1P9WA

Crystal structure of vibrio cholerae putative ntpase epse
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
403
structure length
384
Chain Sequence
b'SDDFFSLAEELAPIIKLINAMLGEAIKEGASDIHIETFEKTLSIRFRVDGVLREVLAPSRKLSSLLVSRVKVMAKLDIAEKRVPQDGRISLRIGAVDVRVSTMPSSHGERVVMRLLDKNATRLDLHSLGMTAHNHDNFRRLIKRPHGIILVTGPTGSGKSTTLYAGLQELNSSERNILTVEDPIEFDIDGIGQTQVNPRVDMTFARGLRAILRQDPDVVMVGEIRDLETAQIAVQASLTGHLVMSTLHTNTAVGAVTRLRDMGIEPFLISSSLLGVLAQRLVRTLCPDCKEPYEADKEQRKLFEPLILYRATGCPKCNHKGYRGRTGIHELLLVDDALQELIHSEAGEQAMEKHIRATTPSIRDDGLDKVRQGITSLEEVMRGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General secretion pathway protein E
publication title Crystal structure of the extracellular protein secretion NTPase EpsE of Vibrio cholerae
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Protein transport
total genus 100
structure length 384
sequence length 403
ec nomenclature
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1p9wA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p9wA02
4URVR 2YV5A 2QM8A 1P7CA 2GVDC 4BQSA 5JI2E 2OBMA 3NBYC 1XEWX 4WBSA 5CLLA 4PC3A 4B48A 2GETA 4FCWA 2W6JA 2Z5FA 1OH7A 1E2QA 3LWNA 3GLGB 3VHLB 1AA9A 4LPKA 5CK4A 2J3EA 5F98A 3L8ZA 2O8DA 2GJ8A 4MKIA 2HLDA 1M6NA 5KUTA 2OAP1 2DFTA 3WMFA 4CZ2A 2QEQA 1GITA 3IDQA 1QF9A 4TT3D 1CLUA 3NBXX 2IYQA 1COWD 4XIGS 5AJYA 521PA 2CCJA 4Q02A 3OIVA 1IN7A 1DVRA 2NMVA 4QJ5A 2Q6TA 1Y63A 4WZBE 2QY9A 3RC3A 2WSSA 1IXSB 1S3GA 4OI1A 2F43A 1OW3B 4DLYA 1UJ2A 1E69A 3I61A 1KI6A 3KUDA 5B30A 2VSXA 3FMFA 2CMKA 2FX3A 1SQ5A 2YWEA 3QKRB 2VLIA 5EUMA 3U6BA 1ZUNB 2ZSDA 2QPTA 1N6LA 2ZE7A 1MR3F 4TQAA 5DISB 2J7PA 4UNQA 3K0SA 4POAA 1L8QA 5AUNB 5JS8A 4G0NA 4DBLC 1CR0A 1US8B 2ZS7A 2PZFA 3QJYA 4TMVA 4BLQA 1KY2A 4ZV4A 5CITA 4C7OA 2ZM5A 1WQ1R 4TLCA 5TV2A 2IEYA 4W9MC 2JJ2A 3PFIA 3ONWA 2QAGC 3CRVA 1KI2A 2IHBA 2VF7A 4Q9LA 1KMHB 4QNMA 1XJ0A 3MWYW 4CF7A 3TBKA 3OEHA 4JVLA 1GZSA 1VG1A 2XB4A 4CEHA 1KO7A 1RYFA 3CX7A 4Q4JA 1WE2A 4TLEA 2D3WA 2QU8A 2DWQA 4CVNA 4RKFA 1I4DD 4PHGA 1G17A 3JZAA 1ZNWA 4LV5B 3DHWC 3KQKA 2ZYUX 2FFQA 2OSBA 4RD1A 3LLUA 3U44B 2ZIAA 3QIAA 1DEKA 3ZLJA 5E3HA 3KJEA 1HURA 4HAYA 2GZAA 1SZPA 4P32A 3BORA 4R98A 3SHFA 3RABA 3LBIA 2OCAA 4URXR 3TW4A 3CB4A 3DL0A 1JQJC 1E9CA 1XWIA 4V0MA 2JJ8A 4JT2A 1KSFX 1AM4D 4M21A 1KTVA 1W5TA 4JL6A 1XCMA 3QF4B 4F93B 3FKSA 2WPDA 1FX0B 4LK2A 3U7EB 2O5VA 5GJCA 1SXJC 1YR9A 2CVFA 2BM0A 1VG0B 4PC7A 3OEEA 4TLAA 4PPQA 2GAOA 2GCNA 3IILA 1YZGA 5EP3A 1UDXA 3WHKA 5KDDA 4M1SA 5IRCD 2RGBA 4BLRA 4OQMA 1IBRA 2I3BA 1G41A 3SDZA 2QQEA 2GK7A 2X2FA 3W6OA 3BXZA 2HT1A 2GCOA 5DHAA 1MKYA 3DZ8A 1N25A 1XEXA 1ZP6A 2G3YA 5FFMA 2HJVA 2HUPA 4TMKA 4M1YA 5BN4A 2OAQ1 2EYUA 3ZQJA 1IN4A 1NN0A 4HAWA 1QHSA 1M7BA 2WSMA 3BFVA 3QY0A 4AKIA 1OXUA 4DVGA 1S2MA 3CWQA 2WMOB 4LJAA 4C30A 4ARZB 3NHBA 3GFOA 4M9XA 2QRZA 4HDOB 3QQ5A 4GDFA 1XD8A 4WXRA 4DDUA 1EFRA 2C77A 5J4VA 1Z3IX 1G8GA 4LV6A 3T15A 3TGPA 4GI7A 3LNCA 4D25A 1HT1E 1MRSA 2DHRA 2Z4RA 3BRWD 4XD7D 5JS7A 5SZHB 3DOEA 1E1QA 1W2GA 5LBIA 2D2EA 3T34A 4D4LA 1VCMA 3O8DA 1XZPA 4PPGA 4QJ4A 5FR1A 4QKQA 1U90A 3R7WA 1GIAA 4HB0A 2IYYA 3A1SA 2G0NA 3D31A 3S1AB 2J0SA 3EPHA 5EQTA 3D6TB 3TE6A 2QP4A 4EDHA 1NVVQ 2A7QA 4KITB 2PMKA 4LV8B 3BH0A 5IF9A 2ZSBA 5TARA 4Q1AA 1HY3A 3KB1A 1RKBA 2VP4A 2GJ9A 5DNYB 4XOIA 2GCPA 3OAAA 1HE8B 1L4YA 4M53A 1QDEA 1GRNA 5JRJA 2BWJA 4M1KA 1DAIA 4LGMA 2P0EA 2ZJBA 4QHTA 3NC0C 4MDEA 4CEJB 2VRWA 3NWJA 4LPSA 3TSOA 5C18A 2ERXA 4PZLA 2V7QD 3ICEA 1CU1A 2NOAA 5GVSA 2FZ4A 2RB4A 3FOZA 1E2FA 2B8TA 4DLXA 1F2UA 1JALA 4KLZA 5CLQA 1FW6A 3RDPA 1VYTA 3KZ1E 4JL8A 4KBFA 3L43A 5FL3A 2BKUA 5CJPA 3UMRA 4Q4AB 5FBRB 5CYOA 3L82B 4EFMA 2QTHA 5KO2A 3EA0A 4NYJR 3HYRA 1VMAA 1ODFA 2P2LA 4XVRA 2FPMA 1ANKA 5EZ6B 1DTSA 2R2AA 4MITA 4RZ2A 1G4UR 1IAQA 3QSYA 3LFUA 1NSTA 4QG7A 2C04A 2AXPA 2OEPA 1ZCBA 3DM9B 1SVIA 4B35A 4PXAA 2OBLA 3VFDA 5JSZA 2UZ3A 2HYDA 2OXCA 2ZJ8A 1II8B 2ZYTX 1Z06A 2C8VA 4LHXA 4FINA 2A2ZA 4FI3C 2I1QA 4ESVA 2E87A 2ZRLA 2W2TA 4D4KA 1Z2CA 2BJWA 4JLVA 4ZI3A 4OI2A 1R0ZA 3QF7A 1MO4A 4RZXA 4NCJA 2ZI5A 1OIXA 3G0HA 1DADA 1ZVQA 1R0WA 3RC8A 3U5ZB 1J90A 4KVAA 1JR3E 5GJBA 1Z6XA 4A82A 2PL3A 1QHHB 4QGFA 4DDVA 2GTPA 4RZ3A 4MKHA 5H8WA 4TWZA 2XJ4A 2XITA 2AKAB 3GP8A 4JKYA 2RGXA 4GZLA 2F3RA 5EE0A 3OIUA 1IN5A 4PC2A 3BFXA 2B21A 4YMTA 2ZANA 2IWRA 3GLHA 2CL7X 3Q7PA 2YWGA 4B47A 1SVOA 2PT5A 2PBRA 4YDHB 4DEYA 2GEDA 4DLSA 5JCZA 3B8HA 1EWQA 1ZUIA 1AN0A 2JA1A 2YWHA 2XOKA 3MJRA 4FN5A 1UKEA 4IKEA 4GNKA 1KJZA 4KI0A 3BC1A 1NMYA 3GQBA 3FMPB 2O8EB 4ESHA 5CDFA 4YMWA 1G1MA 2ATVA 4O2LA 1S96A 4HUQB 1KK3A 3G82C 1C9KA 2A5DA 4BLPA 3B82A 4IFEA 1TX4B 4D82A 1QHIA 2ZRIA 1P2TA 5HE9A 2XGJA 1F2TB 1J70A 4HAUA 1EGAA 4NBSA 1QHYA 2VPPA 3FMOB 3I72A 1M34E 3UKDA 2XXAB 3A36A 4DIEA 4V02A 2C95A 1W0KD 2EU8A 2ZRHA 1BKDR 3CRMA 4PC1A 5KNDA 1Z6YA 3QXCA 4RFSA 1KKMA 4DSUA 4QBHA 1LTQA 1MABB 2R65A 1ZC4A 2P6UA 1U94A 2ZAMA 3Q3JB 1W4AA 4FCTA 4OK3A 1SULA 4GFDA 1NBME 4EQ6B 5B58C 1NRJB 2NPFA 3I5YA 1QHGA 2L0XA 1IM2A 3CKLA 2QMHA 1OT3A 4OHZA 4D80A 1RRGA 2AFHE 3QKRA 2OT3B 4U5XA 1NVXQ 2YKGA 2VP9A 4A6PA 1XRJA 2QORA 4DB4A 2ZE5A 4M1MA 5GVRA 4TTRA 2C99A 4IDPA 4AYWA 1SXJD 3KFXA 1OB5A 3SJCA 3VR3A 1US8A 3AVPA 2ZJYA 2GXAA 2FFAA 3P26A 3TIFA 4Q1EA 1MRNA 4F4IA 4URWR 4LY6A 3EIEA 2ZI3A 3W3AA 4LI0A 4E03A 5F3WB 3AVQA 3FE2A 5JRZA 2R6DA 5DN6D 1MOZA 1DAMA 2FGJA 4RVCA 4BZPA 4UNRA 4JKIA 5J4KA 4JLAA 2ZRFA 4DZZA 5G41A 3EIQA 2OG2A 1NG1A 3DPUA 3TQFA 4A2PA 2J1LA 1MH1A 1IJFA 5BN3A 1YVDA 2F9MA 2WJJA 1IY2A 3ZDQA 3T1QA 2FDCA 3TAHA 1RJ9B 4CGZA 4ASUA 1CJVC 3IO5A 3Q8XB 3DVLA 1TTTA 1F5NA 3ASYA 4XWKA 1E2GA 1Z83A 1X6VA 1P6XA 4TYPA 3CX6A 1GKIA 4JLBA 3WP0A 4TYQA 3U44A 2PLRA 3KKQA 1PV4A 1EWRA 2V8OA 4D4MA 5L3QA 3SN6A 5SZJA 1DO2A 1MO5A 3ZGXA 3T35A 3SJZA 1R10A 5LDDC 1KO8A 2ZUDA 3KJGA 3QF4A 4QBFA 4PPNA 5B2ZA 4HATA 1LS1A 4Q5IA 4NYIQ 1ESNA 4GP7A 5EE5B 2QMOA 5G40A 3T1OA 2FG5A 2QE7A 3D3QA 5HPYB 1BMFA 1Q12A 1TF7A 2F1HA 3THXB 4RD6A 1Q57A 1UBFA 3HDTA 2WMNB 3KKOA 2HT6A 4C9BA 2J0UA 2TMKA 2BDTA 1P75A 3EZ9A 1WBDA 3MGCA 1JJVA 1YRAA 4A8JA 3SBDA 1JR3D 1VDZA 2RGAA 3GMTA 1W7AA 1CXZA 4LHWA 1Q1ZA 1XU4A 3CF2A 3LA6A 1NVWQ 3AUYA 4Q1CA 4PO1A 4P4TA 1TNDA 3MUFA 2E1RA 4PC6A 4NCIA 3IGFA 4HLUC 4YDSA 1XEWY 4B71A 1I2DA 4DHEA 2D4HA 1Z28A 3KXLA 2GESA 4OI0A 3DKPA 2J87A 3U3MA 4ARZA 5HR5A 3THYB 1NN5A 3N2IA 2NTYC 3VR1A 4EJSB 2JJ1D 4YXWA 3FGNA 1U8YA 4UNSA 3B1XA 1FPMA 3RRNA 3EG5A 2EVWX 1ZCAA 4QGHA 4TYWA 3K9HA 3SE0A 1AK2A 3K0CA 1E1RD 1GG2A 3VU9A 2IF2A 3TSZA 3KXIA 3W5IA 1XCPA 3FHOA 3QPWA 4GZMA 1T91A 1EFCA 1ZNZA 4MA4A 4CYMA 5F9FA 1U0JA 2IW3A 2WJGA 2WWIA 4IOMA 4NZYA 4OQLA 5FBLB 3PEUA 4BE7B 1EX6A 1LNZA 1R2QA 1XEFA 2V9PA 3BOSA 4YMSA 1H8HA 3QUSA 4D26A 1OIVA 1ZU5A 2E9SA 1AQYA 2QUZA 3NEYA 4M1TA 2KB0A 2QI9C 1G20E 2A5GA 3EW9A 1XBTA 4IOKA 3RS5A 2W58A 1QRAA 2WJYA 2IHYA 4KU4A 3MD0A 1L4UA 4XVQA 3BB1A 1GSIA 3WMEA 5JZVA 1PLLA 3UANA 4GMDA 2EFEB 3ZZ0A 1IQPA 2CL6X 2HXYA 4PSVA 4C0AC 5M04A 4HB2A 1KGDA 2W6ID 4URZR 1CF4A 1VG9B 2NPIA 3H84A 4B32A 4UNNA 4GOXA 4WVFA 3C4JA 1VHLA 5SZKB 1ZM9A 4AYTA 3FFBA 1LY1A 3V4FA 5BQ5A 5FTNA 4MRPA 3UMFA 1TUIA 2VP5A 4JZKA 1N6RA 2P6NA 1FUUA 1NF3A 4FW9A 1CRQA 2FMXA 1DG1G 4AURA 2QPOA 5DIFA 4MH0R 4ZKEA 2IYZA 4G5RA 4Q4AA 2A9KA 2QGZA 2VP0A 1U8AA 2FPLA 2ZR9A 1E2DA 3CO5A 2VIIA 721PA 2BC9A 2JLQA 2QROA 1E2JA 2FF7A 2Q9AA 5JHGB 2CHVA 1ZYUA 1GVNB 1WF3A 2ONKA 3KUCA 4A6XA 4Q19A 4B2LA 4G5GA 4B44A 4US2R 5KTYA 1II0A 4IEEA 3QVUA 1ZC3A 3X1DA 5H70A 1J8MF 1J99A 1GTVA 1AGPA 2DFKB 4B3CA 4AK9A 1KO5A 2P67A 4LJ8A 4C0LA 2VP2A 1II8A 1YHNA 2WAYA 5FOSA 3LD9A 4LC1A 1P2SA 4QL3A 2H7VA 3CNLA 4YMVA 2PX0A 3SR0A 1E2PA 4JMPA 3VKWA 3QEOA 1JAHA 3M1IA 5TMPA 1FNNA 4BLOA 2IS2A 1E32A 1P4SA 1XF9A 1QVAA 3B1YA 4TN1A 2ZI6A 2ZPTX 2I4IA 3MLEA 3PCRB 4JBYA 4E07A 2REOA 2A5JA 2JIZA 4EJSC 1ZM3A 3SEAA 4KFRA 3W34A 3RS4A 1JECA 4JLPA 4TYNA 3NG1A 2JLXA 2BEJA 2FU5C 1H8ED 4IDNA 3A1WA 4KCGA 4Z54A 1BYUA 3PUVA 5E95A 5HCNA 1HT2E 2REBA 4RFVA 2W0MA 2BCGY 3CZQA 3K0FA 5DE3A 1U8ZA 4TT3A 4XSHA 1COWA 1DOAA 3QXXA 2ZREA 2FSGA 4ACBA 121PA 2ZU6A 1W36C 3LV8A 2ZS8A 4G1UC 4MRSA 1F60A 1QVRA 1E9SA 1R0YA 2ANBA 2V4ZA 3MWJA 4PAMA 1FOEB 2J45A 2OM2A 1DO0A 4PFSA 3ZVLA 5HZHA 1KDPA 2V55B 2XAUA 4HUQA 4DCTA 1FP6A 2ZRGA 1N6HA 2BV3A 5KSYA 3WYAA 3U4QA 2BHRA 3QOFA 2UVQA 5LB4A 2AR7A 2XXAA 4Q9KA 3ZIAD 3NHAA 1SXJB 2Z83A 3E5HA 4NH0A 2N46A 3QI2A 3GLIB 5TY0A 2XNDD 3FMIA 2D62A 2BVNA 4TTQA 3EZ6A 4LYFA 4QM6A 1FL9A 4BFYA 2QNRA 4RKEA 2VQSA 3L0SA 1CR1A 4P3YA 2BOVA 3SQXA 1MABA 2AD5A 4Q4HA 3UIEA 2RAPA 2CCKA 1JXOA 1G8PA 1CTQA 2IWHA 1Z0FA 5F2EA 3EPLA 4HLDA 4BRWA 2EQBA 3CWZA 4U02A 4A0FA 3Q9LA 1EXMA 2D06A 1YZKA 3KQHA 4Q1DA 4V0ME 4BECA 2CXXA 1M1YE 3WNCA 1D9ZA 4ZDJA 3BJIC 5HE8A 1YR6A 1XP8A 2A3RA 2IUUA 3W8RA 1Z0IA 1BO6A 5FI1B 1NI3A 3IIMA 3IQWA 5A5GA 2AHOA 4QBGB 3ADKA 3WHLA 3ND9A 4I4LA 2HEIA 2ZAOA 4HEJA 1YJ5A 2VA8A 1YU9A 1Z2AA 3EXAA 1FQKA 4PANA 3FKQA 2BCJQ 3AKYA 3AB3A 5CM9C 1ZJ6A 3B78A 4PHHA 3WYGA 1OKKA 1ZIOA 4A0GA 2DFNA 2AL7A 3TKLA 3KL4A 3GD7A 1X86B 4F92B 2F1JA 4GRAA 1FFHA 1E96A 3VNUA 3UXMA 5FBQB 2IS1A 3K1JA 3AGQA 5CB6A 5FL7A 3H0KA 1HUQA 2JASA 2FJUA 2HF9A 1P3JA 4P31A 2ZRKA 2ZE6A 1RW4A 2P3SA 1NJGA 2JDIA 2FSHA 4LHVA 1Q1EA 1QHXA 3LQRA 3B7GA 3WBKA 1KSJA 1GFIA 2MMCA 2Q3FA 3AF4A 4DUGD 2XTNA 4F38A 2PLFA 2QP9X 3PUZA 3GJ4A 4K81B 4LZZA 1RIFA 3K70D 2R6AA 3QBVA 2BMFA 3HU3A 4IVPA 3QEJA 3PEWA 1U0LA 2GXQA 1X8KA 1CR2A 1G19A 1Z0KA 1KZ7B 3WY9A 2GZHA 2PEYA 3BIFA 4OK6A 4WXPA 3H86A 1EK0A 4LSGA 5JWHA 4D0LB 4H1UA 4DIDA 1P9NA 4UNPA 3QKTA 3MFYA 3A58B 1E9EA 5EXSA 3THXA 4AYXA 4B73A 1M74A 4XD7A 4N3NA 3GJ3A 3ZS9A 1S9HA 3AKDA 4UJ3A 2FOLA 5FOUA 3C41J 2JLRA 1CJUC 5KNCA 3AP1A 1U2RA 4C0HA 4MRNA 5FUXA 1E2EA 1IONA 1N6OA 2NG1A 2OLKA 4BZXA 3ECCA 4A36A 2EYQA 2WSSD 2WWWA 1G16A 3B6EA 1GUAA 1SKYE 4TL8A 4YC7A 2FNAA 2EWWA 4KODA 1KIMA 3K9GA 2KJQA 2KSQA 4HB3A 4CRWB 4FD2A 3EX7C 3OZXA 1TF5A 5C1BA 3THYA 1L7VC 4B6FA 4A0HA 3CRQA 3WBJA 4A4DA 4HLQB 4NONA 1FMLA 2J59A 4QHYA 2GJSA 2JCSA 5DSZA 2X8AA 3SOPA 4NTZA 3FFAA 3HP1A 2C5LA 1Q0UA 4ZO4A 3I3SR 3UMSA 1W49A 1TU4A 3ZD7A 4FWIB 2QT1A 1RRCA 3ZJYA 4E5UA 2C78A 2V7QA 5K8UA 4X8LA 3ADCA 2XTZA 2WAXA 1VYVA 4FCVA 4BFZA 1G7SA 4AKGA 3CRRA 1Z07A 3GLFA 2ZRJA 3UG7A 2JJ2D 1E0SA 2IXGA 3FB4A 1W47A 4E09A 1GRQA 4JBWA 2FV8A 3V4RA 1PZNA 2DFLA 1VPLA 3IEVA 5KNBA 3CH4B 1R5NA 1RRPA 1G8FA 1P72A 2AK3A 2CK3A 5AWFC 4L9SA 3SYLA 3X1YA 4DDTA 1RRFA 4QNRA 2XX3A 4DSTA 3THWA 1Z0DA 2QN6A 3K0AB 4WOPA 3U6KA 2NO1A 3EZ7A 4C0JA 1GAJA 5TVKA 1E79A 1E9RA 2RGEA 3P4YA 1HH4A 2C2HA 3WYFA 2GEVA 1GWNA 2ZJ2A 6Q21A 2BBTA 2P5SA 3NBFA 2ZJOA 1IN8A 1OFUX 4ZKDA 1KJYA 2CL0X 1NY5A 2H1LA 4GMXA 1W48A 5AJWA 3UK6A 3LBNA 5L3SB 2ODNA 1VKJA 2PT7A 2DCUA 4LJ7A 2FE4A 2GXSA 3CX8A 4TLDA 3RRZA 1NLFA 1Y3AA 3CH5A 5E4FA 3KJHA 2OV2A 2DR3A 4KJZA 3AQ4A 2LCFA 2WM9B 5KDLA 4JLKA 4XH9B 3U61B 1XD2A 1HTWA 3GLHE 3PITA 3VHXA 4P4UA 1MT0A 4HB4A 4ZCMA 3VR6A 1WDTA 5BYKA 2F1IA 1E3MA 3IHLA 1XB2A 2QSZA 1E6CA 2ZI4A 2RHDA 1YE8A 2RHMA 2W00A 4DWJA 4LJ4A 1GL6A 2OUKA 4HYYA 4Q18A 5DLQC 1W36D 4Q66C 2IYVA 4DLZA 1KY3A 3A4MA 5CDFE 1IXZA 4B3GA 2VHTA 2ATXA 2PH1A 4JL5A 1KI3A 1XCGB 2AKYA 3CF6R 2KI5A 4EAQA 3UATA 2V3CC 3VKHA 2IYUA 4OI4A 2N1BA 5JJIA 2WVJA 3AUXA 4FMDF 5KSOA 3OFNA 3IIJA 3LO5A 4TMZA 3SFVA 1CP2A 1EFRD 2WBLC 3N5CA 5IDVA 3W6NA 3SBEA 3WNBA 4M4SA 3VMFA 2GF9A 4DDWA 1W1WA 5DYIA 1TPZA 4UXIA 5CYPA 4Z8YA 3EPKA 4EFLA 5AJXA 1E1QD 4RCZA 4H1VA 4DEXA 5EJEA 1U9IA 2QAGA 1YZTA 2G83A 4MGYR 4BFXA 2WICA 3JVUA 3WXMA 1W0KA 3MAAC 4DT1B 3GCGA 2VL7A 4MYTA 3BD9A 4X8HA 1NP6A 1TMKA 4ZCIA 4C2UA 1G3QA 3BH7A 4GOJA 4S2EA 4A8JC 1N5JA 1T3SA 1G7RA 1JEEA 1ZINA 1E9BA 4Q48A 3U7HB 2B7BA 2QPAA 4XTCS 3TR0A 4A9AA 2OBNA 2EFHB 1ZM2A 1OXTA 2F6RA 3RAPR 4Q7LA 2FA9A 4US1R 2GZDA 1W0JD 5CK5A 2B92A 2P6RA 1VG8A 1G291 5DI3B 2NIPA 4BWYA 1OHHD 1G7CA 1T8TA 2OE2A 4R2HA 4PAQA 4UJ5A 4TYYA 2GBLC 3QKUA 4FMDB 1LB1B 2Z6VA 2ZRNA 3IKJA 4B33A 3ADDA 1XX6A 2ZYWX 3P27A 1U81A 1G5TA 3U3JA 1TF2A 1SXJA 1YZNA 2J9RA 3GLIA 1Q44A 4PTLA 1YZLA 5JI3E 2NO6A 1CULC 4P0TA 2IT1A 3IQXA 4NCHA 4G5SA 4BEBA 3QKSB 4ZDKA 4BFWA 1E2LA 4KAXA 2QMUA 5DI9A 1S1MA 2ZI9A 1LF5A 1RYHA 4KFSA 5BXQC 4TZ0A 5DN6A 3EIHA 4BUJA 2QBYB 1ESMA 1KAOA 1G6HA 3GLGA 3BH6A 1KI9A 3VR2A 2YWFA 1OXSC 2CNWA 1ZU4A 1KK2A 3LXXA 5E7MA 1FP7A 2CBZA 2RH5A 3CRW1 2G1JA 3PIRA 2ZTSA 4IOJA 4DXAA 3ICQB 1EESA 1T5LA 4WW0A 1WBBA 1G3MA 3NTUA 2MSDB 5KPJA 4BFUA 2OFXA 4OJKA 5KDOA 3AF3A 2FFHA 3WRXC 4V03A 1A7JA 1Q3HA 4HI0E 3ZZTA 2IC5A 3RSLA 3A4LA 2V1XA 4QC2A 4RCYA 1R7RA 1AZSC 3RANA 2OCYC 1SVWA 4AWXA 1N0VC 1EFHA 1R5BA 3OE7A 4Z1MD 3EZ2A 4WZ6A 5FUWA 4JVMA 1B23P 1NKTA 1UEJA 5B57C 1YR8A 2P5TB 1NG9A 3EWSA 1FQJA 2ZSEA 1D2NA 1RVDA 3K9NA 5JWRA 2FSFA 2ZROA 4B2IA 1KDOA 2NGRA 3VR4A 4BFVA 3MG9A 4KYUA 1EFUA 1O3YA 1GP2A 2F7SA 4G5QA 3U2QA 5CJ2A 4Y0AA 2H92A 2FEMA 1JAIA 3B1WA 3M0EA 2Z0MA 5J5CA 2F1RA 3WRYC 1DS6A 5IK2D 1E4YA 2YOHA 3FHCB 1ZRHA 2H5EA 1KMHA 2GXUA 5BWMA 2IYSA 3T1VA 1XD9A 1G8HA 2XOKD 3GJXC 5A4JA 1G5RA 3AF0A 2VP6A 3AVOA 5FUYA 1OIWA 4PZZA 1TEXA 1K5DA 3TRFA 5LD2C 2BEKA 2VHQA 1Q1BA 3BK7A 1CRPA 4QJ3A 5AR1A 5F9HA 1XXHB 3NIBA 3HPQA 4Q9IA 4OQFA 4HDCA 4RD0A 1XNJA 2DWPA 2DYKA 1KI4A 1SVLA 2F9LA 2JJ1A 4RD4A 5FPHA 3RSOA 3RWOA 1OH8A 4AY2A 4TTPA 4KFTA 1AKEA 1OXXK 2GDJA 3BB3A 4IW3B 1VCIA 4N0DA 5SZIA 3VKGA 4NHOA 3E1SA 2X19A 3SJBA 1E1RA 4CT5A 1E98A 4KFUA 1KK1A 3CBQA 2BM1A 2VEDA 1I4LD 4W5WA 5KU1A 4O2RA 3NXSA 1T0JB 1FX0A 3GFTA 4YMUA 2OFWA 1S8FA 2Y8EA 1SVMA 3GEIA 4TMWA 1RC8A 3JZMA 1DAFA 1XTKA 1OXVA 1CS4C 1KZGB 4MGIR 5J47A 1ZUHA 3QENA 2FZLA 4Q4JB 2MSEB 2F3TA 2O8BB 4KVGA 5FPSA 1OPXA 1Z47A 3I5XA 3T5DA 3I1FA 3QVVA 4D81A 2HV8A 2J0VA 2OILA 1NIPA 1M7HA 1OSNA 2UKDA 3L2OB 3MCAA 3A37A 5KPDA 2V1UA 1MV5A 4JLNA 3LW7A 3RYTC 5FTLA 4XJXA 2EWVA 3R8FA 1DBSA 3T61A 1LFDB 3IIKA 2K5UA 1TQ4A 3REFA 3ZZUA 3M4YA 1PVOA 1XZQA 1S4QA 2EW1A 1IN6A 3HWSA 4II7A 4OHYA 3SQWA 2J7KA 3T12A 2XEXA 3K70C 2X1VA 1P62B 1A1VA 3B9PA 1N3BA 3LVRE 1R8SA 4GSYA 5J40A 4Q1BA 4TL7A 2PX3A 3K09C 4NPHA 3ZVMA 3KKNA 1PUJA 4Q21A 3M6AA 3K0AA 2YZ2A 3EZFA 4ASUD 2V54A 1ZBDA 3LH5A 1XPOA 2IYLD 1BIFA 2JATA 2LWIA 1KYIA 4I1UA 3EARA 2GVZC 2GCOB 2VSOA 1W36B 5JHHB 1I2MA 2DY1A 1AS0A 3S1AA 2WWXA 4ABYA 4NP6A 2Q3HA 3DO6A 4BPBA 4Q9HA 3I73A 5L3SA 1BOFA 1UFQA 4B3FX 4DC9A 3TLXA 4KBGA 2XZOA 3FDIA 3W9YA 2VYFA 1GM5A 2IYRA 3PR1A 1HYQA 1T8UA 2FN4A 1Z6GA 2OLJA 2B6HA 3SI7A 4GPTA 4E22A 1NBMD 5FOTA 5JEDA 2GWHA 1L2TA 2ZE8A 1RPZA 4CEJA 4DCNA 2CLDX 3LW8A 4NYJQ 1TQDA 4KSCA 3C15C 1CJKC 4I1VA 4OQXA 1FNMA 4TSFA 2IXEA 2CJWB 3K9LA 3LY5A 4LUCA 4QRHA 4YLGA 2J46A 5G3ZA 1CBUA 2QZ4A 3X1WA 2RMKA 4CW7A 1H8EA 3MMPA 1RE0A 1TADA 1KKLA 2QG6A 2CLCX 3NDBB 3TUIC 2IK8A 1ZW6A 4X8MA 1WB9A 1Q1QA 1UBCA 1TL7C 4OYHA 1IHUA 2ZR0A 3H4MA 4B34A 5ELXA 3BFKA 1V5WA 1QZXA 1KMQA 3DEFA 1T0HB 3PQCA 4G3XA 3WP1B 3EAQA 3I62A 2IS4A 3GEHA 1WXQA 4Q47A 2ZI7A 3KQUA 2ZJZA 1ZM4A 2WKPA 3RS2A 2J5XA 4NMMA 2H18A 3Q5EA 4C0KA 1W5SA 1JBKA 4JSYA 3CONA 3QBTA 4ITRC 1NL3A 3ZH9B 2JAQA 1M2OB 2RGNA 5HKKD 5DYGA 3C14C 1AS3A 2I1VB 1G6OA 3L0IB 1NN3A 3KJIA 4DB2A 1NJFA 5G53C 2XSZA 2JLSA 3CPHA 1CKEA 1E2KA 5FTKA 1IXRC 1EFTA 3EASA 1SHZA 4LYAA 1KSGA 4KO8A 1QHHA 3CR7A 2WJHA 1F48A 2ZRDA 2GILA 4EKDA 3OF5A 3PV0A 4IXNA 2R62A 3MWKA 5B64A 1WMSA 1NLYA 2DBYA 4WZAE 8OHMA 4NKRA 3ADBA 1G8YA 3LDAA 1VIAA 4AKEA 4KV9A 2C9CA 621PA 3I92A 1ETUA 3CIOA 2X77A 2WWYA 1W44A 2OXRA 1KAGA 2YC2C 4LYJA 4DSOA 4J0QA 5DI3A 2WTUA 3AVXA 4A1FA 4AIIA 3K8YA 1LW7A 1R8QA 4BFSA 4Q7MB 1AJEA 3VAAA 1HA3A 4FMBB 2IXFA 1IY1A 4MQBA 1A2KC 4IDOA 5E7JA 1N6PA 2Q9BA 3B9QA 3EWAA 4IXMA 4AG6A 1OB2A 2O8EA 2WHXA 1P9WA 2JLVA 2NO0A 5FBWB 3GJ0A 3OIWA 2QTVB 5JJKA 2GJKA 4LBVA 2GA8A 4C0SA 1F2TA 3IUYA 4HAXA 4OKSA 3AP2A 3BWDD 3TUZC 1JB1A 4O25A 1KI7A 3U7GA 1B0UA 2QENA 4I81A 2F55A 2PMDA 3HYTA 2MMGA 1KI8A 3AVWA 1OYYA 1YZQA 4EPYA 3JVVA 4HLUA 5GJVC 3GLHB 2H17A 2IF0A 1AKYA 3SS8A 3DKVA 2ZEJA 4KHZA 1PJRA 3IO3A 4MYHA 2ZRAA 2BMEA 4HLCA 2VSFA 2QGNA 1E9FA 4EQ6A 1E0KA 3EPJA 5JBQA 2Q9CA 4G01B 4V0LA 3T1TA 1H65A 2CCGA 2GK6A 2YNMA 3L8YA 4IOLA 5H1YA 1XPRA 1XTRA 3HPRA 3GJ6A 4EPWA 1P61B 2ZITA 5LPNA 1KK0A 1BS1A 3PUWA 3R9IA 1BYIA 2AD1A 4L4UA 1ZM7A 4GL2A 3LX8A 3BB4A 1UADA 3F3YA 4F4JA 5C2JB 1D6JA 2XNSA 3GJ7A 1CJTC 4S35A 4YQFA 2DB3A 4MYUA 4Q03A 1W46A 4MYCA 1AIPA 1VCOA 4XVUA 3AP3A 4LBYA 4URUR 2NO9A 3PVSA 4RFSB 3TUJC 4AD8A 5JLJA 5UKDA 2O0JA 2O0HA 4ZIRB 2W2XA 2FGKA 3WMGA 5LB2A 1HE1C 4LRWA 1NN1A 5FOXA 4W7SA 1E0JA 4I1OA 4TL9A 2BBSA 1E2HA 5TXGA 1IJEA 3RRMA 1N0WA 3V00A 4OL0A 2ZSAA 4EFNA 1M7GA 1RJ9A 2ZU0C 4ERNA 5EXTA 2PZEA 1XXHA 2Q21A 2YHSA 3U3RA 3W5JA 2Z4SA 2ZRBA 4JYBA 3GLFE 5FOVA 1JXMA 3TQCA 1DG3A 4LJYA 4OHVA 4RY2A 4D2IA 3SFZA 1Z6AA 1N6IA 2Q3MA 3HR7A 1JQLB 3LBHA 2ORVA 5J4YA 3G5UA 2ZS9A 3KX2A 4JIMA 4QGAA 4QBIA 2CVHA 1V43A 2R6CA 2RCNA 5BYJA 4X8OA 3SJAA 2HCJB 1P5ZB 1HQYE 3VNVA 4DCSA 2ANCA 5FPTA 1P2VA 3DDCA 4B3XA 4V0OA 3QXSA 3PG5A 1U9IC 4JJKA 4NCKA 4B3BA 4I1SA 2RGGA 2ORIA 3TSWA 1G7TA 2W6JD 1II9A 1E99A 4WAUA 4U7DA 1FTNA 4LBZA 1EX7A 1GILA 3SNHA 3THOA 2HLDD 2O8BA 1X8JA 1S9DA 2FFBA 4TLBA 4RZUA 4JYCA 4IDHA 1JPNA 2BBWA 3MJHA 3TW8B 4QGGA 1DPFA 1XMIA 4ZI2A 1HEIA 1PLJA 3X1XA 2A30A 4PZYA 1RZ3A 5DHFA 4BRUA 3I4LA 1NY6A 4Q7KA 2WV9A 1ZNYA 3VR5A 2NQ2C 5C46F 1Q21A 2AWOA 4PSAA 2VHUA 3AVVA 3TMKA 3O47A 2VH5R 1VTKA 1OKKD 1XMVA 4MUBA 2R8RA 4A2QA 4EJSA 3QG5A 3KB2A 1VYUA 1Q22A 2NO7A 1OH6A 1S0UA 2R6GA 3B5JA 5D3MB 4KSBA 1X1RA 2J7PD 2JLYA 3OIYA 3SHWA 2OCBA 5FL7D 1G3IA 1KNXA 2WOJA 1IY0A 1P60A 2ZUCA 4EPTA 4DCUA 5HZKA 2J0UB 1JJ7A 4M9ZA 3QE0A 4LX0A 1GNRA 4ACAA 4DKXA 2CHQA 2H57A 4DRZA 1VECA 3DOFA 4A8JB 1TQ2A 4W5JA 1G5PA 2JDID 4NYIR 4NCNA 3DZDA 4TL6A 3VTKA 1DAGA 2G1KA 5JWOA 2IEZA 3BE4A 1J2JA 3OEHD 1SGWA 4M0LA 4MGKR 2O8FB 5K8LA 3SC3A 1N5LA 4V0KA 3TNFA 821PA 3E2IA 3TR5A 3VQTA 4OK5A 1DAKA 2YOGA 4AKHA 2C03A 3CF0A 4CEIB 3QPVA 1G9XA 2CE7A 3B13B 3CPEA 3K0EA 4WA7A 2YJTD 5J4HA 1A5TA 4PSKA 3FVQA 1E2MA 4IVQA 3BS4A 1QG2A 3EC1A 3TVTA 2ASEA 4CT4B 3AVUA 3UPUA 4PQYA 4Q4LA 3K53A 3LVQE 2WWHA 1A4RA 1DE0A 3VU9B 1Z29A 1OFHA 2IS6A 1F6BA 4OHWA 3W6PA 3DM5A 2CJWA 2GHIA 4TMXA 4NYMR 4Q1FA 3FKSD 4EUNA 1OF1A 2WPDD 3NDPA 4BLTA 1KNQA 1N5KA 1A82A 2YVUA 4L5BA 1JI0A 3WNDA 3OEED 1Z08A 4D0GA 4B43A 4DCVA 1XTQA 2G6BA 2ODEA 3AF1A 3NKVA 5L3QB 3Q72A 1T6NA 4JLMA 4URYR 5CB8A 3AM1A 3RVBA 1JR6A 1E4VA 2AX4A 2R6FA 1OJLA 1WCV1 1Z0AA 4TQ9A 3L0PA 2C96A 2XJ9A 4L9WA 1SXJE 2VF8A 3GLIE 4JBXA 4JLOA 2GAAA 3PEYA 1W0JA 3I8XA 4OHXA 2BJVA 3R20A 1OHHA 5JCPA 1D9XA 3A1UA 1TEVA 1X3SA 1J7KA 3FYHA 4M1WA 4DJTA 3LXRA 3D7MA 4FWTA 2A78A 3ZD6A 3GLGE 2IYWA 2JEOA 1DAHA 3KTAB 2FSIA 1W4CA 1G21E 3AKCA 1QG4A 2QP3A 4U00A 4DSNA 3CLVA 4HDQB 2O52A 1P2UA 1CJMA 5E7IA 2CK3D 1AS2A 1M8PA 2WJVA 3B2EA 4HZUB 5IHPA 2J41A 3NEJA 2Z43A 1F3OA 1YRBA 4B6EA 3FHTA 1E79D 2EFCB 1XMJA 3BGWA 1UAAA 3AVYA 1KSHA 1U0HC 221PA 2DPXA 4A92A 5L3RA 2GJAA 4TQUS 2PZGA 3RLFA 1GKUB 5LD2B 1NIJA 4K8OA 2O8CB 4IEIA 1LV7A 3FPAA 2WKRA 5FPKA 4UXJA 4OBEA 2V6JA 3IPYA 1W4RA 5G3YA 2O0KA 2VTKA 1KO1A 1R0XA 5EP4A 3OAAD 5AUQA 3N70A 2QQ0A 4KXFB 3RNLA 3ZVRA 3MWLA 1P73A 4CIDA 5FTJA 4GOKA 2IYXA 5FH9A 2C9OA 1W4BA 1X1SA 1AZTA 1I4TD 1K5GA 3KQNA 4Z1MA 5HTKA 1T4GA 3BAFA 2BIFA 5IT5A 4L8GA 1UEIA 3A8TA 3IEUA 3ASZA 2VBCA 1Z5ZA 1FUKA 3QG1A 2ERYA 1KOFA 3NVAA 3K0CC 3PUXA 2PJZA 4LJ5A 1PUIA 3VX3A 1T5IA 4R9UC 2OFOA 2QSYA 3TJZA 3FTQA 5L3VA 3LQQA 3K0FB 5EE3A 3DMDA 3F0TA 4D6PA 2AXNA 4DLTA 5AJVB 5IK2A 3V9PA 4R2IA 1HV8A 1N0UA 2Q0HA 2QAJA 5ANRB 3Q7QA 4P33A 4P4SB 4UXHA 1CR4A 4YONB 5FI0B 2ODBA 4TZ6A 4L16A 2CDNA 2HXSA 4BASA 1D8TA 3OFND 5L8VA 1G3UA 1UBEA 1AQUA 2UZIR 3LX5A 5HCIA 5EP1A 4R7ZA 1WA5A 2ZETA 3TH5A 3CNNA 4QFMA 3P1JA 2C9YA 3CPJB 4BGDA 4RD2A 2AN9A 3W90A 1OYWA 4LC0A 3CW2A 3KXKA 1NSFA 3NC1C 1G4AE 5TDHA 3U4QB 3RS0A 2QTFA 3T06B 2CLSA 4KYIB 5D3QA 3O8BA 4NU0A 2AK2A 3ZQ6A 2QRNA 1ELOA 3F8TA 4D0NA 2RGCA 5KHOC 4C0BA 4QHSA 3K70B 3QXJA 3A1TA 3IBYA 2WZQA 2WKQA 2SHKA 5CIWA 1GKYA 4ZDIA 1YQTA 4US0R 2ZVQX 4PR0A 3NH6A 2H8KA 3RWMB 4MRRA 1R4AA 2A5FA 2D74A 1T3LA 2N42A 2OZEA 4Q4HB 3R8CA 4ZIRA 3I8SA 3W8NA 1ZMXA 4BZQA 5AJZA 3U3OA 4B75A 1NNEA 1KJWA 4XWAA 2O8DB 4V0NA 1K6MA 5J4LA 4C4PA 4EPRA 1BH2A 2ONJA 2C98A 3GEEA 3CZPA 1K8RA 1JR3A 3CUEF 1XJCA 1KHTA 4RSGA 3C7KA 4IFBA 4LBWA 2NZ8A 2W0SA 1QBKC 1PLKA 1X8LA 2G0TA 4WIAA 3VX4A 5AUOB 1DARA 3C5CA 1OV4A 4GT1A 5KOYA 1N6KA 2F43B 3SU8A 4ZDWA 5EE9A 4A0RA 3KQLA 1XFAA 2FPKA 1UKYA 2HDNB 1KI6B 3P20A 1UKVY 4I99A 2ECKA 1Z0JA 2WIBA 4XWOA 4JVNA 2JLUA 2FH5B 3ETLA 3MSXA 4C0QC 2RGNC 3PENA 4JT4A 1E9AA 3GPLA 3NBZC 5DO9A 3B1ZA 3L0OA 2R44A 2D2FA 2CNWD 4D4JA 1J8YF 3A6PC 1GNQA 1GNPA 2KE5A 4BEJA 3ND8A 2HCBA 3BBPA 1E9DA 1Z63A 3AEZA 2BMDA 4FMCF 2WIAA 4JJZA 4C7OB 1D5CA 4NDZA 1EG7A 4LJ9A 4QOSA 5FBVB 5FR2A 1R6BX 3B60A 4AC9A 1GRRA 2B7CA 3CM0A 4CEHB 5BN5A 1Z8FA 5EXXA 4PQFA 4BFTA 3C16C 2D7DA 4A2WA 1KO4A 1OE0A 2ZR7A 4MRVA 4M9QA 4HUTA 3OE7D 1ZNXA 2GEUA 5CIQA 4BLSA 4MDFA 4PQRA 1DELA 4JLDA 4O0MA 1XTJA 1OFTA 5D3MA 4LJ6A 2W6IA 1LF0A 4PPFA 1NVUQ 3GFPA 1NBMA 3GJ8A 3UWOA 4PX9A 1N2CE 1C1YA 3E70C 4IJMA 1Z22A 3BERA 2GF0A 4EPVA 3O8CA 2LKDA 2YOFA 3SYKA 2ZJAA 4JVSB 1VIYA 5TB5A 3TK1A 3C5HA 3N2EA 3AVTA 2OESA 1CIPA 3AGPA 1S3SA 1C4OA 1JPJA 4IDQA 1JNYA 3AKEA 3C8UA 1YKSA 3MRSA 4ZCLA 2O8FA 2VHJA 1U99A 1S1CA 3F5FA 3KKMA 1FTSA 4B76A 2IUSA 4AI6A 3IPXA 4UKDA 4GBMA 3HU1A 5C4GB 1ZD8A 2XZLA 2CEAA 1KI1A 4FMCB 4M8NE 4F91B 1ZAKA 1NMXA 1OH5A 1XMSA 4CEIA 2PCLA 3KDSE 4OQNA 1NMZA 2GBLA 4MKFA 5KSZA 1WP9A 4NYMQ 3KKPA 1O87A 2H16A 3REGA 4LYHA 2BBOA 2ZUBA 4ILEA 5DH9A 1SVKA 5EZ5A 4B74A 1XEXB 2G77B 2DWOA 2IUTA 3UWKA 1JEDA 2IX3A 2ODWA 1YR7A 2XZPA 3EC2A 2QA5A 2LKCA 2FEOA 1KDTA 3A4NA 1KDRA 4JLJA 5H68A 1QHNA 4W5HA 2IYTA 1FZQA 3LRPA 4FIDA 2QMEA 4XTRA 3TVDA 5FTMA 1CEEA 1GOTA 1UPTA 2ZRCA 3PEVA 3A1VA 2CE2X 1HQCA 2BMJA 4HAZA 4PAOA 3SYNA 1Q3TA 5HKKA 3GLFB 2JLWA 2ZJ5A 3CR8A 4TMTA 5EE1A 4DLWA 2QE7D 5P21A 1BMFD 2PEZA 4A15A 1ZD9A 2XB2A 1TUEA 4LOAA 3ZS8A 5GADl 2IL1A 3T5GA 1GDDA 1TAGA 2WJIA 3OESA 2G9NA 3LAWA 3QPUA 4HAVA 4RD3A 5DGXA 3THWB 2NZJA 2HJGA 5JJLA 3KFVA 2OCPA 1XTSA 3R7WB 4Q9JA 4CDGA 3H1TA 1W2HA 4Q00A 5KSPA 3UG6A 2ORWA 2KBEA 3QXHA 3PJRA 2CHGA 4UQOA 3CNOA 2REXB 5JECA 2IBMA 1OFIA 1A2BA 2YYZA 1SKQA 2EFGA 1P9RA 4PHFA 4EPXA 2ZQ5A 3U60B 5JMTA 4LHZA 2VHCA 1E0AA 1T9HA 1FMJA 2HYIC 2EFDB 1ONBA 2QL6A 3IBGA 3IHWA 4K46A 2VO1A 4YXWD 1GL7A 3KTAA 1DAEA 2OO7A 2HF8A 4N0EA 5FOWA 1SKYB 3PUYA 1XD2B 2BKEA 3NH9A 4FXPA 1ZIPA 4B3DA 1G64A 1NVVR 2R9VA 2W2VA 3ZVNA 4EIWA 4HZUA 3Q5DA 5GJWC 1IOZA 2KWIA 3I32A 4IHQA 2RKOA 1XTIA 2A5YB 1SHKA 3HU2A 3ZIAA 1F2UB 1UKZA 3PXGA 2XNDA 4DT1A 2XTMA 2P65A 1H8HD 3X1ZA 2ZSFA 3X2SA 4NL4H 1D2MA 3RHFA 4OJQA 3QNUA 4B2PA 2O8CA 2WWFA 2OHFA 5FPYA 1MO3A 4MUAA 3U3KA 1WRBA 1UM8A 3HJNA 1Z6TA 4Q01A 3P32A 2FWRA 2YC4C 2JGNA 4Q7JB 1MO6A 1XJQA 4DLVA 1U98A 2YINC 5EXPA 4JS0A 2GKSA 2W83A 4MKGA 3RS3A 4C2TA 4LHYA 2J0QA 2D7CA 3D8BA 3GJ5A 4XSGA 5KYKA 2B8WA 1VCNA 5JSZB 2MSCB 1LVGA 1TQ6A 2QM7A 4F4CA 4Z8XA 4DLRA 3J81k 1G18A 3P4XA 4G5OA 2IA5A 2WOOA 2AFIE 4TSFD 3LLMA 4PO9A 3O8RA 2ZRMA 421PA 4R71A 1GL9B 4LCBA 5FUVA 4HSEA 1N5IA 3ZYCA 2QAGB 2JLZA 2V6IA 5K8IA 1ZD1A 4GP6A 5CM8B 4M9SA 5EP2A 4F7WA 1VHTA 5A0FA 3B1VA 1UF9A 3R9XA 3QKSA 4KLNA 5BW8A 1Q20A 4LWZA 1XXHE 4L15A 4QM7A 1RFLA 5C4MA 4LDJA 1TU3A 4NE2A 1NLZA 1NKSA 2QBYA 2PCJA 1D2EA 5K8TA 4HZIA 4M2LA 2GNOA 4P4SA 1OLOA 1SVSA 1UDWA 2ZYVX 2ZRPA 4N1AA 4ZPXA 2AWNA 1E94E 1XPUA 2G88A 4DLUA 4JSTA 4M22A 3TAUA 3U7FB 2ZVPX 1G3RA 4Z51A 4C3ZA 5AUPB 1XDBA 4IVRA 3EA5A 2KBFA 3HR8A 1AGRA 4ON9A 5EUQB 2PJRA 3R9WA 3OHMA 1E2NA 1YZUA 2X2EA 4DUGA 1R5OA 4IRUB 4M1OA 2GRJA 4RJLA 1E2IA 1T3HA 3FWYA 3DMNA 3H2YA 4PO8A 3SZRA 3W3ZB 4AG5A 3RRYA 5JEEA 5AK0A 4O3MA 3AV0B 4MGZR 4QXAA 3B85A 1UBGA 1LS6A 2WWGA 5JFGA 1N6NA 3Q85A 2XSZD 3AH8A 3RS7A 3AF2A 4Y0VA 2ZXUA 3K09A 4PHTA 2JIZD 2QT0A 2RGDA 4H9GA
chains in the Genus database with same CATH superfamily
2VBIA 4EHHA 1P7CA 1N2IA 3Q7VA 3T9EA 1OH7A 1ULUA 5CK4A 3L8ZA 3PHBE 2QZPA 3IDQA 5EKSA 4XIGS 2I8AA 2X1HA 5EJ4A 5EIEA 3NOOA 3OPYB 2VHZA 1E69A 4GUAA 2PT9A 3DFZA 4QARA 3A26A 1VKRA 4W5TA 3EXFA 2E37A 3E1KA 4ERXA 2IU4A 4NXGA 4L22A 4EI7A 4JP2A 3BCUA 1EWKA 1L5MA 4OOFA 1GZSA 1IPFA 4RUKA 4IR7A 2TMGA 2FPRA 4UA7A 1O9GA 3M6HA 3PHYA 4ZVKA 2H1IA 1KDWA 2WJ6A 2A92A 4EO4A 1GCAA 3WL3A 1C3LA 3QH4A 1VG0B 3JY6A 2IOFK 2XBMA 2IV3A 1J22A 4IIXA 4UASA 2Z3WA 4M9CA 5AHWA 1QOPB 4OQMA 4GLOA 1HZOA 1MKYA 3QUCA 3G68A 3BFVA 2C7GA 2NV0A 2DPHA 4U5QA 3QY0A 2G07A 4JKOA 2H08A 1Y48E 1E6UA 1MTZA 2QRZA 3UHFA 1MOPA 4J6FA 2B02A 4DV5B 3FZGA 4S24A 5BSFA 4FYKA 4YIKA 2CFSA 5JYCA 1X9IA 2NSDA 1G42A 3CMMA 5M5BA 1F8UA 1E3UA 1UBJS 1NVVQ 3BFJA 4LV8B 3H75A 2CV0A 1OREA 7AT1A 2GCPA 3G8AA 3PGKA 1M67A 1HKUA 1KE4A 3PE4A 3ICEA 4IRXA 1JFVA 1E2FA 1F2UA 3RDPA 4JL8A 5CJPA 1AY0A 1V3TA 2H7CA 5JH7F 5EWLB 5I7EA 3OF2A 2FPPA 4EAAA 2JEYA 1N57A 2XWJI 1X7XA 1MC0A 2AXPA 2WP8J 1E8MA 1COZA 1V2GA 1NF8A 2OXCA 5JE8A 4IICA 4C6TA 4D4KA 4OI2A 1L5GB 1K5HA 4V0RA 2W1TA 3B6KA 4E3WA 2RH9B 1GQSA 3WNVA 4QGFA 2H0QA 4C04A 1OLSA 1O5IA 4EYKA 3GLHA 3KYEA 3LDHA 5AKIA 2HHCA 3ADPA 1ZZGA 2Z30A 1EWQA 1ZUIA 4UM9B 1AN0A 1ZGBA 1HNWB 3TDKA 2HIAA 1PWDA 4U9UA 3DPIA 4RGYA 1KK3A 1C9KA 4BLPA 3TO5A 5FQOA 2WYOA 4MS4B 1Q92A 1QHYA 2BFEB 2VPPA 4ZVLA 2M1ZA 1W0KD 2ZRHA 2P04A 3R24A 4LFUA 4TKUB 2PLAA 3N0RA 4R4SA 3WGMA 4HQLA 3IKLA 3EJWA 1NBME 4ETZA 1ERMA 1Q5PA 4G5YA 3JQAD 3QMWA 4WELA 4LOHA 3F4KA 3JQ8A 3KNZA 4MDZA 2O5CA 3JRWA 1MRNA 5HQTA 2W6MA 2FGJA 4BZPA 5EUCA 2QYOA 1QQTA 1RPAA 1Y3BE 5BN3A 5HA5A 1N8TA 5LQRA 4ASUA 1S6RA 4FFBA 1E7QA 2W11A 1Z83A 3CX6A 4W1SA 1XVAA 2PUVA 1DDGA 1WL8A 4OHUA 3SN6A 1EHIA 3U40A 1UWKA 3ZGXA 2I7VA 1GPLA 2ZUDA 4MVJH 4WFQA 4L73A 1O0SA 2QUBA 2F1HA 1GA4A 2C84A 1JAYA 1BVHA 4A8JA 3I37X 1VDZA 4JI1B 4LHWA 1IL0A 4B4WA 4EO7A 4ETWA 4I46A 3BCSA 3UK7A 4ZVSA 3CNQS 4RTNA 3B20A 3F6RA 4ZZ1A 2ZM6B 3KXLA 3U3MA 2Z8XA 4YCDA 2EVWX 1ZCAA 3CLUC 2ZWOA 5CGZA 3O92A 5B36A 1YZHA 3RIGA 2B9VA 5BUSA 1GG2A 3C6QA 3TOCA 3HNRA 1WWKA 2O9JA 1B8NA 3AR2A 3RTGA 1FOFA 1R2QA 4EW2A 5CDUA 4D26A 4JA0A 3C38A 2A5GA 4B7CA 1J0BA 1L7EA 4B87A 3NM6B 2XYPA 2DJ5A 1BDJA 1DP9A 4YGYA 3ROKA 1TLFA 4V24A 3BK2A 4XGNA 1B6TA 3FUCA 2XVYA 2H9AA 3VVBA 1OU0A 2VIIA 2HIGA 1WVGA 3MAGA 1YR2A 5KSZA 2VV7A 4D3SA 2X14A 3X1DA 5B2FA 2VV6A 4H7EA 4B3CA 1WUTA 4Y9DA 1R0RE 5J5VA 1DQYA 2H7VA 4JP3A 3H2JA 3NGXA 1KGSA 4NPAA 1EX9A 3B1YA 3GPDG 2XA7M 2QHKA 1F38A 5CNJA 3HWWA 3ONEA 5KVSA 4YP9A 3JPYA 1Y8ZA 4LF8B 1EDDA 3QTTA 3H5OA 3LECA 4KXLA 2OORC 1SXIA 4B80A 2B7LA 2IYEA 5CA0A 4HJ3A 3LV8A 1T5HX 4JOBA 4X95A 2XGSA 3DT9A 2C2XA 4XFKA 2J45A 2IGTA 1BZAA 1F9AA 5EINA 3CZAA 3JQAB 1BROA 4UW9A 4LYFA 2PUEA 1KRWA 3ZHQA 2JCXA 1CEYA 3GY0A 2YUTA 5EN4A 4J0IA 1T4CA 2EQBA 4LDPA 3KQHA 1DY6A 1Y98A 1LD3A 2WVGA 3MXSA 3FLEA 4DXHA 3WO1A 1D7EA 2R87A 5CM9C 1SBQA 2Z2IA 5BSHA 3HO1A 3WB2A 1S2GA 2W0NA 3VNUA 2VDUE 3IT2A 3AHEA 1HUQA 4DG9A 1ZUD1 1GHTA 2D5AA 1P3JA 1U3DA 4P31A 4LHVA 3ZGLA 1QHXA 2A3UA 2FEXA 5HMLA 2XTNA 4OMFG 5HF5A 1I8TA 1D6SA 1I0IA 4ZO8A 1KMCA 1LI7A 2FUCA 4I0WB 3MWFA 3BECA 3OCLA 3EA4A 2AJBA 1E9EA 4EI2A 1M74A 1PO7A 3AM5A 3ZS9A 5K6TA 3AKDA 4ZU1X 3JZFA 2FMIA 3OCJA 1FXWA 2V7XA 4UEJA 3WOVA 1NM5A 3LP6A 2XFTA 1ES5A 1DBVO 4FD2A 1OI4A 5DT2A 5AVJA 1J2TA 3C3XA 3JQCA 5DSZA 5CTJA 3VP4A 5K2MA 1PQWA 5L4SA 4ZO4A 3C3DA 2W2OA 1VL6A 3UMSA 3CRRA 4QUGA 1JVSA 4DV4B 3ZDFA 1LK7A 5JPCA 4NG5A 3Q8MA 3V4RA 3RM3A 4M8KA 2XT0A 3CH4B 4EEXA 5DWDA 3LLVA 2GEBA 4E1BA 4DDTA 4RJIA 4EZIA 3P4YA 2QZ6A 3LI9A 3NHWA 4CUKA 4F2WA 2PH3A 2FFRA 4FYHA 4F9FA 3LBNA 2G5GX 5FI7A 1VJ5A 2HJ9A 2DCUA 4LJ7A 3B2NA 4TRNA 3MNFA 3RUPA 5HFJA 3JQEA 3GLHE 3WRWA 3BJMA 4MYSA 3OSZA 5GMOA 5DTSA 1GZ7A 3MRTA 1U28A 5AFSA 3WHIA 5EIWA 2QB5A 5HOEA 4AW9A 5DTRA 3VC7A 1QTIA 3CNHA 2FR0A 3FPLA 5IN4A 1AHPA 4M4SA 4UHKA 4MV3A 3ICYA 1BHJA 2HIHA 2J3KA 2G09A 4RGVA 5LYJF 2WY2D 2BKVA 3MAAC 1TA4A 3VDQA 1U3UA 4X8HA 4JF5A 4HDNB 1UBTS 2EFHB 2PWPA 1W0JD 5D2CA 1P0QA 5DI3B 1ZOIA 5EECA 4D8UA 2VNJA 4EBBA 3EK2A 1TC1A 4BFWA 3QWHA 4TQGA 1RYHA 3WG9A 1F2KA 1S8AA 1NQXA 3VDMA 3BKWA 1YMVA 3MT0A 3WWOA 4HH0A 1U2EA 4KUGA 5C80A 3PQ5A 1GU0A 3A3KA 1H5UA 3FPVA 3JTMA 1K4FA 2O20A 3REOA 1TF1A 2V0GA 2DZDA 3O4VA 4ZGWA 2ZSEA 2Q5IA 2ZROA 4U0JA 4BVHA 2NGRA 1OBVA 1WKVA 4DLBA 2XE7A 5CJ2A 1RRMA 1PCXA 4DR4B 1TT5A 3PYLA 2I34A 3QBEA 3ZI4A 1NURA 1Z17A 2VP6A 1TEXA 4R1LA 2IEDA 2HEGA 1XJ2A 2P91A 3KJXA 4HDCA 1XNJA 1AO3A 1P2BA 4RZQA 3C6BA 3ZVTA 4M0UA 4A8TA 4MVJF 2PU4A 1T19A 3F96A 4W5WA 4P87A 2WQ6A 1L5HB 3Q0TA 4U7WA 1OXVA 2QW1A 4S2OA 1KDZA 2I9VA 5IWCA 3HTXA 1JLHA 3T5DA 2R5NA 1X19A 2HV8A 5KPDA 1PT8A 4GYKA 3PTAA 5M18A 1RAIA 2V98A 4RPLA 1YV9A 3V8BA 1WD5A 3TNJA 3HG7A 2V54A 4HDKB 3WL4A 2VJMB 1QP7A 4RVNA 4OSPA 3AUSA 4RADA 2HX1A 2NX2A 4LTMA 1T5BA 3TR6A 3RAFC 1O96A 2OECA 2GRUA 5JEDA 4NYJQ 1X80A 3V1TC 3OQIA 2IXEA 4YLGA 3GEMA 3H9BA 1FS5A 4UUAA 3DBIA 2OHHA 5ELXA 5K5BA 1EDEA 4NE7A 3CUEC 2GPSA 5H9VA 2FFFB 1TTPB 4NMMA 4C0KA 3CUWA 5EFOA 3CONA 4ITRC 2P5YA 2BI8A 2WIDA 3L0IB 1IXRC 1RLTA 3OMWA 2R62A 5E9WA 3MERA 3AUTA 1DKMA 1D0VA 3UV3A 5KYWA 3FCYA 1KAGA 4J3NA 4S2LA 4YAGA 1D4OA 2H5LA 5ALFA 4BO3A 1HA3A 2G9ZA 1RHJA 4QFCA 3B9QA 5EJ7A 2I99A 1T2AA 4OOLA 5LP6C 3LC7O 4O25A 1U7WA 5KNDH 2QTGA 3HYTA 3ZGYA 4GAEA 2G5CA 2QV0A 3J7TA 2AQKA 3DKVA 2AEEA 1ZI9A 3I9V6 3AJ8A 1VRVA 2WHQA 5JBQA 3L8YA 1XPRA 3PKJA 4OB8A 2XGOA 1MJGM 3G85A 5C2JB 2RHLA 2XNSA 2C2BA 3W3AH 4CL0A 1VCOA 2ZM2A 2ZUSA 3KAJA 1Y3CE 1X0XA 3ZG9B 1XXLA 1G2IA 3GJQA 1RJ9A 3F5QA 3ETGA 3U3RA 5JAMA 1QIKA 3GV9A 1JXMA 4L0LA 2GCIA 2E4XA 1N6IA 2B37A 5DTTA 4JIMA 3ZWNA 4L4XA 5BMVA 2C20A 4BJHB 3EEAA 2C3UA 4O8ZA 2C59A 1JHAA 3E5MA 4NCKA 4E3OA 5J5AA 3BRWA 3QHAA 5DP1A 3EMDA 3LSYA 5HL6A 4MN5A 3BJNA 3VFHA 4NETA 2C82A 4ZOLF 5DHFA 4Q3OA 2GAIA 1OKKD 4RK0A 1ISPA 5TVGA 1UQRA 2WD7B 2J4CA 5D3MB 4WXMA 4C6YA 2C6WB 1VB3A 3AEUB 1MJGA 1G8MA 4XYBA 4DBZA 2ZUCA 2ZC4B 2CEKA 3D0KA 3DOFA 1RABA 3LC1O 5JWOA 3O4FA 4IVNA 3EDMA 3TR5A 1QVVA 5CDGA 3B13B 3CPEA 2EJWA 4WV3A 2WDZA 1TM7E 5I4KA 3N2LA 4G5HA 3UPUA 3UO9A 4WNAB 3VU9B 5A5EA 3W6PA 1AVTA 1YDHA 3P9PA 2UWXA 4X90A 3OEED 3TFOA 2HSDA 3C4OA 1T6NA 1Q6YA 4MAAA 4LMPA 3CLOA 4ITUA 1MPLA 1DUSA 4KG6A 3GYGA 1U1DA 1P39A 1X3SA 4DXDA 4PBSA 4HDSB 2VKTA 4U00A 3MJ4A 2L18A 3OE1A 4PTZA 2WJVA 3B2EA 5IHPA 3D8TA 2Z43A 2ZIUB 1XTPA 2PUGA 3ZQ5A 3H1PA 2GJAA 4QYWA 5LD2B 4IRMA 2DBZA 1ZDMA 1QK3A 2PBDP 1G9SA 3OAAD 5C34B 3MWLA 4EG8A 2BUAA 2XECA 5K3OA 4L8GA 1CUEA 3A8TA 3BMNA 2HV9A 2IA2A 4BVBA 3UAGA 4JB0A 4R9UC 3TI9A 3E7FA 4QVIA 2OHJA 2WKEA 1ESDA 3JSAA 3N7UA 4NV0A 3LX5A 2IBTA 3CNNA 2WIGA 1MNAA 4CKBB 4N0MA 4YUZA 5FNVF 2RH4A 4BC1A 2UXCB 2M2IA 1AKTA 3TKAA 1GLNA 5CHYA 3HUDA 4E3KA 3RGWS 4KQDA 4TWRA 2F1OA 2O3JA 2IOHA 3DTVA 1ODLA 4ZVMA 4V0NA 2O5EA 2BFOA 2IHKA 1KVTA 1RGYA 1C80A 4IFBA 1HNXB 5AUOB 3R40A 2HDNB 3DEKA 1E7SA 2YWRA 5KMGA 2RGNC 2PXHA 3O9MA 1WKCA 4JT4A 1WF6A 1P0IA 2FN8A 3JD0A 3A6PC 2ONYA 1GNQA 4TV9B 1T9GS 3RREA 3HXQA 3N0XA 1C0IA 1BQ4A 3CN9A 4DV3B 3GZNB 2XY4A 4PYRA 4U9HS 4BKRA 5BN5A 2G71A 1QCZA 4PQFA 4JSRA 3EMBA 4KQXA 4F6CA 1ZHHB 2CLKB 2H7XA 4AS1A 4MDFA 3G7NA 2EA9A 4OH7A 2O9CA 4IJMA 5J23A 2VQFB 4LX8A 4EY6A 1JXQA 3R3VA 3C5HA 5HDSA 4CM4A 5KJ1A 1Z56C 4ONEA 4KH1A 5IMSA 4GMKA 4K9NA 4PIMA 3R23A 2XZLA 4F91B 4IZIA 4YI5A 3V4LA 3KDSE 3A6DA 3TL3A 1J8QA 2VJQA 3OZUA 2BBOA 5ALQA 4N5DA 2PMFA 1YR7A 3Q9NA 3O8QB 4PO3X 4HF7A 1VC2A 2VJWA 2W2NA 4I5DA 3J80A 4HAZA 4LMAA 1YJBA 5HKKA 5EE1A 3VR6H 3SQLA 3J7AC 5DM4A 2F9FA 1LBIA 3R7WB 3BDVA 4Q00A 3C70A 1PRYA 3PRHA 3TTUA 4HFMA 1QRRA 1SKQA 1WQ4A 1THGA 2J6IA 4JU9A 2J9FB 1E0AA 5AVVA 2HYIC 4JGRA 2IH4A 3W2ZA 1KE3A 2IEAA 3AGFA 4QE3A 3BUSA 3L1JA 4YP5A 3PU6A 4UTPA 4QPRA 1UPFA 1ENYA 4N8EA 1ORWA 3P0RA 4YS6A 1JLLB 2VKSA 1RWPA 4Q7JB 1XJQA 3PUIA 3JPUA 2GKSA 1YE5A 2O23A 2P75A 3AHHA 4I2VA 4IJ5A 4WN9A 1P80A 3VISA 2QM7A 2PZAA 3DQQA 3J81k 1KVRA 4S0XA 3KKLA 5FUVA 3ZYCA 1Q7RA 1ZD1A 5ARBA 2AN4A 1UF9A 1BTOA 3C3CA 2QJFA 4JI5B 1NLZA 4BX9A 3PBTA 5FLXA 2PWZA 3FZCA 1E94E 2GASA 5LM3A 1HLUP 3U4DA 2QMYA 4F2GA 3BY8A 5EUQB 3OHMA 4Q3LA 1T3HA 3F1OA 1YDWA 2R1TB 3AH8A 1UZMA 1J0DA 3K09A 4PM8A 4U6QA 2OBMA 5C5IA 5AQ9A 4H0FA 3TW6A 1LNSA 5F98A 3OT4A 4GS9B 2Y0EA 1BX0A 2ZSKA 2QEQA 521PA 2PD3A 5TBMA 2Y59A 3EXIB 4OP1A 3FNFA 5DHTA 1J39A 4FONA 3MMNA 4UUMA 4RORA 4YASA 3FMFA 3I09A 4BVKA 1MR3F 3MBKA 4TQAA 2AZTA 3PPIA 2H0TA 4DTIA 1GZ6A 3KYDA 1KY2A 3INYA 3A4IA 4H7PA 2OBBA 5IBRA 2IYAA 4CEHA 5TMDA 4Q4JA 4ZRDA 2FEWB 5HK8A 4LWOA 4PHGA 3JZAA 2L19A 2VK2A 2OSBA 4B4UA 5I7AA 3UENA 5JNUA 3D4NA 1UT8A 1U5BB 3ZTYA 3HZRA 4CHTA 1M1YA 1NUTA 2CVFA 4DIUA 2YL2A 5FSRA 3ENNA 4JEUA 1J7JA 2AIRA 3K9BA 2AN3A 2HJVA 5CGXA 1M7BA 3AR3A 3KQWA 3FCOA 5JD6A 2JJQA 2PH5A 1EFRA 1W5EA 4YCAA 2G17A 3A04A 1MRSA 4XD7D 5LR6A 4BTVA 2P69A 1LZKA 5JD5A 5B58T 5E2AA 4J0FA 5TS3A 4OH0A 3LVBA 4R8SA 1SBIA 1ECLA 4P3KA 1ADCA 2FDRA 3BH0A 2CSXA 3IUNA 5DYWA 4RDXA 2C5WB 1KOJA 3ZXIA 5LU9A 1SCNE 1N9OA 1M6EX 2GYWA 4LRZE 4PZLA 5GVSA 2E5FA 3NEPX 4WLUA 1V41E 4ZC8A 2FOIA 2QTHA 1Z7EA 4HFRA 4FWBA 2FPMA 3UB9A 3MINB 3J81A 3C48A 3LFUA 3WADA 1OAOC 3SYTA 4C7MA 5CMLA 4J0GA 1KY5A 2HBZA 4G37A 3CVOA 2ZJ8A 2ZYTX 2BI4A 2R66A 5IYZB 2HV1A 2ACKA 3QF7A 1FJXA 4LV1A 3NFYA 5ADHA 1Z6XA 3B1FA 2XDAA 2XJ4A 2OA0A 1L3IA 4ETNA 1HYBA 2P6PA 3WDMA 4LNAA 2JKVA 3OIUA 3G9XA 4FLEA 3SXJA 2FKNA 2YWHA 3OLZA 4QA9A 2K7ZA 2QE6A 1UODA 3D5EA 3RVJA 2J09A 4LQ4A 1YI8A 1R6UA 4E5MA 1VPWA 2CT8A 2ENWA 5BVGB 2XVZA 2V7TA 1GCGA 4LRUA 1T8YA 2P6UA 3B9BA 3OPVA 4LZWA 5FQJA 4EQ6B 1FTGA 3MLAA 3SQNA 1IM2A 5HDDA 3CKLA 2BKLA 1E3DA 5U1PA 3QLUC 2YIMA 4U5XA 4OLDA 4RPKA 4ZFNA 1US8A 5HIAA 4JFRA 5JTTA 5I9MA 1O5OA 4AP6A 4CM8B 4JLAA 3TQFA 2GA9A 3JRNA 5FPQA 1WDWB 3W4IA 4UHDA 3HKEB 1JEQB 4C07A 3RUDA 4JLBA 4F8EA 3LFTA 1D7AA 1RWBA 1RP1A 3EXHC 5SZJA 2XCRB 4NQRA 4M1ZA 3TBHA 5CFPA 4B46A 4H6JB 1X87A 4PPNA 1TQHA 2FP4A 3T1OA 2O19A 2BUBA 2WABA 1TE2A 3RJ5A 1BMFA 4DADA 1Q57A 3JWJA 3V4OA 5ER9A 4C9BA 3JYPA 1XFDA 2OO5A 4IIJB 5IDXA 3WIEA 2B20A 2RGAA 1OCEA 4ZT6A 3JX9A 1I3LA 5FEMA 5JD3A 4JUCA 2ZIZA 1Z37A 1EUDA 3PNKA 4FEEA 3OZTA 3SEZA 2JJ1D 1XXMA 5AOBA 2RJ3A 4GX2A 3A9VA 4RVOA 4P7KA 3IQIX 4IOMA 4OQLA 1EX6A 3QLJA 4KWCA 5C7OO 1OIVA 3HLGA 4S04A 4NBVA 4KU4A 2RGYA 3IP6A 4QBKA 5D6NA 3ZZ0A 4IS2A 1JNXX 3EG9A 3GUYA 3UPTA 5KOHA 1DEAA 1PZXA 3C4JA 5EZSA 1OYVA 5EXEA 4JZKA 3SS5A 3GEGA 3LU1A 4C5CA 4TM8A 1BKSB 1GAQA 2WYXA 1S2NA 2EZUA 1AF4A 1FYWA 3PQEA 4UCQA 1QQAA 3PSHA 1LPMA 3GYBA 5A06A 3ROTA 2IS2A 1RP5A 3W34A 2GM3A 2BEJA 3DG9A 1ND6A 1CUYA 1NJ4A 3ZJ5A 2B30A 1Y6RA 3ZGOA 4KZ9A 1Y6QA 1W8YA 2ASVA 2PWAA 3MS7A 1RHRA 3MSHA 3DVRX 4G2TA 1MHTA 4OEHA 2Y77A 4UFNA 1R8XA 2JL1A 3WYAA 3DKIA 3QOFA 3GLIB 2OHGA 3TQSA 4Y1RB 5LA6F 2RAPA 2CCKA 3W6UA 3RIEA 5F2EA 3EPLA 4HLDA 1MBZA 1KC3A 2CB9A 4R2LA 1M1YE 2P9FA 3PTZA 1TS6A 2I4TA 3W5DA 2VWPA 1U3VA 2A3RA 5HVNA 3EOBI 3I9MA 4ZVOA 5A5GA 4GOMD 1UXKA 4E51A 2HEIA 2YCBA 5DF8A 1YU9A 3BJEA 2FPGA 3CJRA 4QPDA 4PGFA 3LBAA 4YCMA 3TKLA 3GD7A 3LWDA 1YC5A 3FBGA 3TRKA 3PJDA 3BTOA 4AZWA 2F62A 2VNHA 4AQDA 3G5TA 3AR8A 2FSHA 3D7RA 4FFSA 4ZO9A 4F38A 3TTYA 2QP9X 1JJBA 3PUZA 5AKGA 5KKAA 3OE5A 3HU3A 4IVPA 1ECJA 3QVOA 1ZISA 3R0QA 2VTBA 3DMPA 1FYDA 2WFMA 3H86A 5HDCA 3ZZMA 1CDZA 5DXJA 3THXA 4N3NA 2DGDA 1S9HA 4GP9A 1Z35A 1H69A 4JCCA 2LB9A 5JRDS 4C0HA 4O4JA 4MRNA 3GH3A 1T8WA 4EZBA 2WWWA 1JQ3A 1KMIY 1FR6A 3ZDRA 3S81A 2LIPA 2X9VA 3BM5A 3THYA 3QA9A 4NONA 3LY7A 1M0EA 5H3HA 2JEZA 4X8LA 1QANA 4NARA 3GT4A 3RFBA 3BTUA 1M0SA 2QIPA 3D02A 5BNZA 3CTMA 4G41A 3QU2A 4NK5A 3S8MA 3DTIA 1E9RA 4L74A 5GOTA 2C2HA 1GWNA 4RHXA 1C1XA 4IGAA 4E21A 1MQSA 2WHRA 2I80A 3OJOA 5AJWA 3EGCA 5L3SB 3V4VB 3SXUA 5HQJA 1Z6ZA 4TLDA 1GCOA 3M4JA 4QU3A 2IPOA 4WY2A 2ET6A 2VBFA 1OI3A 2ZI4A 1QQ6A 2L2QA 2IDZA 4OJMX 3N07A 1UXHA 4Q18A 4DLZA 3PFWO 2QHXA 2FZEA 4MNTA 3BK1A 3OFNA 3NDRA 4TMZA 3QMPA 1CP2A 1R37A 1QE5A 2J3MA 1LL5A 3UQYS 4ROSA 2PIDA 4C03A 1RYYA 2G83A 2HH9A 1YR3A 5FNZA 3WXMA 3KTOA 3TCNA 3D4IA 2FMKA 3KSZO 1STOA 1DZIA 3V5NA 1KEWA 1G7RA 1ZINA 3DNPA 1DRWA 1MDBA 2B7BA 4C0XA 2XODA 2PQ6A 2J3TC 3FI9A 1RLIA 3TQIA 1FSYA 3VNSA 2VZEA 4PAQA 1GU1A 5E6RB 5AJTA 3ET4A 1LPSA 3NP7A 1Q17A 1YL5A 3OWOA 3GNQA 3PIIA 4G3KA 1VE5A 4GLFA 1E2LA 4QD3A 2QMUA 4RKQA 4BBPA 1TPYA 4M6WA 2QJRA 4IV8A 5HQ3B 2PTGA 1D07A 5CPFA 2P9QA 3QY9A 4KQ2A 2MSDB 4OJKA 2J80A 3WB0A 4WFJA 5KWIA 4OBXA 1T13A 3RWBA 5F5NA 5HAIA 3EGEA 1NG9A 4DMMA 4ENQA 2CZQA 2YXDA 5F5YA 2R1VB 2J5BA 3AZPA 3QVGB 3GMIA 1JG6A 3KEFA 3RF6A 3AF0A 3ZI7A 1OIWA 1K5DA 2I6UA 3UCEA 1SD5A 1CRPA 4Q9IA 3CC8A 4MEJA 4R4JA 1M54A 2DYKA 3G2OA 4TTPA 5H3LA 5F2NA 4NHOA 2X19A 2XZTA 3B1JA 4KFUA 3FPWA 2B99A 3ZR4B 4J2HA 4BZZA 1Y4DE 3JZMA 2F8SA 3NTVA 1Q1AA 4OLFA 1T1IA 3I5XA 4D81A 1DOZA 4XCQA 4JLNA 3ISTA 3PC7A 1TM3E 3T38A 2ZULA 2XHZA 3W5VA 1LK5A 4U3JA 2OYRA 2QJOA 1HR0B 3MEQA 3B9PA 4AECA 1N3BA 2MJLA 1C3BA 4OXKA 4PWZA 3TRJA 3AIIA 3K0AA 3Q1FA 2IYLD 2VDPB 2VSQA 3PHHA 4ABYA 1IZYA 2Q3HA 3WAGA 1K92A 3I73A 2I54A 1SKAA 3SR4A 1ZJ4A 3E2PA 5J3JA 4GPTA 1NBMD 2C3OA 3H2SA 4Y0NA 5KWVA 3PGA1 1MORA 3C15C 3GFBA 3HR4A 3JD4A 1BS9A 1Z4QA 1KEUA 5HAQA 1MA0A 1LC0A 3HLDA 1AD2A 3UHPA 1PRQA 1OX4A 2Z4TA 3EHDA 2ZR0A 2G9QA 3PQCA 3EAQA 3AY7A 5HM6A 2RGRA 4NEED 3WSWA 2ZJZA 3BGOS 4DQXA 1K5PA 4KV7A 5DHSA 4AMGA 3EODA 1P19A 1F4PA 3ROEA 3R4VA 5C5CA 1SUSA 2XSZA 5B2EA 1EFTA 3KS9A 2JG3A 1QVZA 3QBJA 4YCLA 1T8RA 2C58A 4J0QA 3DAVA 5EHZA 4KBYA 1QB8A 5KJFA 3B42A 3H3JA 2QTVB 1YU6A 4P80A 2EZ9A 1E0DA 3KC2A 5BOSB 4OKSA 3U80A 4LXQA 4CMHA 5CH8A 4JWTA 2WI8A 3STTA 4GR9A 2UYYA 3VTFA 2ZOHA 2PIAA 5GJVC 4EERA 1RHKA 5F23A 4OYRA 1CUBA 4GHIB 4NR0A 4BENA 1W76A 2XA1A 3ZVKA 1XTRA 4OMCA 3R9IA 4ROTA 1J06A 3FDFA 1BYIA 2TYSB 3L5KA 4CMCA 5EZYB 1L0GA 1Q7CA 3AP3A 4LBYA 5JAOA 4XEHA 3GDFA 3MELA 4RDIA 4UM9D 1NN1A 1WTCA 2XOXA 3R3YA 3OPPA 3ESCA 3GW8A 2Q21A 3W5JA 1C1DB 4J0CA 2OTCA 4Z4QA 2X9QA 3DFMA 4BLVA 5JROA 3HR7A 4NOKA 3RU7A 5GINE 3F6PA 3ILVA 1DJAA 4X7BA 2JGDB 3GGJA 3KSFA 2CWWA 3TSWA 2OHVA 5A5FA 5ARDA 2YY5A 1LV8A 4HWOA 3K7EA 3BZBA 1ZJYA 4JYCA 4QAQA 1JEYA 1M1NA 2HD4A 3CZ4A 3DOOA 2DSTA 3N3BC 3VR5A 2HMSA 5AQ1A 4RH0A 2VHUA 2Q0XA 1XTZA 3C5AA 5BMOA 4RSHA 3IERA 4DM4A 4HXGA 5FL7D 1G3IA 2PG3A 5B6PA 3TOVA 3H4TA 3DP9A 4XUXA 3PEFA 1SU6A 3QV2A 1UOEA 4W5JA 4HNUA 3QKWA 3ZG0A 3WJ1A 3EDOA 3S7ZA 1R4MB 3IWQA 3HO6A 1YUBA 1GZVA 4GR4A 3OE4A 4H4CA 4RQUA 4PSKA 1FDUA 3UNWA 2WWHA 5JYOA 4LOJA 4JXVA 4Q3NA 4Q1FA 1AV6A 1N9GB 1ZSNA 1IYOA 2X6TA 2GTIA 5L3QB 4JGIA 5JQGA 3TRCA 2Q2VA 1E4VA 2FEKA 3IMEA 5D6OA 4C87A 3U09A 1POXA 3QFSA 5KYXA 4AY6A 5I8WA 4IYJA 4NOJA 3QP4A 1D1JA 1EVKA 1GTZA 3BGVA 3I9NA 1BMQA 4DXBA 2Y2QA 2ADFA 4DSNA 2Y8HA 2WF6A 1H8YA 3JYIA 2X4DA 4U2KA 4REQB 2PNJA 1E63A 1F3OA 3OBIA 4EG4A 1ISRA 3L18A 4WHMA 2CUNA 3BGWA 1E3UD 3IVGA 1U0HC 221PA 5DASA 5KSCA 2FWIA 2XYRA 3UT5A 2WKRA 1W4RA 4C3VA 2Q62A 2VTKA 3G2ZA 1Q1GA 5BV8A 5ALRA 2QL7A 1M8KA 3TN7A 1M2NA 3DBHB 3WGIA 4D0RA 4EW1A 2IP1A 1YFZA 2P9BA 3QLTA 4KXMA 1I1QB 5ALWA 5LWHA 3V2HA 3AETA 3D6NB 3ICVA 4QPPA 1DBQA 3ZWDA 3PNLA 3NDIA 1SAYA 4NU0A 4YCJA 1YRLA 4S2MA 3HB0A 1HFKA 2Y91A 5JJ5A 5I4BA 3PHJA 2QRVA 1WHSB 4MRRA 2D74A 4RTMA 4ZIRA 4NAHA 3NW9A 3Q7VB 1S2OA 1FDIA 2P3LA 1P33A 4JLSA 3ZHUA 3IVCA 1K6MA 3PGJA 4C4PA 4EPRA 1O2DA 1SKOA 2NM0A 3DOIA 3SIXA 3C7KA 3RSZA 4LBWA 4LOIA 4EESA 4ZEVA 5B1SA 4RHEA 4YJKA 3K92A 1A9OA 4YJ3F 5AOCA 1G5IA 3ETLA 4PLGA 2D2FA 2BPOA 4LGCA 1PW1A 2WIAA 2W1RA 4B7UA 4QOSA 1C3OA 1R6BX 1K88A 3WL7A 3TLGB 1IZ7A 3CM0A 3TAXA 3C16C 3TXXA 3IMGA 4M9QA 5CIQA 4MHTA 2AB0A 1NHGA 1QAMA 4EVQA 5C53B 3GF4A 4EPVA 4HDAA 2ZJAA 5TB5A 5FX2A 1V9YA 1TZ2A 1WR8A 1A4IA 3AKEA 1U99A 4LF9B 3NDGA 1L4GA 4GX0A 2H16A 1E5XA 5LQDA 3KOUA 1XC7A 1NOIA 1U0EA 1Z4LA 4JR1A 4GHWA 3ZCRA 3RB8A 3L0BA 2QRHA 4IIYA 2PEZA 2D00A 4L57A 3OOSA 3BIWA 2HJGA 3KFVA 4X61A 4XM0A 3KU4A 2O0LA 2ORWA 4JUIA 4DQDA 1F9EA 3P94A 4FNMA 4I50F 3LT2A 5CLIA 4G8DA 4YJ2B 4TX1A 4MCHA 1E3LA 4H35A 5A5VA 1P2GA 1KIAA 1DAEA 1GCEA 4DMHA 3PNMA 1OUMA 1W35A 1IIRA 2VPTA 3HU2A 1F2UB 2JFZA 4E5DA 3HYLA 4NL4H 1D2MA 1AKUA 5A1JA 3QNUA 1QIJA 1A9PA 2CB0A 5AHOA 3B3JA 2YINC 1YTUA 1Q0HA 4FM9A 3GRYA 3B70A 4DLRA 4G5OA 2P9VA 4RA9A 3ROPA 4CWAA 1LJUA 4R71A 2QAGB 5K8IA 3OZHA 5EP2A 4F7WA 3FIUA 3R76A 4AKTA 2W1TB 6REQB 4LWZA 2OHOA 2V8CA 3ESDA 3RVSA 1OLSB 4FH2A 4CIAA 3T4JA 1RCFA 3H1BA 3L1IA 4XUDA 1DIOB 3UXHA 1IC6A 4PO8A 4PYQA 3AV0B 4MGZR 2WWGA 2GAJA 3ZOZA 1EDZA 5FTLA 2IUFA 1JB9A 4GGOA 1T1SA 1Z09A 4IFTA 2AR0A 5JI2E 5BXYA 2ZQ9A 2A14A 5M7EA 1CB0A 4PICA 2GJ8A 2V6BA 1MZPA 4JKTA 3RFCA 1HDIA 5I7SA 3E9YA 4KKXB 4N9WA 3PC8C 2F43A 4DLYA 1VETA 3M3DA 1AXEA 1KI6A 3KUDA 4H6VA 1GSAA 5AI4A 3G8BA 1ZR2A 1JDVA 3RJUA 4CGYA 3IP7A 3B3GA 4UNQA 1O03A 1GDTA 3UFXA 1PW7A 4OQPA 3K94A 3QJYA 2X5XA 4BLQA 1ETHA 3AUJB 5TV2A 3ACDA 3VNBA 4FOSA 4WOCA 5BN3B 3HJAA 4AICA 1XMQB 1ST2A 3BRMA 1JTVA 3JYOA 3BWCA 1QO0A 4O01A 1KGFA 3QIAA 3W8FA 4R98A 1PL0A 4Y1EA 3TW4A 3TNYA 3UJ6A 1E9CA 1S2DA 1W5TA 3HDGA 5K0TA 4RF4A 3NGLA 1RQ7A 4WK2B 4WCDA 1B1AA 3OOEA 4QDOA 5IRCD 1SD1A 4WADA 1C0KA 3BXZA 3SGLA 4KQQA 3NMUF 1QHSA 1ZGAA 2EHDA 1WB6A 4AKIA 2H63A 3SVZA 1TM2A 2VXOA 1A9TA 2NLOA 3I2IA 3DOCA 4D25A 3G2JA 2NUPA 2JZCA 1O7EA 5SZHB 1H05A 3W2HA 5J58A 3HBMA 4HWTA 5L51A 2O1EA 4IEDA 2QP4A 4EDHA 4DJ5X 2X7JA 3N2ZB 4Q1AA 2GJ9A 2I4NA 1S4SA 3W7VA 1DAIA 3BAZA 1N2OA 3OI7A 2CDAA 5CCXA 2RB4A 1AURA 4KLZA 2LXNA 2CJPA 4GRDA 4NYJR 1LX6A 3G2YA 3RYIA 5EKXA 3W9UA 1FDRA 1TDLA 1VKNA 3SH8A 4CE6A 4YUAA 3K9CA 3T4EA 5JSZA 2AW3A 1BWQA 1TKCA 1OWOA 3NIFB 3GEPA 1BWSA 1MO4A 5AMXA 4PINA 3RHSA 2IP4A 2OZPA 3NJ8A 1W8DA 3X1KA 3U4AA 2M6KA 1XTBA 2VDNB 4D3ZA 4KP7A 4ENWA 1HLFA 4DNQA 5KI6A 3Q6MA 1DRVA 4HS4A 3VNRA 4YDHB 3KTDA 1JT2A 1ZA1A 3HA2A 4ZALA 1LI0A 3HCYA 4YFMA 1NY0A 4DMFA 3HFJA 1XEAA 4W9NA 3IPAA 1L7QA 2VS1A 1XZEA 3G31A 4G1CA 2BGGA 1L5ZA 1ZC4A 1NRWA 3SMQA 4ZYUA 1T4CB 2NPFA 1QS0B 1TUGA 2HK6A 4ZGGA 1ZD5A 3MWEA 4D80A 1PEKE 4AS3A 2YKGA 4Q4DA 1NQ5A 1EBFA 4BCDA 2QJWA 4M89A 5GLBA 4A91A 1U4SA 3FF1A 5F73A 3SZGA 1IELA 2AG1A 4UNRA 5G41A 3UMEA 4NDNE 4GC9A 5DBHX 2QV7A 2FDCA 1UWCA 3OA2A 2RARA 4UPEA 4E4TA 5HZGA 3FRIA 4TYPA 3AL0C 1RWVA 3ON5A 1ZZEA 1T9KA 2PLRA 3AL2A 2AEFA