1P9WA

Crystal structure of vibrio cholerae putative ntpase epse
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
403
structure length
384
Chain Sequence
b'SDDFFSLAEELAPIIKLINAMLGEAIKEGASDIHIETFEKTLSIRFRVDGVLREVLAPSRKLSSLLVSRVKVMAKLDIAEKRVPQDGRISLRIGAVDVRVSTMPSSHGERVVMRLLDKNATRLDLHSLGMTAHNHDNFRRLIKRPHGIILVTGPTGSGKSTTLYAGLQELNSSERNILTVEDPIEFDIDGIGQTQVNPRVDMTFARGLRAILRQDPDVVMVGEIRDLETAQIAVQASLTGHLVMSTLHTNTAVGAVTRLRDMGIEPFLISSSLLGVLAQRLVRTLCPDCKEPYEADKEQRKLFEPLILYRATGCPKCNHKGYRGRTGIHELLLVDDALQELIHSEAGEQAMEKHIRATTPSIRDDGLDKVRQGITSLEEVMRGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General secretion pathway protein E
molecule tags Protein transport
source organism Vibrio cholerae
publication title Crystal structure of the extracellular protein secretion NTPase EpsE of Vibrio cholerae
pubmed doi rcsb
total genus 100
structure length 384
sequence length 403
ec nomenclature
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1p9wA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p9wA02
4LCBA 2F3RA 2UZ3A 1G41A 1E94E 1SXJC 2WWXA 2V1XA 1P7CA 1U9IC 2QM7A 1CJKC 3SFVA 3WBJA 2NO6A 4YMVA 3UIEA 2AD5A 5JEDA 4EIWA 1UBFA 4UNQA 5DISB 4KLZA 5DE3A 3TRFA 1XDBA 2TMKA 3HYTA 1EX7A 1JPJA 2QTVB 2XTZA 4AG5A 4UKDA 4KBGA 4AKEA 3W6OA 1JBKA 1U8AA 2F1HA 1JALA 1G3RA 1NKSA 1Z0AA 1JB1A 1PLLA 2GK6A 3JZAA 2QMUA 3MCAA 4OQLA 4PSVA 2IWHA 4WOPA 4ACAA 1LV7A 2D4HA 5A0FA 4OK6A 4JIMA 4ABYA 3EWSA 3DKVA 1KY3A 3CF6R 5FOSA 1G18A 3C5CA 2P5SA 5DH9A 5FTKA 1KDPA 2GEUA 4BFVA 3EPHA 4KU4A 3GLIA 1Z0IA 1NRJB 4UXIA 3LAWA 1KKMA 2FSFA 3BAFA 521PA 3SHWA 5KSZA 2ZXUA 5KO2A 1MO3A 2VP2A 3KQUA 4NYJR 2WOJA 5FR2A 4LK2A 4Z8YA 1R10A 4I1OA 2ZROA 2CE7A 5DNYB 5C18A 1AKEA 2XB4A 3T34A 2J1LA 1FX0A 1T3LA 4GDFA 2W58A 2WWWA 4JL8A 3CKLA 1ZRHA 4RZ2A 5HKKD 3HWSA 4XOIA 1CR2A 3SQXA 2ZYVX 3C16C 4HDQB 1W4RA 4KAXA 2HXSA 4NP6A 2GCOB 2A30A 3Q72A 4ZI3A 2REXB 5EZ5A 4Q4JA 4V0MA 3BFKA 4W5HA 4YMSA 3KB2A 3QUSA 4DLTA 1Q57A 2H92A 5HPYB 3SI7A 2ZJAA 1VCMA 2OXRA 4C0KA 3U7HB 3K70B 3AKYA 3FYHA 1ZIOA 4TMWA 1KI2A 2BCGY 4KFUA 2C9OA 5EP4A 1JR6A 4RFSA 3AV0B 5FTMA 1PLKA 2HLDD 2NO0A 5AR1A 3B1VA 2HJGA 1II0A 5BYJA 4ZI2A 4TYWA 4PC7A 2EFDB 3IEUA 4IOLA 2X8AA 3E5HA 4R2IA 3B9PA 3QVVA 3EARA 2P2LA 4Z54A 4RFVA 1YE8A 3LBNA 1RIFA 1C1YA 3LQQA 4CF7A 4G5GA 1K5DA 4GNKA 3R8FA 4EFNA 1QHHB 4LSGA 4TLDA 1N5KA 1P2VA 2FNAA 4DLWA 3I32A 3T1TA 4WBSA 3SNHA 2X19A 5CITA 1KDOA 4TLBA 1NN0A 4US1R 4Q19A 1U81A 3I62A 2NG1A 3X1DA 2VSOA 1ESMA 4LWZA 2VHQA 4G01B 1T8UA 2EFEB 2WMOB 2EYUA 3QE0A 1IJEA 4PO9A 2ERXA 5J4YA 1M74A 2GJSA 4OHZA 3U3RA 4F4CA 3BWDD 1CJTC 4LHZA 2GF0A 3VNUA 3NBFA 2R6CA 2HCJB 4C30A 2PJZA 2CHVA 4YMUA 3OHMA 1G7CA 2IYZA 3VAAA 4KFRA 4B44A 3ETLA 3K9LA 1J90A 2YWFA 4MUAA 1EESA 1DEKA 4OHXA 2ZJ2A 2YNMA 2XZOA 3ZIAA 1D9ZA 5E7MA 1DADA 2OESA 3EIEA 4Q7MB 2GTPA 5G3YA 3ASYA 2KWIA 2RHDA 3NH6A 5DN6D 3U7FB 2BM1A 2R9VA 2WWFA 3ZYCA 2QAGA 1GP2A 2Q6TA 2QGNA 2QU8A 2OG2A 1GNQA 3T1QA 4LHYA 1G17A 2WAYA 2WKQA 3QY0A 4PSAA 1A7JA 2YWEA 2YWGA 1XTQA 1BYUA 3Q8XB 4GZLA 1AJEA 1ZJ6A 5JJLA 3K0FB 4OI4A 4B34A 4P4SA 1EFRA 4NH0A 3P27A 4RY2A 1DARA 2OLKA 2N42A 3K09A 1E0SA 1Z06A 4C7OA 1WBBA 3TQCA 4JL6A 2AKAB 2Q21A 4EKDA 4TMTA 1AQUA 3SR0A 2JJ2D 4GSYA 2ZITA 1LTQA 5CK5A 4URWR 2G77B 2ZREA 5FUVA 1ZP6A 4KSCA 3EPLA 2FPKA 2JGNA 4K81B 3W9YA 1TQ2A 4LJ9A 3RWOA 1Z47A 2W83A 4P4UA 1H8EA 3TH5A 2GZHA 1IXSB 5DIFA 1R4AA 4DDTA 1OE0A 2QPOA 5JMTA 4RD4A 4NHOA 1AZTA 1OXVA 2QE7D 5AUQA 1Z2CA 4QHSA 2JATA 5IT5A 4QGFA 3SJBA 3CZQA 4DT1A 3KJIA 2CJWB 5J4HA 2NIPA 4QHTA 3K09C 3ZQJA 4B43A 4QJ3A 1UFQA 1FPMA 5C4MA 3NEJA 5EE0A 3ASZA 3IKJA 4RCZA 1OH5A 2WV9A 2JLRA 2QG6A 1KZ7B 3VNVA 1JEDA 4MKIA 1FOEB 4UNSA 1E98A 2FE4A 3ND8A 1S1MA 2ZAMA 4M1YA 1SKYE 1P4SA 3GLGA 5BN3A 4QBHA 2IYYA 3PFIA 4FW9A 5AJVB 2R2AA 1YRAA 3AF2A 1V5WA 3LNCA 4D4MA 1E2IA 3H84A 1X8JA 1TTTA 1PUJA 1OFIA 2AL7A 3AEZA 1GM5A 3VKGA 2J46A 3JVVA 2FSIA 1FL9A 3KB1A 5E95A 1HQCA 1MO4A 2IYSA 1RVDA 1FX0B 4JVSB 3U4QB 2FFBA 2O8DA 4Q1AA 4A0RA 2W2TA 1KTVA 1ZD1A 4FMBB 4Y0VA 1IXRC 1E9FA 4DLXA 1T5IA 1OIWA 4XVQA 3ZZUA 1E2LA 5AJWA 3MLEA 1OH6A 5DN6A 1BMFA 2YKGA 1MH1A 1M7HA 4EPWA 3T1VA 4NYMQ 4URVR 4XTCS 2O8CA 2XSZA 4G3XA 4RCYA 4Q66C 2IS2A 1IXZA 4AI6A 2DBYA 3IO5A 2WWHA 3EA5A 2BKEA 4C4PA 2RH5A 4O2LA 4E09A 1G9XA 4XJXA 2ATXA 3I73A 5IK2D 1R2QA 2IYTA 2ZRAA 3CH5A 3U6BA 1E32A 4Q47A 2OO7A 4HB0A 3MJHA 2FFHA 4X8HA 4FWTA 2P5TB 3IHWA 4L5BA 1SHKA 2IBMA 2Y8EA 2JJ2A 3C7KA 1G291 3GJ6A 4HDOB 5IDVA 4BFZA 4DDUA 1CR4A 1XJCA 1G8FA 2YHSA 5KYKA 4M0LA 5JCPA 5EP1A 5L3QB 3H0KA 3U3OA 1R5NA 3NEYA 2O8DB 4MKGA 3BXZA 1XTKA 4HLUA 4D80A 4JBYA 2ZSEA 3IUYA 3RC3A 3DMNA 1X1SA 4L15A 3K70C 4F93B 1OXTA 3ZLJA 1RRCA 2OE2A 1E2NA 4V0OA 5FPTA 4Q1CA 1W1WA 4F38A 1N5JA 4QNRA 3KKNA 5B30A 3NH9A 4FMDB 4FCTA 2ZETA 1NKTA 1NIPA 2ZI7A 3SJAA 4PC6A 3B1YA 4GOKA 1P6XA 2O8BB 3U6KA 3SQWA 2IC5A 3PUVA 4G1UC 4YDHB 1AS2A 1ZVQA 3TMKA 1AN0A 2B21A 1NG1A 3UWKA 4B3BA 2HF8A 3NKVA 3OEED 2GZAA 3LX5A 3BK7A 1ZM7A 4FCWA 4BEJA 4A15A 2PX3A 4A2PA 1VYVA 4MGIR 3DOEA 3KKOA 4HUQA 2GZDA 2ONJA 4BFYA 3NWJA 4PHHA 4YONB 4XD7A 4E22A 1DAFA 3FTQA 5JLJA 4NU0A 4Q18A 4TT3A 2Z43A 2MSCB 1VCNA 2V7QD 4AURA 4JLBA 4U00A 4AKHA 3QJYA 1YQTA 2J9RA 1U0JA 3R7WB 2ZR9A 2EQBA 2D2EA 1I4LD 2FGKA 2WZQA 1R0WA 2XX3A 4WZBE 1XPRA 1G6HA 3JZMA 1OFHA 4GMDA 4CYMA 1A2KC 4G5SA 1QHSA 1JR3D 3AM1A 2CLCX 1G8GA 4QJ4A 1ETUA 2FJUA 2ODEA 1AZSC 2DWQA 5DO9A 2LWIA 3TE6A 2OLJA 2IF0A 2CCGA 1G3MA 1XWIA 1KI1A 3L43A 3GJ5A 4P32A 2CEAA 1IQPA 1DPFA 2PBRA 3CR7A 3QKUA 2DFTA 2DFNA 2X2EA 3FHOA 3EG5A 4P0TA 5FR1A 2BV3A 2GCPA 4QOSA 2YZ2A 2P6NA 2R65A 2PCLA 1YR6A 3QPUA 1KMHA 2EW1A 3KTAB 3W6PA 2WKRA 4NYIQ 5F3WB 1SVLA 1KHTA 1MABA 4MRRA 1OPXA 4V0KA 5BN4A 5DI3A 1IN4A 4R7ZA 4EJSB 3V4RA 1HEIA 3NC1C 1LVGA 3E2IA 1N6KA 4TL7A 2F6RA 4HAUA 3RLFA 3HJNA 3R20A 3KQKA 1YR8A 2AHOA 1XF9A 2ZJBA 1F2TA 3Q9LA 4Y0AA 4Q9JA 4NCNA 3KKQA 3U2QA 1W49A 4MYHA 4JMPA 4BRUA 3LD9A 1P9WA 3LW7A 2H17A 3BFXA 2VF7A 3PUXA 4YDSA 3FB4A 1SKYB 3GJ8A 4HAYA 1A5TA 1NBME 1OKKA 1N6RA 3A58B 5TXGA 4HATA 3VKHA 5P21A 2IYRA 3SEAA 3HR8A 4O2RA 3K8YA 2QRZA 4URYR 5JI3E 1KKLA 1E2DA 3TW8B 3CX7A 3ZZTA 4DCSA 3AVQA 2GKSA 3QKSB 5J4LA 4US0R 2WOOA 1Z0JA 2HYDA 4GI7A 4KO8A 1E69A 3UMRA 1XB2A 2VP9A 5SZHB 2AWNA 4EQ6B 3EZFA 4XWKA 4OI2A 4WXRA 3QIAA 4X8LA 3RC8A 2CDNA 3EZ7A 2VSFA 2QT0A 1W46A 1ZNXA 2BC9A 3F8TA 3OZXA 4FMDF 4OQNA 4C9BA 5AUPB 3TSWA 1S4QA 2MSDB 5A5GA 4TZ6A 3GD7A 4JKIA 4LBZA 4PHGA 2YC4C 5FBVB 1KO4A 2DCUA 2XTNA 3RWMB 1IN6A 1KMQA 3AF3A 1Z6AA 2O0JA 3HPRA 4B75A 1OYWA 1ZINA 2BMDA 2W6ID 2R44A 4BFSA 4EFLA 4URZR 3BB3A 3L0OA 2PEYA 2BKUA 4N0DA 4DZZA 1OSNA 3K0CC 4LHVA 4Q9LA 3RSLA 1TF5A 2F9MA 1RYHA 4KVAA 2IUSA 1KI6A 5B58C 5M04A 4OK3A 1R0YA 1P60A 3BGWA 5JWRA 2REBA 4FI3C 4Q03A 1VMAA 2VSXA 3MAAC 1KJWA 1YZTA 1NVXQ 1VCIA 2IK8A 2QQ0A 1ZC3A 2PMKA 3RDPA 2VQSA 4JJKA 2XNDD 4MRNA 5IHPA 2ZYTX 4OYHA 4TL6A 5AWFC 3V4FA 4ZCLA 3T1OA 3ZD7A 1N0WA 3IHLA 3L2OB 2OHFA 1W4BA 3DHWC 4F4IA 2IHBA 3IEVA 2BCJQ 1U2RA 4M21A 4LYAA 4IVRA 5E7IA 1NVUQ 5CDFA 2R62A 3BRWD 3QSYA 4R2HA 2O0HA 4Q7KA 4DCTA 3P26A 2EFGA 5CYPA 1MT0A 2NZ8A 3FKSD 2C99A 4B3FX 1W5TA 4DIEA 4ZDJA 3OESA 1CS4C 4M4SA 1JR3A 4HYYA 2O8FA 1HTWA 1S2MA 4R9UC 3BIFA 4BE7B 3NIBA 4PXAA 4CZ2A 5E7JA 3DMDA 1T5LA 3N5CA 1KMHB 3KTAA 4CT4B 1R7RA 2ZS7A 1JXMA 3L0SA 3GMTA 2BBOA 4PZYA 2VPPA 3TUIC 2WICA 2F1RA 4RD2A 4TMZA 1RC8A 3VTKA 4J0QA 3P4XA 2FU5C 1N6LA 4LBVA 3GLGE 1OV4A 2ERYA 4UJ3A 3E70C 1TX4B 2F7SA 1XCPA 3EWAA 3GLFB 2PH1A 4OQXA 4WAUA 2BEJA 3ZVMA 1XPOA 1DVRA 3BB4A 2VP0A 1WP9A 3FMPB 2VA8A 1Z63A 4B3GA 5EXXA 4IVQA 4MA4A 4Z1MD 3BH7A 2ZI9A 1VG9B 5EP3A 1E0AA 2Q3FA 2IYXA 2B92A 1ELOA 3NHBA 1KAOA 2R6GA 1LS1A 3FFAA 4GBMA 4UNPA 3PEWA 1GOTA 4DUGA 5KNBA 3SYLA 3D8BA 5EXTA 1FMJA 1YKSA 3WNDA 4F91B 3DDCA 2N46A 3SC3A 3W34A 2MMGA 2C9YA 3IBYA 3VR6A 4GOJA 2W00A 4MH0R 1KK0A 1SKQA 1ZW6A 2G0NA 3FKQA 2QQEA 1J8MF 4O0MA 1OHHA 4TYNA 1ZCAA 2RGAA 1MRNA 1QHYA 4BLPA 1N0UA 4HDCA 5H8WA 2H57A 4B3CA 3TAHA 1KI9A 3ADKA 3B60A 1ZYUA 5TVKA 4LPSA 3MFYA 1KNQA 1J7KA 1UKZA 2WJVA 3UG6A 2F43A 5JECA 2FZ4A 3EASA 4OKSA 1OH7A 3I61A 4MYUA 3DEFA 1E1QD 2IWRA 2G88A 4LV6A 1HUQA 3AP1A 4JLKA 3UWOA 2J0UA 2PEZA 2QENA 1P2TA 1CJMA 3GJ7A 1Z6TA 3LW8A 2WSMA 1Z6YA 5D3MA 4A6PA 2WIBA 3KQHA 4AC9A 4Q4AA 4DWJA 4TYQA 1FNMA 2N1BA 1KAGA 4PC3A 5SZKB 2WVJA 2H18A 2NQ2C 2NPFA 1E1RA 4KI0A 1T91A 4LJ5A 1GL9B 4QGHA 2VP4A 4OHWA 1TUEA 2WJGA 2VL7A 3NDBB 2OT3B 3P4YA 1LW7A 2O0KA 2JIZD 4PZZA 4Q5IA 3RVBA 5AJYA 1AGRA 1RPZA 3G5UA 1ZM3A 3QOFA 1D8TA 1FQKA 1JEEA 2IF2A 2A5GA 1Q44A 1DO2A 3NVAA 3AF0A 2NTYC 3LBHA 1HT2E 5FPYA 2MSEB 4LPKA 2CMKA 4ZKDA 3U60B 2FDCA 1XPUA 4WA7A 5F2EA 2QAGC 3TVDA 1KI6B 2BEKA 2GWHA 2ZRBA 3EZ6A 1CULC 4AY2A 2QNRA 1SHZA 2X77A 2C78A 2PZEA 4CEJB 2IL1A 2GBLC 2PT5A 4H1VA 3AP2A 5DLQC 1DOAA 1A1VA 5ANRB 2R8RA 4MDEA 3B6EA 5BWMA 3BE4A 5FL7D 4JLMA 1E2HA 4BFTA 2FG5A 1NLYA 3CH4B 1T3SA 2A5JA 2QTHA 2RHMA 3X1ZA 5DGXA 2RGBA 2QAGB 4LYFA 1DAGA 5G41A 1TU3A 3MG9A 5CJPA 3MJRA 1D2MA 2OCPA 4TL8A 4ESVA 3A4LA 3GP8A 821PA 4NMMA 5CJ2A 1Z6XA 2G83A 3I3SR 1Z08A 4I81A 5F9FA 1KSJA 1L2TA 3QKSA 4IRUB 3SJZA 5JRJA 2SHKA 4C2TA 2ZEJA 3NG1A 3HDTA 2FPMA 4QNMA 1BO6A 3QPWA 5C4GB 5H1YA 3FVQA 4RD0A 2XJ4A 4IFBA 2QAJA 1DAIA 1FUKA 4LOAA 1RKBA 2VHTA 3OIWA 3EC1A 2VYFA 3CX6A 3RYTC 4ZCIA 4QHYA 2ZRDA 2WAXA 4OI0A 3MRSA 1EFRD 3SBEA 1ZC4A 5KPDA 1OH8A 5JHGB 1U98A 5CIWA 1M2OB 3Q7QA 5TB5A 4AK9A 3A6PC 4DEXA 2I1VB 2CCKA 2GNOA 2IUTA 2X2FA 1TADA 4DSUA 3RS4A 4JVLA 3O8BA 2QPTA 1ZM9A 1W2GA 3KJEA 1J70A 4ESHA 4OI1A 4BLSA 2CHGA 3OE7D 2J7PA 2WPDD 3AVVA 4PQFA 5KNCA 3GLHE 3ICEA 1CR1A 3HU2A 4RZXA 2F1IA 3A4MA 1U8ZA 4F92B 4ACBA 4ON9A 3QVUA 3CM0A 5SZJA 4M1WA 1OB5A 3TJZA 2RGCA 4ASUD 3ZGXA 4L8GA 5LB4A 4HAWA 3DM9B 1VPLA 5KSYA 5FL3A 2CLDX 3WY9A 1QHHA 2V1UA 2FH5B 3D3QA 1XTRA 1VHTA 2QGZA 3K9GA 4DHEA 2HCBA 1HE1C 3B5JA 2FOLA 2A5YB 3PV0A 3I5XA 3SBDA 4D2IA 2QSYA 5TMPA 4B48A 5DYGA 3C14C 1W44A 4Q1FA 2HXYA 2JLYA 1VG1A 2FEOA 2OFWA 3WRXC 1GUAA 2PMDA 5CYOA 2WM9B 5KTYA 4QKQA 1NBMA 3OFNA 3PUYA 4D4LA 4MQBA 4KBFA 1W47A 1HURA 1S3SA 1IJFA 4PC2A 4V0NA 3H1TA 1CLUA 3HR7A 3AH8A 2QSZA 5TV2A 1OHHD 3RRNA 4BFWA 4D0NA 1UKYA 3B85A 3QKRA 3VR3A 2W2XA 4X8MA 3LVRE 1DAKA 4KFSA 5L3QA 1ZM2A 4B2PA 3RAPR 2ZRKA 2CBZA 4JLNA 4B2LA 3PEYA 4C0SA 1KO7A 2QBYA 2JJ8A 1NMZA 1CP2A 1RRFA 4JL5A 2QP9X 4M1TA 2ZSFA 1IN7A 3WMFA 4Q21A 1IOZA 3GLIE 2CK3A 2J0VA 4YC7A 4BECA 1KOFA 8OHMA 4GPTA 4F4JA 3WXMA 3BORA 3CIOA 3B8HA 4DSTA 2GXUA 4XSGA 5FH9A 1XZQA 1WBDA 4JLAA 2ZS8A 4RVCA 2AN9A 2DWOA 3NC0C 2OCAA 4D82A 4U02A 1RW4A 1Z83A 3OIUA 3UPUA 3THYB 1KGDA 3TNFA 1GL7A 1SVKA 1P73A 2HT6A 2FMXA 4ZIRB 5BYKA 4DLVA 3LXXA 3QXJA 1TF7A 2CK3D 4HAVA 4A8JC 4EUNA 3LQRA 3LWNA 3FHCB 1YZKA 3U3JA 2Q9AA 3LVQE 3EXAA 2J59A 2PX0A 4DRZA 3I8XA 1M7BA 3ICQB 3NHAA 4B3DA 3M6AA 4LJ6A 4LYHA 3CB4A 1OFTA 221PA 2HLDA 2ZSBA 4LBWA 1E0KA 3K0AB 2QE7A 3PG5A 4V03A 5FI1B 1I2DA 4PPQA 3ZS8A 1A82A 1CRPA 3T61A 4ZCMA 4XH9B 4ZKEA 3MWYW 1UJ2A 1WB9A 1JAHA 1HV8A 3CWQA 3OEHD 4C2UA 1ZIPA 4KXFB 3CRMA 1W2HA 5K8LA 1AS3A 5H70A 1DBSA 3LRPA 1G3UA 4DC9A 1VECA 3NXSA 4N3NA 4JLOA 4PHFA 5BW8A 5E3HA 5JSZB 1HT1E 3Q85A 4B33A 4DDWA 3KJHA 4CDGA 3IPXA 1AA9A 3VR1A 4JBXA 5HE9A 3LV8A 1IY2A 2QROA 1TAGA 1GITA 3W5IA 1GVNB 2GEDA 3ECCA 1OIVA 4Q01A 1P75A 3GJ4A 3I4LA 4AYWA 3AGPA 2OV2A 4N0EA 3B13B 3U44A 4GP6A 1TF2A 4PAQA 5KSPA 1KDTA 4XD7D 1CEEA 2V4ZA 3BD9A 4D0GA 1BKDR 4EJSC 3H4MA 3IIJA 1AK2A 5CIQA 3REGA 3TVTA 1TL7C 4PO1A 2ONKA 2J5XA 1BYIA 4OHYA 4B6FA 1W4CA 3OEEA 3K0AA 3KFVA 2CVHA 2WWGA 4A0HA 3H86A 3I8SA 1W0JD 5CLQA 2Q3MA 5CM9C 3THWA 1NLZA 5JWOA 4ZO4A 4PHTA 1XEWX 2JJ1A 2OFXA 2VHCA 4MUBA 5CK4A 5DHAA 4LBYA 2ZRMA 1VCOA 4D4JA 4A0GA 3QF7A 5J4VA 2NPIA 1QG2A 4US2R 5LD2B 4DB4A 1G21E 2OILA 2Z4SA 1G8PA 3HU3A 1GKYA 4AG6A 3SN6A 3LO5A 3I5YA 4PX9A 1HH4A 4TMXA 5BQ5A 5EE3A 3GJ0A 2ANBA 2W0MA 3QPVA 5CB8A 3CONA 1T8TA 2FV8A 3D31A 1MV5A 1QDEA 4D0LB 1Q0UA 1AIPA 2IA5A 4P33A 4RJLA 3UMFA 3AVXA 4E07A 2WBLC 2EWWA 1H65A 3GJXC 3KJGA 3B78A 2JLSA 3IGFA 3AP3A 3FOZA 2PZGA 2EVWX 1XMJA 2XXAB 1XBTA 1XP8A 1YU9A 3RS3A 2GJ9A 3CBQA 2GA8A 4DCUA 1XXHB 3M4YA 3S1AB 3TW4A 4I1UA 3WHLA 4XSHA 5FUXA 4EPXA 1E9CA 1ESNA 1ZBDA 3B1ZA 1TMKA 4TLCA 2ZRJA 2ECKA 1KDRA 1WCV1 1XRJA 5JI2E 3BH6A 1WRBA 4NE2A 4YMTA 3GLIB 3VU9A 3R9XA 1N3BA 1XEXB 2FA9A 3AUXA 4JBWA 4C7OB 3L82B 1D5CA 4W5WA 2RGXA 2ZE5A 2ATVA 1NN1A 1KJYA 3IQXA 2OBLA 1XD8A 3H2YA 1KO8A 4NDZA 4Q7LA 3TR0A 4UNRA 2CCJA 3B2EA 3CF2A 2ZI5A 5FBWB 1O87A 4BASA 1NG9A 4DDVA 3FMOB 2EWVA 1GZSA 1VIYA 1F60A 3OIVA 4A6XA 4V02A 3CPEA 5D3QA 3UATA 1Q1QA 3UANA 5FL7A 3R7WA 1QVRA 3TSOA 4KYIB 1JECA 2GEVA 2UKDA 4PO8A 2YVUA 4OL0A 1NJFA 1GFIA 3DPUA 4IOJA 1E79A 4GOXA 5HR5A 5EJEA 4BEBA 4JVNA 5HZKA 2KBEA 1Q3TA 4IFEA 2V8OA 3SOPA 1R8SA 2OSBA 2G9NA 1JJ7A 2CL0X 4RFSB 2JASA 5J47A 3MWKA 1Z29A 1PZNA 1UBEA 2V7QA 2OBMA 2BMFA 1M7GA 1OLOA 4BZXA 2QN6A 2RMKA 2CL7X 2PT7A 5KNDA 1ZUHA 2L0XA 3AKDA 1M6NA 4BFUA 5L8VA 3N70A 1KK2A 2BMEA 3DKPA 2WSSA 5K8IA 1DAMA 3VQTA 2ZR7A 4V0LA 2IUUA 1OIXA 4LI0A 1FUUA 4XIGS 3ZZ0A 3B1XA 1E6CA 1J99A 1QHNA 4C0HA 1U8YA 1CRQA 1ZU5A 3KX2A 3RS0A 4PAOA 3QG5A 4GZMA 2ZQ5A 3T5GA 1Z0DA 1N25A 2ZUCA 2IS1A 1J2JA 3RS7A 4DSOA 1S3GA 4HZUA 4Z51A 2O8EB 2QMEA 1FTSA 4XWOA 1WQ1R 4TMKA 5JS8A 2G1JA 5FUWA 5GJCA 1IN8A 1G8YA 3KDSE 1E1QA 1W36B 1RRPA 1XNJA 2IYVA 4O3MA 1R5OA 3WRYC 1C9KA 4YXWD 1OT3A 2AK2A 3SFZA 1U99A 1NVVQ 4CEHA 4IDOA 2Z5FA 5D3MB 2OUKA 3CRW1 2G1KA 2ZRNA 1G7RA 4DUGD 3L0PA 3AVTA 1SXJE 4HI0E 1XJQA 4Q4LA 4CEIA 3OAAA 4CGZA 4F7WA 3AB3A 5GVSA 2J7PD 1D2NA 3PUZA 5TY0A 4FD2A 2DFKB 1IY0A 4B74A 2IX3A 3GCGA 1E2EA 5LBIA 4NTZA 3FE2A 4LC1A 2R6AA 2BJWA 3BFVA 3D7MA 4ARZA 1SXJB 4BLRA 4GL2A 1RFLA 2XTMA 3FHTA 3TKLA 1JJVA 2W2VA 2RB4A 4C0LA 1NF3A 1CR0A 4LJAA 2WPDA 3KQLA 2C8VA 3GEIA 4LZZA 1HQYE 2Q9CA 4MYCA 2BMJA 2F9LA 2O8EA 3A1WA 3WMEA 4AD8A 2ZRHA 3THOA 2R6FA 1NMXA 4S2EA 1F2UA 1G3IA 3IIMA 2E87A 5L3SB 4UXJA 1RJ9A 3UG7A 4RZ3A 5UKDA 5DSZA 2ORVA 3AVUA 1XMVA 4Q4HB 2KSQA 1G4UR 2HUPA 2J41A 1DS6A 3AKCA 4M1KA 3VKWA 3R9WA 5DI3B 721PA 2ZE6A 2RKOA 1XX6A 1MKYA 4JLVA 1GNPA 2AK3A 4LC0A 1ZUIA 2JLQA 3MGCA 4MGYR 4CVNA 2XZLA 1XXHE 3C4JA 2H7VA 1FMLA 2RGNA 3NBZC 4XVRA 5LB2A 3TIFA 3ZVNA 1X1RA 1UEIA 5C46F 2QT1A 2AFIE 3CNLA 4HB3A 3BS4A 1M34E 1X86B 3AF1A 2ZRLA 2Q0HA 2G0TA 1W0KD 3TQFA 3LY5A 2GHIA 2GESA 4IDHA 1XMSA 3AGQA 5AUOB 4EPVA 5DYIA 2HV8A 1UM8A 3A1TA 4TLAA 2QM8A 1BH2A 5EE1A 2ZRFA 1HY3A 3W8RA 5HTKA 4L9SA 3GLFA 4TYYA 3ND9A 1KYIA 3QEJA 1F2UB 3R9IA 5L3SA 1F5NA 1JXOA 1E3MA 2FSGA 4B47A 5FBLB 4IHQA 3U7GA 1T0JB 3LLUA 1KNXA 2WJJA 2VHUA 3L0IB 4IXNA 4M9XA 4Q4HA 3RRMA 2VLIA 2LCFA 2QMOA 2ODBA 1QRAA 3GLHA 3K9NA 5AK0A 5FOXA 4BLQA 3W90A 3EPJA 4TSFD 3A1SA 2VP6A 4PQRA 3EX7C 4M9ZA 1KO5A 3QEOA 3CLVA 1NMYA 4N1AA 4PZLA 4A36A 3DM5A 1COWA 3K0CA 4NYMR 1DAHA 1KSFX 1I4DD 1JI0A 4C3ZA 4CIDA 4NKRA 3NTUA 2IXGA 1N6NA 1YZUA 3AVPA 2GJAA 3OF5A 4ZPXA 1E96A 2K5UA 1E1RD 1MABB 4FIDA 4WW0A 1IAQA 1P61B 3CRVA 4CEIB 2JDIA 3QG1A 2A3RA 1G5RA 3UMSA 2BIFA 4XWAA 4S35A 1XXHA 2XOKD 3KXKA 1OF1A 2ZI3A 3S1AA 1TUIA 2QPAA 5HZHA 1KI4A 1NJGA 2ZUDA 3LBIA 4K8OA 1Z0FA 4NPHA 4HB4A 3I1FA 2I4IA 5EUMA 1FQJA 3KXIA 1TQ6A 1G1MA 4FMCF 4JVMA 1G5TA 4QGGA 2ZPTX 3HPQA 4DCVA 3VU9B 2OZEA 1DELA 4D26A 1D9XA 2EU8A 3B1WA 4TTRA 2ZE8A 1Q21A 3UXMA 2KBFA 3QXCA 4RD6A 1Q1BA 2C9CA 2GXAA 2RGGA 4YXWA 3EIHA 1PJRA 4Q9HA 1HYQA 1SGWA 5DI9A 4M22A 2DYKA 3EW9A 4NZYA 3U3KA 4A8JA 5C1BA 2E9SA 2LKDA 2VEDA 4EJSA 1YRBA 2OXCA 1SVMA 2WJIA 2QY9A 1DO0A 3G82C 4Q48A 1X3SA 4A2WA 4BLTA 3U5ZB 2HF9A 3CR8A 1W5SA 2ORIA 2WIAA 1EFHA 2YOHA 3THXB 5EQTA 4PANA 5JEEA 3W3AA 3ZH9B 1WMSA 4LV5B 2PL3A 1UKVY 3WP0A 1UDXA 3Q5DA 5B64A 5FOVA 4LX0A 2ZE7A 4EFMA 2CXXA 1GRQA 4IOMA 4CEJA 1NLFA 4JS0A 3A36A 4IW3B 3PXGA 5IK2A 1G20E 1P62B 5CLLA 5G40A 5JZVA 2ORWA 2PLRA 2XJ9A 2A78A 4P3YA 2ANCA 2QMHA 5JJIA 2NO1A 4HSEA 1BIFA 1U94A 1RJ9B 5J40A 1KJZA 2NGRA 3B9QA 1TQ4A 4TT3D 4TLEA 1FP6A 3CW2A 4KCGA 3TLXA 3X2SA 4RD1A 1NSFA 3UK6A 4BGDA 2ZUBA 3G0HA 1JNYA 2WTUA 4QC2A 1XEWY 1H8HD 2CVFA 2IXEA 2YWHA 3EC2A 4L4UA 3IBGA 4IDQA 5KUTA 1OXSC 2V9PA 2YOFA 2FSHA 4QJ5A 3ZD6A 4TN1A 4IXMA 1MRSA 3TK1A 2JEOA 2A5DA 2GF9A 1N5IA 4H1UA 2P67A 1MO6A 4JYCA 2GILA 2YC2C 2W6JA 4L16A 1LNZA 4MRPA 3K70D 5LPNA 1XTJA 4QBIA 2ZI6A 2WJYA 1R0XA 4JZKA 2VTKA 5AJZA 5JRZA 4AWXA 1CTQA 1K8RA 3KL4A 3PIRA 5JWHA 4MDFA 1S0UA 2ZSDA 5FTJA 1YZLA 3GLGB 1N2CE 3F0TA 5F98A 5H68A 2ZJ8A 4KLNA 4WIAA 4TSFA 4TTPA 1CF4A 3L8YA 4Q7JB 3VR2A 1I2MA 3V9PA 4K46A 2QTFA 4AYXA 1I4TD 3CNOA 4TYPA 3GQBA 1DE0A 4ZIRA 2GXSA 1G8HA 3EZ2A 3PUWA 4DJTA 3LA6A 1Z07A 5JSZA 5EXSA 1P9RA 3GLHB 5EZ6B 2ODWA 3HP1A 1L4YA 4B2IA 5K8TA 2YOGA 2IYQA 4GT1A 2IEZA 3R8CA 1F6BA 2KB0A 4QM7A 5GJBA 1QHXA 1QG4A 1SZPA 3T12A 3B7GA 2EFHB 3QF4B 3BOSA 1YR7A 1Q1ZA 2Z0MA 3K0EA 3Q5EA 4W7SA 4XTRA 4KJZA 4DLYA 4WZAE 5A4JA 4EPYA 1G6OA 2AR7A 2D74A 2QUZA 4GMXA 4II7A 3DO6A 2HEIA 4KV9A 3T35A 1W7AA 4PR0A 1NY6A 1LY1A 3QI2A 3LH5A 1E2GA 2C03A 1VDZA 4JT4A 1YHNA 3W6NA 4DEYA 3LXRA 3KUCA 3CUEF 3CF0A 4TZ0A 2Z4RA 2WMNB 1IHUA 3OEHA 1WF3A 4QXAA 1BS1A 4HZUB 3QBTA 2W6JD 2FWRA 1K5GA 4KHZA 3DZ8A 4P4TA 4RZUA 2DR3A 1HE8B 2ZSAA 1KI3A 2C95A 3IPYA 1JAIA 3QXXA 3K0FA 4BZPA 4NCIA 4NCHA 4Q9KA 1E9AA 2GK7A 1F3OA 4NCKA 1W0KA 2V6JA 2GXQA 1OKKD 2GCNA 1XD2B 3QBVA 1T9HA 2H16A 5L3RA 4ERNA 2B8TA 1VHLA 1VIAA 4IKEA 4NONA 3A1UA 4HLDA 4PFSA 3QNUA 4FINA 5KDDA 3DVLA 4NL4H 3U3MA 2RGEA 1SVOA 1KSHA 2H1LA 3P20A 3VR4A 4E03A 2AXNA 4ARZB 4ILEA 1G7TA 2ZU6A 1E9DA 2YV5A 1MR3F 2P3SA 2BOVA 1SVIA 2ZJZA 1KY2A 1NP6A 5JHHB 4JLJA 3J81k 1A4RA 1UBGA 2QL6A 2BM0A 1W4AA 5EP2A 1QHIA 2DFLA 4G0NA 4UNNA 3ZJYA 1ZU4A 4W9MC 3LDAA 3TR5A 4DVGA 3RHFA 4I4LA 1R0ZA 4DXAA 1F48A 1L7VC 5FFMA 2FN4A 2ZJ5A 2VF8A 4M9QA 3GFOA 4UQOA 1S9HA 1T6NA 2J0SA 1G64A 1TPZA 3I72A 3C41J 4JLPA 1U0HC 2P6UA 4G5RA 2DHRA 1G19A 1AQYA 1SXJA 5FPHA 1XCMA 4FCVA 2D06A 2ZIAA 1ZNZA 4EPTA 3QKRB 2FFQA 2JLUA 2OAP1 4QL3A 2W0SA 3T5DA 1N5LA 2ZU0C 2C77A 2GDJA 3FFBA 4Q4AB 4DLUA 1G7SA 4AKIA 5JS7A 1ONBA 3THYA 1E9SA 3CNNA 1NSTA 3FKSA 3VHLB 5IRCD 1XEFA 4URXR 1R8QA 1PV4A 3Q7PA 1W36C 3CZPA 2XNDA 4NCJA 4EPRA 3EIQA 5DHFA 4H9GA 3THWB 1WE2A 1H8ED 4MYTA 2BBTA 2KJQA 2IW3A 3V00A 1YZNA 4OHVA 4A1FA 5CM8B 5FBRB 3VFDA 2JLWA 4B35A 4LGMA 2A9KA 1Y3AA 5BN5A 3CRQA 2KE5A 2ZI4A 2VRWA 2ASEA 1UEJA 4AKGA 1LS6A 3QQ5A 4URUR 2ZJOA 1II8B 2ODNA 3A4NA 2V6IA 5AJXA 1E4YA 1GDDA 1T3HA 3WYFA 2AX4A 2XOKA 2EYQA 1V43A 4DSNA 2ZAOA 2YYZA 1YR9A 2O5VA 2IS6A 4LRWA 1SQ5A 1RZ3A 2A7QA 1XTSA 3BBPA 3N2IA 3MSXA 3BB1A 2J0QA 2HDNB 2XSZD 1SVSA 4W5JA 1KK1A 1S1CA 3X1XA 2REOA 2VHJA 4DKXA 3ZIAD 4AIIA 2FPLA 3MUFA 2CL6X 3A1VA 1KO1A 1UDWA 1Q3HA 2C2HA 5JCZA 1GRNA 2O52A 1TU4A 1UAAA 4R98A 1EXMA 4QBGB 1XJ0A 4PPFA 3VMFA 1B0UA 1A2BA 1QZXA 5GADl 2CNWD 5TARA 1G3QA 4L9WA 2B7CA 2Z83A 1X6VA 4HEJA 4QFMA 2EFCB 3PEVA 4A0FA 4JSTA 1E9EA 4M8NE 3LLMA 4LJ7A 2QBYB 621PA 2JAQA 1KI7A 4M1SA 2ZM5A 3TUZC 2BVNA 2KI5A 4PC1A 1AS0A 1E2MA 2X1VA 4PAMA 1NVWQ 4DIDA 2J87A 2OEPA 5BXQC 4CEHB 1VTKA 1LF0A 1XU4A 2BBWA 2PLFA 1Z8FA 2WWYA 2LKCA 1H8HA 1Q1EA 1AM4D 2YJTD 4B73A 2B7BA 3ZS9A 4HZIA 2AWOA 5KPJA 3DZDA 2GAAA 1ZUNB 2GBLA 4LHWA 2IXFA 2D2FA 3T15A 4A4DA 2IYWA 1TEXA 4JJZA 1Z28A 2JA1A 6Q21A 1EGAA 2B6HA 2D7CA 3PITA 4Q4JB 4TTQA 3KQNA 4M1OA 3C5HA 1CJUC 2G3YA 4A2QA 1ZD8A 2BBSA 4OBEA 2B8WA 1DAEA 2OM2A 2CHQA 4M2LA 2JLVA 1QVAA 1T0HB 1D2EA 2D3WA 1YZQA 4WXPA 4EDHA 3CO5A 4A82A 3GEEA 3MWLA 3WYGA 3KZ1E 4GRAA 4C0JA 3IIKA 3VX3A 2I3BA 2XXAA 3TGPA 4QM6A 1ZNWA 3WHKA 3JVUA 5FOUA 2DY1A 1SXJD 4NBSA 4KITB 2BDTA 3GJ3A 1GNRA 5JBQA 2BJVA 3SYKA 4BPBA 2MMCA 4IEIA 2WWIA 3ZVRA 3C8UA 2BWJA 2H5EA 1GKUB 4ITRC 3X1WA 1G5PA 1E99A 3K53A 1PVOA 5J5CA 1GKIA 2F3TA 4MGZR 1Z3IX 2H8KA 3AUYA 4RD3A 4C0QC 3K1JA 2UZIR 2XITA 3GFPA 4ASUA 5FPKA 2JLXA 1Z22A 1OFUX 1P9NA 3ADBA 5E4FA 1E2FA 3U7EB 1E2QA 1O3YA 4HLQB 1GTVA 3RS5A 1CKEA 2O8BA 4Q9IA 2JDID 2WJHA 3RABA 1Y63A 3TSZA 2JJ1D 421PA 4M1MA 1L8QA 1XFAA 4LV8B 3O8CA 1P5ZB 1W0JA 3E1SA 1KK3A 1XCGB 1CBUA 1Q12A 3FDIA 3QKTA 3KKMA 3IDQA 3FMFA 5ELXA 4MKFA 1XMIA 2DB3A 4A92A 5KSOA 2C96A 2FX3A 4IEEA 3OAAD 3KUDA 4UXHA 1QBKC 3O47A 3C15C 4Q1DA 3AVYA 5SZIA 3NBYC 3ONWA 4KSBA 4B32A 3P1JA 4LY6A 1NNEA 1Z5ZA 2OAQ1 2CJWA 1COWD 4WZ6A 4ZDKA 2A5FA 5C2JB 3LFUA 5KDLA 4HUQB 1WDTA 2PJRA 1NI3A 1Z2AA 2ZTSA 4V0ME 3SYNA 1UF9A 3WP1B 1FTNA 2AXPA 4Z8XA 2J45A 2IEYA 4HAZA 1EFCA 5FTNA 1E4VA 2GRJA 3QENA 4I1VA 5JFGA 1QHGA 2RAPA 4Z1MA 2XB2A 3RANA 5FPSA 3OE7A 2QEQA 3U4QA 4IOKA 3TUJC 1PLJA 1U9IA 1GIAA 4X8OA 4LDJA 5FI0B 3N2EA 1P2UA 2ZYWX 3L8ZA 4FWIB 3PVSA 2IHYA 3PCRB 2D62A 4BQSA 3QXHA 2QRNA 2RCNA 3MD0A 4ZDIA 3AQ4A 1WXQA 1JQLB 3EPKA 5CDFE 3GLFE 2F1JA 4BFXA 2UVQA 3F3YA 2HJVA 4YLGA 5EXPA 5AUNB 3BERA 2HYIC 2IT1A 2OBNA 3CWZA 1GWNA 3ZVLA 4Q00A 1OXUA 2WHXA 4AYTA 5KOYA 3LX8A 5B57C 1W36D 3IO3A 4CT5A 2ZYUX 3DL0A 5FOWA 4QGAA 4DLSA 4JYBA 3WNBA 1GAJA 2AFHE 2C5LA 3BJIC 3SJCA 1GRRA 4PTLA 4LUCA 3RSOA 4Q1EA 4TQUS 2D7DA 1OW3B 1DG3A 1UKEA 1M8PA 4HLUC 4A9AA 3O8RA 1QF9A 1E2JA 1X8KA 1US8B 2WKPA 2R6DA 1ANKA 2NOAA 1N6HA 1OYYA 4IJMA 4Q02A 4B71A 2PZFA 3VR5A 3VHXA 3PJRA 1FFHA 4LJYA 1TEVA 1B23P 4DCNA 4R71A 1NIJA 4BLOA 1J8YF 2C98A 3B82A 5GVRA 4DBLC 4HUTA 4U7DA 1RRGA 4TQAA 3GFTA 3KFXA 4DB2A 4BRWA 2XAUA 3HU1A 5K8UA 2V54A 2DWPA 4PPNA 5EE5B 3SHFA 4B3XA 3IILA 2P0EA 3DOFA 4B6EA 3KXLA 3SZRA 3W3ZB 4C0BA 3ADCA 2RGDA 1E9RA 2ZRGA 3ZQ6A 2QORA 1EG7A 4MRSA 3REFA 1K6MA 1NBMD 3OFND 1S9DA 1DTSA 4XVUA 4KFTA 1S96A 1TQDA 1GL6A 2NZJA 4TL9A 1FW6A 1P2SA 3SE0A 1VG8A 3WNCA 4IDNA 2Q3HA 5CB6A 1N6OA 4IDPA 1X8LA 4UJ5A 1DG1G 3OIYA 3PENA 3PQCA 3BC1A 4RKEA 1CJVC 1FNNA 1LF5A 1LFDB 1UPTA 1YVDA 4MITA 1GILA 1AKYA 3UKDA 1IN5A 2AD1A 2V55B 1EWQA 1VYTA 3FMIA 3RRYA 2CNWA 1G16A 2GJ8A 2BHRA 4D4KA 3GPLA 4HAXA 3RS2A 3HYRA 2VH5R 2VO1A 3M1IA 3MMPA 5KHOC 2GVDC 1KSGA 1XEXA 1P3JA 1UADA 3D6TB 2E1RA 1N0VC 3GEHA 1EFTA 1P72A 2ZVQX 2C04A 2J3EA 3CPJB 1ZMXA 5KDOA 3WMGA 2A2ZA 1E2PA 2QA5A 4FMCB 2P6RA 3K9HA 3AVWA 4TMVA 5JJKA 2IS4A 2OCYC 1Q22A 2ZRIA 1JR3E 4QBFA 3K0SA 1YZGA 1OB2A 1NN3A 2Q9BA 2VIIA 1PUIA 1R6BX 1XD9A 3M0EA 2XZPA 4U5XA 4D81A 2CLSA 3FWYA 1CXZA 2J7KA 2QP3A 2F43B 1KIMA 2ZANA 3W8NA 2O8FB 2QZ4A 4BWYA 1UBCA 2G6BA 1EFUA 2ZJYA 3ZDQA 5G3ZA 1JQJC 5F9HA 4DLRA 4C0AC 4OK5A 4JSYA 121PA 1M1YE 2GVZC 3MWJA 4DT1B 1GG2A 4PSKA 1ZM4A 1MO5A 1FP7A 3AF4A 2IYUA 2NO7A 4YMWA 4YQFA 2JCSA 4EQ6A 4PPGA 1FZQA 1YJ5A 4O25A 3BH0A 2FEMA 1VKJA 4ZDWA 1F2TB 5EE9A 2NO9A 3CRRA 1OJLA 3F5FA 3TAUA 5TDHA 1Q20A 4FN5A 5HCNA 2GCOA 4PQYA 3FGNA 4IVPA 2HT1A 1R5BA 1SULA 3PEUA 1XZPA 2RGNC 4CW7A 1JPNA 2WSSD 1XD2A 3WBKA 4E5UA 3RNLA 4LJ4A 4LJ8A 3WYAA 4TWZA 4MKHA 1W48A 1ODFA 5HKKA 2FGJA 3SS8A 3ADDA 3IQWA 4OQMA 1EX6A 2ZVPX 5LD2C 2GAOA 5J4KA 2YINC 3THXA 1E2KA 4TQ9A 3O8DA 1N6IA 3CPHA 1IONA 2ZS9A 4I99A 3NBXX 4POAA 2FF7A 4BUJA 5HE8A 4P31A 5GJVC 1IM2A 2NMVA 2JLZA 1BMFD 1E79D 1VYUA 1EWRA 2FZLA 4HB2A 2ZR0A 2JIZA 3EA0A 2FFAA 4GFDA 2W6IA 4OJKA 2J0UB 2P65A 3AVOA 1Z0KA 1RYFA 1GSIA 3QF4A 4M53A 3A37A 4B76A 3A8TA 3P32A 4MRVA 4EAQA 1LB1B 4KVGA 4NYJQ 3RRZA 3X1YA 2XNSA 4RSGA 1ZCBA 3EZ9A 2VP5A 2Z6VA 4WVFA 3CX8A 1NL3A 5FUYA 4ZV4A 2PCJA 1WA5A 1EK0A 2OFOA 5G53C 3SU8A 1NN5A 1E0JA 1G4AE 5FBQB 3KKPA 1NY5A 2F55A 2AKYA 1S8FA 1U0LA 3EAQA 1U90A 2ZRPA 4LHXA 2XGJA 3U44B 4JKYA 4M9SA 2QI9C 3QXSA 5EUQB 1ZD9A 3PR1A 4QG7A 3TBKA 5L3VA 1SVWA 1TNDA 1IY1A 1IBRA 4MGKR 2GJKA 3FPAA 5B2ZA 3Q3JB 1AGPA 1ZAKA 4GP7A 3SDZA 3W5JA 1C4OA 2GETA 5LDDC 4NYIR 2V3CC 1RE0A 4D6PA 5HCIA 4BZQA 1KI8A 5KU1A 4OJQA 5FOTA 2DPXA 1II8A 4P4SB 5GJWC 4G5QA 3U61B 3I92A 4CRWB 1OXXK 4QRHA 1VG0B 2XEXA 3T06B 1CU1A 1BOFA 1HA3A 1ZNYA 1N6PA 1MOZA 4RKFA 1XTIA 5FTLA 1KZGB 3AKEA 1CIPA 2I1QA 4JT2A 4LYJA 1Z6GA 1E9BA 2O8CB 1D6JA 1NVVR 3NDPA 1US8A 2QP4A 2OCBA 2ZRCA 4FXPA 4KODA 4I1SA 4DLZA 1T4GA 4G5OA 4A8JB 3VX4A 5IF9A 2VBCA 1L4UA 4Q1BA 4D25A 2CE2X 4HLCA 1II9A 4JLDA 4OQFA 4KYUA 2IYLD
chains in the Genus database with same CATH superfamily
4LCBA 4UHHA 2F3RA 4EMSA 2UZ3A 1SKFA 4ARBA 2WWXA 1D0SA 5IJXA 4AXBA 2PR6A 4QGBA 5A3QA 5DWQA 1Z25A 4G85A 4AJ1A 4H6XA 3UIEA 5JEDA 2UZ1A 4REOA 4UNQA 3R0JA 2PVCA 5DE3A 1ND5A 3E7DA 4DLKA 3QBJA 3N3BC 1EX7A 2QTVB 4P8RA 4DWVA 1SOWA 4UKDA 4KBGA 2OO5C 2XOXA 2FZGA 5EQJB 1D4OA 5EAIA 5EOOA 3R6DA 4P86A 3ZXUB 3GR6A 1U8AA 2F1HA 1Z0AA 3QLVC 2NZXA 4HDMB 4OQLA 1PLLA 4PSVA 1DBPA 2QMUA 4BKUA 4ZU3A 1XTZA 4EBBA 4IFTA 3PBQA 1JB9A 4ABYA 1LHYA 2F1KA 3DKVA 1YAHA 3EWSA 4N39A 5FOSA 3C5CA 2P5SA 5DH9A 1KDPA 2PO7A 1DIOB 2DMRA 3GLIA 1SHLA 2D0OB 1NRJB 2VNHA 4OPZA 5DCWA 5KWJA 3SHWA 5CBKA 1C1DB 1SKMA 1UK8A 4QY5A 3FYCA 3R77A 4R1LA 1MDFA 2X0KA 2CNNA 1OZHA 3KQUA 1AC5A 1EAMA 5DM0A 5B36A 2QXUA 3GFFA 4R2LA 2XB4A 3AUSA 4LOHA 3QU2A 5CGWA 1SRQA 1CZLA 3ZY4A 2WWWA 3O2JA 1NVBA 3PWTA 4TTAA 3DTVD 4I66A 2M2IA 4AAYA 5CEJA 3QX8A 2YQ5A 2IZ1A 3SQXA 3JD3A 4F2WA 4JI7B 3JXEA 5FQQA 5JCJA 2CNKA 3FIUA 1QGYA 3FNQA 2REXB 2YJ3A 3R3UA 1E1YA 4BY9E 4Q4JA 5JATA 3IKTA 1Y3HA 1FOFA 4H35A 3VR3D 5BQOA 4BQMA 4AUKA 4CDRA 5LQUA 4KMSA 2H92A 3HO6A 4P1ZA 2ZJAA 2X1MA 3U17A 2AG8A 1ZD3A 4PYLA 1RLJA 3ZVKA 3U7HB 3C30A 3AKYA 2WA2A 1U0EA 1RAEA 2BCGY 3WNZA 1JR6A 4ZYWA 3VZSA 1QZUA 4C2TA 3QVLA 3AV0B 3HUOA 3QP5A 1PLKA 2HLDD 2I4MA 1R6VA 2NO0A 3OM9A 1II0A 2C59A 4OGLA 3P8ZA 4E2ZA 1BXGB 4G4GA 4PC7A 3LECA 4ZI2A 3ACCA 1PZOA 2E37A 5AM1A 4C20A 5JAOA 4FHFA 4XYEA 4ZARA 1IEMA 2MYPA 4ND6A 3V8MA 4D8XA 2CDCA 2QZ6A 2EFUA 4YDQA 2Y1XA 4RFVA 4LZPA 1E3WB 2PDAA 4JT8A 1RIFA 1C1YA 1ZMRA 5C3MA 1D1QA 4GKUA 1K5DA 2Y6VA 4CF7A 2P78A 4DIDA 4TLDA 1NZDA 3FDJA 4E5SA 4CUKA 2CSUA 1I3OA 2AFHB 3AONB 4WBSA 1ULSA 3VC1A 1TZCA 3BYZA 1NKVA 4ZGGA 5J2TA 3P94A 1NBOA 2NG1A 1QGED 4PX3A 5A6SB 4F5DA 5FI6A 1DNPA 2VSOA 3Q12A 4LWZA 4WCFC 1T8UA 3K2IA 4RLSA 4WY2A 4FYVA 5DX8A 4IRXA 2NU8A 4K2HA 4DJ2A 3ZHXA 3K94A 5EIBD 1E66A 2OZVA 2GN9A 4E3OA 3ENNA 5E6UA 2ERXA 1UJ6A 3IX7A 4LRXA 1M74A 4OHZA 2HX1A 3U3RA 3BWDD 2J3IA 2R6CA 3HKCA 4JP2A 4YMUA 2CHVA 3OC0A 1Z35A 2OG1A 4JEHA 4P7FA 2H0YA 2XB9A 2DQKA 1NJ6A 3KEGA 4KFRA 5L51A 2B4YA 1GUFA 4MUAA 5JU6A 4Y1GA 1DEKA 1F2VA 1S7CA 3SGLA 3K15A 3PR2B 1ZDMA 3ANSA 3E3MA 4RQAA 3UZUA 5LQAA 4Q7MB 3UOAB 2CNDA 1MRZA 4MQEA 5B1HA 3RG2A 3NBAA 4CKWB 3LC1O 3BF8A 2GN1A 1BMTA 3DBVO 1DXQA 1Y9JA 3GFVA 2P4SA 4ND8B 5FYQA 4DR2B 3U7FB 5BQXA 2A94A 2WWFA 1TZ2A 3DE3X 3LWBA 4Y1RA 4EHAA 2HRCA 4GBGA 4EHHA 2O4UX 4LHYA 2E4WA 2YS7A 3M6MD 3KEQA 4BMNA 3QY0A 4PSAA 1A7JA 2VBFA 4PLCA 2H1HA 4NCAA 4GZLA 1AJEA 3PBOA 2OLEA 4B34A 4P4SA 1EFRA 3FKWA 2NVUB 5C1OA 2EJWA 4CG2A 1PEDA 5IMBA 1DARA 4MBKA 3JQ7A 4RIFA 1GDTA 5E4YA 2BZGA 4UEWA 4CEIB 1E61A 1Z06A 4GXQA 4ZT6A 3TQCA 4JL6A 1NR5A 1NHGA 3ZEIA 3ZCTA 1QPZA 2WYXA 2NAPA 1TA0A 2Q21A 1QQ7A 5I7EA 4IDDA 3FDXA 2XE7A 2QSJA 1LBEA 4URWR 4L4RA 2ZREA 5CK5A 3UV3A 4BMDA 1IWBB 1Y9ZA 4YJ3A 1B8UA 4DUZB 3H1BA 2P3QA 3UHJA 3BL6A 2PV7A 4U2CA 4DQUA 1SXQA 1N2SA 4YAGA 3BRSA 4Q93A 4EHLA 1H8EA 4N8EA 1IDOA 2GZHA 2OQVA 4LW8A 1RC0A 4X53A 4NI5A 1LJ8A 2I7CA 4A91A 5MDHA 3CVWA 4KR7A 1EE1A 5LLSA 1AH2A 3MERA 4LNHA 2QE7D 3EGXB 3D1LA 4QDOA 1YL7A 4D5EA 3EF0A 5KVSA 1HNNA 2HK9A 4MV3A 4DA0A 5B12A 5ENVA 4BFCA 3UB5P 1P0ZA 5IT5A 3IAEA 4QGFA 1N4AA 4BVAA 5F2NA 3IPLA 3RXXA 1TC1A 2CJWB 3KJIA 4KWTA 1K08A 8MHTA 3K09C 4QJ3A 4PZAA 2M1CA 1OH5A 3IKJA 4RCZA 3VNVA 2WV9A 2Y2HA 4MKIA 4X94A 1FOEB 5CVVA 2FETA 1GGEA 3JAMA 3LIBA 2F64A 2FEXA 5DBFA 5ERYA 5JD4A 3WL5A 3LGAA 5K03A 3NP9A 2X3FA 4GHIB 1CE8A 2XW6A 4KAJA 4M1ZA 4NE7A 2QN9A 3PIIA 5BN3A 2OA0A 4IUCS 1RE1A 1Z62A 4AX4A 1XYVA 4BKOA 3L8DA 1V5WA 4FJ1A 4QUJA 1R0CA 5BQFA 2QPNA 1TTTA 5F9MA 5A6VA 2J46A 3E05A 1C1HA 1HQCA 5A0TA 5T4BA 2J6IA 2HRQA 2WT8A 1NW9B 4JVSB 4YRLA 4IRMA 4GW9A 2FFBA 2LDXA 3L0YA 4BCBA 3PPXA 1HLDA 4Q1AA 2JFGA 5ALSA 2V4MA 4LK3A 4NV0A 1KTVA 1ZAYA 1L7QA 3BTSA 3L7AA 1SUAA 1B41A 4C07A 3G9XA 2QX7A 3FOAA 1JT2A 4CFYA 2VPXA 3GC6A 3LHFA 1J9EA 4I50B 5MGNA 4N5IX 5AJWA 1L1FA 3KSFA 3R4VA 3MLEA 3X2FA 4DA6A 2P2SA 4EHIA 1E7QA 5DN6A 1NWCA 5I9SA 3T9AA 4IJVA 1HF3A 1Z38A 4HVCA 1QTIA 1MH1A 5EMJA 1O89A 1QHFA 2BGNA 4EPWA 2DLDA 1VSVA 1GA0A 3TSCA 5K5BA 4XTCS 4DE5A 4RCYA 3A32A 4QXOA 1W5AA 1U11A 2FSVC 2PZMA 2IS2A 2DBYA 4GX1A 3CVVA 1ZNQO 2AFRA 3S7QA 3EA5A 5TF0A 4S2OA 1COZA 3Q3IA 1EE2A 4OM7A 4E09A 2DXIA 2PAAA 4L5IA 3ROPA 4F9GA 3DBRB 3E15A 3I9OA 5A93A 1WCXA 4XJXA 2WTMA 3N1UA 5HM8A 1R2QA 4PYRA 5CLHA 4D8YA 2Z6CA 5JANA 1JJBA 3Q3VA 4GVPA 4XJTA 3U6BA 1NAHA 2IV3A 4HB0A 2MT9A 1PU2A 4CLOA 2HNKA 3WGQA 5IXSA 3MJHA 4L9FA 1B8OA 3N74A 3P0JA 4MS4B 3OJOA 4OMFG 2Y8EA 4YCMA 4KXMA 4RBNA 3T0FA 3UPDA 1UWKA 3ORSA 4NZOA 4BFZA 2XLNA 1HKHA 1U5CA 1ZD4A 3QP6A 2GYWA 2J8ZA 3QX9A 4GS9A 3U4HA 7MHTA 1G8FA 1VHDA 1NDQA 5JCPA 5EP1A 3U3OA 4QWMA 1JLSA 1ZITA 1LSXA 3NC8A 1YQUA 3GB9A 3NIAA 1D4FA 3WIDA 1G5QA 2IWDA 1SCQA 3O26A 4EO9A 1DL5A 5E6UB 4AF6A 5HPFA 2QTBA 3IUYA 2ZQDA 3FNEA 2V8FA 1L5RA 2R1ZA 1VL6A 5H0IA 4F93B 1OXTA 4OA8A 5CD9A 1L4BA 1L5GB 1RRCA 2GO1A 1QUEA 2QL7A 1O94D 3L7MA 2OC4A 4V0OA 4V0QA 2PGOA 3IIIA 4GWLA 4Z4IA 1XQVA 3F2VA 3GCDA 3O4HA 1O97D 1KARA 3NH9A 4C6TA 4XARA 3ED5A 3HYCA 2XODA 5HDCA 3PB3A 2VDJA 1V8DA 1NKTA 3H82A 1NIPA 3UB4A 5JAUA 2QI9F 5AKZA 3SJAA 3TSGA 2I1WA 4PC6A 4RIEA 3HCWA 1P6XA 1A8PA 3HJCA 4GOKA 1CD5A 3ZHRA 5D85A 2QD5A 2O8BB 3NVMB 1FXWF 4GKBA 2IC5A 4ZRRA 3SSOA 1LT0A 4YDHB 1AS2A 4EY5A 4MO2A 4C4XA 2BFAA 3KSHA 4X1MA 3DHVA 5H16A 4EYOA 1MFPA 2VQDA 3QX7A 4TLLB 1U2ZA 3HCFA 1YVEI 4FCWA 4NG5A 4BEJA 1E3UD 4A15A 2PX3A 5HF5A 1VYVA 4FFSA 3L4JA 2GCIA 1HFWA 2VJAA 2XB8A 2GZDA 3SBOA 2WD9A 3NWJA 5IARA 3ZJ4A 4DUPA 2F2TA 3EY9A 1A96A 3D54D 3EDQA 2O3UA 2EZTA 4TT3A 2MSCB 5LP6C 2V9ZA 4MJXA 4YRNA 1VCNA 2V7QD 4JJAA 5FHRA 2AEFA 3OJFA 1TTPB 3GZ4A 3A7EA 3NAMA 2IH5A 3DXYA 4NLLA 4AKHA 1IXKA 4KZKA 1V3VA 2GTHA 3ZNYA 4CM4B 2XDAA 3H75A 1W5EA 1I4LD 2F90A 3LFTA 4E6WA 2PYIA 4OY3A 2QTZA 4ZOAA 3JZMA 4MVJA 1OFHA 1SUSA 2J3HA 4GMDA 4D5GA 1XPJA 1O95A 2GNAA 4XQ0A 5FQMA 1BXRA 1JR3D 1QHSA 2YNMC 3ZV4A 5KTRA 3AM1A 3GW8A 4MCJA 3JYIA 1N9NA 1AZSC 4JFRA 3DL4A 2Q27A 1MB3A 4DCPA 1YS4A 2QW8A 5CU7A 1R8XA 5HAQA 3IESA 1VPWA 1G3MA 1T3ZA 4Z3KA 4B0OA 1HGXA 2Z30A 3L05A 3PJGA 3SQMA 4GI3A 1Y6QA 3R5SA 1IQPA 2MTBA 3PLAE 1CX9B 1R9NA 1ES4A 3C87A 4M8KA 3BZWA 3K7EA 3R3SA 4MUIA 2G08A 5JYDA 3JQEA 5IWAB 1KU0A 1YR6A 1EWTA 2D0PB 4L85A 1KMHA 2DUMA 3PNMA 1Q74A 3W6PA 3NDGA 3WB9A 3IXHA 5F3WB 1KHTA 3D02A 3AUJB 4RADA 3ROTA 1ZIXA 1IN4A 3LQ4A 3NTLA 4PGGA 1RS0A 1TIPA 5CD1A 3K6SA 1LVGA 1GFWA 1HG1A 4JYAB 1NZOA 1F38A 2F6RA 4HAUA 1BZYA 3HJNA 4HD8A 5I5GA 3RLFA 3KQKA 1YR8A 4U0XA 3G34A 2QX6A 3QUCA 4MVJD 5I8WA 2IDMA 2HU2A 1EX9A 4FE3A 1I7QB 4QUDA 5HS6A 4OJTA 4H1TA 4WPGA 3LPDA 4FZ5A 3QOWA 4MYHA 5B1SA 4CCAA 4JMPA 5IZCC 3IHTA 1DGQA 1P9WA 1R8JA 2G9QA 2HHLA 3JVEA 1XXLA 4P3OA 4WXHA 1PKXA 2PKEA 4YDSA 3VV3A 1PL6A 1NBME 1YB1A 4DV1B 1JG6A 3E9ZA 1QRSA 1QF7A 4TTIA 1XVAA 3KDAA 2X7JA 1HFJA 3KU1A 2QJFA 3HR8A 1U3CA 4KXNA 4WLEA 3VR2D 2FW1A 3GCZA 4RANA 3TW8B 4X6LA 4NS4A 3O1JC 3NULA 5HIAA 2Z1MA 2ZAIA 3ZG8B 1Y7LA 1KH3A 1RLUA 3F6RA 4QIHA 4US0R 2WOOA 2RJNA 2J9PA 2JKYA 4K9KA 2FZCA 5KTKA 3CXRA 3BWVA 4RMGA 4KIJA 1NNUA 1XQYA 2QSUA 3R44A 3EZFA 5HWTA 3HQ4O 2Z9DA 5C5CA 1KEWA 4EFDA 1DI0A 3DDHA 4XUDA 1LJUA 3EZ7A 3GVXA 1ESUA 1YS7A 4MW5A 2BC9A 3TOVA 2FPIA 3B51X 5EVIA 1U1CA 2JKTI 2PBLA 2WNIA 3I28A 5AW3A 5JXGA 2MSDB 3EVNA 4L3WA 1EVLA 3CUKA 5A5GA 4Z1WA 2V6MA 1BD4A 1M54A 5CBPA 1KO4A 4RY8A 3ZNOA 5ESWA 2XTNA 4LRUA 1KMQA 1ITZA 4MV6A 4CLCC 5U9CA 1MN6A 3HKCB 1J24A 3W78A 1HE2A 3CN9A 1P5FA 1WXXA 2V65A 3ECAA 4EFLA 3MJCA 1ENYA 4MLDA 3K5IA 2ALJA 4MVJM 1NYYA 1DT5A 3V1UA 5CT9A 2OPHA 4CMAA 4LHVA 1YLPA 1YL5A 4Q9LA 4IIGA 4WBNF 5K8TA 2EJCA 1RYHA 3QPCA 4KVAA 1KI6A 1ZWLA 5B58C 3MTAA 5BVGB 5M04A 4ZVLA 2ZOHA 3K73O 1TFRA 3V7YA 2QTCA 3BSYA 3ZE2B 2VYQA 4OJYA 3ZK7A 3P9ZA 1F12A 3H3JA 3H42B 1MAUA 4B3MB 4LXIA 2NWQA 3WYDA 2YX1A 1CUVA 3DKIA 4AWAA 2DRIA 5EHXA 1T1IA 5CA1B 4JJKA 1UT8A 3EVFA 2LE0A 2CGEA 4MRNA 3K9WA 1NW5A 5EFWA 2FFJA 4LV3A 1YI1A 1QORA 2G80A 2PXAA 2W98A 3K2BA 2HSWA 3R5HA 4KI7A 5BNZA 3UB3A 6CHYA 3IEVA 3CNBA 4F4FA 4IUHA 2W6QA 3BX1A 5EWJA 3P2YA 1YLTA 1U2RA 1AB5A 1NW3A 1USUA 2QZJA 2FRDA 1FYEA 4MJ3A 1XVUA 3T4KA 5HWWA 1DC6A 3ZY3A 5F7OA 2WADA 4CKBA 2R62A 4ML3A 2PGNA 2IZ7A 4CHTA 3A1FA 5T4EA 2Y1CA 4BV9A 1NRIA 2WF5A 4MWDA 4FFPA 2YVKA 1UP7A 3P26A 4HWGA 4IKOA 4YRGA 3AM5A 2JBHA 2P9QA 3BMNA 4BIIA 2AUMA 2NZ8A 3FKSD 1K57C 5JAHA 2C99A 3A4VA 4B3FX 4DIEA 4DBZA 2FZ5A 3FJ1A 3AIOA 2C2ZA 1DZIA 1D3AA 3TCXB 4B6GA 2VJBA 1S2MA 3BIFA 4PXAA 4PRYA 1UXGA 3N5CA 2C4UA 4N03A 4E70A 2VATA 4BUZA 1R7RA 3KAKA 3T9CA 1HE3A 1JXMA 2J3TC 1KJJA 1L1RA 3B3QA 1S01A 2BKAA 4NJMB 3FZQA 3GPBA 1C9JA 1PS8A 2WICA 1KP9A 1XRNA 2F1RA 3QLVA 1VLMA 5H83A 3SEQA 5DBHX 4K5QA 3HN6A 3P4XA 3OBFA 5H02A 2BFBB 2IZZA 3KJFA 5BPHA 5LJIA 4HCJA 2ZYIA 4LF7B 2ERYA 5DRTA 4YWJA 4BP9A 4O8GA 1TJ5A 3AEQA 3W5AA 2C7OA 4EI7A 2PUVA 3WMXA 3IWOA 1YMQA 4OQXA 4RMJA 2LRHA 1LPPA 3FPBA 4KQ9A 4IMJB 3V39A 2HH9A 3DWFA 3UE0A 2QX4A 1L7DA 5EQDA 2IBSA 4RC9A 4B3GA 3RU3A 2WZZA 1HK7A 2XYQA 3NY4A 4IVQA 4D9HA 4Z1MD 4G8DA 2VTBA 2ZI9A 1BE6A 1GEEA 5AXBA 4E6XA 1E6EA 1M1XB 1E0AA 1K66A 3H9JA 3B33A 2I7TA 2G9VA 3O4FA 2LIVA 3C97A 3K0BA 4BTLA 3LSTA 5FWDA 3P96A 1JWLA 1EIWA 3H7WA 2PGAA 3B70A 4XUEA 2I7VA 1MP0A 3SC3A 2F8LA 2V6GA 3VR6A 4GOJA 5ER6A 5KTNA 4MH0R 5KTMA 2WPNA 3KT6A 4ZHSA 1ZW6A 2AXEA 3GDIA 3C7CB 3OZRA 3Q1LA 2GKGA 4L02A 1FTQA 1R3UA 4YH1A 1OTHA 4J7AA 5CEEA 4ALIA 4I19A 4O0MA 4CM9D 1MX3A 1OHHA 3P9IA 4IO0A 1EGVB 3TXAA 1BSVA 2RGAA 2JAUA 2WHRA 3FOBA 2VDMB 3OLVA 4WXMA 2JI6A 5TQ0B 3VHQA 2E1PA 2OV8A 4LGCA 3AERA 3B60A 2CV1A 3I2YX 2JGJA 1GSAA 4B46A 3DNPA 1YSQA 1J33A 2A35A 4J90A 3KUKA 2F43A 1H1TA 3E2KA 4Q39A 1CZNA 3GBVA 3H18A 3A2NA 3EASA 5TT0A 1U63A 2VZ0A 1E1QD 4I3JA 4S2NC 2AZTA 4IGIA 3UWOA 4JLKA 1DMRA 2NU7B 2J0UA 2PEZA 1T8WA 2IHZA 2J9FA 4AECA 1CJMA 3V7NA 4EEXA 4ER0A 3KL2A 3DVSX 2DH5A 5ALWA 3UWSA 2UU9B 2WSMA 3P2OA 3FYUA 2VPWA 3TLKA 5KYUB 2WC1A 1QAQA 3A9SA 4OB7A 3Q9NA 2PL5A 4TYQA 2KLBA 4YVFA 1KAGA 1KYVA 2VCEA 2VUIB 4P08A 5D5HA 5SZKB 2PD7A 2FW0A 3LUJA 4DR1B 2WU4A 3E81A 4HWRA 4IIBA 2NPFA 3EEHA 1AMNA 1ZHHB 4W9NC 3RVMA 3KP1A 5LZ2A 2P04A 2VL7A 3UAGA 4EA6A 2OT3B 3MWDB 1LW7A 1SC1A 2JIZD 2O0KA 4PO3X 4WA8A 1NFRA 5AH0A 1FLNA 3PVZA 1AGRA 2JIOA 1NDHA 4NZPA 3V32A 5CEFA 1RPZA 3QOFA 1Z68A 4RZQA 1TF1A 1D8TA 3LIAA 4BO3A 1PFUA 4AJPA 4WBNB 3IPAA 2O7NA 3D2LA 2HJEA 5F1FA 1U4SA 3G85A 3IKMB 5FPYA 2GR9A 1G5UA 1FB5A 3TD2A 4F60A 1Q2UA 2BMVA 4YP9A 4FH4A 1RYMA 4B9EA 2Q28A 5F2EA 3I2IA 4ZVRA 4JGPA 3TVDA 5TJ9A 2QR5A 4ZEWA 2GWHA 4NXNB 1ZLYA 3VO1A 1NUSA 2ZTUA 4UUQA 5DBEX 1R15A 2NUBA 3B9RA 3DQZA 1SHZA 1KPGA 4Q8IA 4NETA 3T1RA 2PZEA 5FSRA 2Q2OA 1GZHB 5TEVA 2JCVA 2PT5A 4EB0A 2LR0A 2ZYSA 1U80A 3CT4A 1JA9A 3EFOB 4G07A 1RBMA 3KYZA 3DH0A 2IELA 3H5IA 5DLQC 1DOAA 4M9RA 5ICFA 2FN8A 1A1VA 5LQMA 5L4LA 4DOMA 2PA3A 1HDCA 3FOWA 2B7LA 2CBXA 5BWMA 1YVPA 3OCVA 3PXCX 4JLMA 4IQFA 3G5AA 4HYEA 4OVKA 3CH4B 3ONNA 4RPIA 5J8XA 1T3SA 2A5JA 2RHMA 4GI5A 2IOFK 3RVNA 5K7SA 2ZJ3A 3ZW7A 2HXGA 1CUIA 4BVJA 5A5VA 3EQZA 2IU0A 1WTCA 5CDUA 3W3AH 4AIRA 4F2HA 3UDXA 4Y2VA 4ESVA 3A4LA 4G81A 821PA 2Y1WA 1KGGA 1E3EA 1JFFB 1Z6XA 5CJ2A 1O96A 3HLDA 1CZUA 3IBFA 3IKVA 3OUZA 5JNUA 5F9FA 3TKAA 4D3ZA 3QKSA 1MG5A 4IRUB 4MCHA 3SJZA 1T4CB 2V5UA 4XR9A 2J4CA 5JRJA 3U2AA 3T0IA 1PNOA 4YAIA 2RD2A 3U56A 1T24A 3SKYA 2FPMA 1TM4E 3C6XA 4FHCA 5JSQA 1EDZA 4QNMA 1R74A 3CSUA 1BO6A 2NUPA 3M1LA 3DD5A 3V1TC 3IH8A 4IV0A 5H1YA 1OAKA 4RD0A 5J43A 3A1CA 3LGSA 2PT6A 2XJ4A 3ZC3A 2QUBA 2R1TA 4GI1A 3H87A 4R51A 4E5YA 4URHA 1X74A 1T1BA 3O87A 3PGMA 1X1DA 2W2OA 3MCVA 3VMAA 1VI2A 3WK7A 3LMKA 1AZLA 2WILA 4DF6A 3WLEA 2VYFA 1IQRA 2GD1O 3AM3A 3ZBTA 2FQXA 3HL0A 2GZ1A 3SZOA 1GQSA 1LBQA 2WAXA 2ZRDA 4LSMA 1YLZA 1ZC4A 1OH8A 2ZBPA 2ZIZA 3H17A 1KVMA 3OLZA 1LU9A 3KO8A 4MV0A 4O2AF 5CIWA 4BGIA 2C54A 3F74A 5TB5A 3SC2A 4UTPA 1SQ6A 1P19A 1FK8A 2BEVB 2X2FA 3C8ZA 2OUIA 3DBOB 2LIPA 4K87A 2WUGA 3IEIA 3Q3CA 4C7BA 2VTBB 4DKIA 4KXLA 1O96B 1YBHA 4QYSA 1B93A 1I1OA 2WF8A 3KJEA 1J70A 3AGDA 4L8VA 4W6ZA 1JG7A 1K63A 2G5PA 3OEWA 4J2TA 3VH1A 3ZX4A 4M8LA 3H6GA 4H3HB 4EEUA 4AZVA 1DKMA 1M0TA 1RYBA 2J7PA 2PX8A 2QNBA 3EDMA 4X24A 5DLYA 1CFJA 1DV1A 5KYUA 3T3OA 2AQ8A 5CR9A 1CR1A 4ZXPA 1MORA 2GEKA 4UHUA 3AOEC 4OF4A 4OQZA 2F1IA 5EPOA 3A4MA 1MOPA 3C1OA 3VNQA 3VZRA 4E33A 4A5SA 2J3LA 3C3MA 1ZHHA 5GIOE 2H59A 1VGQA 2G4CA 4F92B 4KPFC 1TCBA 4F3LB 4L3OA 3K96A 2VDUE 2X0JA 3QVUA 5LZ5A 5SZJA 3PVCA 4ZCRA 9MHTA 4RAOA 1OB5A 4UEOA 3A1EA 4GDNA 1EP1B 2VXBA 2RGCA 4ASUD 5FATA 1PFKA 5E1MA 3ZGXA 3T7CA 1UC9A 1GAQA 3OT1A 2H2GA 4Y9TA 1XRLA 4I2NA 5FL3A 2VJQA 2ES4A 3N0VA 1G9TA 2V1UA 3I58A 4QOEA 1PNVA 3PA6A 2A3NA 3D3QA 5HFJA 4HVLA 1VHTA 1YBVA 1ZJ5A 4ZCQA 2G8NA 5FQIA 2OO5A 4P54A 1TKRA 3B5JA 2FOLA 3FDFA 4C2AA 3OT4A 3I5XA 4D2IA 2L4RA 1W9HA 2XNCA 1YTUA 1W19A 4B48A 4XGNA 1RYYA 1EXNA 1MGPA 1NYLA 4Q1FA 4YS6A 3ITAA 2OFWA 4JHLA 2O48X 3VJLA 1JAXA 3PRJA 3FMGA 1GHIA 4X56A 2YYAA 5CBPB 1NI5A 1X1CA 5AVSA 1X39A 5IEJA 1UZAA 5KTYA 1XKQA 1YJBA 3E4CA 3CF4A 3FCXA 4BMWA 2GCEA 3B2NA 3OCCA 2V6FA 4V0NA 1TA4A 4KK3A 1IJFA 4PC2A 4W8GA 1CNMA 1CW2B 1MZPA 4FSFA 3EBPA 1IIBA 3AH8A 1PWGA 4X69A 3MIIA 5ALGA 3A2KA 3RRNA 3RVJA 4RM3A 1I36A 1U3GA 5CXUA 5JHGB 1UKYA 4R3BA 3QKRA 1AQIA 1PR5A 4IWNA 3LVRE 5F1OA 3ITNA 4KFSA 2WTNA 4N0QA 2ZRKA 2CBZA 5F2KA 4X3OA 3PEYA 3OLYA 1IRXA 2P2YA 1FSFA 1KO7A 1PSWA 1GZ4A 1S2IA 2CEKA 3S2GA 5LVAA 1JILA 2R4TA 3JQQA 1QU2A 1WO8A 1V7ZA 1CP2A 1U4NA 3DLCA 4WXYB 4Y2HA 5JMOA 1NZJA 1IZ0A 1V35A 4OLAA 1GZ6A 2QP9X 3OZWA 2ECFA 2ZSFA 1IN7A 4B9AA 5IVKA 1M2VA 5HUHA 5KYYB 4MW1A 1S2NA 1IOZA 5DOVA 2ZWVA 2CK3A 3W8EA 5AKLA 5BV0A 3SZMA 4ZTUB 4NY1A 2VJOA 4Z53A 4N7MA 3CHWP 3CV3A 5D3KA 2RGWA 3STUA 2ZUEA 2P6OA 1AQJA 1A98A 3JQDA 4PS0A 5JNVA 1SMKA 3M89A 4WNCA 2EP8A 4JLAA 3SF8B 4RVCA 3L8EA 1RR6A 5SYMA 2OCAA 5FI5A 2ZBFA 2ZULA 1N9LA 3OQIA 3GVBA 1OCEA 1TZKA 4K6MA 1RW4A 2B6NA 5REQA 3WDMA 3RVSA 4IKPA 1KGDA 3UPUA 1RHQA 1RGYA 2ZT8A 1GL7A 4Q82A 2AFIA 1Y28A 1ISIA 3IUMA 1LK5A 1KEPA 3M7IA 4N12A 3R3HA 3PTEA 5DGIA 2HT6A 3KPWA 2WTEA 5BYKA 2Z58A 3UCFA 1NBAA 1DRWA 1PR2A 1RQRA 4JGBA 5CVTA 1XRRA 3T95A 3LI9A 1V2GA 2MYTA 5FA6A 4OTZA 4YR7A 1JSRA 1AUOA 1YZKA 2LCIA 4YV1A 2OGUA 3FAZA 4UTZA 3LQ1A 1L6RA 3E5MA 3EXAA 4JJ8A 2WE8A 1M34A 5D7BA 5AKKA 3WLAA 4DRZA 4HWTA 1Z88A 3N8DA 3IQFA 4KX5A 1W7FA 2H1SA 4JDUA 3ROQA 4PGFA 5HOEA 3CB4A 3OTQA 3H2GA 1PD0A 2IYOA 1KQFA 4RETA 3LCUA 3FCOA 3IDOA 2QE7A 2ADMA 1TFUA 3GI1A 3GAAA 4O2BA 4S12A 4PPQA 2PHYA 3IH9A 1CRPA 3VOBA 5K3DA 4ZCMA 3TNJA 4AG3A 1SQSA 1T10A 3KEMA 1E8DA 3E5NA 3MWYW 3RH0A 4CLDA 8AT1A 2O7RA 3R5JA 2IY9A 2ZQZA 1ZXLA 2WIJA 3PGXA 3CWQA 3OEHD 4QPDA 4R0NA 5FDSA 1LBIA 2AX3A 2F00A 2G0AA 3OZDA 4XGIA 1X42A 1O0BA 4QOJA 5K8LA 3DMFA 1UINA 1WSWA 3BCRA 2XYRA 3BIXA 3R40A 4DC9A 5LYYA 1EX1A 1VECA 5JSZB 4NNPA 3C1TA 3ZXXA 1UGUA 2VV6A 2B5WA 1PKEA 5AVOA 5C8YB 1ZVKA 3M6XA 3KJHA 4CDGA 3SS5A 5E8RA 1OTXA 3VR1A 4MROA 3IF6C 3U49A 4HV4A 4R40A 2INWA 1BD3A 1SQ0A 5HE9A 1QAMA 1Q5PA 1QFXA 1TAGA 1WVIA 3NV9A 3QFFA 1IHYA 4IIDA 5JXIA 2OCKA 1GVNB 1H9BA 4ZAMA 3I0NA 3EHDA 1P75A 3GJ4A 3I4LA 4NARA 4RJTA 1ND6A 1ONSA 3AGPA 3B13B 2AC7A 3INRA 2IEAA 3CLRD 5FV4A 2PE5A 4MPJA 1UIRA 1Z7WA 3I52A 4DXDA 2R7AA 2AI2A 2W48A 4QFBA 4Z4GA 4XX0B 5ALRA 1JWZA 3WS2A 1JKMA 1NASA 3A11A 3ABIA 4JJ4A 4PBRA 3REGA 3TVTA 4K6FA 2ONKA 5BO5A 5BUSA 1QIHA 3O83A 3L7OA 3Q7IA 3OEEA 3BECA 4JV5B 2M32A 1ZEJA 2FCAA 3Q7ZA 2R5NA 2WWGA 3GRVA 1QFSA 2JGRA 4KQMA 1EQ2A 1QK3A 3G35A 1XHEA 2YWCA 3JZDA 4FYMA 4KXQA 2QHKA 3WWZA 5A90A 2FZEA 2WI8A 4FEEA 1RPNA 4BIMA 1QZTA 2XWJI 3DZCA 4PHTA 3AJRA 4BV8A 1XEWX 2ZMFA 2JJ1A 4QUKA 5DHAA 5T8KA 4QOHA 3UHFA 4LRZE 4WZ4A 3W2IA 3IUPA 2A0FA 1VCOA 3HUEA 4K1LA 2DX7A 4G0YA 4D4JA 4A0GA 4FOPA 4I6JA 2XZTA 5FEFA 1GVHA 1WP4A 2R66A 2FPOA 3PHGA 3ZCZA 1PG5A 4GLBA 1CQAA 3O0DA 4US2R 1K68A 4QWWA 4REMA 4LZJA 5J5AA 1G21E 5JLAA 2ZB3A 3HKBA 1Q7RA 4EU0A 1G8PA 3RFVA 1ODKA 4KBYA 2O1SA 4CM8B 1IULA 2Z5GA 1C50A 3M33A 4MWZA 1KC1A 4OU4A 5BWBA 1PYGA 2Z8ZA 2X40A 4PX9A 4MEZA 2R7NA 3SS7X 1BROA 2ANBA 2W0MA 5DTRA 5TSDA 3D31A 3FXAA 2FV8A 1QDEA 4D0LB 4XFDA 3ZJUA 1YB6A 3AVXA 2R8PA 4ZU6X 4E07A 1CG6A 4L8FA 4V2IA 2DNSA 2P8JA 3GJXC 3ERCA 3H0EA 5T67A 4BNMA 1T2UA 2QYOA 4BAUA 1JA0A 2PZGA 4F84A 4GBJA 4ZAYA 2Y2OA 4WNAB 1FRQA 3L8GA 2BFPA 2GJ9A 3CBQA 2IOHA 3FTEA 3X3HA 1NZUA 3R7AA 3S1AB 3M4YA 3HUNA 3F5MA 3MXRA 2BZSA 4CTJA 4F8YA 2HTFA 4NHEA 4YQEA 4YRDA 3F49S 4CQMA 2W6OA 4X92A 5A9RA 1TT7A 2GBGA 2HDHA 2VAVA 2I2WA 3EODA 2JHPA 4KDRA 2ECKA 1J49A 4H1WA 4B6OA 4ZDXA 1SOAA 2ZIWB 1PT6A 1S8AA 4X55A 3KEOA 5D1NA 1N3BA 3BZBA 1ORTA 4YGYA 1QGDA 3FLEA 2MCFA 3JQBC 3L82B 4BQEA 3TVYA 3HFRA 4Y15A 3K20A 3T3EA 3IQXA 4LHSA 1XD8A 5M1AA 4PLVA 3LFVA 1YT5A 2CCJA 3B2EA 3BWCA 4WOCA 3TR0A 1JKFA 3U9SA 2B2NA 4DDVA 1ZI9A 4ZRNA 4O63O 1VIYA 4B4OA 4KZPA 3UXYA 1F60A 4XW2A 5DNVA 4DMRA 1RWKA 4ENRA 1X14A 3GD5A 3R41A 1DIRA 4J1TC 4FILA 1DEHA 4J16C 1ZH8A 1XTVA 1QGZA 4ABTA 3CPEA 4H7KA 1SK9A 3UATA 3B38A 1SHTX 1Q1QA 1TI7A 4IICA 5I3CA 2EX8A 3R7WA 1QVRA 1I13A 2HTEA 2R8YA 3E3LA 3FX2A 4P87A 3UO9A 1JECA 4IDAA 2IHVA 3MTBA 5E2AA 3WGKA 2PQ0A 4BO5A 5BR1A 5HDSA 1CT9A 2FN9A 4MW2A 1E7WA 1G66A 4OL0A 3DPUA 1U8XX 3S7PA 1BQEA 4Z5XA 1I10A 5EJEA 4P6VF 1TIBA 1PTJA 2A4MA 1Q3TA 2KBEA 1VIMA 3ZWVA 2H5SA 2OSBA 4HR7A 3TQHA 1DZ3A 3PEFA 2Q0OA 2H1OA 4KXYA 1LBTA 1Z29A 1UBEA 2PM8A 2V7QA 1RCFA 1U5BA 4DC1A 1H93A 2OHJA 1I01A 2BMFA 1M7GA 1L9XA 2OAEA 4CLXA 2Z04A 2BFOA 1EBFA 1DX6A 3LGXA 1TW3A 1L6IA 3QV2A 1RZVA 1QMFA 4HEQA 1T2NA 2CMNA 2Y4AA 2BFCB 5AM4A 3Q41A 4QO8A 5KNDA 2GZMA 3FM9A 4EGQA 4R23A 2L0XA 3TB6A 3S22A 1ZK1A 3C85A 1E3UA 4L0DA 4BFUA 3N70A 3R74A 2GM4A 1E4OA 3DKPA 2WSSA 1G60A 3L4EA 5D7NA 4CV1A 5JRDS 2ZR7A 1VRCA 4N4AA 4LI0A 4X6YA 3EDYA 1N2EA 4MUMA 2HQBA 2TYSB 3EZYA 1I4OA 4OFBA 4PVDA 3MC1A 4XIGS 1CQZA 1B4DA 2JCGA 4OXXA 1U8YA 4DV2B 1O6FA 4PX2A 1MY8A 2IXBA 2Q4RA 4PAOA 4QATA 5DN9A 5F6AA 2BM8A 2W2KA 1Z0DA 3V6MA 4F5EA 5HDQA 1J2JA 2EARA 3RS7A 1S3GA 4HZUA 4DSOA 2QMEA 5IANA 2RAVA 5FBZA 1PDWA 3Q3EA 3G23A 3P2MA 5BQ3A 5CW2A 5GJCA 2FMTA 1IN8A 1KY5A 1G8YA 1ZOOA 1I7DA 2Y1KA 3DXXA 1E1QA 3KDSE 1IMJA 4OLJA 4EW6A 4O3MA 2OKCA 3GDGA 5GV8A 3VV4A 2J5QA