1P9WA

Crystal structure of vibrio cholerae putative ntpase epse
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
403
structure length
384
Chain Sequence
SDDFFSLAEELAPIIKLINAMLGEAIKEGASDIHIETFEKTLSIRFRVDGVLREVLAPSRKLSSLLVSRVKVMAKLDIAEKRVPQDGRISLRIGAVDVRVSTMPSSHGERVVMRLLDKNATRLDLHSLGMTAHNHDNFRRLIKRPHGIILVTGPTGSGKSTTLYAGLQELNSSERNILTVEDPIEFDIDGIGQTQVNPRVDMTFARGLRAILRQDPDVVMVGEIRDLETAQIAVQASLTGHLVMSTLHTNTAVGAVTRLRDMGIEPFLISSSLLGVLAQRLVRTLCPDCKEPYEADKEQRKLFEPLILYRATGCPKCNHKGYRGRTGIHELLLVDDALQELIHSEAGEQAMEKHIRATTPSIRDDGLDKVRQGITSLEEVMRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General secretion pathway protein E
publication title Crystal structure of the extracellular protein secretion NTPase EpsE of Vibrio cholerae
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Protein transport
total genus 100
structure length 384
sequence length 403
ec nomenclature
pdb deposition date 2003-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1p9wA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1p9wA02
1NMYA 1YHNA 1OKKD 3QNUA 2PZGA 3RRNA 1E94E 5LD2B 2BBWA 2Z0MA 2ZI4A 4C7OA 2ZSDA 1D2NA 2KE5A 2WKQA 2GTPA 2G1KA 4ZI2A 1KDRA 1NMZA 4IXNA 5KYKA 3GMTA 5FTMA 4B74A 1JR3E 1ZU4A 4ZDIA 1BS1A 4EIWA 2OAQ1 5CK4A 4D25A 4TLAA 2HT1A 3DKVA 4HUQA 2GETA 5FPTA 2HDNB 3BBPA 1ZRHA 2GVDC 4PHHA 1NVVQ 1FNNA 3UANA 3UPUA 1ZAKA 1E2LA 5FR1A 5GJCA 3WP1B 1XTKA 4JLJA 2W83A 4TTQA 1E0KA 2ZRMA 4GSYA 1TF5A 2NPIA 1KDOA 5BQ5A 5P21A 3DZDA 3LX5A 1OIXA 2JJ8A 1HE8B 2ZREA 3OEEA 5KDDA 4NCIA 2ZYUX 3C14C 4QBGB 1L7VC 1T91A 1Z0KA 3BFXA 3BOSA 3FMIA 2GHIA 5CYPA 4HAXA 4BFXA 1UAAA 1UPTA 4GOJA 5H1YA 4WZBE 1W0JD 2AL7A 3ZD7A 3GLFE 1KO8A 2XJ9A 2ZJYA 1E9FA 2ZUDA 1ELOA 2UZ3A 2BBOA 4CYMA 1G3UA 2RGDA 5FPYA 1P61B 3RS4A 2X2FA 2O0HA 2QNRA 2NZ8A 5UKDA 2OFXA 1W5TA 1ZCAA 2NZJA 4QXAA 5FPSA 2RGEA 3T1VA 2C2HA 3THWB 5FBLB 4LSGA 3VR6A 2BHRA 4NBSA 2CXXA 2V7QD 3GD7A 1S96A 5CIWA 4IJMA 2FFHA 2ZRHA 3F3YA 4PZLA 3FMOB 4BLSA 3C15C 4QHYA 5K8UA 2XEXA 1JR3A 2XTMA 2V55B 2EYQA 2GJSA 3CPHA 3KKMA 1DAGA 2Z6VA 2JJ1A 1SVOA 1GKUB 1N6IA 2LWIA 3FMPB 3KKOA 4POAA 3DPUA 1RRCA 1GP2A 1NI3A 3BAFA 2A9KA 1OFUX 1Z3IX 2IXEA 4JLNA 1CR0A 5F2EA 4AG5A 2C78A 4HATA 2RGGA 1VECA 2RGAA 3QBVA 1IXZA 1E6CA 3ZZ0A 1NVWQ 4TMZA 1YZTA 2CJWA 2WIAA 1E3MA 3NG1A 2DHRA 1HQCA 2WOJA 4O25A 4TSFA 3RWOA 5KO2A 1CF4A 1G3IA 3GLGE 2AX4A 4Q01A 5DI9A 3ICEA 2WM9B 1P4SA 2ECKA 1KKMA 3TUZC 1E2DA 4FMCB 2N42A 4TL8A 2BCJQ 4MUAA 5CJPA 2WV9A 1E2MA 4P32A 1Q22A 1A4RA 2GNOA 4Q1BA 5G3YA 1BO6A 4M1WA 4A0GA 3GLFA 4B3XA 4B3CA 2GVZC 2A78A 4LBVA 1I4TD 1PJRA 2WMNB 1NMXA 4A0HA 1Z5ZA 3U4QA 1DAFA 5DNYB 4B43A 1R0XA 2QT1A 2DB3A 4M2LA 1W36D 3EPJA 4FI3C 2CMKA 4GZLA 4Q4JB 4YMTA 1I2DA 3IGFA 1LW7A 3LO5A 3H1TA 2W00A 5JWHA 1NY5A 1W0KD 1TQ6A 1GNQA 1II9A 4TLDA 4BPBA 5HCIA 3ND8A 4QGAA 4YDHB 3DM5A 2D7DA 5F3WB 2IXGA 1KO5A 4LWZA 2VP4A 4LY6A 4IVRA 4A2QA 5L3QB 1OLOA 3IEVA 4Z8XA 3OE7D 4WAUA 4C4PA 4Q9IA 2NO9A 4QG7A 3R7WB 3O8DA 2AK2A 2HCBA 3V4FA 2FPMA 1RYHA 2G0NA 2R6FA 4QM7A 4XWAA 1E2FA 3CH5A 2JAQA 1G9XA 2O8CB 3ZZTA 2VP0A 4ERNA 2WJVA 4KBFA 5JJKA 2VHTA 3VKGA 1KK0A 2E1RA 1XD2A 2YOHA 4HDOB 4Y0AA 1VHTA 3U7GA 1P62B 1UF9A 1XTRA 3GLGA 2XNDD 2BMFA 2NO1A 1P73A 3THYB 1RZ3A 5HCNA 1OXTA 2G6BA 2WSSD 4IDQA 1EWQA 4B73A 1RC8A 2A7QA 2ORVA 2J0UA 5JI3E 1OFIA 2GRJA 3W5JA 4DRZA 3ZJYA 2EU8A 3A4LA 2WWYA 4PC3A 1F2UA 3HYRA 2B21A 4QGHA 3RANA 4P4SB 5CLQA 1X3SA 1TPZA 1S2MA 3LAWA 1EFTA 1X1RA 3CKLA 1E9AA 2A5GA 3IKJA 2O8EB 1G7CA 1ZD1A 1NKSA 1L4UA 2DYKA 3NTUA 3NWJA 4C9BA 5KDOA 1NVXQ 1JQJC 3OEHA 4LBYA 3WXMA 2QBYB 1DAKA 2OBLA 3AVQA 3EARA 2GJKA 1GSIA 2QRNA 1D2EA 5D3QA 2IS2A 2ERYA 3U3MA 2BM0A 3NBFA 4GP7A 3TUIC 2XZPA 5J4HA 1NNEA 1TU3A 2PCJA 4QBIA 2JA1A 5BYKA 2PX0A 5IK2D 2EW1A 2ZROA 4ARZB 5GJWC 5EP4A 2ZE5A 4OI2A 3C8UA 1MABA 3V00A 3LY5A 1W48A 3MSXA 1Z29A 5KOYA 4WXPA 3W5IA 4BFSA 1WXQA 4GRAA 1BMFD 1U98A 4PO1A 5CLLA 1Q0UA 2RH5A 1W4BA 1N0UA 2G88A 3EA5A 3NC1C 2QEQA 5DI3B 3GLIB 5JEDA 3CNOA 4W5HA 5AJWA 4E22A 4DSOA 2JIZA 3BH6A 4RZXA 4YMUA 3DO6A 3VKHA 4XH9B 4ZO4A 2F55A 1DAMA 4FMDF 4O0MA 1AN0A 1YQTA 4OHZA 1AKEA 4LCBA 4A92A 4LJ8A 5LB4A 4XVUA 1YRBA 4Y0VA 4BFZA 4DHEA 1CRQA 3I61A 4BFTA 1VG8A 1JPNA 3WYFA 1ZINA 5KSPA 1W1WA 5BYJA 4E07A 4YXWD 4Q9JA 1YRAA 4Q7KA 2IYYA 2CK3D 1HE1C 1G41A 4AK9A 5HR5A 3BRWD 1XCGB 3GJ4A 4F4JA 3AKEA 4P31A 4LYAA 1FW6A 3KL4A 1HT2E 1D8TA 1OFHA 3B60A 4XSHA 1E2GA 121PA 2ZYWX 4N1AA 2QROA 2QUZA 2Z5FA 3QG5A 1XEFA 2MSCB 3JVVA 4LBWA 1NJFA 1NJGA 2LKCA 2EYUA 4HSEA 2D2FA 2B92A 1GAJA 1WMSA 2R44A 1E79D 5EXSA 2OESA 2WWIA 3P20A 4JBXA 1GITA 1CS4C 1Q3HA 1WF3A 2MMGA 2P5SA 4TLEA 2W6JD 3UKDA 3U44B 2QSYA 1OH5A 4AKHA 4Q19A 1T5IA 3EWAA 1G6HA 1U90A 4TMKA 5JJIA 3TBKA 3P1JA 1T5LA 3DM9B 4PZZA 5CYOA 3I92A 4R7ZA 2GJAA 1F6BA 1Z8FA 2BJWA 1U2RA 1R10A 1G8HA 1QHIA 4DVGA 1KO1A 3EPLA 4ON9A 3KJIA 3CW2A 4PFSA 2MSEB 4KSBA 4AKEA 4ZDWA 3G82C 1RRGA 4B47A 3VNUA 2PEZA 4LYHA 3UIEA 3PUWA 5FI0B 1GM5A 1KK3A 1UBEA 3K70C 2XAUA 2WAXA 3UATA 2A3RA 4H1UA 1YVDA 4MGZR 3TW8B 3ZLJA 4F92B 3U61B 1FNMA 4CDGA 2FG5A 2IUUA 2W6ID 3NIBA 3NC0C 3TRFA 1E0SA 5KDLA 1MV5A 1DELA 2HXSA 2J0SA 2HJGA 3IPYA 4EDHA 4HDQB 1TAGA 3L0IB 5BXQC 4L15A 2OCPA 4Q4HA 4HUQB 1KO4A 5FBRB 3FE2A 1M74A 1NBME 4I81A 3OIYA 3H2YA 4G01B 4M1KA 1UDWA 1OF1A 3FVQA 1E1RD 3AVPA 4TL9A 2XGJA 2ZUCA 2QMHA 1E0JA 5G40A 2F1HA 2IS6A 1AQUA 1BOFA 3VU9B 4IOJA 4RFSA 2D2EA 3Q7PA 4Q7JB 1M1YE 1VG1A 1YR9A 3KZ1E 2NGRA 3BFKA 2XZLA 2CL6X 2P6UA 3CRRA 4I1VA 3RC3A 4LHWA 3HU3A 3MCAA 2D3WA 4G0NA 5A4JA 3QVVA 1SXJE 2Q21A 4Q7MB 4KI0A 5FBVB 3MRSA 5KTYA 4JLDA 4OQLA 1R8QA 1KI1A 2VPPA 3MWYW 2FJUA 1AJEA 1OV4A 2ZRFA 3BS4A 2IC5A 2WBLC 1EFCA 1LV7A 3GQBA 4LHVA 4KITB 2CE2X 2F43B 3CZQA 3RDPA 3GFTA 4GPTA 1AS0A 4ABYA 3ZD6A 2ZS9A 2FF7A 3GLHE 4V0KA 1T3LA 1LB1B 2J46A 3F5FA 3AF1A 4RZUA 2V6JA 1NG1A 3KTAB 2Q6TA 4BRUA 5GJVC 4X8MA 1CULC 4BLRA 5EXPA 3TE6A 5L3SA 2O8FA 1SQ5A 3VHLB 2BCGY 2NO0A 4LJ5A 4NYMQ 3GJXC 1IM2A 4D4KA 3M4YA 3RS5A 5KNDA 4ILEA 4RD3A 2XZOA 4U02A 1RKBA 3J81k 2OHFA 3Q8XB 4W7SA 4F93B 3HU1A 5HZHA 1XCMA 2F9LA 2R6CA 2PLRA 4HLDA 4LV8B 1KO7A 3VX3A 4NP6A 4Q9LA 2CL0X 3QUSA 2C9CA 1EFRA 1NL3A 1US8B 5DHAA 1W47A 5A5GA 3KXLA 3I72A 3C41J 4O3MA 1SXJA 1UKYA 1WP9A 3QENA 5FTJA 3AVYA 4M9ZA 1XEWX 4FWTA 5FL7A 1E4VA 1SHKA 1SXJC 2YWHA 3THXA 3A1TA 3L0SA 3VNVA 4R98A 4LHYA 1GKIA 2F1IA 2J41A 2QT0A 2O8BB 2XTNA 2EWWA 2HUPA 4XWOA 3DKPA 5H68A 3TMKA 3P27A 4NYIR 3I3SR 3U4QB 1G6OA 2PT7A 1HH4A 1XCPA 3AQ4A 3D31A 5GJBA 4GI7A 5F98A 4ACAA 3NXSA 3WNCA 4V0OA 2Z4RA 1WDTA 2YJTD 1W4RA 3EG5A 2F3TA 3U2QA 3GLHA 1CIPA 1X1SA 3O8RA 1K5DA 1G1MA 1MH1A 4NE2A 1XPUA 5DYIA 3MGCA 4URVR 1XD8A 2RGBA 4TYPA 2W58A 3QF4A 3ZS9A 1XBTA 2Q0HA 3IBYA 3AP1A 3K0AB 3M1IA 2FGJA 4FWIB 1MKYA 1ZIPA 4IVQA 2X77A 5JZVA 4BQSA 1XTQA 3B8HA 2JJ2A 5KU1A 4PQFA 4A82A 3REFA 2ZTSA 3WYGA 3CNNA 4O2RA 5E7MA 3SJBA 4F7WA 3IQXA 4CRWB 4HAUA 5GADl 4LRWA 1E9SA 1I4DD 3CUEF 4L9WA 4PC6A 4RD1A 1T0HB 2QZ4A 1KIMA 1OHHA 5TDHA 1II0A 4Q03A 5HZKA 1A82A 2OXRA 5JBQA 2KB0A 4U7DA 4B71A 2DFKB 5JFGA 4TWZA 3KFVA 3G5UA 3LWNA 3W3AA 2J45A 4KVAA 4PAMA 4JJZA 5CB8A 1TL7C 4EUNA 2AD5A 3TLXA 2J0UB 4Q7LA 3TW4A 1QG2A 2REOA 3L0OA 3N5CA 1P7CA 2CBZA 4OBEA 5JJLA 1ZD9A 4NCKA 5KNBA 2A2ZA 3FTQA 4QNMA 1KZ7B 1EG7A 3PIRA 4DDTA 1E0AA 3RS0A 4CZ2A 1DG3A 1CLUA 1ESMA 3L43A 5TVKA 2IK8A 4AKGA 5KSZA 2PL3A 4A9AA 4F38A 1AGRA 4M4SA 2XSZD 2HF9A 3HP1A 1CJKC 1ETUA 4G5OA 1SVIA 4HZUB 4DWJA 2HT6A 2I4IA 3CRQA 2ZAOA 3R9IA 1JR6A 1LF5A 2ZR7A 1ZNYA 1CR1A 4D26A 4F4CA 1NLZA 3AVXA 3NBZC 2FE4A 2BEKA 3VR3A 1RYFA 4S2EA 4EJSA 4LJAA 2H18A 5EE1A 3TQCA 3HWSA 1DAEA 4QRHA 3R9WA 4JVLA 3GJ7A 4A6PA 5J4KA 4IKEA 4WA7A 4CEJA 3EZ2A 4DEYA 1XJQA 4PQYA 1TMKA 4PO9A 2XNSA 4EQ6A 2E9SA 2QP9X 3PFIA 3O8BA 2DR3A 1WCV1 2ZSEA 5JSZA 1U81A 1ZBDA 5FUXA 4N3NA 1J99A 1TADA 4C0HA 5FOSA 1IQPA 1Z22A 4GNKA 2ONKA 3RRZA 3U3JA 4ZIRA 4DLWA 3I8SA 1RVDA 4IW3B 2J7KA 1W4AA 2F3RA 2GXSA 2NPFA 3IO5A 4PHTA 1XXHE 4Q02A 2FGKA 1KI6A 1KOFA 2GF0A 3BIFA 4A8JB 3N2EA 4MRPA 4AIIA 2N1BA 3LBNA 1CTQA 2I3BA 2W2XA 1P2VA 1S3GA 3LV8A 4FMBB 4M1YA 1LVGA 2FZLA 2JLSA 4IEIA 4KU4A 4OJQA 3NHAA 2PT5A 1CEEA 3PXGA 2JASA 1K8RA 3T61A 2QI9C 3C16C 4BFYA 5J4VA 4LGMA 1AZSC 3L0PA 2H16A 2VYFA 3TAUA 1ZUIA 3LLMA 4N0DA 5BWMA 2OM2A 4TTRA 1KKLA 1WBBA 1L2TA 2PX3A 4M9QA 1ZM2A 2J0VA 2J59A 4DUGA 3QKSA 2R62A 5LBIA 1ZM7A 3W6OA 4NU0A 4QHTA 4WW0A 5KSYA 2AKYA 2NQ2C 1EGAA 3PEUA 2B6HA 1U0JA 3WBJA 2OCAA 1U9IA 1KI4A 2IS1A 5AUPB 4M1MA 4EPYA 4CEIB 1K6MA 1U9IC 1HUQA 2QP4A 1N5IA 3ETLA 4HB3A 2F1RA 2QAGA 1KI8A 3IEUA 3AEZA 1JEDA 4DDWA 4LUCA 2JDID 2QAGC 2D06A 2QU8A 1C9KA 2IYRA 4IOLA 4QJ5A 3CBQA 1R0YA 4TQAA 4TMTA 4A15A 2C95A 1LFDB 4DB4A 3FWYA 5AR1A 1NN5A 4LYFA 4KCGA 2V7QA 1VCOA 4X8HA 2WWWA 2BWJA 3L82B 3G0HA 4GL2A 1NSTA 4GOKA 4CIDA 4Z54A 2J87A 1FP7A 1QHNA 4M9SA 1PLLA 1RW4A 2VEDA 1XXHA 3W8RA 1KY3A 2OZEA 4NDZA 5DLQC 5AWFC 1J7KA 4R2HA 1GRRA 1L8QA 5DO9A 1XPRA 1Q57A 1GG2A 2IW3A 4FD2A 4RY2A 1XDBA 3GEEA 3A1VA 2IT1A 1A1VA 5EZ5A 4DT1B 4NYJQ 3GEHA 5FUVA 1FQKA 1E9EA 2VLIA 1QVRA 3K1JA 3AM1A 3CO5A 5J47A 2PMDA 4XVRA 1DPFA 5B2ZA 3JVUA 3LRPA 2C03A 2WPDA 3QKRB 3NH6A 3OESA 2GCOB 1DVRA 2GBLA 1R5OA 2C5LA 2XB4A 4C3ZA 1EK0A 3K0EA 2ZSAA 2GBLC 2QN6A 4LBZA 1AKYA 2ZRAA 4CGZA 3FKSD 1KHTA 4YONB 2ZS8A 3KXIA 3SFVA 4JLBA 1AM4D 3SJCA 2OSBA 2JATA 3SR0A 1OYYA 1LY1A 2ZPTX 4QKQA 3Q5EA 3B7GA 2V54A 4YQFA 4CF7A 5BN3A 3E2IA 2IF0A 3WMFA 3L2OB 5CDFE 1XEXB 1YZKA 4A36A 1R6BX 5FI1B 2O8DB 4BASA 3EASA 3LXXA 4W5WA 4DJTA 1W36C 3X1ZA 5AJZA 2WJGA 1MO6A 1CJMA 3U7FB 3HJNA 4KSCA 5FOTA 1BYUA 1Z06A 4CW7A 3BGWA 5HKKA 1TUIA 2Z83A 4JT2A 4FCWA 1ZU5A 5IDVA 2XXAB 4Q4AA 5FPKA 1JEEA 1E69A 1KSGA 3AVTA 3TSZA 1N6RA 2VA8A 1HTWA 4HB2A 4JYBA 1OT3A 1X8LA 3TK1A 2DY1A 2GA8A 3LVQE 5L8VA 1G5RA 1XRJA 3QE0A 5IHPA 4IOMA 4BECA 1T3SA 1VIYA 2IYSA 4XD7A 3RWMB 1JXOA 1G7TA 1IBRA 4B75A 1OSNA 1S3SA 2WSMA 4IDOA 4NCJA 5CITA 1VCMA 1W2GA 2P2LA 2BKEA 3RRMA 3K0SA 2GK7A 4TTPA 4NL4H 1F2TA 2D74A 5CK5A 3CB4A 4XIGS 2QM8A 1E1QA 1N2CE 2HLDA 4Q48A 4BEBA 2GCNA 2QGNA 2WSSA 2VP5A 2F6RA 2G77B 3ZVRA 3OEED 2R8RA 1R5NA 5CM8B 2QA5A 1T8UA 1GUAA 4IFBA 1ONBA 2IWRA 1F48A 3EPHA 3IQWA 2JLVA 1RFLA 4Q1AA 4NMMA 5CDFA 3BE4A 3BJIC 4HEJA 3RSLA 2ZRNA 3EIEA 6Q21A 3SBDA 2HCJB 3WBKA 3S1AB 3NVAA 4ZDJA 3I73A 1E2HA 3WNBA 4CT4B 1GL9B 2ZRDA 2QPOA 4D82A 4TMWA 4KFRA 4PHFA 1N5LA 4B3FX 5SZHB 1EFUA 5F9HA 4ZCMA 3RS3A 2FMXA 4AYXA 4B48A 4MA4A 1JJVA 2ZJ5A 5GVRA 4KBGA 1D6JA 2JJ1D 4ZDKA 3B2EA 3QF4B 2AKAB 4Q47A 5IRCD 2J9RA 1G291 1NP6A 4R9UC 1KGDA 4G5SA 3KXKA 1A5TA 3GJ5A 1G8FA 4JJKA 3K9GA 4JBWA 2DFNA 1IY2A 2CHVA 5TB5A 4DBLC 1UJ2A 2X2EA 2CDNA 2QE7D 4MRVA 1TU4A 2DFTA 4DIDA 3MWJA 3OFNA 4JKIA 4PAOA 3RRYA 4K8OA 2RAPA 4RCZA 3LVRE 4QNRA 2X19A 1ZUNB 4PPNA 3PG5A 4TSFD 1OXUA 4UNNA 2XTZA 2ZM5A 2ZRPA 1IXSB 4IDPA 4WIAA 2RGNA 2FSIA 3B78A 5IF9A 3QPVA 4Z1MA 1ZM9A 4AYWA 4FXPA 4H9GA 2RGNC 3KKPA 2WKRA 5J4LA 1FX0B 1GZSA 2VTKA 4EFLA 1IHUA 2IYTA 2RGXA 4P0TA 4C0AC 3A37A 3KFXA 4LJ4A 4DCSA 1OE0A 3IHWA 1XD9A 2W0SA 2ZSBA 5HE9A 3AKYA 1UEJA 3O47A 1P2SA 2P6NA 2V8OA 1W2HA 3H0KA 3L8YA 2CK3A 3K53A 4L5BA 4D4MA 3I5XA 3QVUA 1J90A 4CEHA 2IEYA 4URXR 1LNZA 2OAP1 4DLYA 3NEJA 3TSOA 2VH5R 5E4FA 5KPJA 5DN6A 2A5FA 3FGNA 1UKVY 4K81B 1M2OB 4TN1A 5CJ2A 2PJZA 4V03A 1S1MA 1JQLB 1MO3A 3PEYA 1BH2A 3SS8A 2BBSA 5JI2E 1KAOA 1Z6GA 3W9YA 1PLKA 2Q9CA 2AHOA 2C8VA 2Q3MA 2ZR0A 4UNPA 4HUTA 1II8B 1RJ9A 2VRWA 2R6AA 2O0KA 4TYQA 3IHLA 2W6JA 3C7KA 4QFMA 3PUVA 3TJZA 4G5QA 1NVVR 4PPQA 3E1SA 4C0QC 2GXUA 1QHHA 4OHVA 1PLJA 4IRUB 2DWPA 4M1TA 5E3HA 4DKXA 3QXCA 4M1OA 1M7HA 2AR7A 3D7MA 2CHQA 5JRJA 4US2R 1YR7A 2WTUA 1Y63A 2F1JA 4B3GA 4PSKA 3NDBB 3GJ6A 4NYIQ 2WWHA 4B44A 4OK5A 1RPZA 1OH6A 3FDIA 4Q9HA 4BZQA 5JWRA 3HR7A 1VYTA 1M6NA 1OXXK 5EXTA 1H65A 1YR8A 1BIFA 3TH5A 1IN4A 3RS2A 4MGKR 4UNSA 4E5UA 2X8AA 3B5JA 3SDZA 1P3JA 4D4JA 1VIAA 4Q1FA 4UKDA 1Q1QA 3UMRA 1CRPA 1VCIA 4DCVA 4ZCIA 2XITA 4BZPA 3N2IA 1TEVA 4ASUA 3X1WA 3KJEA 3T1OA 4E03A 1U94A 2IYXA 3UG7A 3EC2A 3FHOA 2WIBA 3QKUA 2QGZA 4PPGA 2J0QA 1KTVA 3AGQA 3OEHD 1QHSA 3K0FA 3WRYC 1DTSA 1QF9A 1YZUA 1FMLA 1YJ5A 2ZRIA 4KV9A 2FA9A 1HQYE 3T1QA 1VG9B 2H5EA 1D5CA 5JHGB 1L4YA 1ZVQA 1W46A 3H4MA 1EXMA 2HEIA 4OI0A 1XMIA 3KDSE 4MQBA 3A1UA 3QQ5A 3AH8A 4FN5A 4EPTA 1E9DA 1XB2A 4PR0A 4M53A 2CEAA 4BEJA 4AD8A 5EJEA 1ODFA 2EVWX 1KZGB 2OFWA 3DVLA 4LPKA 4NZYA 5C2JB 3SHWA 1YZNA 1R0ZA 1TNDA 2ATXA 2QAGB 4UXHA 3VKWA 3WY9A 1SVLA 2YZ2A 1SVWA 4C7OB 3WP0A 3T15A 1G3MA 2ZRKA 2IYUA 5FL3A 2FPKA 4B2LA 2B7BA 1SHZA 2IBMA 4URWR 4D2IA 3A6PC 4D80A 2J7PD 2FSHA 1IN5A 3BC1A 4XTCS 2ZVPX 2C96A 4OQXA 4XOIA 5SZKB 1G3QA 2JLZA 3QJYA 1CU1A 3D6TB 3NH9A 4YMWA 1ZW6A 2IA5A 1IY0A 3MMPA 2P0EA 4TZ0A 4HAVA 2CNWA 4IEEA 4PZYA 1YU9A 3C4JA 4MGYR 4UXIA 2R2AA 2Z43A 3QXXA 2FWRA 3MWKA 4FMCF 1FFHA 5KNCA 2RMKA 2EFHB 2AXNA 1E9RA 3KQUA 2EFDB 1Z2AA 5EP2A 1TQ2A 1SVKA 3TNFA 1MOZA 2FEMA 3K8YA 4MKGA 4KODA 1G17A 4FW9A 1KSFX 5H70A 1ZD8A 2YKGA 4R71A 2QTHA 1H8HA 3ASYA 2VO1A 4PAQA 5H8WA 3KJGA 2VHUA 3IPXA 1E99A 1OXVA 4MDEA 2WZQA 1Q44A 4GMXA 2REBA 1LF0A 5FOUA 4ZCLA 3SQXA 2QG6A 1Z0FA 1G18A 2NG1A 5J4YA 4LX0A 2O52A 4MYHA 1GNRA 2QP3A 2JLUA 3VTKA 2IYZA 2H92A 2G1JA 4JLVA 1U8YA 1Z6AA 2VF8A 3ONWA 4RVCA 4MKHA 4BLTA 4L9SA 1M7BA 2ZI9A 2ZEJA 5K8IA 1CP2A 3RAPR 3KQNA 4Q1DA 2QPTA 3THWA 2GDJA 2QY9A 5HE8A 1VCNA 3IO3A 3PEVA 5AJXA 4IHQA 5FPHA 3UMSA 3ADDA 1FTSA 2D4HA 4MH0R 3I4LA 1PUJA 1Z07A 2VSOA 2OO7A 1AZTA 1XTIA 3B85A 4MUBA 4AWXA 1COWA 3EC1A 1EX6A 5FUYA 3GPLA 1X8KA 3X1YA 2H8KA 3W8NA 1CJUC 4TZ6A 1NBMA 5C46F 1S9HA 1R4AA 5LPNA 2OLJA 1KI9A 2J5XA 4WXRA 2WKPA 4JYCA 3E5HA 3KKNA 4M8NE 1A7JA 3CR8A 3CRVA 3WMGA 3H86A 2GCPA 2CJWB 5DISB 3REGA 3VR4A 3MUFA 1KAGA 2RKOA 2NIPA 5HPYB 3BERA 4OJKA 1J2JA 1W49A 2Q3HA 4AYTA 2QAJA 3TR0A 2IYLD 3U7HB 4ESVA 2D7CA 2GEVA 3TSWA 2OILA 3UWKA 1FTNA 3T06B 3GLFB 4I1OA 3TQFA 4EAQA 2QMOA 3Q72A 1KNQA 1KNXA 5JMTA 1EWRA 2ZE7A 3WMEA 2QQ0A 3TR5A 1RRPA 1U0LA 5EUMA 1DEKA 3HYTA 1VTKA 1ZYUA 2EQBA 2HYDA 4LI0A 2QPAA 4ITRC 4HZIA 1G3RA 2XOKA 1U8AA 2IYQA 1Z83A 4Q4JA 5EP1A 1KMHA 2GILA 5JHHB 3F8TA 1OIVA 2WWXA 1DE0A 3KUDA 4EFNA 4KYUA 1H8ED 3DHWC 2P67A 3CWZA 4P4UA 2I1VB 2XSZA 1IN6A 4LC0A 1WQ1R 3U3OA 1NVUQ 1A2BA 3SYNA 5L3QA 4RD2A 1XMSA 421PA 4LJ9A 3CLVA 5CIQA 4H1VA 3UWOA 5TY0A 1AS3A 3R7WA 4HDCA 4RJLA 2JGNA 1W44A 2CLCX 4AI6A 2CCKA 3LXRA 4US0R 1ANKA 2MMCA 4E09A 1D2MA 3K9LA 2ZIAA 4KFSA 2O8CA 2ERXA 5IT5A 1XD2B 3EZ6A 1DAHA 3OAAA 4D0NA 3U6KA 3AV0B 3QKTA 4ZKDA 2ODBA 5FBWB 3TVDA 3B6EA 3GLIE 4JIMA 1ZNWA 4WVFA 3PENA 3GLGB 2JCSA 3AKDA 4MGIR 5G41A 1P5ZB 2F7SA 3TAHA 1OB5A 4LV5B 3EZFA 4OQNA 4Q66C 2HYIC 2KI5A 2J1LA 4KHZA 2OLKA 3EPKA 3VR2A 4TT3A 1J8YF 4DCUA 3THYA 3PITA 1FP6A 2IF2A 2ZRJA 4Q18A 1E4YA 3VQTA 4RFVA 2ZAMA 1HT1E 4BRWA 3CZPA 1E96A 2VHJA 1U99A 3PR1A 1KSHA 3NKVA 1F2UB 2KSQA 3ADBA 2BMEA 3AP2A 1JPJA 1VPLA 1U0HC 1NN0A 3OIWA 1VMAA 2GJ9A 2VF7A 3SE0A 5TMPA 3AUYA 4P4SA 2BM1A 3IBGA 3IUYA 4HAYA 1NLYA 3ZQJA 3N70A 3KQKA 2O8EA 2SHKA 1P6XA 2H1LA 5EP3A 1D9ZA 1R5BA 2QBYA 2WICA 4U00A 1SULA 2GJ8A 2QTVB 3AVOA 4G5GA 4KXFB 4Q1EA 4PTLA 4LC1A 2VBCA 2MSDB 2CE7A 4EJSC 1FMJA 1ZC3A 2KJQA 2GXQA 4QJ4A 1Q1ZA 5LDDC 2P65A 3B1XA 1MABB 2G83A 2ZXUA 3MG9A 2ZYVX 1N5KA 3EIHA 3T34A 4JVMA 4TYYA 3DOEA 3HU2A 1JJ7A 3QI2A 4JL8A 2H17A 3AVUA 2UKDA 1VG0B 3QF7A 5FTKA 1IOZA 1YZQA 1KJYA 4EPRA 3QXSA 2XX3A 1U8ZA 1Z6YA 3RLFA 4QJ3A 3ZIAA 4TYWA 1G7RA 3VX4A 5DI3A 3SOPA 1HA3A 3VFDA 2GK6A 4RD4A 1QHHB 3CF6R 2YINC 3VR1A 1OIWA 1OKKA 3GLIA 2GWHA 1GOTA 2H7VA 2DPXA 3Q85A 3AUXA 4LJ6A 1ZMXA 4AG6A 2JLRA 1G64A 3SNHA 2EFCB 4LOAA 1OH8A 1NN1A 4MYCA 4FINA 1MRSA 3BK7A 4DB2A 4Q5IA 1E32A 1GRQA 1TF2A 2PZFA 2B7CA 2YOFA 4P33A 1Z63A 1R8SA 1XMVA 1N6PA 3OZXA 2YWFA 3ZH9B 4TQUS 2B8WA 3CPEA 1JECA 3GCGA 1SKYE 5AJVB 2IS4A 4PSVA 3X1XA 1FUKA 2AFHE 2ANBA 2FSGA 1CJVC 3FMFA 1NG9A 4MKFA 2BJVA 3DEFA 1SZPA 2ASEA 4GP6A 3Q9LA 3HDTA 3UK6A 3AVVA 3K0FB 4KFTA 1WRBA 1O3YA 1G8PA 2YV5A 4PX9A 3FB4A 3A1SA 1G21E 3GJ8A 1CJTC 5B57C 1W0JA 4QC2A 2IUTA 4PPFA 3U44A 4NYMR 3EZ9A 3LQRA 1DS6A 4RD6A 3O8CA 2WJHA 1T4GA 2WOOA 2QMEA 5G3ZA 1ZNZA 1JBKA 3NBYC 2FV8A 2KBFA 5JCZA 1V5WA 4PC2A 3V9PA 2VP2A 3QSYA 5L3RA 1F60A 1X6VA 2LKDA 4DLRA 4DDVA 5AK0A 4LHZA 3RS7A 3K70B 3SQWA 2ZVQX 5L3VA 2ZU0C 1QDEA 4RKEA 3WHKA 2ANCA 1KMQA 4TLCA 2OBNA 1N6HA 4I4LA 2WVJA 1Q12A 1GILA 4UJ3A 1EFHA 1EX7A 3IDQA 1IN8A 1DO2A 5DHFA 4TL6A 2WJJA 3VHXA 1AK2A 3MJHA 4JVNA 2W0MA 4ZPXA 3KUCA 4I1SA 3ZVNA 1GDDA 3A4NA 4RZ2A 3SHFA 4O2LA 4FMDB 4Q4HB 2BMJA 1OW3B 3P26A 4DIEA 8OHMA 1JB1A 1UFQA 1P9NA 4IDHA 1CXZA 3K0CA 4R2IA 3WNDA 4D0GA 4ZV4A 1OFTA 5A0FA 2AK3A 3K0CC 1IJFA 2YHSA 5C18A 1G4UR 3T5DA 2RB4A 4TQ9A 4Q00A 4FCTA 3JZMA 4A0RA 1TQ4A 3BB3A 621PA 2ZI5A 1GNPA 2V6IA 2ONJA 4BLOA 4C0LA 4RFSB 2EFEB 4W9MC 2ODEA 1N0VC 3VU9A 4DUGD 5J5CA 2GF9A 1G8GA 4LPSA 1KYIA 4XSGA 1MR3F 4MRRA 4IOKA 3KQHA 1I2MA 3Q5DA 3B82A 1NRJB 4B2IA 1Z0IA 4EPVA 3ZVLA 3EIQA 2TMKA 3CPJB 3UMFA 2VL7A 1TEXA 3LBIA 3SBEA 3KX2A 1KK2A 4PO8A 3R8CA 1W0KA 1IN7A 2YC2C 1AGPA 2GZHA 4KFUA 5JWOA 2GESA 4YDSA 1N3BA 2F43A 1XZPA 4I1UA 1E2QA 1DO0A 2OXCA 3W6NA 1Z6TA 5GVSA 3LX8A 3H84A 4OHYA 1T3HA 5EE3A 2O8FB 2PLFA 3PQCA 4KO8A 3VMFA 3SZRA 4JL6A 3OE7A 1XZQA 5JS8A 1N6KA 3FPAA 3QPUA 2R9VA 3PUZA 3ICQB 1RRFA 1OYWA 2E87A 1N5JA 2OG2A 3RABA 2CCGA 4A2PA 4NKRA 3LNCA 3M6AA 3KTAA 1C1YA 3HPRA 4OK6A 1QVAA 4A6XA 5L3SB 5B64A 2GXAA 2H57A 3PUXA 2BBTA 1IAQA 4DLSA 2L0XA 3DDCA 5SZIA 4BFWA 2IL1A 1Q3TA 2RHDA 3U60B 3FFAA 1JALA 3FHTA 2VIIA 3LQQA 3IILA 4XTRA 3PCRB 2HV8A 3I62A 2YNMA 5M04A 1ZM4A 3ZDQA 4OHXA 2QE7A 2XNDA 4HB4A 5TV2A 3GJ0A 3WRXC 2WPDD 4B6FA 1SGWA 2NTYC 3EWSA 4L4UA 1MO4A 1GVNB 5DSZA 4YC7A 4IFEA 1G8YA 1E2EA 1IJEA 1R2QA 1US8A 1SXJB 1VYUA 1C4OA 2REXB 1E9CA 4F91B 3CNLA 3SFZA 3THXB 4M22A 4KAXA 3TGPA 2FN4A 4MRSA 1XPOA 3B13B 4UNRA 1W4CA 2NOAA 2IYVA 1CKEA 3LD9A 5FOXA 2YC4C 5EE0A 1G5TA 1J8MF 1XF9A 1SKQA 1JNYA 2YOGA 4TMVA 5B58C 5JECA 2ZJOA 5LB2A 2O8BA 4TL7A 3KQLA 1GL6A 5JRZA 1XU4A 1Y3AA 2V4ZA 4WZ6A 4MKIA 3GP8A 4D6PA 2ORWA 5KHOC 3GLHB 4OI4A 3EA0A 3LLUA 2C98A 5BN5A 4WBSA 1JR3D 1KMHB 2YYZA 3BFVA 1G7SA 3CIOA 1QRAA 5IK2A 4DSUA 1UBCA 5HKKD 4RZ3A 3SN6A 1ZP6A 3I32A 5TARA 2BEJA 3QIAA 4DSTA 1UBFA 3CX7A 3WHLA 3EZ7A 3LH5A 2NO6A 4Q21A 2IEZA 1D9XA 1BMFA 2C99A 3K0AA 3X1DA 2GAOA 2ZYTX 4A4DA 4EKDA 1KDTA 1Z0AA 1HURA 1N0WA 2ZJBA 1XMJA 3PJRA 1PVOA 1G5PA 2QORA 1LTQA 1AQYA 4LK2A 3KKQA 1KI3A 4XD7D 3VAAA 1NIPA 4MITA 2IX3A 2A5DA 3IIKA 5K8TA 2AN9A 1CBUA 3U3RA 1R7RA 4TLBA 3SYKA 3ECCA 1P72A 4PQRA 1UBGA 1VHLA 1Z28A 4NONA 4B6EA 4YMVA 1E1QD 2HLDD 3FOZA 3CRW1 4JLAA 2GAAA 1T6NA 5ANRB 3SU8A 2ZE8A 1T9HA 4YXWA 3PV0A 2DBYA 3MD0A 2QMUA 821PA 4UNQA 4US1R 1G16A 3LBHA 3MLEA 3OIUA 2FU5C 4KLNA 1P9WA 4DC9A 2WMOB 3AVWA 1NN3A 3CH4B 2G0TA 4L16A 5FUWA 2K5UA 4Q9KA 5DYGA 2G3YA 2ZE6A 5EE9A 1M34E 1UEIA 3AF3A 3WYAA 4HZUA 4NH0A 4AC9A 4S35A 1P60A 1QZXA 1TF7A 1E79A 1S0UA 5D3MA 4EJSB 4G3XA 1PUIA 1Q1BA 3RC8A 1DBSA 2FFAA 4LV6A 1AS2A 4W5JA 3IIJA 5CM9C 4GBMA 3PEWA 1NKTA 4KLZA 1E2JA 3GJ3A 1MT0A 4NYJR 4CEJB 5AUQA 2GEDA 5EZ6B 5TXGA 4BE7B 4UXJA 4B32A 1TTTA 3R8FA 4FCVA 3GEIA 2DFLA 2UVQA 1NSFA 4JZKA 5E7JA 1LS1A 4EQ6B 2RGCA 2QM7A 4M0LA 2ZITA 5EUQB 5JSZB 2N46A 2QTFA 1BYIA 2IYWA 2XJ4A 4P4TA 4QGGA 2VHCA 4QOSA 3OFND 1FL9A 4JBYA 4ZIRB 2QRZA 1KSJA 1NIJA 5DH9A 3FKQA 1X86B 4JT4A 2J7PA 2W6IA 1KI6B 4Z1MD 3BB4A 2HJVA 4GT1A 1FZQA 2ZI6A 2A30A 5AJYA 2FNAA 4JSYA 2W2VA 1TUEA 4A8JA 1IY1A 4HLQB 2V9PA 3AF0A 1XTJA 4JLOA 3JZAA 4A8JC 2ZJ2A 2FDCA 2CL7X 2FZ4A 4X8OA 4B3BA 2P3SA 3QBTA 4DLXA 1VDZA 5EXXA 3KJHA 1E1RA 1J70A 2PZEA 4JKYA 2QL6A 4JMPA 4DDUA 1QHXA 2ZRLA 4NHOA 2FFQA 3X2SA 3ZYCA 5DN6D 2ZI3A 3QKSB 4MDFA 1G20E 3D3QA 1NF3A 3ASZA 3A58B 3K9NA 4RKFA 4Z51A 3MFYA 4XWKA 2OCYC 2FPLA 5CB6A 4JS0A 2PEYA 4AURA 3M0EA 3DMDA 3CX8A 3P32A 3K09A 4LJYA 1F5NA 3AP3A 4PSAA 4HLUA 4PC7A 3K09C 4CEIA 3NBXX 4GDFA 2FOLA 4HLUC 1YE8A 2JIZD 1UADA 2KWIA 721PA 1OJLA 3EXAA 5AUOB 3DMNA 4V02A 4Z8YA 5FTLA 4EFMA 2OBMA 2ZRGA 3BH0A 3RSOA 2R6GA 5LD2C 1SVMA 2ODNA 4RD0A 3BB1A 2Q9AA 2ZSFA 2IHYA 4DCNA 1P75A 3SYLA 4GOXA 4MYUA 1Z47A 4LYJA 1WBDA 1KJWA 3LA6A 1NLFA 2Q9BA 2ZQ5A 1QHGA 2VHQA 1XXHB 4QGFA 4C0KA 1WA5A 1EESA 2ZRCA 4G5RA 4YMSA 4B34A 4DZZA 1CR4A 3BD9A 1E9BA 1FPMA 5F9FA 4QM6A 2ZETA 3HPQA 4GMDA 5B30A 1KI7A 1TQDA 3BXZA 1Q1EA 1KJZA 4ASUD 2AWNA 4LHXA 1DG1G 2FH5B 4CT5A 1Q20A 3BORA 4DT1A 3PVSA 3HR8A 1UM8A 1ZM3A 5ELXA 1WB9A 1E2IA 3KB1A 3LW8A 4JVSB 1JAIA 4EPXA 1SKYB 1UKEA 2R6DA 3CX6A 3THOA 1PZNA 2FX3A 4QBHA 5FR2A 3C5CA 2O5VA 4PC1A 3QKRA 4WOPA 1AIPA 3DOFA 2GCOA 1M7GA 2KBEA 4I99A 3SC3A 4B2PA 3U5ZB 4OHWA 4HI0E 4MRNA 3LDAA 2JLYA 4D81A 1P2TA 5C1BA 2PBRA 3QEOA 521PA 2IUSA 4RCYA 3ND9A 3I5YA 1R0WA 2A5JA 2P5TB 1ZC4A 5C4MA 1KK1A 1XEWY 1XX6A 2ZU6A 3AKCA 5C4GB 4ZKEA 4IDNA 3CR7A 1T0JB 3E70C 3P4YA 2PH1A 2CLDX 4YLGA 5SZJA 3SJAA 1GIAA 1JXMA 1W36B 5K8LA 4P3YA 1M8PA 1XEXA 4HAWA 4ACBA 2XB2A 4D4LA 4PANA 3K70D 3F0TA 2O8DA 4UJ5A 2RCNA 3SJZA 1OB2A 1XTSA 3A4MA 1S1CA 4FIDA 4AKIA 4GFDA 1H8EA 4J0QA 3ZGXA 2GZDA 4JLMA 4LJ7A 3OIVA 4Q4AB 4HAZA 5JLJA 2YWEA 2XXAA 2WJYA 3RVBA 3ADKA 3QOFA 4KJZA 3B9PA 4OKSA 4DSNA 2GEUA 3FFBA 4OYHA 2AFIE 3QXJA 1HYQA 1S8FA 1ZNXA 1A2KC 1Q21A 3DL0A 4BUJA 4BLQA 1JAHA 2G9NA 2CNWD 1Z0JA 2C9YA 4Q1CA 1DARA 4PXAA 4D0LB 4BWYA 4NTZA 1IONA 1FUUA 4JSTA 4AY2A 5FOVA 2ZJZA 2P6RA 5FFMA 3EX7C 2WWFA 3ZVMA 1YR6A 1F2TB 2YVUA 1ZIOA 4NCNA 3D8BA 4OQMA 4F4IA 4CVNA 2C9OA 4L8GA 4KVGA 4C0BA 5EQTA 1HY3A 2ATVA 2BDTA 2WJIA 4NCHA 1QBKC 3BWDD 3AF4A 1TX4B 1H8HD 5FOWA 2PJRA 1Z6XA 1P9RA 4OL0A 2ZS7A 2WHXA 3IIMA 3MWLA 4GZMA 2A5YB 1S4QA 1XFAA 2BC9A 5BW8A 4HB0A 5JS7A 1NY6A 1F3OA 4X8LA 5J40A 4ZI3A 2UZIR 2QSZA 4MYTA 1PV4A 4BGDA 3W6PA 2DWQA 3K9HA 2ZI7A 4TMXA 4DLVA 1GKYA 3FHCB 1QG4A 3CRMA 3EAQA 3KB2A 3MAAC 3Q7QA 3QXHA 3U3KA 1N6OA 3S1AA 4HYYA 3MJRA 2AWOA 3LFUA 4B76A 5G53C 2QQEA 2ZUBA 3NHBA 3ZQ6A 1CR2A 2CVHA 4JLKA 1GTVA 3B1ZA 2JLQA 3A8TA 4BFUA 1G19A 1FQJA 3T5GA 3TUJC 4EPWA 1XJCA 1COWD 3T1TA 4V0LA 1Z08A 2Q3FA 2J3EA 4V0NA 1GFIA 1NBMD 2C77A 4M1SA 5DIFA 3R20A 1Z2CA 2OT3B 2EFGA 3B1YA 2WAYA 2CLSA 3A1WA 4U5XA 2CVFA 2R65A 3LW7A 4M9XA 3NDPA 4C2UA 1BKDR 3PUYA 5KSOA 5EE5B 4DXAA 1YZLA 1N6NA 2QENA 2VP9A 1ZJ6A 4BZXA 2X1VA 2BVNA 2Y8EA 3SEAA 1EFRD 4JL5A 1UDXA 4G1UC 2Z4SA 1DAIA 2ODWA 3CF0A 5FBQB 3CF2A 3SI7A 4ESHA 1K5GA 4QBFA 2I1QA 3T12A 1FOEB 4URYR 3RNLA 4C0SA 1SXJD 1HEIA 3AGPA 3OF5A 5JCPA 2PMKA 3Q3JB 4B35A 5FL7D 2C04A 2AXPA 1DADA 4DEXA 2HXYA 4K46A 4II7A 4A1FA 1FX0A 2BKUA 2ZJAA 1WE2A 1MRNA 1Z0DA 4HLCA 2JEOA 3QG1A 1N25A 3RYTC 1W7AA 1VKJA 4B33A 3V4RA 3FYHA 3EW9A 4CEHB 5KUTA 2LCFA 2NO7A 3L8ZA 3W90A 1RE0A 3ZZUA 1OH7A 5DGXA 2XOKD 2ZANA 4UQOA 3U6BA 2BOVA 2VSXA 1X8JA 1O87A 4IXMA 4TYNA 4BLPA 1XWIA 4ARZA 1AA9A 3I1FA 2IXFA 4NPHA 4OK3A 3I8XA 4XJXA 2VSFA 1VYVA 2BV3A 2JLWA 5HTKA 5AUNB 1B23P 1RJ9B 2OEPA 5KPDA 1XJ0A 2JJ2D 5D3MB 3ZS8A 1II8A 4V0ME 4URZR 2WWGA 1GRNA 4PHGA 3B1VA 3T35A 5E95A 2VP6A 2JDIA 3QEJA 1S9DA 3VR5A 3CONA 3TKLA 1W5SA 2V3CC 3OAAD 2FFBA 4OQFA 1OHHD 2HF8A 1OXSC 4OI1A 5FH9A 3UG6A 3QY0A 3AB3A 4A0FA 2F9MA 3AF2A 1E2NA 3B1WA 4BFVA 1ESNA 4DLZA 3P4XA 2NMVA 2CHGA 3CWQA 4TT3D 2IHBA 4RSGA 3TVTA 221PA 1XNJA 1SVSA 2GZAA 2FEOA 3GFPA 2ORIA 3BH7A 3DZ8A 1I4LD 2OFOA 3OHMA 4B3DA 4C0JA 2YWGA 2VQSA 4DLTA 1QHYA 2AD1A 2FSFA 1XP8A 4QHSA 2OE2A 3A36A 1GL7A 2ZR9A 1G4AE 1HV8A 3GFOA 3UXMA 1MO5A 2ZRBA 4DCTA 1DOAA 4IVPA 2ZJ8A 1KI2A 1JI0A 1YZGA 3QPWA 2IWHA 5E7IA 1E98A 4C2TA 3B9QA 1OPXA 5BN4A 1P2UA 4LZZA 2OUKA 4M21A 2D62A 1V43A 3RHFA 1UKZA 1GWNA 1KDPA 2DWOA 4URUR 4Q4LA 2DCUA 2RHMA 3FKSA 1YKSA 4WZAE 2PCLA 2O0JA 4JLPA 2OV2A 3R9XA 4QL3A 3W34A 1ZUHA 4A2WA 1KY2A 2B8TA 2W2TA 4LDJA 4V0MA 3ADCA 3W3ZB 2EWVA 2GKSA 4C30A 3NEYA 4N0EA 5DE3A 1RIFA 3CM0A 4KYIB 2V1UA 2JLXA 5FTNA 2V1XA 1B0UA 2BMDA 1LS6A 3TIFA 5JEEA 2CCJA 4DLUA 3C5HA 4XVQA 2BIFA 2OCBA 1N6LA 3ZIAD 1E2PA 1E2KA 3U7EB 1ZCBA 1T8TA 1IXRC
chains in the Genus database with same CATH superfamily
2PUGA 1USIA 1E94E 2Z0MA 2ZI4A 1IHDA 1UWKA 3OLWA 4X7RA 1DAPA 1KBZA 4IXNA 3CQ9A 1QKIA 4CM9D 1A9PA 1H9CA 1ZRNA 4N9QA 1P0MA 1C7EA 2C92A 2GETA 5FPTA 4PHHA 3JD1A 1WB5A 1NVVQ 4OHCA 1ZAKA 3HJAA 2RHBA 3N2KB 4AZTA 3WMRA 3DF9A 1T1SA 1H23A 3LX5A 1G5HA 2JJ8A 4AF7A 1W9MA 4W1QA 1GZ6A 1DEAA 4QBGB 5AHRA 2XWSA 4Y9RA 3J81A 2ZJYA 1E9FA 3WK6A 3OQPA 4C5CA 3TNLA 3T1VA 1HEYA 4LSGA 4DC1A 2CXXA 3ZG8B 2A0YA 4NBRA 2FFHA 2ZRHA 3UB2A 4QVIA 1SUEA 5FYDA 1GKUB 1NV8A 4M83A 1NI3A 5F2EA 1CR0A 1JMVA 3AERA 2C78A 4H8RA 4HATA 3FJ1A 2O6LA 3IBSA 5F12A 3A3DA 2VJBA 3PTZA 1B3BA 3UCFA 3MIZA 2ETVA 4NV1A 3MCZA 3C7VA 2J3DA 2AX4A 2C9BA 4IF4A 3PDIA 1VPVA 1YOBA 2P62A 3EZNA 5DN9A 4P86A 4FE4A 1E3UD 2A78A 1IJBA 1XRPA 5JQGF 1J0EA 1KYQA 2YL2A 5DNYB 5C3UA 1DCTA 1JT2A 2CMKA 2E4WA 4UZSA 1I2DA 3EJWA 1GNQA 1L3LA 1ZX1A 3E53A 4WAUA 3ZWMA 2BSAA 4F5EA 4LENA 2XUPA 4JODA 5DEOA 3LC7O 2QLFA 1DGQA 2VP0A 1U3GA 1VJTA 2E1RA 3GUUA 3VYUB 2AG6A 3GLGA 4WCDA 1THGA 1E3SA 5JI3E 3PX7A 1Y82A 1XA4A 1H2EA 2HSJA 1SZJG 5HUHA 1MAVA 1V37A 1X3SA 5C8YF 4MHTA 1EFTA 3HA3A 1UPBA 4YINA 3AY7A 2QBYB 1MCZA 5HK9A 2I9PA 4F9TA 4XFKA 3GLSA 2PXAA 1DWOA 1WXWA 4UMEA 4BNNA 3SWWA 1Q0UA 3T3OA 1N0UA 3S3TA 4YMUA 2HTEA 3RS8A 5A4KA 1U80A 3C5WP 4IJ5A 3GNSA 1XTBA 5FWXB 3RK1A 1XKLA 1ZINA 3PDWA 2ZBEA 2DQYA 3DFKA 4OCZA 1EXWA 3KL4A 3L46A 1EZ1A 2MOKA 5CT9A 2NU6A 1H5UA 1G6AA 3FGZA 4IHKA 2NXJA 2OESA 4EEKA 2QN2A 1CS4C 4DQKA 3DSRA 3DZHA 4AS3A 3EB9A 1JFLA 3G82C 3ONFA 3PSHA 4V1CI 3UIEA 4BNDA 3EGVA 2A58A 5LNK1 1YVDA 3D5EA 3HKDA 2IUUA 4EYQA 4L5AA 2HA0A 1RIIA 3QLJA 1WXXA 1WXHA 4M87A 2AH5A 1BVUA 1C0PA 1VDMA 2R96A 3FBGA 4CKCA 3C8DA 4DXHA 2IS6A 2GM4A 1WO8A 3Q7PA 4GS5A 3UYLA 4Q3OA 5IM4A 4G0NA 4HNBA 1MZVA 2FJPA 4S1OA 1NRJA 3UMEA 1DKRA 3WLMA 3BRMA 1JJIA 2UYOA 3ZHVA 1ESEA 1AS0A 2ZS9A 1FJXA 2ZCUA 2J46A 3K6SB 3H2GA 3MCWA 2Y05A 5EXPA 3R5HA 1Q0HA 2RCXA 4X69A 3Q98A 2OHFA 4Z1WA 3UVEA 3FYZA 3WGMA 1B7GO 1SZVA 1Z7BA 4QELA 1SXJA 3ZK8A 4DM3A 3QENA 1C2TA 4FWTA 5FL7A 5U1PA 4GR5A 1X7ZA 2O8BB 3RASA 1Y1PA 3WNCA 1CIPA 3DNMA 3O1HB 1IB0A 3QFRA 3A2KA 4PNEA 3FSGA 4E1BA 4BQSA 1EHYA 1K5PA 5ESXA 4NE7A 2DPYA 2ZC7A 1HX7A 2X02A 4A5RA 3CUEF 3NV9A 1XQWA 5BQ3A 3ID6C 2C4KA 3W78A 4DUYB 2Y66A 3I5UA 3R0IA 3W3AA 1YB1A 2A2ZA 3NBAA 2HV1A 1ZR4A 3UFBA 1AB5A 4AN0A 4CM4A 4B6SA 3URMA 4M76B 4HYEA 3RB8A 3TNJA 4H6WA 4I3AA 2W48A 4EDFA 2H18A 4MCWA 1L5VA 4ZEWA 1TT5A 2NZVG 1VE9A 5JNLA 1PR3A 1L7PA 4YFMA 2DR3A 3IQAA 1FC0A 4EW6A 2EGGA 5DRTA 2WIFA 3VO1A 3GA5A 2Y1LA 3FSRA 3O38A 2PX5A 2GXSA 1M6HA 3GT0A 4IBXA 4CWAA 2W2XA 3L1IA 5F3RA 2IHVA 1HKUA 2QI9C 2HGSA 2F3UA 2NAPA 4N0DA 3MMNA 4DXDA 3SXUA 3I6IA 2QU7A 1JA9A 3RYHA 1IC6A 4L3WA 5KQMA 4TQAA 4CMCA 4TM7A 4W6QA 5TJJA 5AR1A 4N6GA 1Y8AA 3WNZA 3MJ4A 1FP7A 3E9CA 1C9DB 5DLQC 4GYKA 2N3ZA 3OE1A 1RLTA 1Z35A 1VEUA 2VZLA 1JIIA 3HO6A 2WPDA 1K4KA 3GAMA 5TGDA 3AT1A 2OKGA 2BZGA 4C3ZA 2ZJ9A 2V0CA 3TD9A 1VQ1A 4OLGA 1IH8A 1MXOA 2WJ3A 5JNUA 3KXIA 3DH0A 4J76A 3MINB 1AHHA 3HLCA 5K6AC 5LQSA 5CXWA 2MSKA 2XBMA 5FI1B 3EASA 4DJTA 4HEA6 1YMXA 4KSCA 4PYJA 5B36A 1F0PA 3VVCA 4FCWA 1VJ0A 3GRFA 4OXNA 1NAHA 2ZYGA 5FPKA 3LCCA 2XQVA 3TLGB 1HE3A 5A90A 4Q24A 4IRXA 5L3ZA 3ROZA 3B8EA 3JD2A 2Z09A 4ECEA 1HSZA 2WSMA 2VDOB 5CITA 3K0SA 2DHEA 3OLQA 3EXG2 1F2TA 4C3OB 3T9AA 1V0JA 2VP5A 2G77B 4D7AA 3B5EA 2R8RA 5IJ9B 3IF6B 3A3FA 4HJ4A 2XCSB 4J90A 3NBKA 4XM2A 2ZRNA 4E6PA 3MA0A 4CQMD 1F8XA 1OVMA 3NVAA 3T52A 3VR6D 3KLBA 4UFOA 1KFCB 2SCUA 2I2XB 2XUDA 3ZBPA 3TOXA 5JBIA 4XT2B 1JLKA 2X2EA 1VCHA 1ISGA 2C3UA 3MWJA 4L51A 2RAPA 2YN0A 4PPNA 4TSFD 4BKRA 3HCFA 4IDPA 4ARVA 2WF8A 1C7JA 2CL5A 4MUNA 4PZCA 4E6EA 2VTKA 3IF5A 2PUVA 1XD9A 2F48A 2A0WA 2V8OA 4CL2A 1ZHOA 3MMHA 2A5FA 5JI2E 1KAOA 5IASA 1P0CA 2Q9CA 3GQZA 2C8VA 2ZR0A 3NWOA 4PPQA 4C0QC 3P98A 3PE6A 2VDMB 1UMDB 2VYVA 2VLGA 2NUBA 1M7HA 3UAWA 1H3EA 4NZOA 2I6XA 3UXYA 5KSWB 1P74A 3KC2A 4IRMA 3PI7A 1RXWA 1AE1A 1WETA 3AV3A 3N75A 3PC4A 1CRPA 4BYMA 3WO1A 4D4GA 4ASUA 1T9CA 4E03A 4FGKA 3IVAA 3UPTA 3ZW8A 3L93A 4UC0A 1YJ5A 1VG9B 3F4KA 4JBHA 3H87A 1CP3A 5JDCC 2V1BA 2EVWX 3O87A 3ST7A 4K6OA 1TIPA 4NZYA 3RGGA 5C2JB 3EQUA 1Q0LA 4U2CA 3LRTA 1OBHA 1ODCA 5D1HA 4J1QA 4URWR 1IN5A 2V58A 2C96A 4BE4A 3LCRA 5DF1A 1BD3A 3JVIA 3F97A 1I2WA 5TIIA 1LVUA 1RJFA 4Z3OA 1EVKA 3NCTA 2AXNA 4YQEA 4R83A 5TMDA 1PK8A 2PDAA 3HFRA 3BWBA 4TKUB 4R71A 2GERA 1T1BA 2XOXA 3MWGA 3D59A 1O08A 3OICA 2REBA 3SQXA 1Z0FA 3OKCA 4RIEA 4OQIA 1P1CA 5JSUA 2ILVA 4GI2A 4L9SA 1WLSA 1D06A 1QV6A 4HVTA 3E2PA 5GM2A 1AZTA 1Q0QA 4UD2A 1N78A 5JYEA 2V45A 1Z88A 2JKFA 3QK7A 2VI5A 2NU9B 2RKOA 3CNQS 1W49A 1O54A 1YL6A 2DVMA 2QRVB 3UXEA 1XPBA 4GLJA 4EAQA 5BSKA 3ZDCA 5JMTA 1MUUA 4NAHA 2QQ0A 3ENQA 5E0KB 2QPAA 4BJPA 1U8AA 3L0BA 3NBUA 4KZAA 1XMOB 1CERA 4OA5A 2WWXA 3AUUA 3KUDA 2VXYA 1PEAA 1XHFA 4M0EA 5E2AA 1U0NA 3NHSA 3LI9A 2I78A 1V26A 3BL8A 3IS2B 4RJLA 2Q2NA 1Y1KE 2YS7A 5IT5A 3NHKA 1DAHA 4B31A 4RTJA 4J1TA 2VEOA 2NYRA 1CDEA 2HGZA 3KOWA 4ZO6A 1FP6A 5DTMA 4EYKA 5EVLA 3ITNA 4QXQA 3ADBA 2IHJA 2PA3A 2VF7A 3NOPC 1CHDA 1M1NB 1N2XA 3BKXA 2Z2LB 2XYPA 1HF3A 5ARBA 3KQVA 3TLEA 1AKRA 2HF2A 4MHOA 4NBVA 4B3HA 3GRUA 2I9KA 4EHLA 1MABB 3MG9A 3T34A 4JU8A 1UKCA 1NMSA 1RD4A 1IOZA 3NR2A 4OFBA 1OIWA 1O89A 3NDGA 4AG6A 2AW3A 4LE2A 3SNHA 5ADHA 2IOQA 1NQTA 4MYCA 2PZFA 2HHCA 4RA6A 3SC6A 3KZMA 1U1GA 1GU7A 2YV3A 3CPEA 4IZOA 1SKYE 5AJVB 5BYBA 2HHAA 4ER5A 2GN1A 5A91A 2XQGA 4BO8A 4CQLB 5K3BA 1WRBA 3B6JA 4BDTA 3LF1A 1JBKA 1XDUA 3TG9A 5JXJA 2PXCA 1RCFA 1GN8A 2IBSA 5HDDA 2ZVQX 3SQWA 2AG8A 4N0PA 1N2GA 1GCIA 5G2OA 1KE3A 4L0MA 1DO2A 2ZIXB 2BGWA 5EM0A 3GY0A 1E7QA 5K0ZA 4E3JA 1D1TA 1PUXA 4H0FA 4RZ2A 2A33A 4WEJA 2V4UA 5F5NA 4JC5A 1PK9A 3SM9A 1MVNA 1UJ5A 4KG6A 1OWOA 1MEOA 4A3SA 1QBGA 3Q8WA 1YB7A 1OI2A 1QVWA 3BZBA 1E3UA 4H16A 4XQ9A 1E1CA 3P5SA 2OC9A 3BQNB 1EINA 4PO8A 2VHEA 2O2DA 1Z6TA 4DJAA 5EMMA 5GZ3A 3QPUA 3K6KA 2OLVA 2CCGA 2GR9A 3QYPA 3PUXA 1IAQA 4F8EA 3K1AA 4ZXPA 3VNSA 3IILA 3PCRB 4OPZA 2JKRM 3KXPA 3OCWA 4PNHA 5TV2A 4HPJB 3F5MA 3VTZA 5FBHA 2Z3WA 1ZIYA 4UUBA 3HEMA 4UHFA 1W4CA 3R6GA 1MQAA 3LD9A 3UWPA 1C30A 2AA3A 3PT5A 4EZIA 4MKIA 1YFLA 3NC4A 2NV2B 1SCKA 1TO2E 5EFOA 3TCXB 1K4MA 4S2NA 4FWBA 5IC4A 3A4VA 4M0DA 1DO8A 2IU6A 5CT8A 3ICCA 2AMYA 2AN9A 1UKAA 3SYKA 1VLJA 3H99A 1P72A 3U1BA 3BM6A 1YDHA 1G2PA 5DM70 4ZALA 2FF5A 3MJEA 4FBGA 3COSA 4FKBA 5FUWA 5ALYA 1M34E 4HZUA 1A8HA 5JLAA 1QZXA 2YH2A 3EXHA 4TKVB 4G4SO 1VPTA 5CM9C 3PEWA 3CG5A 3H13A 4NYJR 4RNDB 1Z4NA 4G63A 4MV7A 4L4ZA 1NSFA 3LVBA 4IO1A 3NNDA 2N46A 3RU3A 1FU7A 4XXRA 2NV6A 3LDFA 2M7UA 3FTNA 3HDHA 1IHPA 2GBCA 2DOKA 4U7PB 3ZDEA 5ITWA 3VFFA 4JF5A 3ABIA 4JLOA 1J6UA 2PPVA 5A4IS 1MA0A 3QBTA 5HWTA 3IVGA 5DN6D 4MB2A 2WQ6A 4Z51A 4AKTA 3F3SA 4AZ0A 1XA3A 4XB2A 4J16C 5SICE 2WGWA 2VNKA 3BTUA 5LZ4A 1MA3A 4LGWA 5ALLA 1L1RA 5DFXA 2PD4A 4TVBA 2C2WA 2JG3A 4GOXA 4I4CA 1TYAE 2Q9BA 1X1EA 3WRVA 4KQRA 3F8SA 4P7GA 1WA5A 3HJKA 4QM6A 2ZETA 2AJBA 3HPQA 4Z4CA 4GMDA 2BISA 4BO7A 4NENA 4I8DA 4BCDA 5A9SA 3HCBA 4O4JA 3EG9A 4NXBA 1PZNA 4PC1A 1RWWA 3ED5A 2JLYA 1SC9A 1ZUD1 3ONEA 3FWLA 1EGQA 4NDAA 2PUTA 2P5TB 3WQRA 4WECA 2PH1A 1B15A 5IVKA 2A92A 2FG6C 4QVGA 5MN5A 1CJFA 4E3OA 4HAWA 5CPBA 2O8DA 1L9XA 1DBPA 2C4TA 3ZGXA 4HH1A 3JRWA 3ZE0B 1M0WA 1ULTA 3RVBA 1TUGA 3FRHA 5B7PA 3ANMA 5EWMB 2JIOA 5FOVA 3H82A 4OONA 1TM4E 5CLIA 2WJIA 4WMCA 3QKWA 3ZHTA 2PKRA 5DRYA 5J40A 4TTTS 2ZI7A 4J0GA 3P01A 2R5NA 4H6JA 4B76A 3ZLUA 2QHXA 2R48A 4D4IA 1RI1A 4BFUA 4E4RA 1ZJ4A 3KSIA 4V0LA 2GEJA 4PMAA 1AG9A 4FYHA 2CLSA 4U5XA 1UFRA 4IX1A 3PQ6A 4QJIA 1D04A 3UOAB 1J39A 3GQVA 1DLIA 1FOEB 1DADA 4DEXA 4K46A 2NT4A 5DFAA 1ZWKA 3TX2A 4JN6B 4OB7A 2JEOA 1XZGA 5IVIA 1X7WA 3W5BA 2LCFA 3ZZUA 3IP1A 1NDHA 1T25A 2XOKD 4UQOA 1EFAA 1Y5IA 2VSXA 1WKVA 1Q2XA 2XUOA 2CW5A 2VSFA 2WWTA 5EYPB 5DHQA 5AUNB 2WG0A 3D0OA 4MDYA 3ZS8A 4PGGA 4CR7A 4LFCB 4GMHA 4D57A 5DLPA 1CRZA 1XZMA 4B5LA 1SG6A 1OHHD 3OX3A 3H7AA 4KIGA 4JITA 2GZRA 1KJIA 4A2CA 1KRHA 4UUAA 5FX2A 2EC5A 4P82A 3KE9A 5J1SB 4IJWA 2ZSKA 3UXHA 3JWIA 4YAKA 1JVJA 4KB5A 5LMZA 2CKDA 1MO5A 4E3KA 3QPWA 4RF4A 1P7WA 5ESWA 4TV8B 1XNGA 2RHMA 1ZGCA 3R9XA 1KY2A 4WF0A 3WAJA 2BEVA 3AY6A 3W3ZB 2EWVA 4W4TA 1ADCA 4REOA 1T5OA 1RIFA 5FTNA 4BJHB 1OXMA 2ZPAA 2BIFA 3H6HA 2REQA 1ZCBA 4RK5A 4MROA 2ZJFA 5ED0A 4GDNA 2FSVA 4X64B 5TJ9A 1NQ5A 3IXGA 1ZIXA 2VSQA 1FIKA 2IZ0A 2ZC3B 1N32B 2CXPA 3L4BA 3BWVA 3KUXA 1LRJA 4N9LA 3RFXA 4EG0A 2O2GA 3NLLA 1AKUA 1KO8A 2ZUDA 1VRWA 3DPIA 5ICFA 1G3UA 1ZITA 2OFXA 1W5TA 1ZCAA 1FB5A 3VR6A 4IJMA 1NATA 4YJ3B 1L5NA 4KQMA 3I34X 3EW7A 5CDYA 2GK3A 4BNFA 4QHCA 5K1ZA 1QV7A 3L1HA 3BAFA 1QGUB 4JLNA 4A27A 2G7UA 4ZYZA 4I5GA 1YZTA 3HRHA 1QMPA 4GOMD 4QDTA 4TSFA 3T4QA 5I7UA 4RMNA 2ZBDA 4Q1BA 4M1WA 2YHAA 4A0GA 1QU2A 4QJGA 3D72A 1IOWA 2EXAA 3JWEA 4FI3C 2XUAA 3PBOA 3T4XA 3K92A 2VP4A 2BELA 1WNTA 4OH0A 2PR6A 4HJ3A 3AR4A 1G9XA 4QEKA 4UATA 4FHZA 2VHTA 1P62B 3GRRA 2BTOA 2G6BA 2G2UA 2C82A 5D01A 1UOEA 1FNSA 4L6AA 2HA5A 3C38A 3O1IC 4IGEA 4OLAA 1FRNA 1YKDA 1QNFA 1NVFA 1AHIA 3TUIC 1F8YA 1NXTA 3EGWA 2CLIB 2EW1A 3GUVA 1XO1A 2QZJA 4G8CA 2WT9A 4WXPA 2C3PA 1ZVVA 9LDBA 3RIEA 5DI3B 3CNOA 2ZB7A 3PNYA 3ZHQA 5F1OA 4IG4A 4RM2A 3ZE2B 1T18A 2GAJA 1U6JA 5GLDA 2HMWA 1E1LA 3CWFA 3E9YA 2QJWA 1VG8A 5CCXA 4EBLA 4Y9SA 5F7ZA 4MQMA 3U19A 1VI6A 4GUDA 4LPZA 4AY4A 5EERA 1PJSA 4N92A 2DP4E 1XEFA 1FLAA 2Z08A 3ESXA 2CNBA 2IYEA 4TWAA 4W5OA 4X45A 4KGZA 1KVTA 3B1JA 2E5FA 1U90A 4DIMA 5JJIA 1ES3A 3P1JA 5CYOA 4MQ4A 3HBNA 3F3KA 2CFIA 2J9FA 3K70C 1U7WA 1S3FA 4CDGA 2Q3LA 4UTRA 2FSSA 2J0SA 4ZVOA 4ARSA 5JD3A 4PYQA 3UE0A 1M74A 3H5LA 4ENWA 5CTMA 1D2HA 4DA4A 3ZYTA 3S1SA 3NHLA 4IOJA 2NGRA 1V4BA 4I1VA 2WYIA 5CCDA 3I52A 3PX2A 1PR1A 4Q7MB 4R9NA 3V2GA 4QOFA 4CCAA 5KTNA 1AJEA 6REQA 2PMCA 3IV7A 3LSYA 4H0NA 2PS1A 4ABYA 3ZWDA 2XBLA 4F71A 5BSFA 4RZUA 2V6JA 3TE8A 1WZCA 5HGXA 1YLYA 3IX8A 2XZOA 4U02A 1N0IA 4WESB 3QNMA 4ZU1X 4X3OA 5FXMA 3QH4A 4LV8B 3QX9A 5CVCA 2K2NA 1I51A 3IEKA 3WZ2A 3G2KA 1TVMA 3A2MA 3L0SA 2C4VA 4YCDA 2VTBB 1JPUA 3IH9A 4NYIR 2OCDA 4NAVA 3AQ4A 4BNZA 5GJBA 3UMJA 3U2QA 1W35A 4TYPA 5IJWA 4YUAA 2ZPUA 1W0CA 1MKYA 3QMMA 3P9RA 3SJBA 1P17A 4XRGA 1K55C 4LRWA 4L9WA 3E1GA 2FN9A 2QZ4A 3GG2A 1A82A 3R40A 3CF4G 5H7XA 1R6VA 2I0FA 5TQVA 1W581 2GZ2A 5IUNC 3RSCA 2J45A 2Z2ZA 4JR1A 1YIAA 3U7JA 2REOA 1VB3A 3N5CA 1IHYA 2AN1A 2WRZA 2W6CX 5EIBD 2JHAA 4PTZA 1PR2A 4YX9A 4F38A 2XWBF 1W63Q 2HT6A 3EGDA 1ESZA 4S2EA 4L8VA 4KO3S 4HRVA 4W7HA 1UMCB 2P8SA 3E3OA 2C7PA 3DBIA 3O8BA 3RARA 4XYEA 2PYDA 4GEGA 2NU8B 1PRYA 1Z22A 2FZKA 3IMGA 2G9ZA 1U2TA 3ZQ4A 1R66A 1JILA 3S1LA 1VM1A 2FKAA 4Q82A 3TTSA 4E46A 4R69A 4A8JB 4N0QA 1H2WA 4QTZA 1NBOA 1W85B 3KVVA 5CH5A 3U26A 4GPBA 1SAYA 2PGOA 4LMRA 1U5CA 1B6GA 3AEYA 3NATA 3A6HA 2F1KA 4HDMA 3DB1A 2HJRA 1JGTA 4I8IA 2J0VA 3I58A 4FYXA 2FN3A 4IMIB 5JXWA 1U9IA 1GPKA 1T4CB 3JVEA 4O59O 1OX5A 3G0CA 5AVYA 1JEDA 1K92A 4IZHA 4IOLA 3RLIA 3IXMA 2WIKA 4XYLA 1OZGA 2WAMA 2PSDA 2WWWA 1NSTA 4AQDA 4RY0A 3O3OB 4PX2A 3TRHA 2OZEA 2VUTA 2QTNA 4RY2A 1GJRA 3T7KA 2CXNA 4YO7A 2CVOA 2ST1A 2XCLA 2PMDA 3JD4A 2AS0A 4OTZA 4G97A 3OBIA 3MSHA 1CG6A 3MLBA 1WDWB 4MPPA 1GR0A 4LBZA 1JDUA 4MQ5A 1LKZA 2VZ9A 2OWDA 2Q3EA 2VKQA 3LP6A 4BB5A 4JLBA 1UPFA 4C2AA 3S7OA 4HMOA 3ZV3A 4OP1A 1RYMA 4EBFA 5CDFE 3HL0A 4IX9A 1GQYA 2WJGA 1V6AA 3BGWA 2QHKA 1K0UA 2IYPA 2PQ2A 3M3HA 1HDGO 4BNUA 1E6MA 5HF9A 4J9VA 4RIHA 2O2SA 2Q07A 4EELA 4GVXA 1YQGA 3WLQA 3OKFA 4DGSA 1ZICA 1TB4A 1RPJA 1JXOA 2D1SA 2Q0SA 1W2GA 2CD9A 1N2CE 3F9IA 2GYUA 2QA5A 3GFVA 2F8LA 4OU4A 3EPHA 3OCCA 1PS8A 2IXBA 3UEOA 1LWNA 1O2DA 4YRZA 2YZ7A 3I73A 1OYOA 4Q0IA 4MWOA 3A3YA 2DCMA 4BLMA 1YIDA 4FEAA 1PGJA 4DYDA 1XNRB 1I2CA 1QYCA 4RHXA 3V4VB 1Y8RB 2FCRA 4OQEA 4EHIA 3OQIA 2QE7D 4KQWA 4K8OA 3LVRE 5BSMA 1QH0A 4E30A 2HOQA 4DEVA 2W2QA 2X0NA 3JQAA 1BZYA 4O2AA 1JLRA 1OE0A 2GTHA 2PFKA 4Q0HA 1NXYA 1WMEA 3DE0X 1B26A 1U8UA 1YK0A 3KYDA 2VH5R 5DN6A 2F9FA 3O4VA 3NGMA 1M2HA 5AMXA 3G35A 1XA0A 3JVDA 4HUTA 3C7KA 4X1KB 2LPMA 2B3TA 2BI7A 1PWHA 2QYTA 3M4JA 1N8SA 5LUBA 1EVYA 4B3GA 2VBFA 3L6OO 5DULA 3P9IA 3OQ1A 5ALQA 5FB3A 3A4IA 3K71B 1XLTA 1MB0A 3KDPA 4D4JA 4UKDA 4ZXFA 4A10A 3MKFA 3IESA 2C97A 2EX2A 2YW9A 1AQ6A 2GBFA 4BD0A 3HY4A 2OENG 2JFUA 1OPRA 1E9DA 2H08A 4RNCA 3WDKA 2WG2A 4BEJA 1ODFA 4UUQA 1YZNA 3ZU5A 2QS9A 3QV1A 3AL2A 1YQQA 5CPFA 2GLXA 2IYUA 4X6TA 1Y3BE 1DTWA 2J7PD 5FOQA 1U1CA 4AZ3B 1KDSA 4KZ9A 3LZ6A 3PDHA 3IQHX 1L6IA 1Z25A 2Z2YA 2ATIA 3RG2A 3LUFA 2O8NA 4AT1A 4YJHB 5EP2A 2P78A 3DFUA 1PZXA 1COZA 1K6XA 1YLZA 3JY6A 1HDOA 1ZG4A 3H1PA 2ZL1B 1C7IA 5J4YA 1P4GA 3C6ZA 1SKOB 4MS3A 4I5EA 4REQB 5HE8A 3TLJA 1SCJA 1LPOA 3LUAA 3SXJA 1UT8A 3G0BA 1O8BA 3B85A 1CUVA 3JARA 4RXMA 2BAGA 3TQHA 3L9WA 1TJYA 1LPAB 2FI1A 3PX3A 1ZXBA 2J5XA 3MTDA 1DP6A 2VYQA 4YP0A 3EXFA 2NIPA 5M29A 3MWDB 5KMGA 4IINA 2B8NA 1EWRA 1ARZA 4AWAA 3R74A 1U0LA 3IDOA 3PIIA 3T3GA 1D0IA 2XOKA 4QULA 3K73O 4UQLA 4LKRA 2RGRA 4EAAA 1I9CA 4MLZA 3RVJA 1U02A 1TGVA 3R2JA 2D02A 3QYFA 4R2MA 3AV0B 3QKTA 1TD5A 2C2MA 3TVDA 5C7IO 4UTPA 2ZP1A 3IMEA 4Q66C 3C30A 4F1JA 3HDJA 1E4YA 1WABA 4LXUA 1A7KA 4W63A 3NKVA 4BMZA 3WKCA 4H7FA 5KSCA 1FNBA 1GA4A 3PLAE 1J2UA 3KQKA 4K9DA 4F7DA 1AURA 2HA3A 4U00A 1SULA 3ZE8A 1GNSA 2QTVB 4KXFB 1WTAA 1Y3HA 3D8HA 5JXIA 3QV2A 3QF7A 1MTOA 3DWIA 4L22A 1NI5A 1ADGA 1KJYA 1C1HA 5EMKA 5EUCA 1SUCA 2G67A 2GWHA 3I4FA 3I39X 5AQBA 2PGDA 1CSEE 3LIBA 2EZUA 4U4AA 1B1AA 3CTPA 5H83A 4L5JA 3STWA 3H9EO 4CLCE 1SKUA 4P0MA 4TVSA 3PAGA 2BI8A 4R6WA 4DV2B 2ANBA 1UJNA 1M8JA 1U7HA 5I8WA 1M6WA 3UUEA 2VHYA 3A1SA 3IBRA 1V9LA 4UA6A 1DS6A 3O8CA 2WJHA 4FQ5A 3CURA 4A8HA 4L4XA 1L4FA 4B6RA 3C3WA 1NVKA 2BZSA 5J1TB 5JVDF 1Z2OX 2PHZA 2GD2A 1LSOA 5DHFA 4YCAA 2R9XA 4CLCC 5DF9A 3D4FA 1DJPA 4PBRA 1PEKE 2DQKA 2AK3A 2W22A 2XRFA 3EQ9A 1PWXA 4TQ9A 2A5LA 4EEUA 3K9FC 1SUFA 4ZC1A 5LA6B 4DF6A 5B6PA 4W99A 4ARUA 1Z45A 2KHZA 5FQOA 3WJ2A 1YO6A 1PU2A 2NU7A 4EB6A 4I1UA 4Q9DA 1DO0A 2WAFA 4OHYA 9MHTA 3JWGA 2PLFA 4KO8A 3LUBA 3LNCA 1SUPA 4J3JA 3NKFA 3D7RA 3R7NA 2XQFA 4N8DA 2J3TD 4L78A 4OLDA 3QTLA 4QB8A 1XWFA 4KEAA 1WCXA 3A1EA 4Y1GA 3RYFB 1VYUA 2OXTA 1H9AA 4AJHA 2YOGA 4FFLA 1XU4A 1LLQA 3GLHB 4OI4A 3OWHA 1JR3D 2B8JA 1B8OA 1UBFA 1TXGA 4O4IF 2PNJA 1W9HA 3E18A 1OBFO 4UUPA 4LSZA 4X65B 1TM1E 1WSDA 1ZD5A 3UQZA 1VL6A 4ZYUA 5CA1F 1Z8DA 3ROKA 1DV2A 4QDXA 3HKEA 2G40A 3CLTC 4XD7D 5IKPA 4I1RA 8MHTA 4TLBA 3T7RA 4FGSA 4OUDA 2VXCA 1T9HA 5IFLA 13PKA 5B1SA 4UNQA 1G16A 1P9WA 4FZVA 3L1VA 1QX3A 3TDKA 4EP1A 2W6MA 4MUGA 5CFOA 1B93A 1TF7A 1LL5A 4EJSB 4R3JA 3KEMA 1EFLA 4GCZA 5EZ6B 1TTTA 3PTAA 4NLLA 4KL8S 4I50F 5EUQB 5A9RA 4P4TA 3KELA 2FRDA 1FL9A 2QRZA 3R3UA 4IBRA 3II6X 4WBNF 4AX4A 1OV6A 4RULA 2I3DA 3H2JA 1A7UA 2VF2A 2DEUA 3CEHA 1LW6E 2AJCA 1JWPA 1NVAA 3IT9A 5AIBA 3D3QA 4RETA 2X4GA 2HX1A 2WIGA 3P32A 4D46A 4DMFA 4U6SA 2HLNA 4QRIA 4QPRA 1B76A 1YDGA 1KAQA 4XPZA 1SVMA 5KKCA 3F98A 1KJWA 1YE3A 3T5CA 3IHBA 3GB9A 4I4TF 4JIGA 2PV0A 2R1VA 3EOZA 4ID3A 4F9FA 1C29B 4M0FA 5CDGA 3FCAA 4BIMA 2W6QA 2GCOA 4MPRA 1P33A 1P2TA 4FYVA 3K5HA 2BZ1A 2IUSA 2ZU6A 5C4GB 3CR7A 4R0QA 2QMZA 5D5QA 1Y9EA 3A6GA 4UJ5A 4IP0A 1F4LA 4MV1A 1S02A 3U2AA 2GZDA 4GRIA 3FWHA 1CUXA 3PF8A 2PH3A 1JAZA 2XAAA 3MT0A 3QX3A 4WWHA 3AZPA 4U7GA 1R4NB 4ETXA 1V8FA 2IY8A 3EE6A 3U3XA 4IVIA 2VXOA 2ZJZA 3AHGA 3KZKA 1HY3A 1RGZA 1QBKC 5FOWA 5FQMA 1S4QA 3R3XA 4B93A 2L42A 4FDUA 2C7BA 2DWQA 5DXJA 3LBYA 3VZCA 5E2HA 1KVLA 4ZO7A 1VL5A 3RTDA 1TCCA 4DY4A 1SRRA 1SFRA 1T5DX 1LBTA 1EB9A 2O50A 4GB7A 2YXBA 1SHLA 3ZDBA 3KTDA 1NBMD 2C77A 3DDZX 3RFTA 4M9XA 4FHCA 3DC7A 4LSMA 1QXSA 1PYOA 1L0GA 3CLRC 3DNFA 2ZC4B 4A1FA 1I7PA 1MRNA 6YASA 4A73A 1R1DA 2HIAA 3JQ7A 4ZOEA 5KUTA 5EGNA 4MYSA 4UBNA 3GA0A 4OK3A 2GNPA 4YT2A 4YH1A 4R3AA 4DR2B 1PDOA 4IJQA 1DOZA 2GB4A 3B1VA 2RI0A 1YJBA 4K40A 3TKLA 4QYSA 5E1DA 2Q1UA 4IGFA 5BR8B 1MD9A 1AQLA 5E4YA 3G5LA 2FDXA 1BCSA 4EUKA 2YWGA 3SP1A 2XDQB 4M55A 4DCTA 1XEAA 4FS8A 1N9BA 4PM5A 1WAMA 1O9BA 5H9WA 1Z26A 4B2YA 4H1WA 1NHWA 2OUKA 2IYAA 3RHFA 2POCA 1KDPA 5CHMA 3WG9A 4MN7A 4QL3A 3L8DA 5J5AA 4F60A 2WNIA 2XCTB 3KU4A 4DCJA 4PN3A 5D2CA 1A4XA 1N6LA 2QZ9A 5JNRA 5GGXA 1G0OA 4IZIA 2WKQA 1D2NA 2GX6A 4H7EA 2GUWA 3IAAA 4GLBA 1UBUS 3A9TA 3ROXA 4YCLA 4D99A 4D0RA 2HDNB 2QL7A 2GVDC 3FZCA 2XEPA 3WP1B 1BOOA 1I4OA 2V0WA 5DGHA 5BR7A 1CNFA 4B6OA 1B0ZA 2BR3A 1I3OA 3PHIA 3MFXA 1ZA2A 5CYPA 1L7VC 3BFXA 1JTDA 4QSHA 4ZZ2A 5MHTA 2NUAB 2C5WB 1TW2A 5L9AA 2FP3A 3BHIA 2HP6A 2FEXA 4JNKA 2R8EA 2NZ8A 4UDNA 3B42A 3SS5A 4ZCQA 1NDUA 3KIPA 1CQZA 3THWB 2Y79A 3JQCA 5CIWA 5HKOA 1OOEA 2GD6A 4LF8B 4C20A 1IB6A 1JAYA 1T9KA 3WLEA 3FROA 5JVDA 4D8WA 1XJ2A 1SZDA 1L5OA 4Z99A 3K6RA 1N1EA 3ZWVA 4EMTA 4GP9A 3OFVA 3V50A 1TIBA 2V65A 1VL2A 1W7FA 3VBEA 1B2LA 3BSSA 3BCRA 4Q01A 1N2ZA 2FLVA 1A4RA 4WZBA 4QUDA 5EVEA 4DPKA 1NMXA 4TKZA 3MXTA 1E1KA 5H3HA 4GZLA 1VYHA 2H63A 5LQUA 5HIIA 3GNTA 3KTOA 1E5QA 3IKVA 3OE7D 4QG7A 4CCYB 3R7WB 1JKIA 4QBKA 2R2GA 2AFIB 2O8CB 1MJFA 4RX1A 2DLNA 3RVNA 4M9RA 2V7GA 1Z3CA 4C4SA 4H15A 4QPCA 4DNPA 1VKOA 3OCJA 1J0DA 2XUIA 1OXTA 3MQQA 1M0TA 3WZLA 1OFIA 2WWYA 3FYUC 4QGHA 1V11A 3MBZA 1Y42X 3VV3A 1G7CA 3PXBA 3EVCA 1NKSA 3EARA 1RE1A 2QRNA 3GLVA 5HJ7A 1X7HA 5JQGA 1I14A 4C6SA 3S2SA 4QFBA 2BMAA 3EQ6A 4TRRA 1OLXB 3W5IA 3N0TA 1FVXA 4ENVA 3M1AA 1I5QA 3H11A 3MZFA 4TWJA 2MHCA 4P7KA 3E82A 2DLCX 2XUJA 3H8JA 5ERYA 5LB4A 1JHQA 2IU4A 3UT6A 1NZFA 4B80A 1ZOIA 1JPNA 4K3UA 4E07A 2IYYA 3GJ4A 1RACA 3PFWO 1H6AA 4MDZA 3TM5A 5C8YA 5HK8A 4AECA 1GAJA 3GX1A 5JNWA 3OPMA 2P5UA 4JBXA 3SF8A 3BDVA 4UAUA 4JI6B 2PVSA 1R10A 5BOSA 1QHIA 3TW0A 3KT6A 1KXJA 3PEEA 2MSEB 2PEZA 5FI0B 2IVFA 3REQB 3UATA 3G5AA 1SU7A 4QY5A 3NIBA 3ORQA 4U7TB 5DF8A 3GCXA 5JYPA 3H2YA 3WRZA 3CAXA 2W37A 1E1RD 1ZD4A 1JE0A 2F1HA 2IEDA 4LWOA 4NOLA 1M1YE 2Y2VA 3BSYA 5A4AA 4LECA 3HU3A 1XT6A 2XF2A 3B9RA 3A11A 1WB4A 3T7IA 3PVCA 1RPAA 4J0EA 1T4DA 1MN6A 4BYGA 3F5FA 3JQFC 1B6SA 3W8DA 2ECFA 5A4FS 3NYIA 5CX1A 3X1KA 2NO0A 4GG1A 4TVOA 4RD3A 3IWIA 3J81k 3HMKA 4K9RA 4I4TA 4F93B 3LR4A 2PLRA 2WG1A 1KO7A 2FB9A 4Q4DA 2WUFA 4CF5A 1IBSA 4YP6A 4PXSA 4GR9A 3T9FA 3P27A 2X6RA 1O0BA 1ZS9A 3RTBA 1XD8A 1G9TA 4DTCA 2B30A 2X77A 8GPBA 3Q11A 4TUYB 3S40A 5E7MA 4OJTA 4HAUA 4RD1A 5C7OO 2FEKA 4PM8A 2HRCA 2Y2KA 2OXRA