71B 4DF6A 3NEYA 1XRPA 3O3MB 4HGNA 3LG2A 1QC5B 5CNKA 1YF3A 3GW8A 3P2YA 2D3WA 2QRQA 1JWBB 2Q5LA 1PNVA 3ZVRA 1BDJA 1KMIY 2EFDB 1J99A 3BULA 1OT3A 1Z17A 1HRKA 3ZG6A 1THGA 1KYIA 4L9SA 4WYYA 3U81A 2AF4C 2GPSA 3FHCB 4GMFA 1M6KA 4EHKA 5ITZA 3DDWA 5DV9A 3UK1A 1DP4A 1TLLA 4RY0A 1GFZA 4I1IA 1DQYA 3DE3X 4LZZA 3ZNNA 4DANA 3KRTA 1U3VA 1S96A 3BFCA 3GJYA 2NAFA 4GOMD 2B36A 3EBPA 5I4BA 5T4BA 3W6PA 4PINA 1E3IA 1SZCA 1F2DA 1Y4DE 4GIBA 4DLNA 4EX7A 1XG5A 3EPLA 3WBKA 4UUOA 4CM8B 2XKJE 3PCXA 2OO5C 4LKOA 4AMYA 4EW7A 2BBTA 1JIQA 1RJ9A 1HL7A 1PFYA 2RJNA 2ZPTX 4K26A 5CB4A 3LVRE 5IMSA 1XZLA 5LQJA 3BJZA 1B3RA 2D59A 4MBHA 3E98A 5T8KC 4YDQA 1F0YA 3F71A 3D6TB 2XH9A 3EEHA 3JYPA 3KKKA 1ZG3A 5J1TB 5C53B 2PBZA 2C07A 1CF0A 3VO9A 1MB9A 3UFBA 2JK0A 3G8YA 3JD3A 4GQBA 4S1PA 1DRWA 2CLHB 3C5CA 3G68A 3G5UA 4QOGA 3PXGA 3W79A 1YB7A 3EVGA 4BAGA 4EOGA 4QHCA 3TMKA 5JFGA 5K0CA 3TD6A 2NP7A 3QEMA 5DOVA 3QP5A 3LAWA 5JDCA 1DAKA 5F98A 2SKCA 1IQUA 1GHTA 2D1YA 3OC6A 1K4FA 4M1OA 1GNVA 1JHRA 1XJCA 3OE4A 3PR1A 5JH7B 1U3FA 4A0SA 5BWOA 3AQ4A 1Q7TA 5ERGB 3RSHA 4HDRB 3MIIA 4LHXA 4EHFA 3EMBA 1LRJA 3PZRA 4F2HA 1UKAA 1QOQB 2XB9A 1M6YA 4R16A 1U8XX 1VRWA 4R8VA 3AVXA 3C24A 1D2AA 1QX3A 1F20A 3LPDA 2QL9A 1UMDA 5FA6A 2ZJ8A 4RKFA 2WJIA 2C59A 2RGNA 5EE9A 1OU4A 1RQLA 1TYCA 2FXVA 4YQEA 3LP8A 3ACBA 1NOIA 2XNSA 3HQ4O 3LYUA 1VMKA 2PA3A 4R7ZA 4WZ6A 4KI0A 5DSXA 1OFTA 4K0RA 4IIJA 3FRHA 3O4IA 3ZY5A 4UHUA 1JLKA 1QIKA 3OJEA 5C80A 2OB1A 1R8JA 5HQJA 3UFXB 5FBQB 3ZW9A 2P3LA 5CLIA 1RC8A 3LUJA 4TLCA 4XIIA 1W0KA 2YWBA 3O8BA 3ZHHA 2HXGA 4QBTA 5DE3A 1SUIA 3SEFA 4FTWA 1N6IA 1Z2OX 1JTEA 1PGNA 4CIAA 4B93A 3T1OA 4B32A 2N1MA 4YP9A 2YJ3A 4W82A 1V71A 4ZQFA 4MN5A 5KYWA 3ELYA 4DKXA 1V2GA 2ZJ1A 3NCKA 1UP7A 4IVRA 4QL3A 2CBZA 2FE4A 4GDMA 3W7VA 2HA0A 3BCSA 4U9UA 2VJAA 1A9ZA 5C31A 1ECPA 3DDNA 5A0FA 3RTAA 1PBNA 2QY9A 1C7EA 1S02A 1AKWA 3NDEA 5A6VA 1C14A 4FDVA 4QXMA 2RGAA 2YHIB 3C45A 1QCDA 3ZY2A 3ANNA 2PLRA 5TARA 4O8GA 4TKUB 4IP0A 2I87A 1Z62A 2H2IA 3JD4A 5E4JA 1HTWA 1KQNA 3ROGA 1I5EA 2NZYA 4HDKA 5G3ZA 5FA8A 5A03A 1V3QE 3QF4A 2IIQA 1NVMB 1YR2A 2RK3A 1UBSB 2Y2UA 4QVGA 1WQ3A 4QQFA 2GI4A 5B1IA 2HWKA 3KJFA 4LV3A 1ZK4A 2VK4A 1E1DA 1VJDA 1XB2A 2YZ7A 3CFYA 3GDGA 1Z6YA 3OHPA 4ZVQA 4HDQB 3MMPA 2IIVA 4WLVA 5ITVA 5IWAB 4JLJA 1K8YB 3NYIA 3MTJA 5GJBA 4UDOA 1L0GA 1BJTA 2XHEA 4RH0A 4OBXA 2EFYA 2QUBA 2XLBA 2REBA 3KVNA 5FEMA 3QXCA 4BGEA 2CXSA 3LDUA 1ADCA 3K35A 2Q41A 1NX9A 3RS8A 4RM3A 4TL6A 3CITA 3HVJA 1M8KA 2IYLD 4NXFA 2OFXA 4Z2AA 3FWKA 2QUHA 4J94A 4PXYA 1OD6A 2JAQA 4NZZA 1T2CA 2PX3A 4MMXB 5TMBA 3KPVA 2E5LB 1E7WA 4KWCA 4JI7B 3AYZB 3TH5A 1O95C 7MDHA 4G1UC 2IBSA 3FZGA 3DCJA 4L9RA 2AG0A 4V0NA 4Y1RB 1JHUA 3MJTA 1PGQA 1QE5A 4TSKA 4R1LA 4TN5A 1YHZA 2O2XA 3PFBA 4R3NA 5ALNA 1IYQA 1FPMA 1OPRA 3BF7A 1TUIA 4YGXB 1IXSB 1XD2B 2HDOA 3VJLA 1U0FA 4LBWA 4Z1MD 1C9DB 1IPFA 1Z26A 2FWMX 1M1UA 3BE5A 3LD9A 3OQBA 3DTVD 2QIOA 3QW4B 1BXRA 5FNVB 1V35A 5TPWA 3E3AA 5HJ5A 4E6XA 5LB2A 3NGXA 1JI3A 2HIMA 3IQZA 2NUPA 4I4TB 2QN6A 5AVUA 3ONVA 4F3NA 4BVHA 1M6EX 4C9BA 3DZBA 2REQB 4EZIA 5JE8A 1RXWA 4DVJA 2IZ0A 2PSFA 4ESEA 1AO0A 4YA6A 4BNUA 5B3KA 5DKKA 4KLRA 5HQTA 1KC1A 2ZP1A 5TS2A 2VRNA 3ZG0A 2XITA 3H0KA 3HKDA 4GPD1 3ZIUA 5E7IA 4AMUA 5F1GA 1I3KA 2X58A 2E48A 4LENA 3E2IA 3LGAA 3ZH2A 4FE3A 1M83A 3SYNA 3HLKA 4J1SA 3ERCA 1DCMA 1VL8A 3JQCA 1TU4A 4XUCA 4GPIB 2V7BA 1Q2PA 1Z3CA 2GR9A 3CGWA 4FT4A 2QOEA 1ZOLA 4UDNA 3Q5GA 4R68A 4RHEA 5BSEA 5AM1A 2VP2A 4BP3A 5KU7A 2NZJA 2UYGA 4CF6A 4IIJF 3G2IA 4ZAWA 2F2TA 3VR6H 4HIAA 3CT6A 3P9NA 2VTBA 3MTBA 3NDJA 4IF6A 4JFRA 4UEKA 1GQQA 2Q28A 5LU9A 1F3LA 2XKKA 3VMMA 3H4IA 5JNUA 4N1AA 4XJXA 2WAFA 4ZRRA 1PIWA 5KSCA 1X6VA 1OIWA 1M67A 2C4KA 2R00A 2ZYIA 1IDN1 3PUVA 2A0XA 3PXAA 4JB3A 4N0MA 3OLOA 4KZ9A 4OP8A 2SICE 2VSYA 3ZD8A 2VQDA 4ZOLB 2J7VA 2CBXA 1SKBA 1D09A 2G5TA 1L4MA 1HDRA 1L5VA 4K8RB 1UOPA 4KIJA 4D3DA 4FQ8A 3I0MA 3MQ2A 3UJ8A 2IH4A 4KNYA 1DPGA 5FUQA 4QSMA 4BTVA 5JAIA 3EFOA 1ILEA 3RS2A 1IQRA 3H1PA 2NZXA 4HJ3A 4QY6A 1DBSA 1Z2PX 3A4TA 1V1MB 1L3LA 2XYPA 3IAXA 3K9BA 2AG6A 3L4EA 4UNNA 4BUJA 5KTTA 3DFUA 3U40A 2HDWA 3K8YA 5HPFA 4UUPA 4MKFA 4G4GA 1NUQA 1P0PA 2QJRA 2GTPA 2P77A 5DO9A 3WYCA 3GUYA 3ER8A 5AIBA 1BX1A 1E2MA 4QXPA 1CQIB 5DTMA 3TOVA 4Q3KA 5FDSA 1GADO 1KPIA 5CEDA 2EFHB 1ZD3A 2O9JA 3L07A 1CEXA 1JR3E 2GHRA 3NBKA 3ZDZB 1Y6GA 1M1YE 2BI7A 1M8JA 4M4XA 2X0RA 4XI9A 3SJBA 3W5CA 4MDFA 1ES5A 3DUFA 2J08A 2UYYA 4B43A 2Y91A 1OILA 9ATCA 4GM4A 4M0CA 4RHUA 4GKAA 2FFHA 2QKPA 2QMYA 2C4VA 5ICFA 5L7YA 1QAQA 2B8WA 1DRJA 3GH3A 4IGKA 4GX2A 5DB4A 2A92A 1PN3A 3HEMA